(data stored in ACNUC1104 zone)

EMBL: BX640444

ID   BX640444; SV 1; linear; genomic DNA; STD; PRO; 349008 BP.
XX
AC   BX640444;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Bordetella bronchiseptica strain RB50, complete genome; segment 8/16
XX
KW   complete genome.
XX
OS   Bordetella bronchiseptica
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-349008
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; 6eae7d58866a9d6cd0ecc8349c1f5d32.
DR   ENA-CON; BX470250.
DR   BioSample; SAMEA1705943.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 494021; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..349008
FT                   /organism="Bordetella bronchiseptica"
FT                   /strain="RB50"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:518"
FT   CDS_pept        290..5026
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /locus_tag="BB2303"
FT                   /product="putative outer membrane ligand binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1112"
FT                   /db_xref="GOA:A0A0R4J8N5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8N5"
FT                   /protein_id="CAE32799.1"
FT                   /translation="MNKNIYRVVWSLVRGAWVVAGEWARAGRKSSSPRRQNRQRARRGV
FT                   AAMVGGSILAQALLPLSALAQGAPTLRPARVAQEEAGQDAAWTRKLAAQAESLARRQAE
FT                   RQPGARVDGDYLKREAQAQVNDVLRDGVNLARESGLPFLRNLQGGLSHDFESGRTSLQL
FT                   NTIDEVYRAGRNTGLLQLGAHNQNDRPTANAGAVYRREVNDALMVGANGFLDYEFGKQH
FT                   LRGSVGLEVIAPEFSLYGNVYAPLSDWKGAKRNNRREEKPASGMDVGVGYRPAFAPGLS
FT                   LSATHFRWNGAEVDYFDNGRTQAGAKGFKVGVEYRPVSLVSVGLEQTKVIGGGRETRMQ
FT                   LGLNINLSEPLSKQLRRDASGTPAFSPDARRHALVERENRIVLNTRRKEIILPLVVSEV
FT                   STLQADGRVTVIGATQPFATVTVRMPDGTTGTATADASGRFAYTSAGDQPSGVLALRAR
FT                   NAEGDSSREVTYRYVDEVVLGDLQVAVMALVPLPADRALEVRGKTEPKIDVKVSFPNGE
FT                   SVLAKADAKGLFTVRSTRKVAQGKVLVQATHPQTRKEARAVADYLPPATLAPTIDAVTA
FT                   QADTGRVTVTGQAEPGAQVDVHFPDGTAKTVDAGADGAYAATSDGDMVSGDIRVQAVDK
FT                   AGGKSPETIRAYVDTVDKTAPVVPTIADVATDAKSGHITVTGMTEPGAEVVVSFPDGTR
FT                   KTVVAGDDGAYTATSDGDMVAGDIRVQAIDKAGGKSPEATRHYDDAVDITPPAAPTIAN
FT                   VATDAASGRVTVAGVAEPGANVAVNFPDGTRKTVVAGGDGAYTATSDRDMVSGDIRVQA
FT                   VDKAGNQSPETTRAYADAVDKTAPEVPTIANVTTDAKSGRITVTGMAEPGVNVAVDFPD
FT                   GTRKSVVADGAGAYTATSDRDMVSGDIHAQATDKAGNQSPEATRHYGDTTDITPPAAPT
FT                   IDNVATDATSGRVTAAGVAEPGANVTVNFPDGTRKTVVAGGDGAYTATSDRDMVSGDIR
FT                   VQATDKAGNQSPEATRAYADAVDRTAPEVPTVTHVATDAKSGRITVTGMAEPGANVTVN
FT                   FPDGTRKTVVAGGDGAYAATSDRDMVSGDIRVQATDKAGNRSPEATRAYADTVDTTPPA
FT                   VPTITDVTTDASNGRITVTGVAESGANVTVDFPDGTRKTVVAGGDGAYTATSDRDMVSG
FT                   DVRVQAIDKGGNHSPEATRAYADAVDKTAPEVPTITNVTTDAASGRITVTGMAEPGANV
FT                   AVNFPDGTRKTVVADGAGAYAADSDGDMVAGDIHVQATDKAGNRSPEGTRAYVDTVDKT
FT                   PSAAPTIARVTTDRSSGVVTVAGTADPDNDVTVHFPDGGRKTVKAGKDGSYSVTSDNDI
FT                   FSGIIQVSARNPAGNASPEVRQDYRDEFVPANAITNMETNSRNGIVTVSGKTSPDATVV
FT                   VSFPGGDEARTRAKGDGTFSVSSPMDVPRGVVSLSTEVDGVRTVVATRTYEDKFTKGGQ
FT                   DYNAILPYTPGFNGVSTSDTSAVLLSVPQYFYSGGAPVAKIMPPDAHDSEFTKRAAAAM
FT                   RVQVTSRRNSSEYDIRVSWPAGTFTPADVGQQADLVVKIFDVGTGKFMLAPGEVRFRR"
FT   misc_feature    419..487
FT                   /note="1 probable transmembrane helix predicted for BB2303
FT                   by TMHMM2.0 at aa 44-66"
FT   misc_feature    1775..1798
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    4145..4195
FT                   /note="PS00237 G-protein coupled receptors signature."
FT   CDS_pept        5199..7673
FT                   /transl_table=11
FT                   /locus_tag="BB2304"
FT                   /product="putative competence protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1113"
FT                   /db_xref="GOA:A0A0H3LN04"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN04"
FT                   /protein_id="CAE32800.1"
FT                   /translation="MTAMDAAMGRVMGVAFVAGTAMVQGLATLDGVVGFACLAALGALA
FT                   AWRAARRAGRPWRVCGKLALPALAASLGVASAAGQAQWRLADAVDPARHNRVARVEARV
FT                   AQLAQGDAGSRRFVARLPDDRPAGLPARLLVTWRALPGQALPEVVPGQRWRMALRVRRP
FT                   HANQNPHAPDSEARLLARGVRGLASVRGRPLLLDDDPWADAGIAIERARHRVRAGMRQA
FT                   LAGLRYAPVLVALAIGDQAGVAREDWQVFQRSGIMHLVSISGMHVTAVAALGGWLAGWL
FT                   WRRARWRGVPLAERAPAQRVAVLAALGPALAYCLLAGWSVPTRRAFFMLAAVAAAVALR
FT                   WPATPSRLLTLAAVAVAVLDPWAPLAPGFWLSFGAVAVLVGTGAGARPRGMRARLRAAL
FT                   LGFGRTQMAVTLALTPLLAFLVRQVSLGSPLANALAIPVVSLAVTPLALLCGALSALPG
FT                   GQGPAWLAGAAGHGLFALLMAPVGWIGRAEWSGLDVAAAPWPWLALALAGAAWALQAPG
FT                   WPARHCGWLCMLPLLAWRPERPPPGYWTLTALDVGQGGAVVLETARHVLLFDTGPRHGD
FT                   ASDAGERVIAPFLRARGYRHIDTLVVSHADLDHTGGLRSVLAALPVGQAYASFDLAAWL
FT                   ARQARVRPDGWRAAPRMPPATRGCEAGVQWRVDGVRLRFVYPPPLAAPLPWRSSNARSC
FT                   VLLVEGVGHRALLTGDVGLVQEAAFAAALPPVDLVMAPHHGSAMSSGSLLAAATRPAHA
FT                   IAQAGYLNRFGHPAASAINRWRRAGAAVWRTDLDGAVRADSTPRGLFASGQRQVARRYW
FT                   RDSRAGPDAPLR"
FT   misc_feature    join(5217..5276,5289..5348,5862..5930,5973..6041,
FT                   6099..6167,6282..6350,6387..6455,6498..6566,6585..6653)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BB2304 by TMHMM2.0 at aa 7-26, 31-50, 222-244, 259-281,
FT                   301-323, 362-384, 397-419, 434-456 and 463-485"
FT   misc_feature    5898..6752
FT                   /note="HMMPfam hit to PF03772, DE Competence protein, score
FT                   6.9e-36"
FT   misc_feature    6843..7454
FT                   /note="HMMPfam hit to PF00753, DE Metallo-beta-lactamase
FT                   superfamily, score 0.0014"
FT   CDS_pept        7673..8641
FT                   /transl_table=11
FT                   /locus_tag="BB2305"
FT                   /product="probable hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1115"
FT                   /db_xref="GOA:A0A0H3LUX8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LUX8"
FT                   /protein_id="CAE32801.1"
FT                   /translation="MGHRRPSGPRRGDIMQEPRLDFVTCASPTGFHRMAYWEWGDPLND
FT                   RVLVCVHGLTRTGRDFDHLARRLAGQWRVVCPDVAGRGKSDWLSNPALYAVPQYVSDMA
FT                   TLIARVRPATLAWVGTSMGGLIGLGLAGAATMMRLARAMRPRPDGLPAQADDLRLHRLV
FT                   LNDVGPRLNVEALQRIAGNVAAQDSYPTFEAAVAAMRQISTTFGPHTDAQWDELARHIY
FT                   VRQGGGWVRHFDPALAVPLGAQVAQAFEAGERILWQAYDSLDCPVLIVRGQDSDLLSAA
FT                   TAAEMLGRNPRARLHEVPGVGHAPTLMTPEQIEPIARFLQD"
FT   misc_feature    7886..8632
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 0.00038"
FT   misc_feature    8015..8083
FT                   /note="1 probable transmembrane helix predicted for BB2305
FT                   by TMHMM2.0 at aa 115-137"
FT   CDS_pept        8711..9556
FT                   /transl_table=11
FT                   /locus_tag="BB2306"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1116"
FT                   /db_xref="GOA:A0A0H3LLS9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLS9"
FT                   /protein_id="CAE32802.1"
FT                   /translation="MNIAAPNVDLHCHSTVSDGSMPPAAVARRAHANGVDVWALTDHDE
FT                   IGGVAEAAQAAAGLGMRFVAGVEISVTWAGLTVHIVGLRVDPANEALVQGLRDTRAGRA
FT                   ARAVQIGERLAGLGMPGAYEGALPFAGNPELISRTHFARFLVEAGYCPDVQTVFNKYLG
FT                   DDCPGHVPMQWASLAEAVGWIRGAGGCAVIAHPGRYKYSPMQFDALYDEFLQLGGTGIE
FT                   VVTGSHTSEEARRYAEVARRHGFLASRGSDFHSPTESRVDLGRLPPLPPDLKPVWHDWF
FT                   "
FT   misc_feature    8732..8923
FT                   /note="HMMPfam hit to PF02231, DE PHP domain N-terminal
FT                   region, score 1.7e-18"
FT   misc_feature    9233..9496
FT                   /note="HMMPfam hit to PF02811, DE PHP domain C-terminal
FT                   region, score 0.55"
FT   CDS_pept        9624..10178
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="BB2307"
FT                   /product="transcription elongation factor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1117"
FT                   /db_xref="GOA:A0A0H3LLT4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLT4"
FT                   /protein_id="CAE32803.1"
FT                   /translation="MNKAFVKESDRDDEDDLPEAQALPAGTRNYMTPQGYARLRDELSH
FT                   LMNVERPSVVQVVSWAASNGDRSENGDYLYGKKRLREIDRRMRFLTKRLDIAEVVDPAA
FT                   QPNRDQVFFGATVLYMDRAGEERTVTIVGVDEAEPLAGKISWISPVARALTKAHEGDTV
FT                   TLRTPGGVEELEILEVRYPDA"
FT   misc_feature    9699..9920
FT                   /note="HMMPfam hit to PF03449, DE Prokaryotic transcription
FT                   elongation factor, GreA/GreB, N-terminal domain, score
FT                   6.6e-32"
FT   misc_feature    9717..9842
FT                   /note="PS00829 Prokaryotic transcription elongation factors
FT                   signature 1."
FT   misc_feature    9936..10166
FT                   /note="HMMPfam hit to PF01272, DE Prokaryotic transcription
FT                   elongation factor, GreA/GreB, C-terminal domain, score
FT                   2.3e-20"
FT   CDS_pept        complement(10369..11397)
FT                   /transl_table=11
FT                   /locus_tag="BB2308"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2671"
FT                   /db_xref="GOA:A0A0H3LSE8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSE8"
FT                   /protein_id="CAE32804.1"
FT                   /translation="MKFRNIVGAALCAAFALGVAPAQAQNYKSEYKLSIVVGTTFPWGQ
FT                   GAVIWSDLVRERTEGRINIKVYPGTSLVQGDQTREFTAIRQGVIDMAVGSTINWSPQVK
FT                   QLNLFSLPFLMPDYAAIDALVQGEVGKEVFKLIDKAGVVPLAWGENGYRQLSNSKHEIK
FT                   TPADMKGLKLRVVGSPLYIDTFTALGANPTQMSWADAQPALASGAVDGQENPLSIYTGS
FT                   KLYTVGQKYLTLWNYVADPLIFVVNREVWNSWSEKDRDIVRQAALDAGKQQIVIARKGV
FT                   TPEDPSLLKEIAGHGVTVSRLDAGQHAEFVAATKPVYEKWKKQIGAELVDLAEKSIAAR
FT                   KK"
FT   misc_feature    complement(10423..11301)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 1.6e-83"
FT   misc_feature    complement(11326..11397)
FT                   /note="Signal peptide predicted for BB2308 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 24 and 25"
FT   CDS_pept        complement(11477..12775)
FT                   /transl_table=11
FT                   /locus_tag="BB2309"
FT                   /product="putative membrane permease"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2670"
FT                   /db_xref="GOA:A0A0H3LN11"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN11"
FT                   /protein_id="CAE32805.1"
FT                   /translation="MIAALLFAVFITLMLIGVPVGVALGLGGTVAIVLSNLDVSWFGLL
FT                   AVPQNFYAGLAKYPLLAIPMFVLVGSIFDRSGVARRLVDFAVALVGRGPGMLPLVSIAV
FT                   AMFLGGISGSGPACAAAVGAVMIAAMSRAGYPAPYSAAVVAAGAATDILIPPSVAFIIY
FT                   SVLVPGASVPALFAAGMVPGILAGFALIIPAVWLARRHGMGAREAHLPRPPLWASLREA
FT                   SWGLAAPVLILGGMRMGWFTPTEAAVVAVFYGLFVGMCIHRTIKVRDLFVILREAAELS
FT                   AVIMLVVTLAGIFAWALSTLSVIDPITHAIVNSGLGEWGVLALLIVLLMTVGMFLDGIS
FT                   IFLIFVPLLMPIANAYGWDPVWFGVILTLKVALGQFTPPLAVNLMVSCRIARVPMESTV
FT                   GWVVWLLGGMFLVLVAVLIFPQLALWLPHRLGY"
FT   misc_feature    complement(join(11519..11587,11624..11692,11702..11755,
FT                   11768..11821,11864..11932,11993..12061,12188..12256,
FT                   12275..12343,12386..12454,12557..12625,12695..12763))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2309 by TMHMM2.0 at aa 5-27, 51-73, 108-130, 145-167,
FT                   174-196, 239-261, 282-304, 319-336, 341-358, 362-384 and
FT                   397-419"
FT   misc_feature    complement(11891..12370)
FT                   /note="HMMPfam hit to PF00597, DE DedA family, score
FT                   2.6e-08"
FT   misc_feature    complement(12701..12775)
FT                   /note="Signal peptide predicted for BB2309 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.939) with cleavage site
FT                   probability 0.469 between residues 25 and 26"
FT   CDS_pept        complement(12772..13353)
FT                   /transl_table=11
FT                   /locus_tag="BB2310"
FT                   /product="putative integral membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2669"
FT                   /db_xref="GOA:A0A0H3LV06"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV06"
FT                   /protein_id="CAE32806.1"
FT                   /translation="MQPLILPALCSTLLPMHRPDASDEPVEPIIPPEADPAVKVPLALE
FT                   DWLAVILLAALAIITFLNVLVRYLTDQSFAWTEEISVFLLIVLTMVGASMAFVRNHHIR
FT                   IEILADNGSPRRQYLMALTAHSLVVFFFALLTVLSARLVYDEFRYEETSPAIGVPTWWY
FT                   SVWMPLLAAVITLRVAGAARRLIARHKAET"
FT   misc_feature    complement(join(12811..12879,12922..12990,13051..13119,
FT                   13147..13215))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2310 by TMHMM2.0 at aa 47-69, 79-101, 122-144 and
FT                   159-181"
FT   CDS_pept        13666..17712
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BB2311"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2668"
FT                   /db_xref="GOA:A0A0H3LLV3"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLV3"
FT                   /protein_id="CAE32807.1"
FT                   /translation="MSLVQHLPGSSVLSAFRRERLLAQLKKAGLPVADISARYEHFIHT
FT                   DSALPAEQQARLAQLLDYGTPAAEAPAKSLELLVIPRLGTMSPWASKATDIAHNCGLDA
FT                   VRRIERGVRYALTPERGLLGAKSFDAGMLARAAACLHDRMTETVVDGTFDGQALFETLA
FT                   GKPMRTVAVQAEGRAALEQANVALGLALSEDEIDYLAQSFGDLGRDPTDVELMMFAQAN
FT                   SEHCRHKIFNAQWVIDGQAQSNTLFGMIRATHKAQPAGTVVAYSDNAAIMEGGPAQRFQ
FT                   AGVPGVAGEGAQAARYVRRDTTVHTLMKVETHNHPTAIAPFPGAATGAGGEIRDEGATG
FT                   RGSKPKAGLTGFTVSHLRFDDALQPWENDHHGLPERIASPLSIMIDGPIGGAAFNNEFG
FT                   RPNLLGYFRAFEQTAGGTRWGYHKPIMIAGGLGSIDAGLTHKEVIPPGALLIQLGGPGL
FT                   RIGMGGGAASSISMGSNSAELDFDSVQRGNPELERRAQEVIDRCWQQGEHNPIVAIHDV
FT                   GAGGLSNAFPELVNDAGRGAIFDLRRVPLEESGMSPAEIWSNESQERYVLSILPQDLER
FT                   FDAIARRERCPYAVVGVATEERQLRVVDGEGLPGLDTIRAQGENEVRPVDVPIDVILGK
FT                   PPRMTRDVQRLPGVSEPLDLAGLDLTEAAYRVLRHPTVANKSFLITIGDRTVGGLSSRD
FT                   QMVGPWQVPVADCAVTLADFEGTRGEAMSMGERTPLAMLDAPASGRMAVAEALTNLAAA
FT                   DVARLEDIKLSANWMAACGVPGQDAALYDTVSAVSELCQSVGLSIPVGKDSLSMKTSWD
FT                   EAGEQRQVVAPVSLIVTAFAPVGDVRASLTPQLRTDAGDTVLILIDLGRGRHRMAGSIL
FT                   AQAYNQVGETVPDIDAPQDLRAFFVTIRTLAEAGTILAYHDRSDGGLFATLAEMAFAGR
FT                   TGVSVNLDMLTFDPQSADWGDYKIRPEQVAVQREELTLKALFSEEAGAVIQVPASQRDA
FT                   VMQVLRGAGLSAHSHVIGGLNGADEVEFYRDGRKVWSQPRADLGRAWSEVSYRIMARRD
FT                   NPACAQAELDIWNDAKDPGLAPRVAFDPQEDVAAPFIATGKRPRVAILREQGCNSQVEM
FT                   GWAFDTAGFEAIDVHMTDLLSGRIDLAGMQGLVAVGGFSYGDVLGAGEGWARTIRYNDK
FT                   LSDQFAAYFARPDTFALGVCNGCQMMAALAPMIPGAEHWPRFTRNQSEKYEARLSLVEV
FT                   TASPSIFFAGMEGARIPVAVAHGEGYADFTQQGDAGRALMAARYIDNHGAATETYPFNP
FT                   NGSPGGLTAVTTADGRFTVMMPHPERVTRNVMMSWAPAQWGERDAGGAFSPWMRIFRNA
FT                   RAWLK"
FT   misc_feature    14404..14970
FT                   /note="HMMPfam hit to PF00586, DE AIR synthase related
FT                   protein, N-terminal domain, score 1.9e-11"
FT   misc_feature    14998..15480
FT                   /note="HMMPfam hit to PF02769, DE AIR synthase related
FT                   protein, C-terminal domain, score 5.9e-38"
FT   misc_feature    16210..16725
FT                   /note="HMMPfam hit to PF02769, DE AIR synthase related
FT                   protein, C-terminal domain, score 1.8e-16"
FT   CDS_pept        17954..27574
FT                   /transl_table=11
FT                   /gene="fhaS"
FT                   /locus_tag="BB2312"
FT                   /product="adhesin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2667"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLW0"
FT                   /protein_id="CAE32808.1"
FT                   /translation="MNAFCFRLVYSQCRAMYVPVALRRRAARRGCGGAGRRLRRALAAA
FT                   GVALACGAMAAPQRSPSGVPVIDIAAPNAHGLSHNRLRELDVEPPGLVFNNSLTEGRSQ
FT                   LAGHLNRNPGLRQAATAILTEITGTRPSRLHGALEVFGRRADLIIANPNGISVNGLSTL
FT                   NASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSE
FT                   QGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKHITLVSS
FT                   DSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGAVSAGKLASGGAVRV
FT                   AGGGAVKIASASSVGSLAIQGGGKVQATQLNAGGPLQVSSRQAVRLGAASSGQTLSVRA
FT                   GAALQADQLSATRRLGVDGKQAVTLGSVASDGALSVSAGGNLQAKQLVSNAGLDVRGQR
FT                   EVSLEAASSVRGMTVAAAGTLAARNLQSQGAIRIQGGQAVSVANANSDAELHVSGRGQV
FT                   DLGDLSAARGADITGEQRVSIGRAHSDGDVNVAARGALSIDSMTALGAIGVQAGDSVSA
FT                   KDMRSRGAVTVSGGGSVNLGDVQSDGQVRATSAGAMTVRDAAAAADLALQAGGALQAGF
FT                   LKSAGAMTVNGRDAVRLDGAQAGGQLRVSSDGQAALGSLAAKGALTVSAARAATVAELK
FT                   SLDSISVTGGERVSVQSVNSASRVAISAHGALEVGKVSAKSGIGIEGWGAVAADSLGSD
FT                   GAISVSGRDAVRVDHARSLADISLGAEGGATLGAVEAAGSIDVRGGSTVAANSLRANRD
FT                   VRVSGKDAVRVTAATSGGGLHVSSGRQLDLGAVQARGALALDGGAGVALQSAKAGGTLH
FT                   VQGGEHLDLGTLAAVGAVDVNGAGDVRVAKLVSDAGADLQAGRSMTLGTVDTTGDLQAR
FT                   AQQALELGSVKTEGGLQAAAGGALSLAAAEVAGALELSGHGVTVDRASAGRARIDSTGS
FT                   VGIGALKAGAVEAASPRRARRALRQDFFTPGSVVVRAQGNVTVGRGDPHQGVLAQGDIV
FT                   MDAKGGTLLLRNDVLTENGTVTISADSAVLEHSTIESKISQSALAAKGDKGKPAVSVKV
FT                   AKKLFLNGTLRAVNDNEETMPGRQIDVVDGRPQITDAVTGEERKDESVVSDAALVADGG
FT                   PIVVEAGELVSHAGGIGNGRNKGDGADVTVRTTGNVMNKGYISAGKQGVLEVGGTLTNE
FT                   FLVSSDGTQRIEAQRIENRGTFQSQAPAGTAGALVVKAAEAIVHDGVMATEGEMQIPGK
FT                   GGRSPAVTAGAKATTSANKLSADVASWDNAGSLDIKKGGAQVTVAGRYAEHGKVSIQGD
FT                   YTVSADAIALAAQITQRGGAADLTSRHDTRFSNNIRLMGPLQVSAGGAVSNTGNLIVRE
FT                   GVRVTAASFDNEAGAEVMAKSAALTTSGAVRNAGKMQVKEAATIVAASVSNPGTFTAGK
FT                   DLTVTSRGGFDNDGKMESNKDIVIKAEQFSNAGILDAKHDLTVTASGQADNRGSLKAGH
FT                   DFTVQAQRIDNSGTMAAGHDATLKAPHLRNTGQIVAGHDIHIINSAKLENTGRVDARND
FT                   LVLDVEDFTNTGSLYAEHDATLTLAQGTQRDLVVDQDHILPVAEGTLRVKAKSLTTEIE
FT                   TGNSGSLIAEVQENIDNKQAIVVGKDLTLSSAHGNVANEANALLWAAGDLTVKAQNITN
FT                   ERAALIEAGGNARLTAAVALLNKLGRIRAGEDMHLDAPRIENTAKLSGSIQPKGVHYVG
FT                   GGKYGRWSGIGYVNYHLSSGSGAIAAPWYDSDLTAEQSLIEVGKDLYLNAGARKDEHRH
FT                   LLNEGVIQAGGHGHIGGDVDNRSMMRTVSAMEYFKTPLPLSMTDIFHNLAPSPLTLTAV
FT                   DNRAGLSPASWNFNSTYELLDYLLDQNRYEYIWGVYPTYTEWSVNTLKNLDLGYQAKPA
FT                   PTAPPVPKVPTLDLRGHKLESPEGLKIYGEYKKLQGEYEKAKAAAQAVEAYGEATRRVH
FT                   DQLGQRYGAALGGMDTETQAVDGIIQAFAADLRTVYAKQADQASIDAETDKVAQRYKSQ
FT                   IDAVRLEAIQPGRVMLAKALSAALGADWRALGHAELMQRWKDFKAGKRGADIAFYPKEQ
FT                   TVLAAGAGLTLSNGAVHNGENAAQNRGRPENLKIGAHSATSVGGSFDALRDVGLEKRLD
FT                   IDDALAAVLVNPHIFTRIGAAQASLADGAAGPALARQARQALGTDGIVDARGLGSADAL
FT                   ASLASLDAAQGPEVSGKRNAQVADARLAAPNAVAAPAGGAVRVAPPAVALPRPLFETRI
FT                   KFIDQSKFYGSRYFFEQIGYQPDRATRVAGDNYFDTTLVREQVRRALGGYESRLPVRGD
FT                   ALVARLMASAGTVGKALGLKVGVAPTAQQLKQADRDFVWYVDTVIDGQKVLAPRLYLTE
FT                   ATRQGITDQYAGGGALIASGGDVNVDTNGHDVSSVNGLIQGKRVKVDAGKGRVLVADSK
FT                   GMGSGIEADEEVDVSGRDIDIEGGKLRGKDVRLKADTVKVATSMRYDGKGRLAARGDGA
FT                   LDAQGGQLHIEAKRLETAGATLKGSKVKLDVDDVKLGGVYEAGSSYENKSSTPLGSLFA
FT                   ILSSTTQTNQSARANHYGTRIEAGTLEGKMQNLEIEGGSVEAAHTDLSVARDARFKAAA
FT                   DFEHAEHEKDVRQLFVSGTVGAGGYQATGTLGSETGASSYAGRGAAASASGRIGWESTW
FT                   EQSTSSRKKYRNADLRLGDGSVVAGGVLDFGGADVNRDRYGGGAEGGSGLRLRGGEVRT
FT                   TKYVDTESTVRSGGRVGLELGVDASVNPQVTASRLGQSLAQTGDGRGIDGGLMFGQALS
FT                   TVFQSVMADTANSTLSMSLQGDWWNERRSATSENVTHVGGNVRIESGAGDMTLAGVRFD
FT                   GGREVDLRSAGALRMRSAESREQRTRDAHSLSLDARMTMGANLVKADAYVRGTVGLSGR
FT                   HEHEASERRTHDQTGIRAANVRLQAARDLVMQGARVDAAQSAQVEVGGTLSMASVQDVH
FT                   DESRTSASWMLAAGAHASSGNGFKPQPVVQVAASFSHGHDRGAVVAQRTGIAAGGPLSV
FT                   RVAGDAHLTGADLASADRQGSVQVGGRVRAGQLADWRDRDGGSAGVSAPAILSTSTRPT
FT                   LVVSGGRLARDHYAATQRSVIAVAPDGFTAAGGVSGHLQRDPAAGREVLRDEHWAGGDM
FT                   AFTLGSVPKFDRGRYAPPRPDTSVPGGSPFSLHR"
FT   misc_feature    17954..18118
FT                   /note="Signal peptide predicted for BB2312 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.771) with cleavage site
FT                   probability 0.771 between residues 55 and 56"
FT   misc_feature    18074..18106
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    21212..21277
FT                   /note="Predicted helix-turn-helix motif with score 996.000,
FT                   SD 2.58 at aa 1087-1108, sequence ISQSALAAKGDKGKPAVSVKVA"
FT   CDS_pept        27667..29139
FT                   /transl_table=11
FT                   /locus_tag="BB2313"
FT                   /product="putative peptidase"
FT                   /db_xref="GOA:A0A0H3LSI3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSI3"
FT                   /protein_id="CAE32809.1"
FT                   /translation="MNARIPDDALPPALDPDALQAFVDDKWDNEIIPALTDYIAIPAKS
FT                   PAFDADWEKNAFIERVVRDAAQWVESQKVSGLTLEVVRLPGRTPVIFFDAPATRADNGD
FT                   TVLLYGHLDKQPEFSGWRADLGPWTPKYENGKLYGRGGADDGYAIYASLTAIMALDKQG
FT                   IPRPRCVGIVETCEESGSYDLLPYVDVLRERLGNVALVVCLDSGAGNYDQLWMTTSLRG
FT                   MVAGTLEVQVLDEGVHSGDSSGVVPSSFRILRHLLDRLEDSASGRLLPQSLHCEIPAER
FT                   IEQVHATARILGDEVWRRFPWSCGAEGGFVLPMTTEPEEALLNRTWRPTLSVTGAEGLP
FT                   PLTSAGNVLRPRTAFKLSLRLPPLVDAVAAAQEIKGLLENDAPYNAKVIFHANEGAATG
FT                   WNAPASASWLSQALDAASQQYYGAPCGYIGQGGTIPLMSMLQKGFPKAQFMVCGVLGPK
FT                   SNAHGPNEFLHVPYGKKLTAAVAQTMAALPTE"
FT   misc_feature    27769..28965
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 1.9e-10"
FT   CDS_pept        29173..29724
FT                   /transl_table=11
FT                   /locus_tag="BB2314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN37"
FT                   /protein_id="CAE32810.1"
FT                   /translation="MIVDVQTGAAVAAEVRLWVDKAVIGLNLCPFAKAVQAKGQVRYAV
FT                   SDATDAEGALSDLEDELMRLSQTDPQEIDTTLLILPDALDDFYDFNDFEDLSDRLLKRM
FT                   RLVGELQVATFHPRFQFAETGPDDIENYTNRSPYPILHLLREASIDKAVEAFPDAAEIY
FT                   EKNIETMRELGEEGWRKLME"
FT   CDS_pept        complement(29839..31131)
FT                   /transl_table=11
FT                   /locus_tag="BB2315"
FT                   /product="putative acyl coenzyme A thioester hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="GOA:A0A0H3LV12"
FT                   /db_xref="InterPro:IPR006862"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR016662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV12"
FT                   /protein_id="CAE32811.1"
FT                   /translation="MPPRMSVAPERALIDVDREIRIDGFGPYACIDVTAEMRMCGVPWR
FT                   SRATFLAGADGSLDLGRDSPVSGDYAEPDAMGLVWSMQCQDPPRAVFPPDRTDALTVHI
FT                   TASDGRHEAHATLVQEFLAEGVRHQAVRARAGGMSLSGELYTPPGPGPHPAIIYMNGSS
FT                   GGVNAPRAALFAARGYQCLALGVFNYEDRPKYLNDMPLEYLEQALRWVRDTLNPRDGFV
FT                   AISGISRGGEMSLLAASHFPELVSAVVAYVPSPVMHGVVSAGAPGTGRDAQVWTLGGKP
FT                   LPHLWQDNATADWEAAYASDPPYRQTHAFMSASRDARAFERARIPIERYPGPLMLISAS
FT                   DDGFWPSTAYSEIVARQRQAAWPARPAEHYVCRGAGHHVHYPNLPATLISKPHAMSGLL
FT                   LDAGGTPPANAHGNAGSYRAMLDFLERARAS"
FT   CDS_pept        complement(31143..32129)
FT                   /transl_table=11
FT                   /locus_tag="BB2316"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLV8"
FT                   /protein_id="CAE32812.1"
FT                   /translation="MRLTRRHVLQALAALPFAVRPSWAQDAYPSRPIRLLVGFAPGGLT
FT                   DIAARALAERMSKAMNASVVVENRPGGQAIIATVAVARAEPDGYTLGFAGTNGMILNPL
FT                   LYNNLPYKQADFKQLGSMGKSPMLLIVHPDLGVRNVQEFIALARQKPGEITCAHAGRGI
FT                   INHLALLHFQSKTGTQFQDVPYKGSGPALLDLMAGTVKSTFDFPTSSIANLRAGKYKAL
FT                   AVTADQRLSSLPDVPTMKEAGLDGFELYTRMMISGPAAMPAQVVGKLEKAVRAGTADPG
FT                   LIQQFADQGVTIEFTSAADMDRVIAEESAMWEQVIKANNVPRTDLKS"
FT   misc_feature    complement(31167..31988)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.5e-82"
FT   misc_feature    complement(32058..32129)
FT                   /note="Signal peptide predicted for BB2316 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT   CDS_pept        complement(32327..33163)
FT                   /transl_table=11
FT                   /locus_tag="BB2317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLW4"
FT                   /protein_id="CAE32813.1"
FT                   /translation="MSNTHEVRPGQSIELLKALHILTRDGKMNQDSRRKLKQVYHLYQF
FT                   IEPLLQNARDARGAVTLVDHGAGKSYLGFILYDLFFKDRRDASHIYGIETRAELVQSAT
FT                   ELAARLGFGGMSFLNLSVADSIASEQLPPRVDIVTALHACNTATDDAIRFALAKQAQSI
FT                   VLVPCCQAEVAAVLRKNKARALADPMAELWRHPLHTREFGSQLTNVLRCLQLEAHGYQL
FT                   SVTELVGWEHSMKNELIIARHQPGRPRREPARRLREMLERIGLQELSERFQVPAQP"
FT   CDS_pept        33455..34252
FT                   /transl_table=11
FT                   /locus_tag="BB2318"
FT                   /product="probable membrane protein"
FT                   /db_xref="GOA:A0A0H3LSI7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSI7"
FT                   /protein_id="CAE32814.1"
FT                   /translation="MAGGFLGILIGLTLGLTGAGGGILAVPALVLGLGMDMPQAAPVAL
FT                   MAVGLAAAVGSAEGLRRGTVRYKAAALMSVVGGLAAPWGAQLARLAPGPWLSGLFAMVM
FT                   LLVAGRMLRQSLAAPAGAQTQAERPCHISPQTGKFVWTPRAAATLGGIGAISGLFTGLL
FT                   GVGGGFIIVPALRQFSDAPMHAIVSTSLMVIALISAVTVGHAVADGLTLDAAAWTFVAA
FT                   AVLGMVLGRALAPRLPTARLQQLFALVCVVVAGVLLWRTGWQA"
FT   misc_feature    33455..33529
FT                   /note="Signal peptide predicted for BB2318 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.666) with cleavage site
FT                   probability 0.446 between residues 25 and 26"
FT   misc_feature    join(33467..33535,33563..33622,33659..33727,33902..33970,
FT                   34007..34075,34085..34153,34187..34243)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BB2318 by TMHMM2.0 at aa 5-27, 37-56, 69-91, 150-172,
FT                   185-207, 211-233 and 245-263"
FT   misc_feature    33701..34228
FT                   /note="HMMPfam hit to PF01925, DE Domain of unknown
FT                   function DUF81, score 8.5e-07"
FT   CDS_pept        34249..35064
FT                   /transl_table=11
FT                   /locus_tag="BB2319"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /db_xref="GOA:A0A0H3LN42"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN42"
FT                   /protein_id="CAE32815.1"
FT                   /translation="MSAMVQLGPLMLPTALLLMLACVAAGSLAARWRAGSAGAGEMPLM
FT                   RVLLAGLLAARLAFVWRHREAYLQSPWDVLDIRDGGWLAWAGFAGAWACGLWFARRRGP
FT                   RRRPLLAGLAAATLAWTVGAAVLGIGAPAAIKAMPPLQLATPDGAPRSLAAFAGQPVVL
FT                   NLWASWCPPCRREMPMLQRMQAARPDVHFVFVNQGESAQQVNAYLRELGMPLRNVLLDP
FT                   GAQAGAYFGHRALPATLFFDAQGRLVDTRLGELSQASLVQRLGALRPAP"
FT   misc_feature    34249..34320
FT                   /note="Signal peptide predicted for BB2319 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.338 between residues 24 and 25"
FT   misc_feature    join(34276..34344,34378..34431,34489..34545,34582..34650)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2319 by TMHMM2.0 at aa 10-32, 44-61, 81-99 and 112-134"
FT   misc_feature    34282..34314
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    34732..34788
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        35094..35930
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="BB2320"
FT                   /product="thiol:disulfide interchange protein precursor"
FT                   /db_xref="GOA:A0A0H3LV16"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV16"
FT                   /protein_id="CAE32816.1"
FT                   /translation="MSDPILPRAAAGLRRACAVLAGAVLAAGAAQAQQPPAPVAALAQH
FT                   GIEILGTFPAPGGLTAWAAHAGDRPVALYATPDGKHVIVGTMFDAEGRDVTQAALEQAI
FT                   EPALSDKLWSALEQSAWVADGKAGAARIVYVFTDPNCPYCNKLWADARPWVEAGKVQLR
FT                   HIPVGILTASSEGKAAAILAAPDPAKALHDHEAGHVASNTRALAAGERKPLDERGIQPL
FT                   ADIPAEIAARLNANETLMAQWGLRATPAIVWREQGGRVRKRTGAPPALLPQLFGAL"
FT   misc_feature    35094..35189
FT                   /note="Signal peptide predicted for BB2320 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 32 and 33"
FT   CDS_pept        35927..36244
FT                   /transl_table=11
FT                   /locus_tag="BB2321"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLW1"
FT                   /protein_id="CAE32817.1"
FT                   /translation="MMTAAPCVRVLLHAPTAGALERARNNAANLLKEAPGAQVRIVANA
FT                   AAVAAALDAPPHPADAHTWLCPNTLARLERPARAPLRALPQAAVLALALLQEEGWRYIR
FT                   A"
FT   CDS_pept        complement(36705..37379)
FT                   /transl_table=11
FT                   /locus_tag="BB2322"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLW9"
FT                   /protein_id="CAE32818.1"
FT                   /translation="MGWLTDNFGAPATATSEVEAAPAYHIYRAHAVQARQVDELIGLVK
FT                   GVLADGAICQEEVAFLLRWMQTNQDASNKWPAKALYPRIAAALADGHMDAMEEAEIMAL
FT                   LLATVGSEDATGQPAINKSTALPLCSPVPDIHFDAHTFCFTGKFTSGTRDWCSQQVVER
FT                   GGSSLSNVTKKLDYLVIGELGNPDWLHSTFGLKIKKAVDYRSSGVALRIISEQAWYEHL
FT                   LS"
FT   CDS_pept        37692..38819
FT                   /transl_table=11
FT                   /locus_tag="BB2323"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2629"
FT                   /db_xref="GOA:A0A0H3LSJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSJ1"
FT                   /protein_id="CAE32819.1"
FT                   /translation="MDATLHADADAITQLLYDGIVDSGDWYAGVELLRARMGAAFFHQM
FT                   TVDCANGAVSDGLATFEAPQDKAREYEQHYARTDERMHAVLAMPAGSMVIDHERFDTSA
FT                   MSSSAIYSDWLPSVGLRHTVGLTLREDGSRKEVIGIMRAREDGMFRASEIALCQRALPH
FT                   LARASALRARVAGLQDRAGFGLAALDALRQGIVVLDAQAAVQYANPAARALAAAGALCR
FT                   VRHDTWRFADAPVQARFQQALAGACARGEPSCAGAFMVHTPQGPVAVSVLPLKAGHPLL
FT                   AWRGVPLAMLSIGAGAQTDVAPPDLLRQALGVTLAEARLAHALAQGLTVKGYALRADLS
FT                   EQTVRGHLKNLLRKTDCHRQVELVTLAQSVQAPPE"
FT   misc_feature    38619..38813
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00196, DE Bacterial regulatory
FT                   proteins, luxR family, score 0.0017"
FT   misc_feature    38673..38738
FT                   /note="Predicted helix-turn-helix motif with score 993.000,
FT                   SD 2.57 at aa 328-349, sequence LTVKGYALRADLSEQTVRGHLK"
FT   CDS_pept        39069..41225
FT                   /transl_table=11
FT                   /locus_tag="BB2324"
FT                   /product="autotransporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2627"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN46"
FT                   /protein_id="CAE32820.1"
FT                   /translation="MKKQVVEYVRCGVPRLRPVMASLALAACHGLASAAPALPPATVGM
FT                   GMHQLAVPMGTTFIPMAMSSDATVLAGTGSVPGLGPHAAMWPLSNPFPYYVIAGDRSSF
FT                   HALSQDGSVGVGVVVSGGLSQAVRWDNGSWFQPLGVGTDGATQSYASGVSADGSVVVGW
FT                   LTWDGAGERRPFRWTQATGVQTLSGFESYSFALASGISADGKVVVGDVYTDGALITPNA
FT                   YRWTATDGIDLLPHVAGGTSSRAAATNSDGSVVVGTAYGSSFGGARAFRWTQAGGSANL
FT                   GTIAGGEAGQSFASAVNADGSVVVGYVDRTGIGLLTEQSAFRWTQAGGMLTVEQWLRGH
FT                   GYTIADGQTWRALAVNADGTIVMGMMQNGDTFVARTPADKVPDPVSPGGGEPAPQPGGQ
FT                   PGSQPGGGGLITLREFASSLGGTAALPASLTSSTDMLLHGAHGSPLRSLVPAGKVGMWT
FT                   TGDWGRTEHGGQDGIAAVGEAGLSYRFNEQVQLNLAVGGGNMRQYLEYDGKSTARQTYV
FT                   MPELLWNLPSTPLWLTASALYADGDLNVRRGYPNAGVDDRSSGKASLRTTAARLRLDWR
FT                   DALAWERAALTPYLDYSYIRTRVGSYTEHGGGFPARWDARTDHANVARLGVDATVQVGG
FT                   NVQLLGTVEASHRFESHNSGASGQVIGLMPFELDGASTQRNWLRFGAGVQAPVGPGTAT
FT                   LMLNTTTHSSMPSYWLAATYRLAF"
FT   misc_feature    39069..39170
FT                   /note="Signal peptide predicted for BB2324 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.944 between residues 34 and 35"
FT   misc_feature    39120..39152
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    40386..41219
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 0.00042"
FT   CDS_pept        complement(41222..41833)
FT                   /transl_table=11
FT                   /locus_tag="BB2325"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2626"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV20"
FT                   /protein_id="CAE32821.1"
FT                   /translation="MTTPMPVYTAFAGHALLAAGPLAEVALAARRAADGDAGAAVFIYE
FT                   DATGRAIDVDTRGTDAEIVARLPLPTPVEPEAEAEPEGSPARPRGRGRPRLGVVAREVT
FT                   LLPRHWDWLAGQPGGASVALRKLVEQARREHAGADALRRGRDAAYTFMSAAAGNLPGFE
FT                   EAVRALYAGDAERLAAHMAGWPADVRAYALRLAGAADLPA"
FT   CDS_pept        42056..43516
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BB2326"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2625"
FT                   /db_xref="GOA:A0A0H3LLW8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLW8"
FT                   /protein_id="CAE32822.1"
FT                   /translation="MRLVQKALTFDDVLLVPAYSEVLPRDTSLTTRLTRNITLNIPLVS
FT                   AAMDTVTEARLAIAMAQEGGIGIIHKNLSADDQAKEVARVKRHEFGIVIDPVTVTPDMK
FT                   VRDAIALQRQHGISGLPVVEGRKLVGIVTNRDLRFEDRLDQPLRNIMTPQDRLVTMKEG
FT                   ATLDEAQALMHKHRLERVLIVNDAFELRGLATVKDIVKNTEHPYACKDSQGQLRVGAAV
FT                   GVGAGTEERVEKLVAAGVDVIIVDTAHGHSAGVLERVRWVKQNYPKVEVIGGNIATAAA
FT                   ARALVEAGADGVKVGIGPGSICTTRIVAGVGVPQISAISDVAKALEGTGVPLIADGGIR
FT                   YSGDVAKALAAGAFACMMGGMFAGTEEAPGEVVLFQGRSYKSYRGMGSLGAMADGSADR
FT                   YFQDPANNADKLVPEGIEGRVPYKGSVLAIIYQLVGGIRASMGYCGCASIDDMRTKTQF
FT                   VEITSAGVRESHVHDVQITKEAPNYRAD"
FT   misc_feature    42056..42319
FT                   /note="HMMPfam hit to PF01574, , score 1.1e-56"
FT   misc_feature    42323..42481
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score
FT                   3.9e-12"
FT   misc_feature    42506..42667
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score 4e-09"
FT   misc_feature    42755..43423
FT                   /note="HMMPfam hit to PF00478, DE IMP dehydrogenase / GMP
FT                   reductase, score 1.9e-122"
FT   misc_feature    42932..42970
FT                   /note="PS00487 IMP dehydrogenase / GMP reductase
FT                   signature."
FT   CDS_pept        43613..45205
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BB2327"
FT                   /product="GMP synthase [glutamine-hydrolyzing]"
FT                   /EC_number="6.3.5.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2624"
FT                   /db_xref="GOA:Q7WK13"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WK13"
FT                   /protein_id="CAE32823.1"
FT                   /translation="MHQRILILDYGSQVTQLIARRVREAGVYSEIHAGDVDDAFVRDQV
FT                   AQGLKGIILSGSHASAYEEGSMRVPAAVFEVGVPVLGICYGMQSMAQQLGGTVSFSDHR
FT                   EFGYAEVRAHGHTKLLDGLADFTTDEGHGMLKVWMSHGDKVTELPPGFKLMASTASCPI
FT                   AGMADEDRGFYAVQFHPEVTHTVQGKAMLARFVKDICGCEGDWNMPDYISEAVARIREQ
FT                   VGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLDEGKQVMQTFAENMGV
FT                   KIVHVDATSQFMGKLTGVADPEAKRKIIGREFVEVFQDEAGKLQGAKWLAQGTIYPDVI
FT                   ESAGAKTGKATSIKSHHNVGGLPDTLNLQLLEPLRELFKDEVRELGVALGLPPQMVYRH
FT                   PFPGPGLGVRILGEVKHEYAELLRRADAIFIEELRNAKDPASGLTWYELTSQAFAVFLP
FT                   VKSVGVMGDGRTYEYVVALRAVQTFDFMTADWAPLPHPLLARVSSRIINEVRGINRVVY
FT                   DVSSKPPATIEWE"
FT   misc_feature    43628..44209
FT                   /note="HMMPfam hit to PF00117, DE Glutamine
FT                   amidotransferase class-I, score 4.5e-37"
FT   misc_feature    43847..43882
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT   misc_feature    44819..45199
FT                   /note="HMMPfam hit to PF00958, DE GMP synthase C terminal
FT                   domain, score 3.1e-64"
FT   CDS_pept        complement(45801..46490)
FT                   /transl_table=11
FT                   /locus_tag="BB2329"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2621"
FT                   /db_xref="GOA:A0A0H3LLX4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLX4"
FT                   /protein_id="CAE32824.1"
FT                   /translation="MYDRIYSMMKNPVRANTPNPAMTQPAPAPTVDGRRLRGERARARV
FT                   LDEAVKLLSIEGLDGITFGQVAERAEVGKSNLQVLFGDKERLQLAALDHAIALYQAQVI
FT                   EPAMRKRTPLARLRALMNGWFDFVETRQLPGGCVITAASSEYRARPGPLRDAIRQYRDG
FT                   ARARLRELIRQAKAQGQLAADTNEARLAMDLLAYQAFANVAASMDDAAEFKRAKAAVAQ
FT                   MLAGGAG"
FT   misc_feature    complement(46218..46358)
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 0.00015"
FT   misc_feature    complement(46245..46310)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1193.000, SD 3.25 at aa 61-82, sequence
FT                   ITFGQVAERAEVGKSNLQVLFG"
FT   CDS_pept        46503..47933
FT                   /transl_table=11
FT                   /locus_tag="BB2330"
FT                   /product="probable membrane efflux protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2620"
FT                   /db_xref="GOA:A0A0H3LSJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSJ5"
FT                   /protein_id="CAE32825.1"
FT                   /translation="MTDAMPPPNVERRHPWRALAVLLTGNFVTILDLFIVNVALPSIQQ
FT                   GLSATDTDLQLVVVAYALAYGLCLINGARLGDLFGRRRLFMAGMGLFTLASALCGVAVT
FT                   PWQLIAARALQGVGAGVLMPQVLASIRVLFEGEARRRAFGVMGAVQGVAATVSQLLGGV
FT                   LITMNAFGLGWRLVFLINVPVGIAALLAGRRALPEWRAPVATKVDMWGALLGAVGLALI
FT                   LVPVMEGREHGWPWWSLAGPVLALLVLGYFVHYEQGLVRRGGVPMLDMGLFANRPFVAG
FT                   IGAVFFFFSAISSFFFALTLLLQFGLGMAPLAAGAVFTPSALAFFGASLVGPRLAARYG
FT                   RGALLFGVLVFAAGVALSAVTAATQPHHLPLLVASLVLNGAGQGLAIPLAFNAILGAVR
FT                   EEQAGMASGMLSTLQVVGTSVGVAVVGAVVFAALEAAGRWPAADGAMVYGRALAVAMVY
FT                   NVAAALASWVLFRLATRR"
FT   misc_feature    46551..47813
FT                   /note="HMMPfam hit to PF00083, DE Sugar (and other)
FT                   transporter, score 0.0093"
FT   misc_feature    join(46557..46625,46668..46727,46761..46829,46839..46907,
FT                   46926..46994,47022..47090,47127..47186,47199..47267,
FT                   47331..47399,47427..47495,47532..47600,47628..47696,
FT                   47733..47801,47844..47912)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BB2330 by TMHMM2.0 at aa 19-41, 56-75, 87-109, 113-135,
FT                   142-164, 174-196, 209-228, 233-255, 277-299, 309-331,
FT                   344-366, 376-398, 411-433 and 448-470"
FT   CDS_pept        complement(47966..49222)
FT                   /transl_table=11
FT                   /locus_tag="BB2331"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LN49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN49"
FT                   /protein_id="CAE32826.1"
FT                   /translation="MKTSLASALPPCSGSAPAWSAGMPRGLVWLFAIASGLSVANVYYA
FT                   QPLLDALARDFRISHAAIGGVVTATQIGCALALLLLVPLGDRMNRRRLMAMQLLALVGA
FT                   LAAVGAARSAPALLAGMLAVGLLGTAMTQGLIAYAASAAAPHEQGRVVGAAQSGVFIGL
FT                   LLARVFAGGVSDLAGWRGVYLCAAALMLALALPLWRWLPTLAAAPGAMRYPRLIASLLT
FT                   LLREEKALQVRGMLALLMFAAFNIFWSALVLPLSAPPYGFSHTAIGAFGLVGVVGALAA
FT                   ARAGQWADQGHAQRTSAAALAALLLAWWPLSLMEESLGALVIGILLLDLGGQALHVTNQ
FT                   SLILRTRPQAHGRLVGLYMLFYAIGSGLGAIGTTAAYAHAGWRGVCLLGAAVSLLALLF
FT                   WWATRRTGHPAAPYRASRP"
FT   misc_feature    complement(join(48017..48085,48095..48163,48377..48445,
FT                   48455..48523,48617..48685,48713..48772,48809..48877,
FT                   48890..48943,48977..49045,49088..49147))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2331 by TMHMM2.0 at aa 26-45, 60-82, 94-111, 116-138,
FT                   151-170, 180-202, 234-256, 260-282, 354-376 and 380-402"
FT   misc_feature    complement(49163..49222)
FT                   /note="Signal peptide predicted for BB2331 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.985 between residues 20 and 21"
FT   CDS_pept        49332..49778
FT                   /transl_table=11
FT                   /locus_tag="BB2332"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV25"
FT                   /protein_id="CAE32827.1"
FT                   /translation="MPPRKPMNDEPCPVARCVDLIGDRWSLLIVRDAFDGARRFGDFQR
FT                   GLGVARNILSDRLRKLVEAGVLEMQDASDGSAYQEYVLTARGESLFPVLVALRQWGERH
FT                   LFERGERHSVLIDRRTGKPVAFMAPVAQDGTALAPAAAEVRKVK"
FT   misc_feature    49389..49661
FT                   /note="HMMPfam hit to PF01638, DE Transcriptional
FT                   regulator, score 9e-22"
FT   CDS_pept        49864..50943
FT                   /transl_table=11
FT                   /locus_tag="BB2333"
FT                   /product="putative C4-dicarboxylate transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2619"
FT                   /note="Similar to Pyrococcus abyssi C4-dicarboxylate
FT                   transporter, putative pab2393 SWALL:Q9V0I5 (EMBL:AJ248285)
FT                   (339 aa) fasta scores: E(): 1.4e-10, 25.14% id in 350 aa,
FT                   and to Methanococcus jannaschii hypothetical protein Mj0762
FT                   SWALL:Y762_METJA (SWALL:Q58172) (342 aa) fasta scores: E():
FT                   1.1e-14, 25.46% id in 322 aa"
FT                   /db_xref="GOA:A0A0H3LLX3"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLX3"
FT                   /protein_id="CAE32828.1"
FT                   /translation="MSPRGPELAPSSAPANPGLLAGLSPASFGIVMATGIVSLACASLG
FT                   LPSVGRWLFALNVLLYAVVWGLNLARLLRHPRRMRNDACDHGRAPGFFTAVAASGVLGG
FT                   QCLLLADARGAAMWLEAVAVVLWVVLSYGIFAAVMVKRDKPRLEQGMSGGWLLAVVATQ
FT                   ALVGLGALLAPGLGEAWQGRLALALLGLWLWGGVLYALLMSLIFYRIMFLPLSPTDLSP
FT                   PYWINMGAMAISTLAGTLLLQQSHAWPLLQTVQPFVQGVTLLFWAGGSWWIPLLLVLGV
FT                   WRHGLQRHPLRYEGLYWAMVFPLGMYAMATHHLALALEQAWLEPLARAFMWVALGAWTL
FT                   AALGLLGALSQALRRPARA"
FT   misc_feature    join(49921..49989,50017..50070,50131..50199,50209..50277,
FT                   50314..50382,50425..50493,50530..50598,50641..50709,
FT                   50746..50814,50842..50910)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2333 by TMHMM2.0 at aa 20-42, 52-69, 90-112, 116-138,
FT                   151-173, 188-210, 223-245, 260-282, 295-317 and 327-349"
FT   misc_feature    49930..50817
FT                   /note="HMMPfam hit to PF03595, DE C4-dicarboxylate
FT                   transporter/malic acid transport protein, score 4e-06"
FT   CDS_pept        complement(50981..52207)
FT                   /transl_table=11
FT                   /gene="opdE"
FT                   /locus_tag="BB2334"
FT                   /product="putative transporter"
FT                   /note="Similar to Pseudomonas aeruginosa transcription
FT                   regulatory protein OpdE or pa2219 SWALL:OPDE_PSEAE
FT                   (SWALL:Q01602) (402 aa) fasta scores: E(): 9.5e-112, 77.09%
FT                   id in 393 aa, and to Xylella fastidiosa transcriptional
FT                   regulator xf1749 SWALL:Q9PCM9 (EMBL:AE003997) (409 aa)
FT                   fasta scores: E(): 3.6e-122, 84.42% id in 398 aa"
FT                   /db_xref="GOA:A0A0H3LLX8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLX8"
FT                   /protein_id="CAE32829.1"
FT                   /translation="MATPLIDGPENADTSDHFQQKPTSWNGVFAMSVCAFALIASEFLP
FT                   VSLLTPMARDLDVTEGMTGQGISISGAFAVLTSLFISTLAGSLNRKTLLLILTLAMGVS
FT                   GAIVALAPNYFIYMLGRALIGVVVGGFWSMSAATAIRMVPTRDVPRALAIVNGGNALAT
FT                   VVAAPMGAYLGTVVGWRGAFLCLVPVSLIALAWQWKTLPSMPAAARAPGAGNAFKVLTL
FT                   FRHPGVAVGMLASSLLFMGQFSLFTYVRPFLEIVTGVHGATISLILLAIGAAGFIGTAL
FT                   IGRVLQRRFYQTLIVIPLLMAATALALIVFGDVIGIVVALLALWGLTGTSAPVGWWAWI
FT                   AKVFPEDAEAGGGLFVAVVQLSIALGSTVGGLLFDRSGYQSAFVMSAVLLTVCAMLTAL
FT                   TARKLAAHA"
FT   misc_feature    complement(50987..52129)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00083, DE Sugar (and other)
FT                   transporter, score 0.0054"
FT   misc_feature    complement(join(51005..51073,51086..51154,51191..51259,
FT                   51272..51331,51350..51418,51461..51529,51620..51679,
FT                   51689..51757,51776..51844,51857..51925,51944..52012,
FT                   52070..52138))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2334 by TMHMM2.0 at aa 24-46, 66-88, 95-117, 122-144,
FT                   151-173, 177-196, 227-249, 264-286, 293-312, 317-339,
FT                   352-374 and 379-401"
FT   CDS_pept        complement(52226..52357)
FT                   /transl_table=11
FT                   /locus_tag="BB2335"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of Xylella
FT                   fastidiosa hypothetical protein Xf1750 SWALL:Q9PCM8
FT                   (EMBL:AE003998) (378 aa) fasta scores: E(): 2.4e-06, 71.87%
FT                   id in 32 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSK0"
FT                   /protein_id="CAE32830.1"
FT                   /translation="MIIPGAVHVDLYDGMDKIPLDRLTAFLRNNLAIQTQGPGRDIP"
FT   CDS_pept        complement(52427..52906)
FT                   /transl_table=11
FT                   /locus_tag="BB2336"
FT                   /product="putative exported protein"
FT                   /note="Similar to Xylella fastidiosa hypothetical protein
FT                   Xf1751 xf1751 SWALL:Q9PCM7 (EMBL:AE003998) (167 aa) fasta
FT                   scores: E(): 3.1e-37, 69.75% id in 162 aa, and to Ralstonia
FT                   solanacearum hypothetical protein rsc0630 rsc0630 or
FT                   rs01532 SWALL:Q8Y1Q9 (EMBL:AL646060) (118 aa) fasta scores:
FT                   E(): 1.1e-18, 52.13% id in 117 aa"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN53"
FT                   /protein_id="CAE32831.1"
FT                   /translation="MKNLFALPMNRTRRKALALLAGLAAGAPARPALALAPRQEPAMKI
FT                   RLTIAGQIASATLYDNATARDFASLLPLSLTMTDYDTIERVADLPRKLSTQGAPGGMAP
FT                   MVGELTHYAPWCNLAIFIQPRAYARSLLPLGRIDEGLAIVSRSGPYEMRIERIEP"
FT   misc_feature    complement(52805..52906)
FT                   /note="Signal peptide predicted for BB2336 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 34 and 35"
FT   CDS_pept        53014..53973
FT                   /transl_table=11
FT                   /locus_tag="BB2337"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa putative
FT                   transcriptional regulator pa2220 SWALL:OPRR_PSEAE
FT                   (SWALL:Q01610) (306 aa) fasta scores: E(): 1.8e-95, 81.35%
FT                   id in 295 aa, and to Xylella fastidiosa transcriptional
FT                   regulator xf1752 SWALL:Q9PCM6 (EMBL:AE003998) (324 aa)
FT                   fasta scores: E(): 1.9e-105, 83.75% id in 314 aa"
FT                   /db_xref="GOA:A0A0H3LV28"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV28"
FT                   /protein_id="CAE32832.1"
FT                   /translation="MARRNLNDLLYFVTIAREGSFTRAAALLGVTQSALSQAISGLEAR
FT                   LRIRLLTRTTRSVSPTAAGERLLNAIGHRFDEIESELDELTQLRDKPAGTVRITCGDHI
FT                   LRATILPRLTPLVREYPDIKLEFDVNYGFRDIVADRFDAGVRLGDTIDKDMIAVPIGPP
FT                   LRMAVVASPAYFEAHSTPGQPRDLLRHNCINMRMQSGRGVYAWDFLRRGRRLNVRVDGQ
FT                   LIFNTTPPMVEAALAGLGIAALPEEEFAPHLENGSLVRVLEDWCEPFSGYFLYYPSRRQ
FT                   PSPAFSLVLAALRYGEGSSGKAQLGGSLKKGRSRRKAD"
FT   misc_feature    53029..53208
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 9.4e-26"
FT   misc_feature    53068..53133
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1959.000, SD 5.86 at aa 27-48, sequence
FT                   GSFTRAAALLGVTQSALSQAIS"
FT   misc_feature    53071..53163
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    53278..53907
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 9.7e-40"
FT   CDS_pept        complement(53895..55304)
FT                   /transl_table=11
FT                   /locus_tag="BB2338"
FT                   /product="probable transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2611"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLX6"
FT                   /protein_id="CAE32833.1"
FT                   /translation="MFKRRLLRAALPLLLLSLGGFGAWLISLPSAPAGLASPPIAASET
FT                   TALLASLAPTRRQRPLIAVVGINDATETTDYLVPTGILRRADVADVVTLATGPGPVRLF
FT                   PALTVEADATLDAFDARNPAGADYVIVPAMSRDDDPAVLAWLREQARKGATIIGVCAGA
FT                   KVVAAASLLDGKRATTHWYYLKELLGRHPSIRYVADRRVVADRGVVTTTGVTASMPMTL
FT                   LLIEAIAGRHKARAVAQDLAIPAWDIRHASGAFALTRPFATTVLGNVLAFWNREQIGIE
FT                   LRPGMDEVSLALAADAWSRTYRSQAVSYAQASGAIATRNRIRVIPDAAAADWPATRRID
FT                   TYTDQAPAQTLDRTLRAIAGRYGAPTASVVAMQLEYPWRGASAATTALAVRSIHPDGFQ
FT                   PTQKTTSSCSNRAPSSCISPSAMAACDTYQAAVRPTRRSTPAERPQSAFLRDRPFFSEP
FT                   PNCAFPELPSP"
FT   misc_feature    complement(54618..55124)
FT                   /note="HMMPfam hit to PF01965, DE DJ-1/PfpI family, score
FT                   1.9e-13"
FT   misc_feature    complement(55179..55304)
FT                   /note="Signal peptide predicted for BB2338 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.370 between residues 42 and 43"
FT   CDS_pept        complement(55365..57092)
FT                   /transl_table=11
FT                   /locus_tag="BB2339"
FT                   /product="putative solute transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2610"
FT                   /db_xref="GOA:A0A0H3LLY3"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLY3"
FT                   /protein_id="CAE32834.1"
FT                   /translation="MASSPADTPHRNWLRWLPGLAVLKTYQAAWLPRDLAAGLVLTAML
FT                   VPVGIAYAEASGVPGVYGLYATIVPLLAYALFGPSRILVLGPDSALAAPILAVVLSVSE
FT                   GDPMRAVATASLMAIVSGLFCIILGLLRLGFITELLSKPIRYGYMNGIALVVLASQLPK
FT                   LFAIPTDDGGPLRELWQLAQAVLDGRTNGYSLAVGSATLGLILLLKRFKRLPGILIAVV
FT                   LATLAVSLFGLDGRGVQVLGEIPQGLPGFTIPWLSNADLARIVLGGCAVALISFADTSV
FT                   LSRTYAARTHTRVDPNQEMVGLGVANLATGFFQGFPVSSSASRTPVAEAAGSRTQLAGV
FT                   VGALAVAALLLAAPNLLRHLPSSAMAAVVIAAAIGLFEFKDLRRIFRIQQWEFWLSMLC
FT                   FAAVVAFGAIPGICLAVVVAVLEFLWDGWRPHFAVLGRVPDLRGYHDLKRYPHAALIDG
FT                   LVLFRWDAPLFFANAELFQQRLLEAVQASPTPVRRVVVTAEPVTSVDVTSADMLRELSH
FT                   HLAESGIALHFAEMKDPVRDKLKRFELSEVFGADRFHPTVESAVDDYLKRPPQGTIDP"
FT   misc_feature    complement(55413..55745)
FT                   /note="HMMPfam hit to PF01740, DE STAS domain, score
FT                   4.7e-19"
FT   misc_feature    complement(55812..56711)
FT                   /note="HMMPfam hit to PF00916, DE Sulfate transporter
FT                   family, score 7.5e-78"
FT   misc_feature    complement(join(55833..55901,55962..56015,56025..56084,
FT                   56244..56312,56394..56453,56472..56531,56589..56657,
FT                   56694..56762,56844..56912,56931..56990))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2339 by TMHMM2.0 at aa 35-54, 61-83, 111-133, 146-168,
FT                   188-207, 214-233, 261-283, 337-356, 360-377 and 398-420"
FT   CDS_pept        57204..58562
FT                   /transl_table=11
FT                   /locus_tag="BB2340"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2609"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSK6"
FT                   /protein_id="CAE32835.1"
FT                   /translation="MLTLTCLGGAGTVTGSKHLLRHGDTRLLVDCGLFQGLKNLRELNW
FT                   QPLPVAPADIDAVVLTHAHLDHCGYLPRLVAEGFRGRIHATPATRDVAELILLDSANLQ
FT                   EKDAEFANRKGYSRHAPALPLYRVVDAERALARFSDVALHRETALPGGATLTLRRAGHI
FT                   LGAATAQIDIGGMRVVFSGDLGRYNDPVMHDPEDVRNADYLVIESTYGNRRHDAADPVE
FT                   ALGAVIERTVLRGGTVVIPAFAVGRAQTLIHALWKLRQAGRLHNVPVYLDSPMATSATE
FT                   LLARHASEHKLSAQDCEAACAAVTYVRDVEGSKALSANRYPKVIISASGMATGGRVLHH
FT                   MAAFGADHRNTLLFAGFQAAGTRGRKLLDGATETRIYGQWMPVRAEVAELPMLSAHADS
FT                   DELMRWLAGFQEAPRRVFIVHGEPQASQALRERIQRELNWQAIVPVQDRRYTL"
FT   misc_feature    57231..57887
FT                   /note="HMMPfam hit to PF00753, DE Metallo-beta-lactamase
FT                   superfamily, score 0.0027"
FT   CDS_pept        complement(58582..59487)
FT                   /transl_table=11
FT                   /locus_tag="BB2341"
FT                   /product="probable AraC-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LN57"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN57"
FT                   /protein_id="CAE32836.1"
FT                   /translation="MDKTANPIPPGVSREPGVLCDGQSVIHAWRCGGVVLEAHTGMPTA
FT                   LPRHAHDTYQIGITTRDPGEYLCEGRTWNAPPGSVILFHPGDVHSVVTVGVRNRRDTSL
FT                   LMFVDPRQMQDIATSLRGVDCGLPVFDDLVIRDAAFIRRFADTHARTRAHANPLEQESR
FT                   LLALLQCLVGGFSAGPIAPRPVARNRRKALLVRDYIDAHYRDTLSMAQLADVAHTSPYH
FT                   LNRLFAREIGIPPHAYQTQLRVERAKRLLLRGTSITDAALSTGFFDQSHFTRYFKRIVG
FT                   VPPRRYTSPAAWHPPRGQAG"
FT   misc_feature    complement(58621..58749)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 3e-05"
FT   misc_feature    complement(58636..58761)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(58768..58905)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 3e-06"
FT   misc_feature    complement(58804..58869)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1463.000, SD 4.17 at aa 207-228, sequence
FT                   LSMAQLADVAHTSPYHLNRLFA"
FT   CDS_pept        59771..60760
FT                   /transl_table=11
FT                   /locus_tag="BB2342"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV34"
FT                   /protein_id="CAE32837.1"
FT                   /translation="MSGNPSAHRPRRRALLALAGAAMIARPAIARSRFPDRSIRLVVPW
FT                   LPGSAADNELRALAHVAGRDFGQSVVIENKAGASGILGAQMIAAEKRADGYLLTQMHTT
FT                   AFRMTALMDKPPYDVMDDYSWIIQLVGYSYGTVVRADSRWKDWDGFVAYSKANPGKVTL
FT                   GTAGVGTTQHITMMQVAKKLGVEWLHVPFRGGGDEAQALLGGQIDAVASSTYWAELVNA
FT                   GKLRLLATFGVERVKRFPDVPTLRELGVDIAQIAPYGLVAPRGLDPDVKRVLHDGFRKA
FT                   LYSPQHQAAIERLDMPLAYLNSEDYEQAAKALFREEVEAIRSLGIKNG"
FT   misc_feature    59936..60748
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.8e-67"
FT   misc_feature    60149..60178
FT                   /note="PS00120 Lipases, serine active site."
FT   CDS_pept        60786..61877
FT                   /transl_table=11
FT                   /locus_tag="BB2343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LLY0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLY0"
FT                   /protein_id="CAE32838.1"
FT                   /translation="MENALSTLPLTAPSAELPRFGPPHIPIREDWLDRQREEILDPGLP
FT                   IVDAHHHLWDRPGQRYMFEDFLRDTGSGHNIRATVYVQCRSMYRLDGPAAMRPVGEAEF
FT                   VNGVAARSASGMYGPMRACAAIVGYADLTLGAAVEEVLHALVRAAPDRLRGVRNMTAAH
FT                   ASPAVAPGFGRVPEGLLSDARFRAGYARLAPLGLSYDVWAFHSQLAEVLDLARAYPDTA
FT                   LIVNHAGGPLGIGPYAGQRDAVMRDWDHHLRALADCPNVALKLGGLGMHISGLRFHEQD
FT                   MPPSSEALAEAWRPWIHTAIERFGAQRCMFESNFPVDKGMAAYAAVWNAFKRLARGATP
FT                   RERQALFAGTAARLYRLPASVLA"
FT   CDS_pept        complement(61942..62928)
FT                   /transl_table=11
FT                   /locus_tag="BB2344"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   ra1058 or sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 5.2e-47, 43.97% id in 332 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein atu4727 or
FT                   agr_l_312 SWALL:Q8U6S9 (EMBL:AE009401) (329 aa) fasta
FT                   scores: E(): 1.5e-45, 44.23% id in 321 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLY8"
FT                   /protein_id="CAE32839.1"
FT                   /translation="MLIPKTLAGFVVAAAVAMPALAQGGGAGPDNPLAGKTVRLLVGFS
FT                   PGGTSDAVARIIAEKLGPLLEARIVVENKPGANGNIAAADVARARPDGLTWYLGSFNNP
FT                   VNQAAGRKLPFDFLRDFAPVAMVAYAPNVLIVNNDLPAHSVADLVALAKSRPGELTFGS
FT                   AGAGSSLHMAGELFKNVAGVNMVHVPYKGSAPAMTDLVGGHLATMFDNLPTAMTQIKAG
FT                   TVRALAVTGGRRVNSLPDVPTVAETLPGFDVTSFFALYAPTGTPPAAIAAINAATNRAL
FT                   ADPDLQRRFAEQGADPGPGTPQQLAALVRDEVVKWREVIVAGDIRLE"
FT   misc_feature    complement(61954..62772)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 7e-105"
FT   misc_feature    complement(62863..62928)
FT                   /note="Signal peptide predicted for BB2344 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 22 and 23"
FT   CDS_pept        63230..64228
FT                   /transl_table=11
FT                   /locus_tag="BB2345"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSL0"
FT                   /protein_id="CAE32840.1"
FT                   /translation="MYPINLTRLKTALAATLAVAALAAAAPAAATDWTPDRPLRIVSPY
FT                   AAAGTNDLLARLMAQKLGERLGKSIVVENRAGANGIIGAEYVAKMPGDGYTMLMGNSAT
FT                   HGINPNLYAKLSYDADKDFTPIGLIASVPLLLVVGPKVEADSLQDLIALSKSRPGQISF
FT                   ASSGVGSSPQLAGELFKSISGLDIIHVPYKGDSPALTDVLGGQVTMMFANIPSALPMVR
FT                   AGKLKALAMTGAARTSAAPEIPTMAEAGLPGVEISAWYGLMAPAGLPSPVLARLNTELN
FT                   AVLQQPDVQTRIRELGAEPAQPGPPAQFQQFVDAELAKYGKVIKTAGIAPE"
FT   misc_feature    63230..63319
FT                   /note="Signal peptide predicted for BB2345 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.883 between residues 30 and 31"
FT   misc_feature    63389..64216
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.6e-113"
FT   CDS_pept        64358..65611
FT                   /transl_table=11
FT                   /locus_tag="BB2346"
FT                   /product="putative acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="GOA:A0A0H3LN61"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN61"
FT                   /protein_id="CAE32841.1"
FT                   /translation="MSKGPLQGIRVLDFTRFLAGPYATMLMADLGADVVKIEEPGGDHT
FT                   RTSGPYLDAATKDQDIGGFFNSLNRSKHGICIDLKSPGGRDLVLRMVKDVDVVVENFRG
FT                   GVMEKYGLDYETLSRINPRLVYASVRGFGDRRTLGTHYPERPTVDLLVQAVSGIMGITG
FT                   SADGQVYKIGPGVGDIFPGTMCLVGILAALQWRERSGEGQYVDTSMYDCMLSLCERMLY
FT                   QHSYTGEIPGPMGNAHPFSAPYTMYPAADGNFVVAAPNDKFWRRIATAIGQPELGADPR
FT                   FATRAARREHRGEIDDIMRAWSSVRKRDDVMAALLGHDVLAAPVNNAADIFADPEVRKR
FT                   RMLVDIDPYPHAPRKVQVAGTPLKFTKTETQPQRRAPLVGEHTHDVLTRMFGLSAAEVA
FT                   ALERDAIVSRREPESAGA"
FT   misc_feature    64580..65158
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   8.5e-64"
FT   CDS_pept        65613..66758
FT                   /transl_table=11
FT                   /locus_tag="BB2347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LV36"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV36"
FT                   /protein_id="CAE32842.1"
FT                   /translation="MSNRKTNPLYALKDRYAVVGVGTTPYGSFPELDEYGLGAWAFKNA
FT                   IDDCGLDKNLVDGLGVCRVPSYTRMGEVLGLNPRWTLTLPAHGRMSGISIVEAVAALNA
FT                   GLTDYVALIYTNIGRSRRVNYGGDESPNIWNPWGFTSPGAGHALMFQRHAQQYGTTGRD
FT                   LAEVAMAFRHHACLNPDAVMKTPITIDDHENSRHIAAPLRLLDYCLINDGAVCLILTST
FT                   ERARDLKRPPVRISGIGARETYVESSLPNFSSDFWYDALQDTAAEVYGMAGIGPQDVDA
FT                   LMCYDNFSPTVLFSLEGMGFCGRGEGGAFVRDGRLKLGGGLPTNTDGGHLSNSYMQGWG
FT                   LNAEAVRQARGDGGERQVPGCRVVQYVAATPCTRSIIYTAD"
FT   CDS_pept        66782..67198
FT                   /transl_table=11
FT                   /locus_tag="BB2348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLY6"
FT                   /protein_id="CAE32843.1"
FT                   /translation="MTPGFPLPKPDVLSRPFWDFAQRGVLSLQRCRHCGDVHFPAAPVC
FT                   PACLSEQQEWVPASGRGTLFSWCEFHKGYWDSVASLLPYRVAVIKLNEGPLLISNLVDV
FT                   ADCAALRADAPVEVVFRPVSADINLPVFRLSHAC"
FT   misc_feature    66815..67189
FT                   /note="HMMPfam hit to PF01796, DE Domain of unknown
FT                   function DUF35, score 3.6e-14"
FT   CDS_pept        67214..68119
FT                   /transl_table=11
FT                   /locus_tag="BB2349"
FT                   /product="putative 2-pyrone-4,6-dicarboxylic acid
FT                   hydrolase"
FT                   /db_xref="GOA:A0A0H3LLZ3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLZ3"
FT                   /protein_id="CAE32844.1"
FT                   /translation="MNASAEPLLESQEPLSAYTPPAFEVPPGACDTHAHIFGPVSRYPL
FT                   DPKRTFNPPRAGIDDYRRLLSTLGLERAVIVHSGAYGTDISVTRDALLASEGKWRGIAL
FT                   VDRDVTRDALADMHAAGFRGVRFNFIFGHRNEEDDVLEIARRIAEFGWHIQLLVDARTL
FT                   PDLLPLIRRLPVMVVIDHIGRMPTSAGIGDPGFQALLGLLRERRCWVKLSGANRMGDPT
FT                   PPYASVVPFAHALVDAGADHLVWGTDWPHVREPGAIPDDGGLLNLLQLWVPDRRLRNAI
FT                   LSDNPARLYGFAPGGKEPQP"
FT   CDS_pept        68116..69468
FT                   /transl_table=11
FT                   /locus_tag="BB2350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LSL5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSL5"
FT                   /protein_id="CAE32845.1"
FT                   /translation="MTPTAIEKIAVFVAGFDPAGATPAARHVAARALYDTIAVAIAGAD
FT                   EPASRLMMDYARGQSAPGMATVWATGDRLPVELAALVNGTMGHALDFDDVSSPLRGHPS
FT                   VAIFPALMALGESRGVSGKALLDAYLAGFEVTIKLARAIVDDQYAKGWHSTPSIAAFGA
FT                   TAACARLLGLDAARIAHAMGILVSQVAGTRQNFGTMSKPFQAGQANVMALRAALLAELG
FT                   FDASMSAMDGPHGYTVLYADGQDIHAQFDTLGQLPLEIDAAGIEVKKYPLCYATHRAIQ
FT                   GILDLRKQQSLAFAEVERVEVKTNYRATVPLIYDRPQTGLEAKFSMHYAVAAALHDGAV
FT                   NLASFEDAAVRRPAIQAFFEKVELSQGEPPMFPRWAEVVVHLRDGVSHRIRVEGLRGSA
FT                   QFPLSNAELVEKGADCLAHGKVALSAERLARACFELDAAPLQALLEVLRSA"
FT   misc_feature    68122..69444
FT                   /note="HMMPfam hit to PF03972, DE MmgE/PrpD family, score
FT                   1.7e-52"
FT   CDS_pept        69480..71003
FT                   /transl_table=11
FT                   /gene="gabG"
FT                   /locus_tag="BB2351"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="GOA:A0A0H3LN65"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN65"
FT                   /protein_id="CAE32846.1"
FT                   /translation="MPGRGCVPRFFSSDSIDMTISPLQLLNDPSLLRTDALVDGRWIAA
FT                   SRRFAVHDPATGRKLADVANLDAAHAREAIAAAQAAWPAWRARTVKERSAILRKWFDLL
FT                   LANQDDLARLLTAEQGKPFGEARGEIAYAASFVEWFAEEAKRINGETLPAFDNNRRLLV
FT                   LRESIGVCAAITPWNFPLAMITRKVAPALAAGCPVIVKPAEHTPLTALAAAQLAVRAGV
FT                   PAGVLGVLPADGANSIAIGKELCANDAVRHLSFTGSTEVGRILMAQSAATVKKLSLELG
FT                   GNAPFIVFDDADLDSAVEGAMQSKYRNAGQTCVCANRIYVQDGVYDAFVEKLADAVRAL
FT                   KVGPGFDEGVTQGPLIEPEAVDKIERHIEDAVSKGGRVVAGGRRLGGLFFEPTVLVDAT
FT                   SQMLCAREETFGPLAPVFRFHADEDAIAAANATEFGLASYLYSRDVGRIFRAAEALESG
FT                   MVGVNVGILATEHVPFGGVKQSGLGREGGRHGIDDYVEIKYMCVGDILK"
FT   misc_feature    69600..70991
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 3.8e-192"
FT   misc_feature    70311..70334
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    70395..70430
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        complement(70996..71985)
FT                   /transl_table=11
FT                   /locus_tag="BB2352"
FT                   /product="probable LysR-family transcription regulator"
FT                   /db_xref="GOA:A0A0H3LV40"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV40"
FT                   /protein_id="CAE32847.1"
FT                   /translation="MRQTPRKGLPRPVPAAPTIPAMDNIDIKLLRTLLVLMSERSVSRT
FT                   ADRLDVSQPAVSHALARLRILFDDPLLLRSRAGMVPTDRASEIEARVRRLLAEYDALAH
FT                   RPQPFDPSVSERHFVLSAPEYAEHLLMPPIFRHLRAHAPNIRVEVRAPDPERAYELLES
FT                   GEVDLRIAWLRKPAQSLRSMQLFQDRIVCIADRDHPALDGTLSLADFLRYPHARPWGMG
FT                   RNMSGRVIDEAVELLGKKLAPPFLVQNFLTIPYTITGSDLLAVLPLVLARAFAAQQPIQ
FT                   ILEVPLRLPRMRYGAYWHERSHKDVGHKWLRSVVLQAAQGLQAPPAAI"
FT   misc_feature    complement(71026..71655)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 8.1e-23"
FT   misc_feature    complement(71728..71907)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.2e-15"
FT   misc_feature    complement(71773..71865)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(71803..71868)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1637.000, SD 4.76 at aa 40-61, sequence
FT                   RSVSRTADRLDVSQPAVSHALA"
FT   CDS_pept        complement(71995..73056)
FT                   /transl_table=11
FT                   /locus_tag="BB2353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LLZ0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLZ0"
FT                   /protein_id="CAE32848.1"
FT                   /translation="MDIADPDAPPRYAPPEIPIRPGWLAMRREPVLEPGLPIVDAHHHL
FT                   WDRPGQRYLFDELRADLQTGHNVLATVYVQCRSMYRCDGPAAMRPVGETEFANGIGAQS
FT                   ASGLYGRLRACAGIVAYADLSLGAAVRPVLQAHLNAAPQRLRGIRCMTAAHASPHIQPN
FT                   SGKVPEHLLMAPRFREGFAELAPLGLSYDAWAFHTQLHEVLDLARAFPQTVIVVDHAGG
FT                   PLGIGPYAGRRDAVYAHWHAAMRALAACPNVNVKLGGLAMHFSGLDFHLLAEPPDSRQL
FT                   AHAWRPYIEACIELFGAGRCMFESNFSVDKGMLSYAVLWNAFKRLAAQCSAQEKAQLFA
FT                   GTARRVYRLPPQP"
FT   CDS_pept        73250..74239
FT                   /transl_table=11
FT                   /locus_tag="BB2354"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLZ8"
FT                   /protein_id="CAE32849.1"
FT                   /translation="MAFKQQLRGLLGSLAGGVLLALQPAAAEPTYPSRPIRLIVPFAPG
FT                   GTTDAVARAVATKLGQALNQSIVVENRAGAGGSIGTDFVAKARPDGYTLLLGSAGPLSV
FT                   NPTLYPNLPYDPTRDFTPVGMICTSALVLVTSSASGIASTADLIRQAKANPGSLTFSTA
FT                   GVGGASHIAAELFASMAGIKATHVPYRGSGPATVAAVAGETSFTFTGQTAAWPMVQAGK
FT                   LRALGVGSRERSAEHPEVPTVAESGPVPGYEALDWNVIMAPPGTPESVVRALSDGLDRI
FT                   LDDPELRASFVQQGIAIRKGTAADVQALMRHDIAKWAKVIEEAGIETQ"
FT   misc_feature    73250..73330
FT                   /note="Signal peptide predicted for BB2354 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.775 between residues 27 and 28"
FT   misc_feature    73400..74227
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.3e-97"
FT   CDS_pept        74401..75471
FT                   /transl_table=11
FT                   /locus_tag="BB2355"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2607"
FT                   /db_xref="GOA:A0A0H3LSL9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSL9"
FT                   /protein_id="CAE32850.1"
FT                   /translation="MRHLLAGNQLRQSLLIAQPASVRVALVAGLQAGLAIFVALVSAHL
FT                   SPWPHLVGFSALGGLAALFGRFASAQGRQRIVMVCGLLLVAGVLVPSLATYAGAGALSM
FT                   VLLLALSAGLYTLAVWRWGLTGGPGAVIFVFAVGAALAPVDSAAAVVERTLATAWGALV
FT                   AWLACALTDRLRPHGAVAMAAAPLPPLSLQLMVAGRIAVGAGAAALIIFWAGWQYPAWA
FT                   AIGAAAVMQGTHLHLTMNRSLQRMAGTIVGACIVWAILAQDPSFWTLVAAVVLCQVITE
FT                   VTIGFNYALGQVTVTPMALLMTYMASPAPASNMPVERVVDTIVGAAIGIVFAVIFSTVD
FT                   DRVHLARRYRKLRIWR"
FT   misc_feature    join(74461..74529,74539..74607,74626..74694,74704..74772,
FT                   74785..74853,74974..75042,75061..75114,75157..75225,
FT                   75244..75312,75355..75414)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2355 by TMHMM2.0 at aa 21-43, 47-69, 76-98, 102-124,
FT                   129-151, 192-214, 221-238, 253-275, 282-304 and 319-338"
FT   misc_feature    74872..74904
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(join(75521..76570,76574..77002))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BB2356"
FT                   /product="putative GntR-family transcriptional regulator
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2599"
FT   misc_feature    complement(75860..75895)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   misc_feature    complement(76763..76942)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 5.7e-11"
FT   misc_feature    complement(76811..76885)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(76817..76882)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1295.000, SD 3.60 at aa 41-62, sequence
FT                   PSTRALAAELGVSRTTVTAVYE"
FT   CDS_pept        77083..77706
FT                   /transl_table=11
FT                   /locus_tag="BB2357"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2598"
FT                   /db_xref="GOA:A0A0H3LN70"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN70"
FT                   /protein_id="CAE32852.1"
FT                   /translation="MYLPAHFAETRPEELARIIRAHPLGMLVTQDAQGLDADHLPFEFD
FT                   PDAGPHGTLIAHVARANTLWQRCPDGSAVMVVFRGAEGYISPNWYPSKHEAHRQVPTWN
FT                   YEVVHAHGTLAVRDDERFVRGVVARLTRRHEAGESRPWKMTDSTPEYIDSMLRNIVGIE
FT                   VAITSLVGKRKLSQNKDERDRLGAVQALQARGQDALAQSMARAE"
FT   CDS_pept        77737..78348
FT                   /transl_table=11
FT                   /locus_tag="BB2358"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2597"
FT                   /db_xref="GOA:A0A0H3LV45"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV45"
FT                   /protein_id="CAE32853.1"
FT                   /translation="MSLLAFLLAAALLAITPGPGIAYVVARTVAGGRAEGLASCLGTAL
FT                   GGLVHVLAAALGLSVLIAESALAFSLLKYAGAAYLVYLGLRMWLSPRPAAVRVVAPQGA
FT                   RRALAEGVLVEALNVKTALFFLAFLPQFVDPGAPLAPQLALLGGICVTLNTLVDVMAVV
FT                   AAHRLLRSEAARVARARVLTRVSGTTMVGLGVFLALARRD"
FT   misc_feature    77737..77802
FT                   /note="Signal peptide predicted for BB2358 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.905 between residues 22 and 23"
FT   misc_feature    join(77746..77814,77851..77919,77947..78006,78067..78135,
FT                   78163..78231,78277..78336)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2358 by TMHMM2.0 at aa 4-26, 39-61, 71-90, 111-133,
FT                   143-165 and 181-200"
FT   misc_feature    77932..78243
FT                   /note="HMMPfam hit to PF01810, DE LysE type translocator,
FT                   score 2.5e-07"
FT   CDS_pept        78384..78854
FT                   /transl_table=11
FT                   /locus_tag="BB2359"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2596"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLZ4"
FT                   /protein_id="CAE32854.1"
FT                   /translation="MADKRTEGSGKGGAKAAGKGGLGEVVLLSGGNPQIAKGYGDAPVQ
FT                   AYIAAMPGWKRAVGERLDAIVERTVPGVYKAVKWNSPFYGFEGEGWFLSFHCMTKYIKV
FT                   AFFRGASLQPLPPGASKQKDVRYLDIYEDAPFDEARFADWVAQASRLPGERM"
FT   CDS_pept        79029..80285
FT                   /transl_table=11
FT                   /locus_tag="BB2360"
FT                   /product="putative peptidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2595"
FT                   /db_xref="GOA:A0A0H3LM03"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM03"
FT                   /protein_id="CAE32855.1"
FT                   /translation="MSKQAMLDAIEAEREVLIGFLQEFVRAASPNPPGDTRAAAAVIQG
FT                   FLSARGVPNELLGPQESMPNVVSECEGGRAGPRLVYNGHMDVFPVGDGHGWTRDPWSGD
FT                   IEEGRLHGRGTCDMKTGTAASVIAYAYLYARRAQLAGSVALTAVSDEETGGRWGTRWLL
FT                   ENDTRWRGDCVLNGEPSSLDTIRFSEKGTLRLKFEVLAAGAHGAYVHRSESPTRIAAAL
FT                   IGRLAEVEAIEPSLPAALKAHLQREDVRRALDVAMGEGAADVVTRTTLNVGVLNGGLKI
FT                   NMIPDRCVFEVDIRLPVGTEPDVVLARLEGILAEFPQASMEVQQWHSTPPNVCAHDHPM
FT                   VDFIADNAQAIVGRRPVAVPSIGSTDCRYWRRSGVPAYVYGPAPGRMAMSNESVDLDEF
FT                   IAVAKVHAAAGWDYLNGAA"
FT   misc_feature    79089..80120
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 1.5e-60"
FT   CDS_pept        80322..81836
FT                   /transl_table=11
FT                   /locus_tag="BB2361"
FT                   /product="ABC transport protein, solute binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2594"
FT                   /db_xref="GOA:A0A0H3LSM2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSM2"
FT                   /protein_id="CAE32856.1"
FT                   /translation="MMSKTGKMAAALAALCLSVGLAGAARAESTLQVALSTSLNSLDPN
FT                   VTTLGEEYVFNGLVFGGLTRIDANSKVVPDLAVSWTPSADLREWTFKLRPGVKFHHGKP
FT                   LTASDVVFSFQRIVDPATGSPGRTQLEVMKSVDAPDDATVHFTLTQPYADFPGLLTGRQ
FT                   LRVVAQDRIDTIKTQPSGTGPFRFVRYTPGDQLELERNPDYYDKDRIKIDRVVMRVMPE
FT                   AAARVAALRSGSIDMIWNLPLETIPDLKKDAAVVVDSVPSASWDGIVLNNSKPPFNDVR
FT                   VRRAVFLALDKKELVNFALFGEGSPTHSPIAPTDPAFNKDIGFAPDLAQAKQLLAEAGY
FT                   AKGFAVDIFVPAGRPSRERLGVAAQQLLRPLGIKLNVQRVPYNRYSAGVAGIAPMYVDG
FT                   FFASPVIDAATSPWFYSTGSWNARMWHFSSKRVDQALDAARASTDRAEQIRHYQDFQRA
FT                   LTEEVPGVIGYVTNVATAYRADIKNYHTNPFLWLDLYDVEKTGGAR"
FT   misc_feature    80322..80402
FT                   /note="Signal peptide predicted for BB2361 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.916 between residues 27 and 28"
FT   misc_feature    80343..81818
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 4.7e-72"
FT   misc_feature    81750..81800
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        81840..82799
FT                   /transl_table=11
FT                   /locus_tag="BB2362"
FT                   /product="ABC transport protein inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2593"
FT                   /db_xref="GOA:A0A0H3LN74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN74"
FT                   /protein_id="CAE32857.1"
FT                   /translation="MWAYLVRRLGHVVFVVAAMAVLIFLITQAMPGNVAYTIAGHFASP
FT                   EQVAAIEARLGLNDPLWTQFWRWAGAALHGDMGQSLVMGRPVGPLISEALGRSALLAVA
FT                   ALVLTAALGIFLGVVAAVRHGRWQDRLILAFSWLSISLPQFLIAIVLVLLVAGTLGWLP
FT                   ATGYVELSAGFGAWLSHLVMPVCTLVLGLVAHVTSLQRSSMLETLSAPYVRAARAKGLR
FT                   ERTVLYRHALRNALIPTVTVLALDFGILMGGIVVVETVFSYPGLGRLLIFAVEQKDLPV
FT                   LQAGVLAVTVIYALANLAADIAYAILDPRIRYGNLDTH"
FT   misc_feature    81840..81926
FT                   /note="Signal peptide predicted for BB2362 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.903) with cleavage site
FT                   probability 0.836 between residues 29 and 30"
FT   misc_feature    join(81864..81932,82137..82205,82242..82310,82353..82421,
FT                   82542..82610,82692..82760)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2362 by TMHMM2.0 at aa 9-31, 100-122, 135-157, 172-194,
FT                   235-257 and 285-307"
FT   misc_feature    82449..82682
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.9e-06"
FT   misc_feature    82452..82538
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        82828..83631
FT                   /transl_table=11
FT                   /locus_tag="BB2363"
FT                   /product="ABC transport protein inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2592"
FT                   /db_xref="GOA:A0A0H3LV49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV49"
FT                   /protein_id="CAE32858.1"
FT                   /translation="MALVVGTLMLAAIVLVSLGAPWLAQYDFDAMDAAARMLPPSPQHW
FT                   LGTDEFGRDVFSRVLYGGTTSILLGVSATALSFVVGVPLGLLAGYLRGWIDDAVMRTVD
FT                   IVISVPPVMLGLLILASTEPSLWKAALAVGIIYTPIMIRLARGMTLSLANEEFITAARA
FT                   RGEGLAWILLREILPNALPPLVVEASLRVSFAILLGAVFSFLGLGTQPPSSDWGLMVAE
FT                   ARPYLERAPWVALSPGLAICLTVIAVNLMGEGLRKRLDARGEQRN"
FT   misc_feature    82828..82884
FT                   /note="Signal peptide predicted for BB2363 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.927) with cleavage site
FT                   probability 0.886 between residues 19 and 20"
FT   misc_feature    join(82831..82899,83032..83100,83119..83187,83215..83268,
FT                   83389..83457,83515..83583)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2363 by TMHMM2.0 at aa 2-24, 69-91, 98-120, 130-147,
FT                   188-210 and 230-252"
FT   misc_feature    83272..83502
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.0062"
FT   CDS_pept        83633..85267
FT                   /transl_table=11
FT                   /locus_tag="BB2364"
FT                   /product="ABC transport protein, ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2591"
FT                   /db_xref="GOA:A0A0H3LLZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LLZ9"
FT                   /protein_id="CAE32859.1"
FT                   /translation="MHQDTILNIKGLEVRYGRNQVLHGVDLELPRGASLGIVGESGSGK
FT                   STIAWTVLGLLPPGAAVTAGSVAFDGEDITGERAAGLRGDRIAMVFQDPFTALNPSLPV
FT                   GRQITEALVERGRADARSARAEALRLMDEVRLPRASTLLDAYPHQLSGGMKQRIVIATA
FT                   LACSPDLLLLDEPTTALDVTVEARILDLLDELRVQRGLSMVFISHNIGLVERMCSRVTV
FT                   MHGGRVQEAGAAQQVLWHPAHAYTRKLLAALPLLEKRAPAVPAVGAPIARVRDVRLTFR
FT                   PAHPLGGWARLLRLPRAEGVAALAGVSLELRPREVVGLVGESGSGKSTLGRCLVGLQAP
FT                   DAGTVELSDHDVYRASPEVARRLRRQSQMVFQNPDSSLNPRQRVGEVLRRPLQLMGLDR
FT                   RQQDRRMDELLDLVRLPAAYAERYPHQLSGGEKQRVGIARTLALEPSVLVCDEATSALD
FT                   VSVQASILELLKDLRDRLGVAMLFISHDLAVVSQISDRVVVMRHGAIVEQGRTDQVLSA
FT                   PAHEYTRLLLDSVPAFVARRAREAAVA"
FT   misc_feature    83726..84310
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.9e-57"
FT   misc_feature    83747..83770
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    84080..84124
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    84572..85141
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   3.2e-63"
FT   misc_feature    84593..84616
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    84911..84955
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        85351..86412
FT                   /transl_table=11
FT                   /locus_tag="BB2365"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2590"
FT                   /db_xref="GOA:A0A0H3LM04"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM04"
FT                   /protein_id="CAE32860.1"
FT                   /translation="MTTKATGNRKVVKIVDVAKAANVSPAVVSRILSNDSKLVVREETR
FT                   ARVQQAIEALGYTPNLQARGLRLSRSNTLAMIVPELNSPVFPVIIQGAQRAAWERGYSL
FT                   LVGGMGGEEEDPKVAGRLLRSNRIDGLLVTTGRHEAQMLQELATLNAPFVLVNRYLDDQ
FT                   HPYVELDERGAAAAITRHFIELGHRRIAFLGGLQRRVGERRVAGYADALAEAGLPWVPQ
FT                   LVVDAGYYKPGGEDGLRQLLALDEPPTAVVATNEIVAAGAMAAAHRQGVRIPRDLSIAS
FT                   FSDGIVAELLSPALTAVRFPLERMGYLATAMLVDIVEGRGAPQAGLCLPHESVVVRDST
FT                   ARPPGRKARAATR"
FT   misc_feature    85378..85461
FT                   /note="HMMPfam hit to PF00356, DE Bacterial regulatory
FT                   proteins, lacI family, score 2.1e-05"
FT   misc_feature    85384..85449
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1590.000, SD 4.60 at aa 12-33, sequence
FT                   VKIVDVAKAANVSPAVVSRILS"
FT   misc_feature    85561..86361
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   6.7e-23"
FT   CDS_pept        86884..87408
FT                   /transl_table=11
FT                   /locus_tag="BB2366"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2589"
FT                   /db_xref="GOA:A0A0H3LSM7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSM7"
FT                   /protein_id="CAE32861.1"
FT                   /translation="MEYLFTLKYQLADADSDLDALVERLGQAGCDDALVGMGLPGRLAL
FT                   EFTREADSAEAAVRSALADVRRAMPTAALIEAAPDLVGLTDVAQIVGVSRQNMRKLMLA
FT                   HPATFPAPIHEGSASLWHLADVLGWLQTRGGYPLAQATLDVARMALKVNVAKEARRLPR
FT                   SAGAGLDALVG"
FT   misc_feature    87127..87192
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1283.000, SD 3.56 at aa 82-103, sequence
FT                   VGLTDVAQIVGVSRQNMRKLML"
FT   CDS_pept        complement(87417..87908)
FT                   /transl_table=11
FT                   /locus_tag="BB2367"
FT                   /product="putative regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2588"
FT                   /db_xref="GOA:A0A0H3LN78"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN78"
FT                   /protein_id="CAE32862.1"
FT                   /translation="MKSTLSQWRSCMDIAEVARRTGVPASTLRYYDKVGLIASVSPPGA
FT                   RRRYAPAVLEQLALVALGQAGGLSLDDIRAMLSPQGAPRVDRQVLLAKAEEIDATVKQL
FT                   QAMSRGLRHAAACPAPSHAQCPTFKRLLKAAAAGALSRRRPASTGAAPRSPRKRAPARP
FT                   "
FT   misc_feature    complement(87762..87866)
FT                   /note="HMMPfam hit to PF00376, DE Bacterial regulatory
FT                   proteins, merR family, score 9.4e-07"
FT   misc_feature    complement(87810..87875)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1587.000, SD 4.59 at aa 12-33, sequence
FT                   MDIAEVARRTGVPASTLRYYDK"
FT   CDS_pept        87959..88453
FT                   /transl_table=11
FT                   /locus_tag="BB2368"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LV51"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV51"
FT                   /protein_id="CAE32863.1"
FT                   /translation="MAPQEMLARVVLVGMGATAVMDVWTMALRRLGVPVLDYALAGRWA
FT                   GHWRHGRFAHADIRQAPAVRGEAALGWGLHYATGVLFAGLLVGVAGQAWLRAPSPGPAL
FT                   AVGVATVLLPWFVMQPALGAGFASSRTPTPLRNCLRSVLAHAVFGLGLYLAGLALAWIG
FT                   R"
FT   misc_feature    join(87977..88042,88163..88231,88268..88336,88379..88447)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2368 by TMHMM2.0 at aa 7-28, 69-91, 104-126 and 141-163"
FT   CDS_pept        complement(88494..89648)
FT                   /transl_table=11
FT                   /locus_tag="BB2369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LM05"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM05"
FT                   /protein_id="CAE32864.1"
FT                   /translation="MTGALQGLRVLDMGQWIAAPYCTAMLADFGAEVIKIEKPGGGDDQ
FT                   RHSSPFVDGQSAFFNLFNRNKHSVTIDLSTPAGRAQCRDLIGSADVLVENYRPGVMARL
FT                   GLDYATLHAEFPRLVYCSISGFGQSGPMRGEGGFDLVIQAMSGLAAQCGPTDGPAHRLP
FT                   IPIVDVSTALFATIGVLTALAARQQTGTGQLVDVALLDSALAMAPLEVADYLATGHNPE
FT                   RMGQASRNAAPYQIFRTQDGAIALGAASQGLWEKTCDLLDRPALKNDPRFADNTARLAH
FT                   RAVLAELVEQALATQPSEHWLARLREAGIPAGPVLSYADILRHPQVAAREMVRRPETAG
FT                   AATAATLASPIRLSDTPARFVSGAPALGAHNGLLASGTRTGPPA"
FT   misc_feature    complement(88878..89444)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   1.5e-60"
FT   CDS_pept        complement(89645..90511)
FT                   /transl_table=11
FT                   /locus_tag="BB2370"
FT                   /product="putative (R)-specific enoyl-CoA hydratase"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM10"
FT                   /protein_id="CAE32865.1"
FT                   /translation="MNVQALLAHEFPVETQSYGARDCSLYALSAGYGQDPMDERQLQYV
FT                   YGDAPKTAGGMALVLANPGFWQRQPWTGIDWARCVLGEQRIATHRPLPAAGRIASQLRV
FT                   TRITDKGRQFGAMLHAERTLHDADNGTHYATLSMVTICRGDGGFGGPPDDSTRLPAVPA
FT                   RAPDIQTEQPTLPQQALLFDLHGIVNPVHSWPAAARQAGYPRPFLHGVCLMGLVQHAIA
FT                   RELAAYDTDGIATLSARFRGVFYPGETLLLSLWRDGDQVRYEAHAKERSTLAVEGSARL
FT                   QPAGAVQ"
FT   misc_feature    complement(89678..90043)
FT                   /note="HMMPfam hit to PF01575, DE MaoC like domain, score
FT                   1.5e-11"
FT   CDS_pept        complement(90525..91493)
FT                   /transl_table=11
FT                   /locus_tag="BB2371"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSN2"
FT                   /protein_id="CAE32866.1"
FT                   /translation="MFCRKLALALGMAVSALSAGAAAAPYPAEPVRLVVPYAPGGTTDL
FT                   LARLIASKLSAKYERQVVVENKTGAGGNIAAGFLARSRPDGYTLMMASIGQFAINPLIF
FT                   SAPGYDAAKDFQPVIQVTRVPNVLVVNAASKLDSLQDLIKLAQAQPGVTYASSGNGSSN
FT                   HLAGALLAHMANIDMLHIPYKGSAPGLQALYGGDVQVMFDNLSSALPHVQGGKLRALGV
FT                   SSETRFSKLPDVPTIAESGLPGYEASAWFGLVAPAGTPAAIVEQLNRDVAAVLADNDVR
FT                   SKLLEMGMTPQGGSVAQFQAVIDADIQKWKPIVQSLNLAVN"
FT   misc_feature    complement(90537..91358)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.1e-110"
FT   misc_feature    complement(91425..91493)
FT                   /note="Signal peptide predicted for BB2371 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.848 between residues 23 and 24"
FT   CDS_pept        complement(91519..92262)
FT                   /transl_table=11
FT                   /locus_tag="BB2372"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LN82"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN82"
FT                   /protein_id="CAE32867.1"
FT                   /translation="MATVKDDLLASGSNKRYVNLAHLLRMRIRAGDYRPGDRLPAIDQL
FT                   ARQFNTAVVTARQALALLERDGLVQRRQGVGTFVLDDAVAPVGLELPLDQDWSGIRALW
FT                   GASQVRILAERDRVECPPDYAQHGQPADAYFYMRRVHEAQGIPYTVADIYIDREVYRKA
FT                   PKRFRHEIALHVLPQLLPQRKLEAFEMIQVDAADVELAKWLDIAVGAPVVIMKRVVRDE
FT                   SGRIIYAGTPVYRGDIVRLDRTFKL"
FT   misc_feature    complement(92026..92205)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 3.6e-19"
FT   CDS_pept        complement(92444..93433)
FT                   /transl_table=11
FT                   /locus_tag="BB2373"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV54"
FT                   /protein_id="CAE32868.1"
FT                   /translation="MQPRLTALHSALAALALCLPAGQAHAQADAAYPARPITLIVPFSA
FT                   GGGSDVVARILATGLGSQLKQTVIVENRTGAAGNIGAEAVARARPDGYTLLFGSMGVMS
FT                   VNSHLYRNMPLQPERDLAPVGRIYDTPHVIVVGQQSTLKSLPQLIEQAKARPDALTYAS
FT                   AGNGTSTHLVGALFMHETGTRLMHVPYKGNAPALNDTMAGHVDMMFDQATNSTGQIQAA
FT                   RLRALAATSHARIPDLPDVPTVAELGYPELEVTSWTVLAAPKATPAATMATLSAALKKT
FT                   LAAPAIKEKIRQTGGVINYQDLPSTTEFVNRETARWGALIQSAGITAN"
FT   misc_feature    complement(92456..93280)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 9e-114"
FT   misc_feature    complement(93356..93433)
FT                   /note="Signal peptide predicted for BB2373 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 26 and 27"
FT   CDS_pept        complement(93469..94539)
FT                   /transl_table=11
FT                   /locus_tag="BB2374"
FT                   /product="putative malate/L-lactate dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LM09"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM09"
FT                   /protein_id="CAE32869.1"
FT                   /translation="MTISPAASHDELAGHLARCADTGAPCRLSADQLAALLARLFERAG
FT                   ASAATAAVLAQTCALAEQDEARSHGLHRVAGYVATLGTDWVDGHAEPAVIDASGATIIV
FT                   DARNGFAQCALRAARPLIEERVRQHGLAMLLTRNSHHFGALWLDVEPYARQQWIALTAV
FT                   NSISHMAPHGGTTPLYGTNPMAFACPRAGADPLVFDQASSVMAKGDVQLAAQHGHTLPP
FT                   DAGVDRHGQPTRDPAAVLDGGALLPFGGHKGSAIAMMVEVLAAALTGGSFSWEVDRSAH
FT                   PTAQTSRTGQFFLCIDPARSAGHGFAARIDQLAQALLRSGQQRLPGERRYAARRLAAQH
FT                   GIAIDPAALLALLRLA"
FT   misc_feature    complement(93475..94464)
FT                   /note="HMMPfam hit to PF02615, DE Malate/L-lactate
FT                   dehydrogenase, score 8.9e-51"
FT   CDS_pept        complement(94551..95741)
FT                   /transl_table=11
FT                   /locus_tag="BB2375"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /db_xref="GOA:A0A0H3LM14"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM14"
FT                   /protein_id="CAE32870.1"
FT                   /translation="MQAMNQPQVQQYDIVIIGGGIIGSSVAYHVLARDPAARVCVVEPD
FT                   PSYEFASALRSSGGCRVQFTCPENIAMSLYSLDVIKNFENTMAANGRPAPVDWVQGGYL
FT                   FLVPPERVAMLERNVARQQAMGCQVDLLTPAELKARFPSIHVDDLGAGAHTPQDGWCDP
FT                   NGLLWGFRRKAVELGAVYLKDRVVAADVTPARARRVTLESGAQLDAEAFVNAAGAWSGQ
FT                   VAELFGMHLPVVPMRRFEHYFTCGNPIEPLPYVKDLSRLAFRSEGRGFSGGLVNGDENR
FT                   GFNFDVDHDYFENVVWPAVAHRFPPLEAAKCHRTWSGLYEQNELDGNPVIGAWNARLKN
FT                   LYTVAGFSGHGMMHAPAAGRGIAELLVHGAFQSLDLSKLGYERVQANQPYREEGIL"
FT   misc_feature    complement(94629..95708)
FT                   /note="HMMPfam hit to PF01266, DE FAD dependent
FT                   oxidoreductase, score 0.0092"
FT   CDS_pept        95853..96647
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BB2376"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="GOA:A0A0H3LSN6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSN6"
FT                   /protein_id="CAE32871.1"
FT                   /translation="MRQALFLGYGRMGAALGEAWLRAGLLAGIDAVDPGRDGAGLRARL
FT                   VRGADELPEQAYDLVVLAVKPAMAQQALRAVPPARLARACLVSIMAGVPAGALRQALQP
FT                   PRPVARAMPNTPVMAGQGCTGLYGGDDVAPAQRAAIGRLFEAVGAAFWVDTEDQLHAVT
FT                   ALSGSGPAYYHLFSEALAQAGEQLGLPAALARSLAARTALGAASLQCEEGADFAALRRE
FT                   VTSPHGTTHAAIEVFEQAGALRTLVRDAVRQAQARSRELARP"
FT   misc_feature    95853..96587
FT                   /note="HMMPfam hit to PF01089, DE Delta
FT                   1-pyrroline-5-carboxylate reductase, score 8.6e-54"
FT   CDS_pept        complement(96663..97316)
FT                   /transl_table=11
FT                   /locus_tag="BB2377"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LN86"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN86"
FT                   /protein_id="CAE32872.1"
FT                   /translation="MTDANAGPLTLTADGVTDELRALILDGSLGIGVQLKQEVLAKRFG
FT                   VSRIPVREALKRLEAEGLVTHAPHQGSVVASRSVQELLETLDIRVGLESRALVLAIPHM
FT                   TPAVFKEAETIIARYDASEFPREWSELNLEFHMCLYRPSGRPRLLKTIENLVRGIDIHL
FT                   RAHQSYAVGRKSPQNEHRAILDACIAGKAKRARDLLEAHIEHTQDVLRKEHGLI"
FT   misc_feature    complement(97095..97271)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 2.7e-12"
FT   misc_feature    complement(97149..97214)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1446.000, SD 4.11 at aa 35-56, sequence
FT                   LKQEVLAKRFGVSRIPVREALK"
FT   CDS_pept        97536..98012
FT                   /transl_table=11
FT                   /locus_tag="BB2378"
FT                   /product="putative phage-related protein"
FT                   /db_xref="InterPro:IPR012596"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV59"
FT                   /protein_id="CAE32873.1"
FT                   /translation="MNSASRLNISSTSDDWRGLALSNFPLSPFVLDGELFASVEGFIQG
FT                   IKFREDDPRRATAFLSSGWDAKHLGDTADRSGAYWGGARIRYGSAEHHQLIERAIRARI
FT                   KQCEGLRRTLRATEGMTLVHDTGKPEAPHTSLPATVFCRILETLRREILARARP"
FT   CDS_pept        complement(98022..99509)
FT                   /transl_table=11
FT                   /locus_tag="BB2379"
FT                   /product="probable outer membrane efflux protein"
FT                   /db_xref="GOA:A0A0H3LM15"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM15"
FT                   /protein_id="CAE32874.1"
FT                   /translation="MHARLPLSALCIALACALAACAVGPDYQAPTPAAPADWTSWHGGP
FT                   PELAGHAGAAGAPAAQWWRSFGDPALDRLQARALAASPDLQSAALRYAQARTQRRTVAA
FT                   QRGPQVDAAAAVTRQRQSEDAAANRILDAIAPANRQAVTELLSDPYTLYQAGFDASWEL
FT                   DLWGRVRRAVEAADADVAASAALYDAARLSLVSEVARNYFELRTAQHQARLLRQDIAAL
FT                   QEQLSLIQARARGGLAADLDVARQRTQLAGLQAQLPRWLEQQAQAGNRLGLLLGARPGE
FT                   LGDELAAPEGDGPARPLPDYALGLPSELARRRPDIRAAEARLHQATARIGLAQADLYPS
FT                   IRLGARFGYESYESGKFGDWGSRTWSIGPSLDLPIFDSGRRRSVVTLRELQQQEAAVAY
FT                   QQTVLRAWHEVDDALSGYRAEQLQYARLREKAESAAQARAWAQARYLGGLTDYLAVLDA
FT                   QREDLQARRDLTASDGRLRTRLVVLYKALAGGAETQP"
FT   misc_feature    complement(98028..98606)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 9e-33"
FT   misc_feature    complement(98649..99299)
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 6.3e-22"
FT   misc_feature    complement(99444..99509)
FT                   /note="Signal peptide predicted for BB2379 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.629 between residues 22 and 23"
FT   misc_feature    complement(99462..99494)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(99524..100645)
FT                   /transl_table=11
FT                   /locus_tag="BB2380"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LM18"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM18"
FT                   /protein_id="CAE32875.1"
FT                   /translation="MLARLSAMLRRIAFLCRKETLAIVKDPANRVILIAPVLLQSLLFG
FT                   YGATYDLNHVPYALLDQSRGAGAVELAARIDGSGVFQRVATLRAPADIARVIDGGQALL
FT                   VIHLAADFDRRLAAGQDAPMQVVLDGRNSTTAGMAAGHLATLVAGYNAALPGVGAPPVR
FT                   VSTRAWFNPNLETRWNIMPGLIATLSMIQTLMLAALSVAREREQGTFDQLLVTPLNPLE
FT                   ILVGKAVPAILIGLAQSTLILLVTRYWFAIPLAGSPATLYLGLLLFTTASVGIGLSISA
FT                   LSANMQQAMVYTFVLMMPLILLSGLITPVGNMPEALQAATWANPLRFAVDLVRRVYLEG
FT                   AGVRDVAIDFLPMLAVAAVTLPLAAWLFRNRLV"
FT   misc_feature    complement(join(99542..99610,99713..99781,99800..99868,
FT                   99911..99979,100040..100108))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2380 by TMHMM2.0 at aa 180-202, 223-245, 260-282, 289-311
FT                   and 346-368"
FT   CDS_pept        complement(100652..101791)
FT                   /transl_table=11
FT                   /locus_tag="BB2381"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LSP1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSP1"
FT                   /protein_id="CAE32876.1"
FT                   /translation="MSPRAGAGGFWPRLASLVRKEFRQLLRDRSNLAIGLVLPILLILI
FT                   FGYGLSLDLRNAPIAVVLEDRSPQARDALAGLAGSDYLAPVWLADMHSAETLMRRHEVE
FT                   GIVRVPADFARRLAAGDAQVQLLLHGADANSAAALARYVDGALGHAARLRADRAGHAAP
FT                   PPGVTMVERLWFNAANTSTWYLVPGLIALIMTLVGAFLTALVVAREWERGTLEALFVTP
FT                   VRPTEILLAKMIPYFVVGMLGLGLCLAAARLLFHVPLQGSLAVLLLSAMLYLVVALGIG
FT                   LLISATTRNQFLASQVAVLSSFLPALMLSGFLFDLRNVPAAIRFVGSLLPATYFMELVK
FT                   TAFLAGDNWPLIARNCAILAVYAVALLALARRLTRKSLD"
FT   misc_feature    complement(join(100682..100741,100850..100918,
FT                   100937..101005,101042..101110,101171..101239,
FT                   101636..101704))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2381 by TMHMM2.0 at aa 30-52, 185-207, 228-250, 263-285,
FT                   292-314 and 351-370"
FT   CDS_pept        complement(101788..103548)
FT                   /transl_table=11
FT                   /locus_tag="BB2382"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A0A0H3LN92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN92"
FT                   /protein_id="CAE32877.1"
FT                   /translation="MNEAPVIEARDLAKRLGQTLALDALTLSVARGRLTALVGPDGAGK
FT                   TTLLRLIAGLMRPDAGTLRVLGIDAVQSPQAVQDRISYMPQRFGLYEDLSVQENLDLYA
FT                   DLHGVPARERRERYARLLAMTDLARFTERPAGKLSGGMKQKLGLACTLVRSPDLLLLDE
FT                   PTVGVDPLSRRELWQIVQQLVEQTRLSVLVSTAYLDEAQHCAQVHVLYRGTLLAQGAPQ
FT                   ALREPAQGLCFLAAPPAGVPARTLQARLLDDSAQIIDAVPEGGAVRYIQRPDADPARLR
FT                   ALLGGAQAHATPARLEDGVQMLLRARLAADAPAATAAPRPVPPAPRASDAPDAAQPAIE
FT                   VHDLVRKFGAFTAVASTSFSVRRGEIFGLLGPNGAGKTTTFRMLCGLLPASSGQLRVAG
FT                   VNLRNAPARARRHIGYVSQKFALYGNLTVAENLAFFGGVYGLGGAALRRRIDAVLDEFG
FT                   LRGHAQARSGELPGGYQQRLAMATGLLHEPEILFLDEPTSGIDPLARRAFWRRITALAL
FT                   DGTTIIVTTHFMEEAEYCDRIAIQDAGRLLALGTPDAVRRQAGNAGDMNTAFIGIVEQA
FT                   RARQGRETRP"
FT   misc_feature    complement(101917..102459)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.3e-54"
FT   misc_feature    complement(102415..102438)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(102910..103455)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.5e-57"
FT   misc_feature    complement(103093..103137)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(103411..103434)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(103545..104558)
FT                   /transl_table=11
FT                   /locus_tag="BB2383"
FT                   /product="putative HlyD-family secretion protein"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV65"
FT                   /protein_id="CAE32878.1"
FT                   /translation="MKKPLIAAAAAIALAIAGAAWWLTRAQPPDDILTLYGNVDIRQVA
FT                   LAFDNSERIADMQVEEGDRVRAGQVLARQETRTLQLEAERAQARASAQEQALLRLRNGS
FT                   RPQEIAQARARADAATADAALAQQDLQRLQGTARATDGRAVSRQDIDRAAARLRVARAQ
FT                   AETQAKALQLALLGPRDEDIAEAAAQWQASLAELALLRHRLAQAELKAPTDAVVRARLL
FT                   EPGDMASPQRPVYTLALTEPKWVRAYLSEPDLGRVRPGMRARVYTDSQPDRAIDGQVGY
FT                   ISSVAEFTPKTVQTETLRTSLVYEIRIRVDDPQDRLRLGMPATVRLDLADAAEPGA"
FT   CDS_pept        104677..105324
FT                   /transl_table=11
FT                   /locus_tag="BB2384"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LM19"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM19"
FT                   /protein_id="CAE32879.1"
FT                   /translation="MTRPRRSLRADGASTRARILEAAGQLFGQYGYAGVASKAICAAAG
FT                   ADLAAINYHFGSRDGLYRAVLVEGHKHFINLDTLTALTQSDLSPREKLCAFIDGMVAGL
FT                   WEQDWHTRVCAREVLAPSAHFAALIDEEVLPKFRLVAGILGDITGFAPGDPALARCAVS
FT                   IVAPCMMLMVVDRNAPSPPQQVLAQPAADLAEHLKRFALAGLDAVSAAAPRR"
FT   misc_feature    104731..104871
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 4.8e-11"
FT   CDS_pept        105384..107144
FT                   /transl_table=11
FT                   /locus_tag="BB2385"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM23"
FT                   /protein_id="CAE32880.1"
FT                   /translation="MAKEAYTVGPVLSFRGVGGARQWRVSALIGVPRTAKAPALRVEGR
FT                   ACAAPVVLHQTARETFLRYDLSCDMQARERKVEFGPRGGPAWHFTVPAKGAAPRLAYVS
FT                   CNGFSDPSGMRKLVRPENAVWADLLCNHDRDLRPADYLLDKEQLWHETRTHDEGLQRFH
FT                   LLLMGGDQIYFDSIWEDIAALKQWVGLARAQQLEFKVSQALEDEIEAYYFGLYSRRWLP
FT                   PSRAPWAGAQPSLDAADAMARVPTIMMWDDHDIFDGWGSYSPAMQRCELFQTLFRHARR
FT                   AFWVFQMQHALADLPPLQAIARANVLPQDPQYEGIAWSRQLKRDRLALPLLDGQPGFTS
FT                   AYRLGPLALVAADLRTERSRTQILGTQAWTALQGWLHGLKGNRPASATGGCRHLIFMSS
FT                   VPVAHPKLSLAEGLLDTFGQDHVLDSNADDLKDHWSHDDHEGERKRLLETLMQVANEKL
FT                   LRVSIASGDVHVAAWGNAYRRDIPPTSNWAQIQQFTSSAVVHPSLLGVAERLFLFMLNG
FT                   TAAQAQPIDVNLSVEMMLFPGHNRYVMPARNWLAFELDAGKAGKLWASWRCETETGFSN
FT                   HLQAVQPAQG"
FT   misc_feature    106542..106574
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   CDS_pept        complement(107145..107990)
FT                   /transl_table=11
FT                   /locus_tag="BB2386"
FT                   /product="putative aldo/keto reductase-family protein"
FT                   /db_xref="GOA:A0A0H3LSP5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSP5"
FT                   /protein_id="CAE32881.1"
FT                   /translation="MKQHRFGATDRMVAAIGQGTWNLDNSARASAVDALRNGLDLGMAH
FT                   IDTAEMYGAGAAERLVGEAIAGRRDQVFLVSKVLPENASRAGTRAACERSLRRLGTDHL
FT                   DCYLLHWRGAHPLEETFAAFDALQREGKIRSYGVSNFDVDDLQETLDIVGPGKLACNQV
FT                   LYHLRERAIEHAVMPWCAAHGVAVVAYSPFGHDDFPAPASAGGRVLARIAQAHGATPRQ
FT                   IALAFLTRQPGVFAIPKAADPAHVAANAAAGRLALSEQDCADLDAAFERGPRPASLPMI
FT                   "
FT   misc_feature    complement(107175..107975)
FT                   /note="HMMPfam hit to PF00248, DE Aldo/keto reductase
FT                   family, score 6e-64"
FT   CDS_pept        complement(108033..109901)
FT                   /transl_table=11
FT                   /locus_tag="BB2387"
FT                   /product="putative sigma-54-dependent transcriptional
FT                   regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2158"
FT                   /db_xref="GOA:A0A0H3LN95"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN95"
FT                   /protein_id="CAE32882.1"
FT                   /translation="MPGYQLSASGQHLPSTQAAAPIVRSWERCASATADLHDDPVALRH
FT                   GDLQERLEQHACVLRAAQPEIETLAGMVASASSLVLLADASGVILQASGNTGFLQRADH
FT                   VALRPGVSWAENHRGTNAIGTALIEAAALRVHGAEHFLRRNQILSCHAAPIRSPRGDIL
FT                   GVLDISGDAGRMHAYALSLASMCARQVANRVIEQAGERCLYLVFHKQASLLDSVERGLL
FT                   LIEDERIVGANDAAVALLGATWPALLDQPLDGWLVDWRAVARTPGRVHTPQGAPFHAVL
FT                   RQGGHARSLPAPPRPPRAVPAQAPEETLPALAPALQAGFERARRALDGGLSVLLQGETG
FT                   AGKEVYAQHLYRRSIWRDGPFVAVNCGALPESLIEAELFGYEPGAYTGARRLGARGRLR
FT                   EADGGVLFLDEIGDMPLALQTRLLRALQERMVQPLGADKAVPVNFGLVSATHRDLDAMI
FT                   AAGEFRADLYYRLHDYAVPLPRLRERDDLRPFICAALRALDDTPAGLTLADDALDALAA
FT                   YAWPGNYRQLRSVLRTLALFHPPGSLIHRHHLPAAIAAPAVHAADGAAPRPGVAAPPAA
FT                   PATLRDASLHRIDQALARHGGNIAGAAHELGIHRSTLYRHLARQRG"
FT   misc_feature    complement(108042..108164)
FT                   /note="HMMPfam hit to PF02954, DE Bacterial regulatory
FT                   protein, Fis family, score 3.5e-10"
FT   misc_feature    complement(108048..108113)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1941.000, SD 5.80 at aa 597-618, sequence
FT                   GNIAGAAHELGIHRSTLYRHLA"
FT   misc_feature    complement(108318..108977)
FT                   /note="HMMPfam hit to PF00158, DE Sigma-54 interaction
FT                   domain, score 5.1e-86"
FT   misc_feature    complement(108864..108905)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   CDS_pept        110159..111688
FT                   /transl_table=11
FT                   /gene="acoD"
FT                   /locus_tag="BB2388"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2157"
FT                   /db_xref="GOA:A0A0H3LV77"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV77"
FT                   /protein_id="CAE32883.1"
FT                   /translation="MDLSDLKKLGLDVAYPFKEQYENYIGGQWVPPVGAEYFDNLSPIT
FT                   GQPFCRVPRSGAADIELALDAAHRARAAWARTSPAERANILLRIADRIEGQLPMLAVAE
FT                   SIDNGKPLRETTAADLPLAIDHFRYFAGCIRAQEGAISEIDANTVAYHFHEPIGVVGQI
FT                   IPWNFPLLMAAWKLAPALAAGCVVVLKPAEQTPASILVLAELIGDLLPPGVLNVVNGYG
FT                   KEAGQALATSKRIAKIAFTGSTPVGKHILHAAADNLIPATVELGGKSPNIFFDDVMDHD
FT                   DEFLDKALEGLAMFALNQGEVCTCPSRILIQESIYERFIEKAIARVQSIKTGHPLDAGT
FT                   MVGAQVSQVQMDKILSYIDIGRQEGAQCLTGGARNDMLPGGLDQGFYVQPTMLLGKNSM
FT                   RIFQEEIFGPVAAVATFKDEEEAIAMANDTFYGLGAGVWSRDGARAYRVGRGIEAGRVW
FT                   TNCYHLYPAHAAFGGYKQSGIGRETHKAALSNYQQTKCLLVSYSAKALGFF"
FT   misc_feature    110240..111661
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 1.9e-227"
FT   misc_feature    110945..110968
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    111044..111079
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        complement(111825..112475)
FT                   /transl_table=11
FT                   /locus_tag="BB2389"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2156"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM24"
FT                   /protein_id="CAE32884.1"
FT                   /translation="MDSSQVPNPVLVLVGSPRRDGNSALLAQAVAEGARQSGAAATLLF
FT                   LDDYIAGFLTDEKEADARRPDDRYGELFFDHFLPARAVVLCTPVYWYGMSAQAKAFFDR
FT                   SFTYYSASHPRHAEVLRRMTGKRLALAVSSEETYPGAALGIVHQLQEFTRYTHSQFVGM
FT                   VHGAGNRRGEVAHDPRRPLQAAHRLGHGLLSLPYSDYRIDSPRDHQVWPGAPA"
FT   misc_feature    complement(111894..112454)
FT                   /note="HMMPfam hit to PF02525, DE Flavodoxin-like fold,
FT                   score 2.6e-06"
FT   CDS_pept        112607..113533
FT                   /transl_table=11
FT                   /locus_tag="BB2390"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2154"
FT                   /db_xref="GOA:A0A0H3LM28"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM28"
FT                   /protein_id="CAE32885.1"
FT                   /translation="MFHDLPLGALRAFEAAARLLSFKGAAAELHVTPTAVSHQIRALEQ
FT                   RLGFALFERLPRGVLLTPKGGRLFQRVHGMLLDLAQTLDALRPRPSTGGLTVSTTHSFA
FT                   ALWLVPRLGRFYQAHPGYEVRLDATSRLVDLLQDASVDVAIRYGGGDRSGRHRGLQAAA
FT                   VLPERFAVYGAPAAVASAARRRPALISVQWRDSTVYETGWRQWCEAAGVSWLARAAPRS
FT                   YEEENYALQAAIAGQGLVLASSAMVSDSEARGLLACFRPDISVPGLRYTALSAPGRQRH
FT                   PPVRAFLDWLAGEFETAAARGRPGLAP"
FT   misc_feature    112625..112804
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1e-21"
FT   misc_feature    112664..112729
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1608.000, SD 4.66 at aa 20-41, sequence
FT                   LSFKGAAAELHVTPTAVSHQIR"
FT   misc_feature    112667..112759
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    112868..113494
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 4.1e-25"
FT   CDS_pept        113530..114825
FT                   /transl_table=11
FT                   /locus_tag="BB2391"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2153"
FT                   /db_xref="GOA:A0A0H3LSQ0"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSQ0"
FT                   /protein_id="CAE32886.1"
FT                   /translation="MSAPADPRLAQLRRMQRWALALLAAMIAGFVASHLMGGQGAWAWV
FT                   RAFCEAATVGALADWFAVVALFRRPLGLPIPHTAIIPANKARIGDNLAVFVRDHFLDPA
FT                   TLLEKLRVFDPAARLGHWLADPRQTRSLGQGARQVALQALDLLDEQAVSRAIQGFAVAQ
FT                   LRRWDAARTAGEVLALLTRDGRHQELLDAALRRLGDYLGEEDIRQRACALLVKFARKEW
FT                   PRIIAAVDVIGSVEGIADNLADRMARALVDELRDVLSRPDHPVRRNYEAWVADYIARLR
FT                   DDPELAGQVEALKQRLIDDPRVQEYALGLWRDIHAVLRRDLQAEDSALARHLEDALQAL
FT                   GQRLSRDPELRRAVNEHVLDSARKLTDSLRSGVTEHISRTVKNWDERHLVRELELSVGR
FT                   DLQYIRFNGTLVGGLIGLALHAGVLLVQRAGG"
FT   misc_feature    113530..113658
FT                   /note="Signal peptide predicted for BB2391 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.964) with cleavage site
FT                   probability 0.379 between residues 43 and 44"
FT   CDS_pept        complement(114847..115731)
FT                   /transl_table=11
FT                   /locus_tag="BB2392"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2152"
FT                   /db_xref="GOA:A0A0H3LN98"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN98"
FT                   /protein_id="CAE32887.1"
FT                   /translation="MSRNIDTALLRAFLAVHDTGSLTAAAALLHLTQGAVSQQLQRLEA
FT                   LFGRTLLERRRSGAALTGDGARLLGRAREMVRINDELMQHMTGAGCVGAVRLGVPHDLI
FT                   GTHLPGLLRAYSLRYPDVDISLISATSPELLEQVRRRKLDLTLAEEPIGAAAGGERLAV
FT                   DRVVWLAAPGGQAWRKNPLPVSLVSDACAFRPVLADALDGGRIPWRSVFENGNADATLT
FT                   TVRLDLAVTASLLSVAPADLQVLDAASGLPALPDYAINLYIAPGERSQAVEEMARHIRQ
FT                   AYQERRPAYAAAA"
FT   misc_feature    complement(114880..115470)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.2e-20"
FT   misc_feature    complement(115534..115713)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.2e-16"
FT   misc_feature    complement(115579..115671)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(115609..115674)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1825.000, SD 5.40 at aa 20-41, sequence
FT                   GSLTAAAALLHLTQGAVSQQLQ"
FT   misc_feature    complement(115654..115731)
FT                   /note="Signal peptide predicted for BB2392 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.880) with cleavage site
FT                   probability 0.495 between residues 26 and 27"
FT   CDS_pept        115830..116705
FT                   /transl_table=11
FT                   /locus_tag="BB2393"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2151"
FT                   /db_xref="GOA:A0A0H3LV83"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV83"
FT                   /protein_id="CAE32888.1"
FT                   /translation="MQTTTSLIASVRRIAAFSDGARGGNPAGVHVAEVLPDAMTMQQMA
FT                   AEIGYSETVFAAPAYGGWRVRYFAPEAEVPFCGHATIALGAVLAEQEGDGVFALTTNHA
FT                   NITVEGRRQGGLYSAALQSPRTRSAPLEAAVRDEALALFGYTPADLDSRLPPAYAEAGA
FT                   AHLILPLNSRERLAAMRYDLAAGRAFMKRTGVVTIAWVHAESATLLHARNAFAAGGVYE
FT                   DPATGAAAAALAGHLRDSGWLRAGAIEILQGFDMGVPARLRAEYGPEPGSSVRVAGTAR
FT                   ALARQPALID"
FT   misc_feature    115851..116696
FT                   /note="HMMPfam hit to PF02567, DE Phenazine
FT                   biosynthesis-like protein, score 2.7e-41"
FT   CDS_pept        complement(116695..117051)
FT                   /transl_table=11
FT                   /locus_tag="BB2394"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2150"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM29"
FT                   /protein_id="CAE32889.1"
FT                   /translation="MDQYVDGFLLSVPNDKLDTYRQMATKAGAIWKEHGALAYCECTGD
FT                   DLDIEGMVSFKTSAAAREGETVVFAWIVYPNRAERDRINAAVMADPRLKEQCVEGVFDF
FT                   KRMAYGGFKTLVNL"
FT   CDS_pept        117125..118156
FT                   /transl_table=11
FT                   /locus_tag="BB2395"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2149"
FT                   /db_xref="GOA:A0A0H3LM32"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM32"
FT                   /protein_id="CAE32890.1"
FT                   /translation="MPTGDCDIVAGGSRQAGRSMLGAMKRLALLVPERANIASLENARQ
FT                   GFLAANGFLRERGCAPRFDVRLVAATPQVRLDHGRITVQADTVLEAVGEVDLCVVPPIQ
FT                   GDPQPALQENGALIDWLAGYYKNGGEVASLCVGAALLAAGGVLDGQRAVVHWAAQSDFG
FT                   RLFPAVRWVSDRVVLEANGIYTSGGAFSAAHLVLHLVDKYTDRETAIWCAKLFQLDWSR
FT                   QSQLPFVVFVGQKTHGDGVVRQVQEHIEANYTERLTVEQLAQRVALGRRTLERRFRHAT
FT                   GNSIVEYVQRIRIEAAKKQLESSRKSVAEVMYEVGYNDTKAFRDIFNKYCGMSPLMYKE
FT                   RYL"
FT   misc_feature    117197..117736
FT                   /note="HMMPfam hit to PF01965, DE DJ-1/PfpI family, score
FT                   0.012"
FT   misc_feature    117857..117994
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 3.1e-05"
FT   misc_feature    117893..117958
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1340.000, SD 3.75 at aa 257-278, sequence
FT                   LTVEQLAQRVALGRRTLERRFR"
FT   misc_feature    118013..118144
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.00026"
FT   CDS_pept        complement(118329..118508)
FT                   /transl_table=11
FT                   /locus_tag="BB2396"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2148"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSQ5"
FT                   /protein_id="CAE32891.1"
FT                   /translation="MPAKSKAQQMAAGAALAAKRGESRVSDLKGASRDMYDSMSERELE
FT                   HMAGTARKGKPYHK"
FT   CDS_pept        118606..119130
FT                   /transl_table=11
FT                   /locus_tag="BB2398"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2147"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA0"
FT                   /protein_id="CAE32892.1"
FT                   /translation="MQCPAFPGRFLRSSRMQISRHFPRLVRRAALALCLAGAAQVHAQE
FT                   AAVQRKSDYPFAATVARLQDALRAKGMTIFAVIDHQAAAKQAGLDMPPTQVVVYGNPKA
FT                   GTPLMLAAPDFALELPLKVLVRETASGEVLVVYHPAGTREGMLGLPAGMAQQLAGAERI
FT                   VDAAVRRAPAD"
FT   misc_feature    118606..118734
FT                   /note="Signal peptide predicted for BB2398 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 43 and 44"
FT   misc_feature    118744..119109
FT                   /note="HMMPfam hit to PF03625, DE Domain of unknown
FT                   function DUF302, score 7.1e-26"
FT   CDS_pept        complement(119141..119977)
FT                   /transl_table=11
FT                   /locus_tag="BB2399"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2146"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV86"
FT                   /protein_id="CAE32893.1"
FT                   /translation="MTPPARSSAAVPAQYADVHYADRPMRIEYALLAPERRDAPLLVFL
FT                   HEGLGSLAMWRDWPRRVCDAAGCRGLVYSRYGYGRSTVRPLDESRPIDYLHQQAAQALP
FT                   ALFAALGIDARRDKPVLFGHSDGASIALLYAALCPDAVAGIAVAAPHIYVEDITVANIA
FT                   VALRAYRETTLRDRLARYHDDVDSTFASWTDTWLDPAFRQWNIEAYLPAITCPVLAMQG
FT                   VDDEYGTLEQIRGIRRLAPQTRLLEIQDCGHSPHKDQPELVTRALAGFVGALPRPA"
FT   misc_feature    complement(119165..119776)
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 2.9e-10"
FT   CDS_pept        120090..120461
FT                   /transl_table=11
FT                   /locus_tag="BB2400"
FT                   /product="putative ArsR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2145"
FT                   /db_xref="GOA:A0A0H3LM34"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM34"
FT                   /protein_id="CAE32894.1"
FT                   /translation="MVEYQAPALDRVFHALSDPTRRAMLRRLADGEHNIRALAAPFAMS
FT                   FTAASKHLKVLESAGLVSRRVQGRSHLCRIDAAPLAAIDEWLKFYERFWHTRLDMLETL
FT                   LRADAASSVPSHPDQDPTP"
FT   misc_feature    120126..120359
FT                   /note="HMMPfam hit to PF01022, DE Bacterial regulatory
FT                   protein, arsR family, score 2.1e-13"
FT   misc_feature    120186..120251
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1024.000, SD 2.67 at aa 33-54, sequence
FT                   HNIRALAAPFAMSFTAASKHLK"
FT   CDS_pept        120458..121009
FT                   /transl_table=11
FT                   /locus_tag="BB2401"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2144"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM36"
FT                   /protein_id="CAE32895.1"
FT                   /translation="MTSPSSASPDGHGARLDAQSIRFERLLPGPIERVWAWLADADKRA
FT                   RWLAGGELPRQPGQTFELHFNHAALTAETAPARYAQYDRPIVARHTLLRCEPPRVLALT
FT                   WGGGAGEAPSEVLFELSEAGEQVRLVLTHTRLADRAAMLDVAGGWHAHLAVLAGKLAGQ
FT                   APPPFWTTLAQAEQDYEQRL"
FT   CDS_pept        complement(121025..122716)
FT                   /transl_table=11
FT                   /locus_tag="BB2402"
FT                   /product="putative sulfate transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2143"
FT                   /db_xref="GOA:A0A0H3LSR0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSR0"
FT                   /protein_id="CAE32896.1"
FT                   /translation="MPHSVACLDLRVIALLEAKRAGLLRRAHWLPNIVSGLIVGVVALP
FT                   LAMAFAIASGAKPEQGLYTAIVAGLLVSLCGGSRVQIAGPTGAFIVILAGITAQHGVAG
FT                   LQLATLMAGCILLALGAARLGAIIKYIPAPVIVGFTAGIGVIIWVGQWKDFFGLPSPAG
FT                   THFHEKLWQLVHSLPQLHLATTALAALSLALLLANNRLPYLRRVPGPLVALVVATTLQA
FT                   VLGLDGVATIGSAFGGIPQGLPSWQWPEITVSRVIELIGPAFAIAMLGAIESLLSAVVA
FT                   DGMAGTRHDSNQELVGQGLANIVAPLFGGFAATGAIARTATNIRNGGTSPLAGVVHCIT
FT                   LLLMVLLLAPLAENVPLAALAAILFVVAWNMSDAPHFVRMIKRAPRADVAILLVTFVLT
FT                   VFADLVVAVNIGVVIAILHFLRRMASSVQVQAQSPAELGDELGHRGYGPLPDDVLVYAV
FT                   EGPLFFGAAENFERALAATHTDPRTLIIRLRWVPFIDITGLQALEEVITDLQRRGVRVI
FT                   LSGANPRVKAKLHRAGLVGLAGADNVFDRFEDAVLSCRAPAAPATA"
FT   misc_feature    complement(121067..121399)
FT                   /note="HMMPfam hit to PF01740, DE STAS domain, score
FT                   2.2e-20"
FT   misc_feature    complement(121448..122362)
FT                   /note="HMMPfam hit to PF00916, DE Sulfate transporter
FT                   family, score 1.4e-89"
FT   misc_feature    complement(join(121478..121546,121583..121651,
FT                   121661..121729,121763..121831,121874..121942,
FT                   122126..122179,122270..122338,122357..122425,
FT                   122468..122536,122555..122623))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2402 by TMHMM2.0 at aa 32-54, 61-83, 98-120, 127-149,
FT                   180-197, 259-281, 296-318, 330-352, 356-378 and 391-413"
FT   CDS_pept        complement(122765..123445)
FT                   /transl_table=11
FT                   /locus_tag="BB2403"
FT                   /product="putative gntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2142"
FT                   /db_xref="GOA:A0A0H3LNA2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA2"
FT                   /protein_id="CAE32897.1"
FT                   /translation="MRSSTDLSAEGISQAIATAIVSHRLPPGTRLREEALASVYKVSRT
FT                   KIRAALLMLSKDKLIQIVPDKGAFVSKPDAHEAREVYAVRRILEAALAREFVACAAPQD
FT                   YERLEQHLHQEREAIHEGDVQRRNQLLAGFHLQLAEIVGNSVLTAMLHELLARTAVITV
FT                   MYQSAHDASCSSQEHYAFLAAAREGDAERACALMDEHLLHLQTALDFDGAPAPNRDLVA
FT                   ALLS"
FT   misc_feature    complement(123236..123412)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 4.7e-08"
FT   CDS_pept        complement(123694..124152)
FT                   /transl_table=11
FT                   /locus_tag="BB2404"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV90"
FT                   /protein_id="CAE32898.1"
FT                   /translation="MHTRARHATSPLPAMPTSLPARAYALPLILPLLLAACSDAVQTQY
FT                   RDLDEARAAGAIQRGWLPAWLPARTGAIAEAHDLDTNRRAARFVLPDGARIEPPGCAPA
FT                   SGRLPPPALALPGWPASLHQEGAAGRYRLYRCADGYAAFDASHGYLWN"
FT   misc_feature    complement(124042..124074)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(124084..124152)
FT                   /note="Signal peptide predicted for BB2404 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.976) with cleavage site
FT                   probability 0.707 between residues 23 and 24"
FT   CDS_pept        124322..125251
FT                   /transl_table=11
FT                   /locus_tag="BB2405"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2140"
FT                   /db_xref="GOA:A0A0H3LM39"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="PDB:5TSA"
FT                   /db_xref="PDB:5TSB"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM39"
FT                   /protein_id="CAE32899.1"
FT                   /translation="MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIV
FT                   NALTGENRVHVGYAVLGGAAGFAATALGALMALGLRAISARTQDAMLGFAAGMMLAASA
FT                   FSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPEAAR
FT                   VNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAV
FT                   GLPIGRAVLVAVASGLMEPLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPET
FT                   HRNGHETTATVGLMAGFALMMFLDTALG"
FT   misc_feature    join(124382..124450,124493..124561,124595..124663,
FT                   124691..124759,124820..124888,124997..125065,
FT                   125084..125143,125186..125245)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2405 by TMHMM2.0 at aa 21-43, 58-80, 92-114, 124-146,
FT                   167-189, 226-248, 255-274 and 289-308"
FT   misc_feature    124805..125236
FT                   /note="HMMPfam hit to PF02535, DE ZIP Zinc transporter,
FT                   score 2e-29"
FT   CDS_pept        complement(125264..125911)
FT                   /transl_table=11
FT                   /locus_tag="BB2406"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2139"
FT                   /db_xref="GOA:A0A0H3LM40"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM40"
FT                   /protein_id="CAE32900.1"
FT                   /translation="MPFLRAPLRAHRAVREQDMKSRRLQLAGVALMMAAACGQAVAGGG
FT                   HHGHHGYYGGYGHSHGSSSDGWWIAGALALVAAGTYLAVSSQPSYAPAAQYSAGGITYT
FT                   TPGGYAASPYDSTVYDPPSYDPPTAYEDAGYAPAGHGQPAYDDGTVAGYPVAPQGAGIA
FT                   RTATRQPAGEAACRREAMNQSGYDPATPSAWTTGVSVDSYQRALSACLAGRG"
FT   misc_feature    complement(join(125657..125716,125774..125842))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2406 by TMHMM2.0 at aa 24-46 and 66-85"
FT   misc_feature    complement(125786..125911)
FT                   /note="Signal peptide predicted for BB2406 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.979 between residues 42 and 43"
FT   misc_feature    complement(125801..125833)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(125985..127802)
FT                   /transl_table=11
FT                   /locus_tag="BB2407"
FT                   /product="putative ABC-transporter membrane-spanning
FT                   ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2138"
FT                   /db_xref="GOA:A0A0H3LSR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSR5"
FT                   /protein_id="CAE32901.1"
FT                   /translation="MRMLWTYLRPHGGLALLALLLAAASQVLALIDPIIFGRIIDEYAI
FT                   GRAGKTGDQLLAGVLGLLALALAVAILSRLAKALQEYVTRLVVQKLGTQIFNDGLRQVM
FT                   RLRFQEFEELRSGETLSLLQKVRSDSERFINAFINTAFAAGVGVAFLCWYSVTRHWLLV
FT                   PVFFVGVLLLGGLTGLLSRQIRSQQRSIMRETNRNSGFITESLRNIELIKSLGLTYPEI
FT                   RRLQAQTQQIFALEMQKVKRIRLLSFLQGMILSVLKLSVLFALLWLILRDVLSTGELIA
FT                   MQFISVAIFAPLQELGNLILAYREADASLNHYAALMARPVERNPESAQDSGPIQRVRFG
FT                   EVRFRHQGATENALDGVSFEARLGDTVAFVGPSGSGKSTLVKLLVGLYAPDHGEVYYND
FT                   VSTRDLRFNPTRRQIGFVTQETHLFSGTLRENMQLVKPDVTDEEIVAAMRQASCANVLA
FT                   RSPAGLDTTIGEGGVKLSGGERQRLSIARALVRQPRLLIFDEATSALDSLTEEQITQTI
FT                   RDVSRRAGQITILIAHRLSTIMHADTIFVLEKGRVVEQGSHAELLAGKGLYYAMWRQQI
FT                   GERPAVRAPEPQSEPDTAGGGPEAGVSLL"
FT   misc_feature    complement(126153..126713)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.9e-54"
FT   misc_feature    complement(126336..126380)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(126669..126692)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(join(126900..126968,126996..127064,
FT                   127257..127325,127338..127406,127575..127643,
FT                   127701..127769))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2407 by TMHMM2.0 at aa 12-34, 54-76, 133-155, 160-182,
FT                   247-269 and 279-301"
FT   misc_feature    complement(126924..127760)
FT                   /note="HMMPfam hit to PF00664, DE ABC transporter
FT                   transmembrane region, score 9.7e-11"
FT   misc_feature    complement(127650..127673)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(127716..127802)
FT                   /note="Signal peptide predicted for BB2407 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 29 and 30"
FT   CDS_pept        complement(127886..128437)
FT                   /transl_table=11
FT                   /locus_tag="BB2408"
FT                   /product="putative acetyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2136"
FT                   /db_xref="GOA:A0A0H3LNA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA3"
FT                   /protein_id="CAE32902.1"
FT                   /translation="MPSAPATPSVAVRRAQAPDAALLPAIERSAGQRFLDAPGLAWIAA
FT                   DEVMSEQDHRAWIAAGTSWVAECPGAGLAGFLVAERTADALHVWELAVRREMQGRGIGG
FT                   RLVRAAIDAAAAAGLPAITLTTFRDLPWNQPFYARLGFATLQADGLNVRLQAILAREAS
FT                   LGLPAARRCAMRREIAAARR"
FT   misc_feature    complement(128009..128245)
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 3.4e-13"
FT   CDS_pept        128492..128686
FT                   /transl_table=11
FT                   /locus_tag="BB2409"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LV94"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV94"
FT                   /protein_id="CAE32903.1"
FT                   /translation="MRLLLAIFLPFTVFFTIGRPIAGIICLLLQITLIGWIPAALWAVY
FT                   ALSQFHTDRKIRDAVGGRG"
FT   misc_feature    128552..128620
FT                   /note="1 probable transmembrane helix predicted for BB2409
FT                   by TMHMM2.0 at aa 21-43"
FT   CDS_pept        complement(128705..129052)
FT                   /transl_table=11
FT                   /locus_tag="BB2410"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2134"
FT                   /db_xref="GOA:A0A0H3LM44"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM44"
FT                   /protein_id="CAE32904.1"
FT                   /translation="MHYHGSCHCGTIRFDVEGELTGAMSCNCSICRRKGALLWFVPRDH
FT                   LRLATPDEQIATYTFNRHLIKHRFCPTCGIHTHGEGVDQQGRAMAAINIRCLDDVDLDA
FT                   VAVHQYDGRAA"
FT   CDS_pept        complement(129081..130520)
FT                   /transl_table=11
FT                   /locus_tag="BB2411"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2133"
FT                   /db_xref="GOA:A0A0H3LM45"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM45"
FT                   /protein_id="CAE32905.1"
FT                   /translation="MPHTLDERKRWLALMVLCLGVLMIVLDTTIVNVALPSIKADLGFT
FT                   EASLVWVVNAYMLTFGGFLLLGGRLGDLLGQRRMFLAGLTLFTLASLACGMAQGQAMLV
FT                   AARAVQGLGGAVVSAVALSLIMTLFTEPAERARAMGVYGFVCAGGGSIGVLLGGLLTSS
FT                   LSWHWIFLVNLPIGALVYALCLPLLPASQGPTGHPRLDLAGAAAITASLMLAVYAVVNG
FT                   NEAGWTSPQSLGLLALAVALLALFLRIEARVPAPLMPLSLFALRNVATANIVGVLWAAA
FT                   MFAWFFISALYMQLVLGYTAMQVGLGFLPANIIMAAFSLGLSARLVMRFGIRAPLVCGL
FT                   LVAALGLALFARAPVAGSFAVDVLPGMLLLGLGAGIAFNPVLLAAMSDVDPSEAGLASG
FT                   VVNTSFMMGGALGLAVLASLAAGRSASLRAGGADVLTALNGGYHAAFAVGAVFAALAAL
FT                   LAGVLLRRPQPGASAPAADAH"
FT   misc_feature    complement(join(129132..129200,129258..129326,
FT                   129363..129431,129468..129536,129555..129623,
FT                   129651..129719,129780..129848,129861..129917,
FT                   129951..130019,130032..130100,130134..130202,
FT                   130215..130283,130317..130376,130419..130487))
FT                   /note="14 probable transmembrane helices predicted for
FT                   BB2411 by TMHMM2.0 at aa 12-34, 49-68, 80-102, 107-129,
FT                   141-163, 168-190, 202-220, 225-247, 268-290, 300-322,
FT                   329-351, 364-386, 399-421 and 441-463"
FT   misc_feature    complement(130422..130520)
FT                   /note="Signal peptide predicted for BB2411 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.777) with cleavage site
FT                   probability 0.512 between residues 33 and 34"
FT   CDS_pept        complement(130539..130958)
FT                   /transl_table=11
FT                   /locus_tag="BB2412"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2132"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSR9"
FT                   /protein_id="CAE32906.1"
FT                   /translation="MPQISAYLMFDGDCAEAMRLYERILGGKLDALITYGESPPEMPCE
FT                   PQDRDLIMHARLRLDDQLLMASDSNSQCPYEGKKGFSLSLVYPTVSDAQRIFNALAEGG
FT                   QVTMPLQKTFWAEIFGVLVDRHGTAWMISGGQMNS"
FT   CDS_pept        131109..131717
FT                   /transl_table=11
FT                   /locus_tag="BB2413"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2131"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA5"
FT                   /protein_id="CAE32907.1"
FT                   /translation="MAEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVV
FT                   VLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGL
FT                   WTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVA
FT                   DRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAADGHA"
FT   misc_feature    131115..131702
FT                   /note="HMMPfam hit to PF02190, DE ATP-dependent protease La
FT                   (LON) domain, score 0.014"
FT   CDS_pept        131730..132548
FT                   /transl_table=11
FT                   /locus_tag="BB2414"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV98"
FT                   /protein_id="CAE32908.1"
FT                   /translation="MTGTMTIRIDEELRAYIDPLTPDEYAALEQSLLAEGCRDALVLWG
FT                   DLLVDGHNRHAICSKHGIAFNTVQNTRLQSMDDVRLWMIDNHLGRRSVSDFQRGVLALR
FT                   KKEILESRRQAGEGDAAPAGGDGPAPLTRQTLARQARLSSATLGQIEKIRQQAAPELVR
FT                   AVQSGEISINAAAAVATLPAPQQAAAAAGGRGELRAAARQVREARLPVRRAPEAEPAPA
FT                   AEPRVVDDYPAEVARLDRLVAQLAEERDALKKKVVQLTVALAEARAKPGD"
FT   misc_feature    132120..132185
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1279.000, SD 3.54 at aa 131-152, sequence
FT                   LTRQTLARQARLSSATLGQIEK"
FT   CDS_pept        complement(132500..133474)
FT                   /transl_table=11
FT                   /locus_tag="BB2415"
FT                   /product="putative araC-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2129"
FT                   /db_xref="GOA:A0A0H3LM49"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM49"
FT                   /protein_id="CAE32909.1"
FT                   /translation="MSALPDSPSASPPPRHDELASLIERHTPADGSTATALPGLNFYRS
FT                   SSPTELNVSFYRPSLALLAQGAKRVQLGDDVYEYDTSHYLLTSFDLPVASRVTLATPGT
FT                   PYLCFALDLDPHRIAGLISELGAPPAGQPLRRGLTLARLTEPLLDAVLRLARLLDTPAD
FT                   IPVLAPLIEREIHYRLLSGPMGGRLRHIARAEGTALQIARAIDWLRRHYAQPLRVEHLA
FT                   TTVNMSVSSLHHHFKAVTALSPLQYQKQLRLHEARRLMVAETLDAGAAAHRVGYESASQ
FT                   FSREYSRLYGAPPLRDAARLRGTAPADAQSPGLARASASATVS"
FT   misc_feature    complement(132578..132709)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.71"
FT   misc_feature    complement(132728..132865)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 2.6e-07"
FT   misc_feature    complement(132743..132877)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(132764..132829)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1390.000, SD 3.92 at aa 216-237, sequence
FT                   LRVEHLATTVNMSVSSLHHHFK"
FT   CDS_pept        complement(133503..134564)
FT                   /transl_table=11
FT                   /locus_tag="BB2416"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2128"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM50"
FT                   /protein_id="CAE32910.1"
FT                   /translation="MRSIAMQAADLYVLQTAQSWLDAGQAAVLLTVARTWGSSPRPPGA
FT                   MMAIRADGAVAGSVSGGCIEDDLIDQIRQRGIAALCPGARPALATYGVDGEQARRFGLP
FT                   CGGTLQLVLEPLGAHSRLADLLARLRAHQTVRRSVRLADGAVTLEPAAADAEPRLDGAG
FT                   FASVLGPRHRLLVVGAGQLSRYLCEMAIALDFDVTVSDPRQEYRAGWQVEGVALTTAMP
FT                   DDMVIAARPDARTAVIALTHDPKLDDLALIDALQTPAFYVGALGSRANHARRVARLREH
FT                   FGLTPAQLARLRGPAGIYIGSRTPPEIALSIMAEIVAGKNGAPLPPAASVAAGKARQPG
FT                   GAGVIQAGLCATL"
FT   misc_feature    complement(133590..134513)
FT                   /note="HMMPfam hit to PF02625, DE Uncharacterized BCR,
FT                   COG1975, score 2e-22"
FT   CDS_pept        complement(134561..136774)
FT                   /transl_table=11
FT                   /locus_tag="BB2417"
FT                   /product="putative exported oxidoreductase subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2127"
FT                   /db_xref="GOA:A0A0H3LSS4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSS4"
FT                   /protein_id="CAE32911.1"
FT                   /translation="MRIAIQNLSRRRFVQGAGGLLLGLSLPPLARRAMAAGPQAGDGFA
FT                   ANAFVRIGADGRITVLAKHLEMGQGAYTGLATLLAEELDADWRQVRVEGAPADSARYGN
FT                   QALGGLQGTGGSTAMFDSWEPMRRAGATARAMLVQAAAQRWQVPADTIEVAEGVLSHPA
FT                   SGRRAGFGELAEAAARSPVPEDVPLKDPARFRLIGKHRLPRVDSAAKSDGSALYTQDMK
FT                   LPGMLVAVVAHAPRLGAAVARVDDAAARAVPGVRAVVRFGGAALRHAGVAVLATNTWAA
FT                   RAGRDALRIEWDEGPAYRQGSADILARYREAVGRPGSMAARKGDIDAAFAGAAKVIEAE
FT                   YTYPYLAHAAMEPLNCLVRLDDERCEIWNGEQFQTADQRAIAQYLGMPAERITLTQLYA
FT                   GGSFGRRASSHADYLLEAVAIARTARAQGLNAPVKLVWMREDDMRAGYYRPLNLHRARL
FT                   ALGADGALQAVHVRMAGQSILLGTPLADWVRDGVDPVSVEGLSDLAYAVPNLQVELHTP
FT                   TDVPVPVLWYRSVGHTHTAFSAETLIDEAAVAAGQDPVAYRLALLAAHPRHREVLQLAA
FT                   ARAGWREPLAAGAPGTRRGRGVAVHESFRSVVAQVVEVTIAADGALKVDRVVCAVHCGL
FT                   AVNPDVVRAQMEGGIGFALSTALHGAITLKDGAVEQSNFHDYPVLRLAEMPAVEVHIAP
FT                   STQPPTGVGEPGVPPLAPALANAIAQATGQRLRTLPLGTTVKA"
FT   misc_feature    complement(134717..135868)
FT                   /note="HMMPfam hit to PF02738, DE Aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding domain, score
FT                   6.3e-08"
FT   misc_feature    complement(135884..136141)
FT                   /note="HMMPfam hit to PF01315, DE Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain, score
FT                   0.00062"
FT   misc_feature    complement(136670..136774)
FT                   /note="Signal peptide predicted for BB2417 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.980 between residues 35 and 36"
FT   CDS_pept        complement(136788..137246)
FT                   /transl_table=11
FT                   /locus_tag="BB2418"
FT                   /product="putative oxidoreductase subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2126"
FT                   /db_xref="GOA:A0A0H3LNA7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA7"
FT                   /protein_id="CAE32912.1"
FT                   /translation="MPTLNINGKDTVLDAPGEMPLLWALRDVADLTGTKYGCGMALCGA
FT                   CTVHADGQPIRACITPVQAVAGRRIVTIEGVAADRAGQAVQQAWRELDVAQCGYCQSGQ
FT                   IMSAAALLRANPAPTDRDIDDAMNGNICRCATYVRIRAAIHAAAAALA"
FT   misc_feature    complement(136809..137033)
FT                   /note="HMMPfam hit to PF01799, DE [2Fe-2S] binding domain,
FT                   score 4.5e-34"
FT   misc_feature    complement(137055..137237)
FT                   /note="HMMPfam hit to PF00111, DE 2Fe-2S iron-sulfur
FT                   cluster binding domain, score 6.4e-09"
FT   misc_feature    complement(137109..137135)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        complement(137404..137748)
FT                   /transl_table=11
FT                   /locus_tag="BB2419"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2125A"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVA2"
FT                   /protein_id="CAE32913.1"
FT                   /translation="MIWKLIPIALLAGLTACASGTRTDSSPPASSQTSSSAAPGSATTP
FT                   SGPDCDAQPVQNLVGQKYSDSVGNDALRRSNSGSMRLLKPGQVMTMEYNARRLNIILEG
FT                   NGSISALRCG"
FT   misc_feature    complement(137656..137748)
FT                   /note="Signal peptide predicted for BB2419 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.728 between residues 31 and 32"
FT   CDS_pept        137941..138810
FT                   /transl_table=11
FT                   /locus_tag="BB2420"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2125"
FT                   /db_xref="GOA:A0A0H3LM54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM54"
FT                   /protein_id="CAE32914.1"
FT                   /translation="MAEARSFAAAGRRLGLSASTVTRAVAALEARLGILLLVRTTRHVR
FT                   LTDAGEQFAHDCRAVLDSLAQAEEAAAGGRVQPRGELSVTAPTLFGELHVMPAIVDYLR
FT                   QHRRVRLRALLVDRVVRLLDEGVDVAVRIGRLPDSSLTAIHVGDVRRIVCAAPDFLARA
FT                   GVPSHPDMLPRYCTVSVVMEGQMDRWRFVCDGHARDLDVQAQLTVTSSQAAVRAAVQGW
FT                   GLAQVVSYQAAGALREGALQVVLREFEPPPLPVHVVYPEGRKGAAKVRSFVEFCVERLR
FT                   AELAELPA"
FT   misc_feature    137944..138093
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.9e-11"
FT   misc_feature    137953..138018
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1663.000, SD 4.85 at aa 5-26, sequence
FT                   RSFAAAGRRLGLSASTVTRAVA"
FT   misc_feature    137956..138048
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    138163..138783
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 8.1e-37"
FT   CDS_pept        138897..139910
FT                   /transl_table=11
FT                   /locus_tag="BB2421"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2124"
FT                   /db_xref="GOA:A0A0H3LM55"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM55"
FT                   /protein_id="CAE32915.1"
FT                   /translation="MEVVRYDIPGALMSDSLVFHTDLPGLADGPWHGGELAMQERAGAR
FT                   ERMAQLGPRVIRDYMPQQHRDFFAQLPFMLLATVDAQGDPWASVLEGPPGFAHSPDERT
FT                   LRLDAWPAGDDPARAGLAHGAGVGMLGIELSTRRRNRVNGHVAALDGQGFCVAVTQSFG
FT                   NCPQYIQTRHARQAAPAPQPARWLAGLDAAARTLVGQADTLFVASYARQAGPHAVDVSH
FT                   RGGPPGFVHLRGDTLTMPDFSGNRFFNTLGNLLANPRAGLVFVDFARGDLLQLCGRAEV
FT                   LAEAWAPAAYPGAQRLWRVHVERAVRRPAALGLRAGFGEYAAQLAAVGQWAGEPPA"
FT   CDS_pept        complement(139918..141036)
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="BB2422"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Phe-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2123"
FT                   /db_xref="GOA:A0A0H3LSS9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSS9"
FT                   /protein_id="CAE32916.1"
FT                   /translation="MTRIDDPLHDREAGQADATQDTTRIDDVRIGAVRPLISPALLQDE
FT                   LPVSAPLQALVEDSRARIADVLHGRDDRLVVVVGPCSIHDHEQAMEYARQLKEAADTLA
FT                   DDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRRARHLLLEIGALGLPIATE
FT                   FLDLLSPQYIADLIAWGAIGARTTESPSHRQLASGLSCPLGFKNGTDGGIQVAADAIVA
FT                   ASAPHAFMGMTKMGTAAIFETRGNDDTHVILRGGKQGPNYDAAAIDACCAALAKAGLRE
FT                   QVMVDCSHANSNKSHARQVDVARDLARQLAGGDRRIIGIMIESNLEEGRQDLKPGVPLK
FT                   RGVSITDACLSWAQTEPVLAELAQAVRQRREG"
FT   misc_feature    complement(139936..140916)
FT                   /note="HMMPfam hit to PF00793, DE DAHP synthetase I family,
FT                   score 3.8e-149"
FT   CDS_pept        complement(141158..141802)
FT                   /transl_table=11
FT                   /locus_tag="BB2423"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2122"
FT                   /db_xref="GOA:A0A0H3LNA9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA9"
FT                   /protein_id="CAE32917.1"
FT                   /translation="MRAAMPEPTQLLAFALICLGMTLTPGPNMMYLVSRSLSQGYRAGL
FT                   VSLAGVALGLVFYVLCAVLGITALLMAVPLAYEALCVAGAIYLMYMAWQALRPGGQSPF
FT                   QVRALAPSPPRRLFAMGLFTALLNPKIAVLYLSLLPQFIDPQQGSVLTQSLALGFTQVG
FT                   ISICVNALFTVMAGAIAVFLARRPMWMVAQRWLMGSVLAGLAVRMALDARR"
FT   misc_feature    complement(141245..141583)
FT                   /note="HMMPfam hit to PF01810, DE LysE type translocator,
FT                   score 8.5e-08"
FT   misc_feature    complement(join(141251..141319,141386..141454,
FT                   141527..141595,141605..141673,141707..141775))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2423 by TMHMM2.0 at aa 10-32, 44-66, 70-92, 117-139 and
FT                   162-184"
FT   CDS_pept        complement(142004..143356)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BB2424"
FT                   /product="putative glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2120"
FT                   /db_xref="GOA:A0A0H3LVA7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVA7"
FT                   /protein_id="CAE32918.1"
FT                   /translation="MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNV
FT                   GCVPKKLLVYGAHFHEDFEQAAGFGWNPGRPEFDWPTLIANKNREIERLNGIYRNLLVN
FT                   SGVALHEGHARIVDPHTVEINGQRHSAQHILVATGGWPFVPDIPGKEHAITSNDAFFLP
FT                   ELPRRVLVVGGGYIAVEFASIFNGLGAQTVQVYRRELFLRGFDGSVREHLRDELVKKGL
FT                   DLRFNTDVERIDKRADGVLAVTLSDGSVLETDCVFYATGRRAMLDDLGLENTGVRLAES
FT                   GYIEVDDEYRTSEPSILAIGDVIGRVPLTPVALAEGMAVARRLFRPQEYRKVDYDLIPT
FT                   AVFSLPNIGTVGLTTEQALERGFRVTRYESRFRPMKLTLTQSQEKTLMKLVVDADSQKV
FT                   LGCHMVGPDAGEIVQGLAVALKAGATKQVFDDTIGIHPTAAEEFVTMRTAT"
FT   misc_feature    complement(142016..142345)
FT                   /note="HMMPfam hit to PF02852, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 3.4e-46"
FT   misc_feature    complement(142421..143341)
FT                   /note="HMMPfam hit to PF00070, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.4e-91"
FT   misc_feature    complement(143210..143242)
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   CDS_pept        143531..143827
FT                   /transl_table=11
FT                   /locus_tag="BB2425"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2119"
FT                   /db_xref="GOA:A0A0H3LM60"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM60"
FT                   /protein_id="CAE32919.1"
FT                   /translation="MQNEDSFFGSLGAMLGAVIRAIVDGLRYVFGGLGRALGDFFGGLA
FT                   SALGMSPSVFNFALLVLGLLLLWTAVRAFMGRAIVAGIFWLVLAMLLLGGLIG"
FT   misc_feature    join(143549..143617,143675..143743,143762..143821)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB2425 by TMHMM2.0 at aa 7-29, 49-71 and 78-97"
FT   CDS_pept        143852..144229
FT                   /transl_table=11
FT                   /locus_tag="BB2426"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LM59"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM59"
FT                   /protein_id="CAE32920.1"
FT                   /translation="MLYRFLADLVLALHALFVAFAVLGGLLALRWPRLAWLHVPAALWG
FT                   AGIMLAGAVCPLTPLENHWRAQAGQQGYEDGFIAHYLLAAIYPEGLSRTAQTVLGALAL
FT                   AGNALVYAALWRRRRRGGIGR"
FT   misc_feature    143852..143923
FT                   /note="Signal peptide predicted for BB2426 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.658) with cleavage site
FT                   probability 0.338 between residues 24 and 25"
FT   misc_feature    join(143879..143938,143951..144019,144128..144196)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB2426 by TMHMM2.0 at aa 10-29, 34-56 and 93-115"
FT   CDS_pept        144270..144965
FT                   /transl_table=11
FT                   /locus_tag="BB2427"
FT                   /product="probable glutathione S-transferase"
FT                   /db_xref="GOA:A0A0H3LST4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LST4"
FT                   /protein_id="CAE32921.1"
FT                   /translation="MIDLYFWATPNGLKIKLFLEEAGLPYTEHPINIGKGEQFQREFLA
FT                   IAPNNRIPAIVDQAPAGGGAPISLFESGAILLYLAEKIGRFIPADVRGRAEVLQWLFWQ
FT                   MGGLGPMAGQNGHFNVYAPEKVPYAIERYTAETARLYDVMDRRLAEREFLAGEYSIADI
FT                   ACYPWVVPHEAHGQKMAHFPHLSRWFEAIAARPATARAYKEAGDSYRPKAPMSDEERAV
FT                   LFGQPGAPR"
FT   misc_feature    144270..144512
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 1.5e-10"
FT   misc_feature    144531..144857
FT                   /note="HMMPfam hit to PF00043, DE Glutathione
FT                   S-transferase, C-terminal domain, score 9.1e-10"
FT   CDS_pept        complement(144976..146457)
FT                   /transl_table=11
FT                   /locus_tag="BB2428"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LNB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB0"
FT                   /protein_id="CAE32922.1"
FT                   /translation="MIKSATNRLFDRAMDFAAILQQAPPAGARLPLQRQLLQRFKNAIL
FT                   DGRLAPGSRLPASRALAQQLGISRNTVLLAYEHLAAEGYVRADRQGTRVAGLARAGMPA
FT                   RASAASSAGPTARRLAALKASAPRTDTYLPLRPGTPALNHFPASAWRNALERALREAPA
FT                   ALLGYGEPAGEPRLRQAIAAYLAAARGVRCEARQIVITEGAQEGLALCVRLLGNAGDTA
FT                   WVEDPGYRGAKTALRCGDMRVVPVRVDAAGLLAPPQAWRDAPPRLIYVTPSHQYPTGAV
FT                   LPVTRRLALIEQARRAGAWIIEDDYDSEFRHQGEPIAAMQGLVPDAPVLYVGTYSKTMF
FT                   PSLRLGFVVLPTGLADEAAEALAEMLRGGHRHEQWALASFIESGQFTRHLNRMRRLYRE
FT                   RQQALRAALARHLRVPHEVLGGHCGLHLTLRLPAALDDRAIAAQALRLGMAPQALSGFA
FT                   IAPRPEDTGLVLGYGNTSAELFEPLIERLARLIQA"
FT   misc_feature    complement(146176..146352)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.5e-09"
FT   CDS_pept        146534..147244
FT                   /transl_table=11
FT                   /locus_tag="BB2429"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /db_xref="GOA:A0A0H3LVB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVB1"
FT                   /protein_id="CAE32923.1"
FT                   /translation="MSARVNEFGQPIGQAMPQWQARPRPPRDPAEGRYCRLEPLDAARH
FT                   GDDLYAAFAVPDAASGWTYLSAGPFADRAGYDEYLRKAADSADPLHHAVIDLASGRAIG
FT                   TLSLMRIDPANGVIEVGHVNFAPALRRSPASTEAQYLLMRRAFDELGYRRYEWKCDSLN
FT                   APSRAAALRLGFLFEGIFRQALVYKGRTRDTAWFSIIDSEWPALRAAFERWLAPENFDA
FT                   AGRQRKRLDACRQP"
FT   misc_feature    146813..147061
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 0.00034"
FT   CDS_pept        complement(147347..148273)
FT                   /transl_table=11
FT                   /locus_tag="BB2430"
FT                   /product="integral membrane protein"
FT                   /db_xref="GOA:A0A0H3LM65"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM65"
FT                   /protein_id="CAE32924.1"
FT                   /translation="MAAAAPLRRPLDGFATYVMLALCICWGFQQIAIKLVAADVSPTLQ
FT                   IGLRSAFAAVVLIWVVLRHEGLGALRDGTLGPGLAVGALFALEFLLVGVGLEYTTASHM
FT                   AVFLYTAPIFTALGLHLLLPDERLKPLQWLGVAVAFGGIATAFLGKGHAAVPGMLLGDL
FT                   LGVLAGAAWGATTVAIRKSSLSEAAPAKTLFYQMLMAGLALPAFHFASGGAAPVWSGAA
FT                   LASLGFQSVVVALSSYLAWFWLLRRYLATRLAVLSFMTPLFGVTFGVLILDEPLDSGFV
FT                   IGAVLVLAGITLVSGAELLREKLRRRT"
FT   misc_feature    complement(join(147374..147433,147461..147529,
FT                   147548..147616,147629..147697,147734..147802,
FT                   147830..147886,147905..147973,147986..148054,
FT                   148088..148147,148175..148237))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2430 by TMHMM2.0 at aa 13-33, 43-62, 74-96, 101-123,
FT                   130-148, 158-180, 193-215, 220-242, 249-271 and 281-300"
FT   misc_feature    complement(147386..147766)
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 2.5e-17"
FT   misc_feature    complement(147830..148204)
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 1.5e-13"
FT   CDS_pept        complement(148276..148611)
FT                   /transl_table=11
FT                   /locus_tag="BB2431"
FT                   /product="putative thioredoxin"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM64"
FT                   /protein_id="CAE32925.1"
FT                   /translation="MDQIELTDGTADRYLLDAPGLSLLVFHSRTCATCGVARQRLPEFD
FT                   LPVDRLCWIDAGENGGLVQRYEVFHLPALFVTRDGAYYGPVSAQLADWDLRQQISLALD
FT                   SYPAELP"
FT   misc_feature    complement(148489..148545)
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        complement(148669..149931)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BB2432"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="GOA:A0A0H3LST9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LST9"
FT                   /protein_id="CAE32926.1"
FT                   /translation="MTTTFPPLNAERLWSRVETLSRMTLPDVPWTRRAFSPLFEQSRQW
FT                   LRAEFEAAGLAVRLDAGGNLVGTRPGRDAARRPIATGSHCDTVMAGGRFDGIIGVLAGI
FT                   EVAHTLHEQGVTLEHPFEVIDFLSEEPSDYGISCVGSRALSGQLTPDMLAARNADGETL
FT                   AEGLRRIGGDPDALGAPLRGPGQTAAFVELHIEQGPVLESRGLPIGVVTNIVGIRRVLI
FT                   TVHGQPDHAGTTPMDIRRDALVGAARVIDAAHRRASTQSGKPHYVVATIGRIAMTPNAP
FT                   NAVPGMVELMLEVRSDSDAVLDAFPEAIMAEVADALAALRLSAAMAPVSRAHPTDCAPL
FT                   VMDAVEDAATRLGYASMRLPSGAGHDAVYMAPTGPIGMIFVPCLNGRSHCPEEWLEPSQ
FT                   LLDGTRVLYETVLELDRRLSR"
FT   misc_feature    complement(148840..149901)
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 3.4e-07"
FT   CDS_pept        complement(149961..151343)
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="BB2433"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="GOA:Q7WJR0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJR0"
FT                   /protein_id="CAE32927.1"
FT                   /translation="MPRSTARAAWKRELAATLALGLPLVLTNLAQMAMTVTDVIFIGRL
FT                   GSQALAASALGANLFTAIEFFGLGLVAATAPMVAHALGRRGNAVRDVRRTVRQGLWTAV
FT                   IYSVPGCLLLWHGEAILLAIDQPPELAAQAGAYLRALMWAMPPFLGFLVLRSFVAALQR
FT                   PRSAFLIALAAIVLNVFGNWVLVFGNLGAPALGLVGAGLASALATLGLFLGMVGVVCLD
FT                   RRFRRYHLFGDVWQPDWQRLAEFWKLGLPIGAATAFEVTIFNAAAFLMGWLGEPELAAH
FT                   AIAIQIASVTFMIPYGIAQAATVRVGHAYGARQPDQVARAGWCAFSLGIGSMAIAAALM
FT                   LLAPGLLVSAFLDIGDPANAQVLRLATAYLAVAALFQIVDGAQVLGAGMLRGLHDTRVP
FT                   MLYAALGYWGVGLPSGAALAFWAGWRGVGVWSGLAIGLALVAVLMMQRWLRRDRVGLLR
FT                   RA"
FT   misc_feature    complement(join(149997..150065,150078..150146,
FT                   150207..150260,150303..150371,150432..150500,
FT                   150528..150596,150684..150752,150780..150848,
FT                   150867..150935,150978..151046,151107..151175,
FT                   151218..151286))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2433 by TMHMM2.0 at aa 20-42, 57-79, 100-122, 137-159,
FT                   166-188, 198-220, 250-272, 282-304, 325-347, 362-379,
FT                   400-422 and 427-449"
FT   misc_feature    complement(150093..150596)
FT                   /note="HMMPfam hit to PF01554, DE Uncharacterized membrane
FT                   protein family UPF0013, score 2e-35"
FT   misc_feature    complement(150792..151280)
FT                   /note="HMMPfam hit to PF01554, DE Uncharacterized membrane
FT                   protein family UPF0013, score 1.2e-26"
FT   misc_feature    complement(151191..151343)
FT                   /note="Signal peptide predicted for BB2433 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.387 between residues 51 and 52"
FT   CDS_pept        151531..153387
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /gene_synonym="pck"
FT                   /locus_tag="BB2434"
FT                   /product="phosphoenolpyruvate carboxykinase [GTP]"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="GOA:Q7WJQ9"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJQ9"
FT                   /protein_id="CAE32928.1"
FT                   /translation="MNKPSEVKPVALNVPDYVKHSGLIAWVERIAALTKPDRVVWCDGS
FT                   QEEYDRLCEQMVQGGTMRRLNPAKRANSYLACSDPSDVARVEDRTFICSEREEDAGPTN
FT                   NWAAPQAMRETLGGLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIM
FT                   TRMGRKVFDVLGSDGAFVPCVHSVGMPLAEGQQDVAWPCNPTKYIVHYPETREIWSFGS
FT                   GYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPKGRKYHVAAAFPSACGKTN
FT                   FAMLIPPHGMDGWKVTTIGDDIAWIKPGPDGRLHAINPEAGYFGVAPGTSEKTNFNAMA
FT                   TLKANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQGQDWTPAIAAETGRKAAHPNARF
FT                   TAPAAQCPSIDPEWENPKGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFDHWLKLGRRLEETGATLPRIYCVNWFRKGP
FT                   DGKFVWPGFGENMRVLRWMLGRLDGQAGGVDQVFGISPAYGDIDWTGLEFSPDKFEQVI
FT                   SVDLPAWRAELALHDELFTQLAARLPEDLPLTRTAIERRMAA"
FT   misc_feature    151603..153381
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00821, DE Phosphoenolpyruvate
FT                   carboxykinase, score 0"
FT   misc_feature    152347..152373
FT                   /note="PS00505 Phosphoenolpyruvate carboxykinase (GTP)
FT                   signature."
FT   CDS_pept        153448..154071
FT                   /transl_table=11
FT                   /locus_tag="BB2435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB3"
FT                   /protein_id="CAE32929.1"
FT                   /translation="MTLTSDDLRQIAALTLAHYDDNAVSFEVGTRDHDVSQNIAALLRH
FT                   IQGDPPYAILDFGCGPGRDLKTFAALGHAAVGLDGAAHFVAMAHQATGCEVWQQDFLRL
FT                   ALPAGRFDGIFANASLFHVPTQELPRVLGELRDTLKPGGVLFCSNPRGGNEEGWSRGRY
FT                   GVWHDWESWRALLEAAGFQALEHYYRPAGLPREQQQWLASVWRR"
FT   CDS_pept        154125..154592
FT                   /transl_table=11
FT                   /locus_tag="BB2436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVB4"
FT                   /protein_id="CAE32930.1"
FT                   /translation="MPGVASLRAQQYYGHPRNAFWPIAAELFGLDAAQPYAHRVQALQR
FT                   AGVALWDVLQACERPGSLDAAIVADSVRPNDFQAFFAAHPGIACVGLNGAAAATLYRRH
FT                   VLPRLHGLAHLRYVALPSTSPAHAAMDFAAKLRAWRAIAPASSDPSACLSP"
FT   CDS_pept        complement(154725..155588)
FT                   /transl_table=11
FT                   /locus_tag="BB2437"
FT                   /product="putative exported protein"
FT                   /db_xref="GOA:A0A0H3LM69"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM69"
FT                   /protein_id="CAE32931.1"
FT                   /translation="MSQSLFAAGAQAALADSPLIVTVAPNGAYKTAADHPAVPLTAAAL
FT                   AAEARACLDAGAAMMHMHVRTPEGRHSLDVAAYREALAAVRQAVGEELLVQVTSEAAGV
FT                   YRAAEQMAMVRELRPEAVSMGLREIAVPEMPERELADFLAWVAAERIMAQIILYDAADV
FT                   ARWQALRARGLAPEGAWSVLFVLGRYSAGQVSSPRDLLPFLEVYDGSLPWAVCAFGREE
FT                   NACVATAAAFGGHMRVGFENNLKLSDGATAPGNAALVAQAAQAGRVLGRPIATAAQARE
FT                   IYGRLA"
FT   misc_feature    complement(155544..155588)
FT                   /note="Signal peptide predicted for BB2437 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.947) with cleavage site
FT                   probability 0.898 between residues 15 and 16"
FT   CDS_pept        complement(155585..156547)
FT                   /transl_table=11
FT                   /locus_tag="BB2438"
FT                   /product="probable 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="GOA:A0A0H3LM68"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM68"
FT                   /protein_id="CAE32932.1"
FT                   /translation="MSSPDSALGRPGASHAVVIGGGTMGADVAVVLARALCRTTVVEPD
FT                   AARAAALPRRAADNLAQAGRAEGAAHIAVVPGLDAVEWDSVGLVIECVPERLDIKQALF
FT                   AELARRAPAHAILASNSSSFPISAIGAGLPTRERMLGLHFFMPAHLVPLVEVVLCEASD
FT                   PACADVLIAFMRRCGMVPVRVAQDLPGFLANRLQHALSREAFDLIDRGIASPEDVDAAV
FT                   RFGFGFRFLAAGPVMQRDHAGIDVHAAAGATMYPTFCNADTPARCLTERAADGRHGMKA
FT                   GTGFYAWTPETIAAERARYDRLLRAGLDLLGAELPEIQP"
FT   misc_feature    complement(155684..155980)
FT                   /note="HMMPfam hit to PF00725, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 1.5e-18"
FT   misc_feature    complement(155984..156520)
FT                   /note="HMMPfam hit to PF02737, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain, score 5.9e-32"
FT   CDS_pept        156662..157663
FT                   /transl_table=11
FT                   /locus_tag="BB2439"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LSU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSU4"
FT                   /protein_id="CAE32933.1"
FT                   /translation="MKINLSMRDIETVLVLGRTLNFRQAAAQLHLSQSALSTQVLRIEE
FT                   ALGVRLFDRTTRTVRLTAAGEVFMQQAASLQVAFREAIDAVSGIASAEHGQVAVAALPS
FT                   LAARLLPRVLMAYRQAHPGVALKVHDTLSGPAFDLVRAGEVDFALTAADPQQADLHYVP
FT                   MMSDSFILLIPQDHALARGKGPLRWADTLAAPHVSMVHPSSVRQYAEWAFLQNRIRFQP
FT                   AFEAEHLATIVAMVECGFGVAALPEIAAAAVAHSGIVERPLTGPVAERSIGLVTSRNRT
FT                   LSPAAAALVAQLREHLAASAYKPAPAAPSARTTAARARSRETAPGSPGAPRR"
FT   misc_feature    156680..156859
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.5e-18"
FT   misc_feature    156719..156784
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1367.000, SD 3.84 at aa 20-41, sequence
FT                   LNFRQAAAQLHLSQSALSTQVL"
FT   misc_feature    156722..156814
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    156929..157555
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 4.4e-47"
FT   CDS_pept        complement(157587..158879)
FT                   /transl_table=11
FT                   /locus_tag="BB2440"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNB7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB7"
FT                   /protein_id="CAE32934.1"
FT                   /translation="MIESLSALGAMLALVFMRVPVAFAMALVGFVGLGLLRGWPPAYAM
FT                   AGSVIYESGFQYLLSVLPLFILMGNFVTESRMSRELYAAAHALLGHRRGGLAMSTIAAC
FT                   GGFGAICGSSLATAATMAKVAYPEMRRMGYSEKLAAGSIAAGGTLGVLIPPSIIMVVYC
FT                   LLTEQSIGKMFAAGVLPGVLAILCYMAAVAWVVRRDPAAGPRGPRSTWPHTLHALRQVW
FT                   MVLALIGMLLGGIYGGLFTPAEAAGVGAFLSFLFACSRRAMTWRRFLDVVVESAKTTGM
FT                   IFVVMIGALMLANFINFTSLPQDLLDVVARHQLSPLTVILAICVIYIVLGCVLESMSMI
FT                   LLTVPVFYPLVQSLGFDLIWFGVIVVVVTEISFITPPFGMNVFVLRGLLPGVSTPTIFR
FT                   GVMPFVVSDVVRLAILVLFPSISLLLPSYVR"
FT   misc_feature    complement(join(157593..157652,157740..157808,
FT                   157827..157931,157974..158042,158103..158207,
FT                   158292..158360,158385..158453,158532..158600,
FT                   158661..158720,158778..158846))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2440 by TMHMM2.0 at aa 12-34, 54-73, 94-116, 143-165,
FT                   174-196, 225-259, 280-302, 317-351, 358-380 and 410-429"
FT   misc_feature    complement(158001..158477)
FT                   /note="HMMPfam hit to PF00597, DE DedA family, score
FT                   0.0052"
FT   misc_feature    complement(158808..158879)
FT                   /note="Signal peptide predicted for BB2440 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.849 between residues 24 and 25"
FT   CDS_pept        complement(158872..159363)
FT                   /transl_table=11
FT                   /locus_tag="BB2441"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LVB8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVB8"
FT                   /protein_id="CAE32935.1"
FT                   /translation="MRILDRAVTALLRAIVVISLCGMSLLTVADATGRYLLNRPIMGTV
FT                   EMVELLMVAVIFASIPLVTRARGHITVDSFSHLFSPATLRAQDCVAGLLALTVSACLAW
FT                   VALRKAQSTADYGDMTPMLNIPLAPFVYAMAVLLALDAAYRLAALVGPAATQPEPTQDD
FT                   "
FT   misc_feature    complement(join(158932..159000,159043..159096,
FT                   159175..159243,159271..159339))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2441 by TMHMM2.0 at aa 9-31, 41-63, 90-107 and 122-144"
FT   misc_feature    complement(159277..159363)
FT                   /note="Signal peptide predicted for BB2441 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.982) with cleavage site
FT                   probability 0.885 between residues 29 and 30"
FT   CDS_pept        complement(159373..160404)
FT                   /transl_table=11
FT                   /locus_tag="BB2442"
FT                   /product="putative extracellular solute-binding protein"
FT                   /db_xref="GOA:A0A0H3LM73"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4P56"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM73"
FT                   /protein_id="CAE32936.1"
FT                   /translation="MMHKTLAAALFALGLAGTAPAIAQKPVELTLSSWLPPTHAVVADF
FT                   LMPWGEEIRKATDGRVTLRLLPKAVTNPAGHFDAVRDGLVDVTFVSHAYYPGRFQLTKF
FT                   AVLPFSGDTATSRSIAAWDTYEKYLLKADEHKGVRLLGIYAHGPGIAFTTSKPVKQIGD
FT                   FQGLKIRVGGGMAADVAKAVGASPIAKPAPESYELLSTGVADGVFFPAESLVSFKLDSI
FT                   IRHATEFPGGLYSDTHAVIINRDAFARLSKQDQDTLVRLSGRHLAELAGRAWDTHDAAA
FT                   RKVLEGGEIELVKADDALIEAVRERTKGFEQAWLDAAKAKGIDGPAALASFRAEIKQLD
FT                   QQR"
FT   misc_feature    complement(159442..160314)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 2.4e-19"
FT   misc_feature    complement(160336..160404)
FT                   /note="Signal peptide predicted for BB2442 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.983 between residues 23 and 24"
FT   CDS_pept        complement(160460..161419)
FT                   /transl_table=11
FT                   /locus_tag="BB2443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LM72"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM72"
FT                   /protein_id="CAE32937.1"
FT                   /translation="MRVLITGANGYIGRALAERLCALPGVPGHGALEQLTLCDLAFDAA
FT                   PADPRVRQVAGDFADPATLAAITDPPPDLVFHLACVASGRAELEFELGLRVNLEGSLRL
FT                   LEQLRRQGRSPGLVFTSSIAVYGAPLPALVTDDTPLAPALSYGAQKQAVEILLADYTRR
FT                   GFVRGRAVRLPGVAPRPPAPNGAWSAFSSTLLRALAAGQPCEMPVGPQATLWLMSLPCC
FT                   VDNLLRAAELTAQAPPPGGRTGWTLPALRVSVRDIVQAFDARSQGAATPLVSYAPRPDI
FT                   EAQFGNQPPLQCDAAQAAGFRHDGSLPALLERAVGPPP"
FT   CDS_pept        complement(161407..162213)
FT                   /transl_table=11
FT                   /locus_tag="BB2444"
FT                   /product="putative exported protein"
FT                   /db_xref="GOA:A0A0H3LSV0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSV0"
FT                   /protein_id="CAE32938.1"
FT                   /translation="MKLAANLTLLYPGLPLAARMAAAREDGFAGVEILFPYDQPPAQLA
FT                   AQLREHGLALALVNTPLGAAGEKGLACVPGREADFGAALDQALALCRATGCRIVHAMAG
FT                   MPPAPAGMDECRATLIGNLQRAAPRAAQAGVTLTLEPLNRADMPGYFYYLPEQAADIIR
FT                   AVDHPNVGLQFDIYHNLREGLDPHAELRRVLPLVRHVQFAGPDGRHEPDPASPPVAATL
FT                   RLLAQSGYGGWVGCEYTPRGLASAGLKAWRGAYDAACGSGGAACAS"
FT   misc_feature    complement(162145..162213)
FT                   /note="Signal peptide predicted for BB2444 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.867) with cleavage site
FT                   probability 0.708 between residues 23 and 24"
FT   CDS_pept        complement(162210..163106)
FT                   /transl_table=11
FT                   /locus_tag="BB2445"
FT                   /product="probable dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LNC1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC1"
FT                   /protein_id="CAE32939.1"
FT                   /translation="MSATLAFCGAGLMGAPMIRRLLAAGHRVRVWNRSAAKAQALAADG
FT                   AVVCATPAEAAAGAQAVLLCLTDLAAVQATVFGPHGVADVAGGLLVDHSSIEPDATRAL
FT                   AARLLAASGRVWIDAPVSGGVAGAQAGTLSILAGGPAAAIEAAQPWLRAYAGRVTRLGD
FT                   TGAGQIGKLCNQTIVATTVNAIAEAVALARRNGIDAAALDTALAGGWADSVLLRIFVPR
FT                   MTAPVDQPLGALQTMLKDLENVAALAAASGTQLRGLQGVLDSYRTAAARGLGPGDLSDI
FT                   VRVAWPERPAAPAREPA"
FT   misc_feature    complement(162594..163103)
FT                   /note="HMMPfam hit to PF03446, DE NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 0.00021"
FT   misc_feature    complement(163038..163106)
FT                   /note="Signal peptide predicted for BB2445 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.715) with cleavage site
FT                   probability 0.695 between residues 23 and 24"
FT   CDS_pept        complement(163103..164815)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BB2446"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="GOA:Q7WJP7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJP7"
FT                   /protein_id="CAE32940.1"
FT                   /translation="MSLHKHRSRMVTQGLTRTPHRAFLRATGFDDAALEKSMVGIVSTQ
FT                   GENTPCSMALGPQADRARLGVAAGGGVPVSFSTISISDGTSMNHAGMRMSLLSRETIAD
FT                   SVELVVRGHAYDALVAFAGCDKTLPAMMMAIVRLNVPAVFLYGGATLPGHAASGQVTIL
FT                   DTIEAVGRVQHGTMPAAELKAMERTCTPSAGSCPGQFTANTMAMVGEALGLSPLGSAMM
FT                   PAVYSERLAIAQRAGEHVMRALAAGGPLPRQLVTRASLENACAAVAATGGSTNAALHIP
FT                   AIAHEAGIAFTLDDVARVFKRTPLIADLQPGGRYLARDLHEAGGVPVVLKALLDGGHID
FT                   GSVLTLDGRTLAEALADTPAPDGKVVRACGQALHPTGGVAVLKGNLSPDGALLKIAGLK
FT                   SLKFSGPARVFENEEACMRAVSTHAYQPGEVLVIRNEGPRGGPGMREMLSVTAALYGQG
FT                   MGEKVALLTDGRFSGATRGLCIGYAGPEAAAGGPIALLRDGDMIHIDAEADTLDVALSD
FT                   EELARRRAAYQAPPQARLAGALEKYAALVRPACLGAVTHSGQVDWPYETPEAE"
FT   misc_feature    complement(163148..164710)
FT                   /note="HMMPfam hit to PF00920, DE Dehydratase family, score
FT                   2e-241"
FT   misc_feature    complement(163391..163426)
FT                   /note="PS00887 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 2."
FT   misc_feature    complement(164414..164446)
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT   CDS_pept        complement(164856..165536)
FT                   /transl_table=11
FT                   /locus_tag="BB2447"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LVC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVC4"
FT                   /protein_id="CAE32941.1"
FT                   /translation="MPALTHPDPLVHTSVNEAIYRRLRDHLMRGDYAAGAVLGIQELAD
FT                   AFGTSAMPVREALRRLVTQRALEPMKSRSVRVPVISRASLEDIRRARVLIEGHVTAWAV
FT                   EHITAPELAELRALADQIGRSLSDTASVQAGLENNQRFHFTIYRAARSDSMLATIESLW
FT                   LQSGPYLRATRELMHSDERPSAELHAAIVDAIARRDAESARAVMAQDISWAFDRLQALQ
FT                   PAMP"
FT   misc_feature    complement(164874..164903)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    complement(165306..165482)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 0.00024"
FT   misc_feature    complement(165360..165425)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1427.000, SD 4.05 at aa 38-59, sequence
FT                   LGIQELADAFGTSAMPVREALR"
FT   CDS_pept        complement(165732..167222)
FT                   /transl_table=11
FT                   /locus_tag="BB2448"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical signal
FT                   peptide protein smc01185 r01608 or smc01185 SWALL:Q92PW5
FT                   (EMBL:AL591787) (495 aa) fasta scores: E(): 2.1e-147,
FT                   71.51% id in 488 aa"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM77"
FT                   /protein_id="CAE32942.1"
FT                   /translation="MHLPPKLALTTGVLLVALPLATPAWGQPPTPASPLVQQLNNGNWL
FT                   DPKEAETLRDELYYQRAIHAYMTMLPALNVIGMRDGSEKVFGAGYNVLPVWKERMDART
FT                   MVPTPNADVIYSMSYLDLKKTGPLVVKAPANVIGMFTDFFQRTLTDVGAIGPDRARGGL
FT                   YLILPPDYDGHVPSSYFVVKSPTYNVFLFFRTIMGQGKGKPDPAPAVKAAETTRVYPLW
FT                   AEEKDIKPMEFPDGSGKHINMMYPVDQEYWTKLKEFVDYEPVSAIDPELRGVLASIGIV
FT                   KGQPFKPTAREQELLKRAVETAPKMILAMRQLGREDKRHLYYKDRQWERAWAGATAEWM
FT                   QDSYLDVNQRATFFQIAYSSAPAMVMRTTGAGSKYPFTARDANGEFLNGSATYKLRMPP
FT                   DAPAALFWAVTAYNVTDGTMPETDQLMPSTNGYYDIPKQKDGSTEIWFGPQKPADVADA
FT                   AFIKTIPNRNFLVTLRLYGAEDAFYDQTWKPDDVVKVK"
FT   misc_feature    complement(167145..167222)
FT                   /note="Signal peptide predicted for BB2448 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 26 and 27"
FT   CDS_pept        complement(167306..168757)
FT                   /transl_table=11
FT                   /locus_tag="BB2449"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein smc01184 r01609 or smc01184
FT                   SWALL:Q92PW4 (EMBL:AL591787) (512 aa) fasta scores: E():
FT                   2.8e-135, 68.44% id in 469 aa"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM76"
FT                   /protein_id="CAE32943.1"
FT                   /translation="MKRCLAILAFAALLFPALPAYSAPARQPSSNTPPPDIVMHPEYAR
FT                   TIGRLAYVWGWPMVNMLNRNARITKAPHPGLLGGILPAAPRGQVGMLHDYILPAETFVT
FT                   CPNQDVVYGLGFFSLDTEPVIAQVPDFGDRFWVYALYDHRTNQFGELGKPYRSKPGFYL
FT                   LVGPNWKGQKPAGVQAIIRSPTALANAIPRIFMDDTDEDRQAIQKKINQVVFYPLKDFD
FT                   GKMKSLDWQSTADIPNPGADSANAGETRWVVPEEFFNQFGQVLDMVPPLPGEEAMYVQF
FT                   RSMMDAAAKDPAIKNALVEVAKETEEQVIAPFFQWKHNGKPAGNNWNRSVNNAQTGLDY
FT                   FNRTGTAKSNMFDNRPNETQYFYTDFDSTGAVLDGGKRYEITFASGQLPPVKGFWSLTL
FT                   YNKHHLFSPNDLNRYSLGTKNKNLVRGPDGSLTIHVGPTSPGKDKEANWLPSPREPISL
FT                   YIRAYWGEQAILDGTWKPPAVKKIE"
FT   misc_feature    complement(168692..168757)
FT                   /note="Signal peptide predicted for BB2449 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 22 and 23"
FT   CDS_pept        169012..169920
FT                   /transl_table=11
FT                   /locus_tag="BB2450"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Pseudomonas putida EbdR protein
FT                   ebdR SWALL:Q9K4R5 (EMBL:AJ293588) (332 aa) fasta scores:
FT                   E(): 0.036, 25.81% id in 275 aa"
FT                   /db_xref="GOA:A0A0H3LSV5"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSV5"
FT                   /protein_id="CAE32944.1"
FT                   /translation="MQLRRFDSFGEFESAVVDVDLKVRLLGPRDGRWKLGHIDVDGITV
FT                   QRGVEAVPNLCEASGWPAHLMLLLSAGRPVPTWLNGLPFAEGTVGVLAPGRGFVFRAAG
FT                   PNEWMTIALPSASSLFEADNETGRVLRSWCQSTRILDAAPFAIGQLRKAALVAADARTP
FT                   RAAGRVLIEQAVVALAQSSRQPHSAILGRPGISPHAICDAALALLKMMDARRLADLPIS
FT                   SRSQRKFFKQCFGLGPAQYLHLIRLHGIHEALQDVRGSLVSIAETFERHGYPYSAYALA
FT                   RYQAIFGELPSATRKGPKAVR"
FT   CDS_pept        complement(169959..170645)
FT                   /transl_table=11
FT                   /locus_tag="BB2451"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LNC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC4"
FT                   /protein_id="CAE32945.1"
FT                   /translation="MTLTALPADPPPADALDLDLAVEQLEEDIVFGRLFPRQRLTEDEL
FT                   MARFGLKRHAVRQVLAQLEQRGAVERKRNVGAEVRAFTAREVMDLYDLRELLETRAAER
FT                   IALPVDEARLAALVAVQREHDAAVAAGNARRVFRSNQRFHRELFGLLDNPVLQQAIEEY
FT                   ARRTHPIRFGSLAAAGYRERARQEHWAMIQALRQGDRAALVALCRNHLLPSRDAYLAAA
FT                   GLRAGV"
FT   misc_feature    complement(170409..170585)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 4e-08"
FT   misc_feature    complement(170457..170531)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(170463..170528)
FT                   /note="Predicted helix-turn-helix motif with score 988.000,
FT                   SD 2.55 at aa 40-61, sequence LTEDELMARFGLKRHAVRQVLA"
FT   CDS_pept        complement(170652..172394)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BB2452"
FT                   /product="putative dihydroxy-acid dehydratase"
FT                   /db_xref="GOA:A0A0H3LVD3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVD3"
FT                   /protein_id="CAE32946.1"
FT                   /translation="MTQRDQGGKPPGGLSKGLTNYGDTGFSLFLRKAFIKGAGYTDDAL
FT                   ARPVIGIVNTGSSYNPCHGNAPQLVEAVKRGVMLAGGLPVDFPTISVHESFSQPTSMYL
FT                   RNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGVPAIQLVTGSMLTGSHRG
FT                   ERVGACTDCRRYWGRYRADEIDTAEITDVNNQLVASVGTCSVMGTASTMACLTEALGMM
FT                   ISGGASAPAVTADRIRVAERTGATAVAMAAARLTPERILTGKAIENALRVLLAIGGSTN
FT                   GIVHLTAIAGRLGIDIDLAGLDRMSRETPVLVDLKPSGQHYMEDFHKAGGMPALLRELR
FT                   PLLHLDALTVSGRTLGEELDAAPAPFAQEVIRALDAPIYPVGGLAVLRGNLAPGGAIIK
FT                   QSAADARLMEHEGRAVVFEDAEDMARRIDDDALDVTADDILVLKRIGPTGAPGMPEAGY
FT                   MPIPRKLARAGVKDMVRVSDGRMSGTAAGTIVLHVTPEAAIGGPLAHVRNGDRIRLSVR
FT                   QREISLLVSEAELAQRAAAQPIERPQAERGYRKLFLDTVTQADQGVDFDFLRAPASKQT
FT                   VPPR"
FT   misc_feature    complement(170697..172256)
FT                   /note="HMMPfam hit to PF00920, DE Dehydratase family, score
FT                   5.4e-190"
FT   misc_feature    complement(171975..172007)
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT   CDS_pept        172627..173631
FT                   /transl_table=11
FT                   /locus_tag="BB2453"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM81"
FT                   /protein_id="CAE32947.1"
FT                   /translation="MSDRQSARLPRRAALCSMLALCAGFALQPVAAQSAYPDRPIRMIV
FT                   PYPPGGATDVIGRVLAKEMSGALGQSVVVENRAGAAGNIGADVVAKATPDGYTILMGAM
FT                   TSHAINAVLYQGRVSYDIEKSFAPVAIVGTVPLVFVVNPAVPADSLQSLIALAKSKPGY
FT                   LTMASAGNGSPQHLAGEMFKRVAGVDLLHVPYKGSGPAMTDLMGGQVLSMIETVPAAQG
FT                   NVKGGKLRALAVASAQRVESLPDVPTTAEAGLPNFQVSSMFGIAAPAGTPAPVVERLNA
FT                   VLKEALAKPEVQTALLNQGAISTWTTPADAAARISAERQQWATVIAEAGVKAE"
FT   misc_feature    172627..172719
FT                   /note="Signal peptide predicted for BB2453 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.485 between residues 31 and 32"
FT   misc_feature    172792..173619
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.4e-116"
FT   CDS_pept        complement(173645..175282)
FT                   /transl_table=11
FT                   /gene="alkJ"
FT                   /gene_synonym="alcO"
FT                   /locus_tag="BB2454"
FT                   /product="alcohol dehydrogenase [acceptor]"
FT                   /EC_number="1.1.99.-"
FT                   /db_xref="GOA:A0A0H3LM78"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM78"
FT                   /protein_id="CAE32948.1"
FT                   /translation="MPPALCASYDYIIVGAGSAGCVLANRLTADPACRVLLLEAGGEDR
FT                   NFWLRLPVGYFRSIYDPRFSWQFPVEPQAETGERPIVWPRGRVLGGSSSINGLIYIRGQ
FT                   HADYDDWARAGAQGWGYRDVLPYFRKSERYSGGASEYHGGAGELCVSDLRNDHPLCRDW
FT                   VEAGLQAGFDPNPDFNGARDSGLGNYQLTLKGRWRCSAATAFLHPVRGRPNLTVLTGVR
FT                   VTRLLIDGGVCRGVEWVDERRRGQPVRTQADAEVLLAAGALQSPQLLQLSGVGPAELLR
FT                   RHGVAVQVDAPEVGRNLQDHYQARVIVKLKHPLSLNDDVRKPLKMLGMGARWLLRQDGP
FT                   LTVGAGQVGGMVCSEHARDGRADVLFNVMPLSVDKPGDALHGFSGFSASATQCRPLSRG
FT                   TVALRSADPFEAPRIVANYLTDPHDIKVLVAGLKLLREIYHQPAFRQHLSGEEYMPGAA
FT                   IRGDADLEQFARTRGGTVFHASGSCRMGGDPASVVDPELRVRGVDRLRLIDASVMPAMV
FT                   SANTNAAAILIGEKGADLVRGRQRLDAA"
FT   misc_feature    complement(173687..175258)
FT                   /note="HMMPfam hit to PF00732, DE GMC oxidoreductase, score
FT                   1.7e-180"
FT   misc_feature    complement(174458..174502)
FT                   /note="PS00624 GMC oxidoreductases signature 2."
FT   misc_feature    complement(174956..175027)
FT                   /note="PS00623 GMC oxidoreductases signature 1."
FT   misc_feature    complement(175220..175252)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(175299..176306)
FT                   /transl_table=11
FT                   /locus_tag="BB2455"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSW0"
FT                   /protein_id="CAE32949.1"
FT                   /translation="MMNPQRRTLLKTGALAAAMAGIGIPSLARARDKVRVGYLHTPAVD
FT                   GQIWTGQQTGAFAKHGLDLELIQFTTGLELFQAMIGGSLDMLSTGAVVSNFPARGQGKV
FT                   FLVNNIEYATAQLWVRDDAGIKTLADLKGKKISTTTGTTAHVFLDRALRSVGLQAGKDV
FT                   QIVNQRMAEAVTSFISGAVPAVALWVPFDVTIRQKLPGARKLLDASTFYPEAAIVGGWA
FT                   ARNDYYDKNPKIINALIQAWAETNDYLLSHTDEALVALQKNHYQQVPLPDLKEQFKASK
FT                   YFTAAEWRQRYADGTVTRWLQQVTDFFVQSANIAQPVPAERYFDPKPYLEAVRA"
FT   misc_feature    complement(176217..176306)
FT                   /note="Signal peptide predicted for BB2455 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.887 between residues 30 and 31"
FT   CDS_pept        complement(176329..177150)
FT                   /transl_table=11
FT                   /locus_tag="BB2456"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /db_xref="GOA:A0A0H3LNC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC8"
FT                   /protein_id="CAE32950.1"
FT                   /translation="MSATPASDVRIRFEDVCVDYPTADGPMRVLDGINYEIRQGEFVSV
FT                   IGPSGCGKTTMMGLVGGFVQPTAGRVLLDGQPVGGPGPDRGVIFQEYGVFPWLTVRENI
FT                   AFGLNLRSNRVAAGERAQICQRYMTLMGLGDFAHHYPKHLSGGMRQRLALARAYAVKPQ
FT                   FLLMDEPFGALDAQTRSAMQDLLLQVQMTEGKTVMLITHSVEEAIYLSSRIVVVTARPA
FT                   RIRTIIDVPFGYPRAENLHEDPRFGELRSHIRALVMEEYAKQARQTVRLSD"
FT   misc_feature    complement(176491..177033)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.3e-56"
FT   misc_feature    complement(176677..176721)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(176989..177012)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(177170..177937)
FT                   /transl_table=11
FT                   /locus_tag="BB2457"
FT                   /product="permease component of ABC transporter"
FT                   /db_xref="GOA:A0A0H3LVE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVE5"
FT                   /protein_id="CAE32951.1"
FT                   /translation="MKRRSALMRALLVLAPWLLIVLLWYGIRASGLVSPALVPSPGEVW
FT                   TRFVALMQARLPHDILMSTQRVFVGVCLGTLLAVPVGFVLGWYRGVRSFIDPVINFFRA
FT                   LPPIALIPLVIVYFGIGETAKIAILFYASFFAGVIVMYEGISQINPIFVRVAKTLGATD
FT                   GEIFRKVIVPLTIPHMLTALRVALGVAWATLVASELIAAQQGLGALIQDASSFFQLDII
FT                   YVGIICIGFIALAMDLALRAAARRLVAWQDRIA"
FT   misc_feature    complement(join(177206..177274,177317..177385,
FT                   177494..177562,177575..177643,177677..177745,
FT                   177857..177925))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2457 by TMHMM2.0 at aa 5-27, 65-87, 99-121, 126-148,
FT                   185-207 and 222-244"
FT   misc_feature    complement(177293..177508)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 4.8e-12"
FT   misc_feature    complement(177419..177505)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(177521..177568)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   misc_feature    complement(177845..177937)
FT                   /note="Signal peptide predicted for BB2457 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.899) with cleavage site
FT                   probability 0.228 between residues 31 and 32"
FT   CDS_pept        178037..178762
FT                   /transl_table=11
FT                   /locus_tag="BB2458"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LM85"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM85"
FT                   /protein_id="CAE32952.1"
FT                   /translation="MAINFHDSPIPRYLQLADLMRQRIARGQWGQGHRLPSLEELVAEF
FT                   GVARVTVRQAIDVLTREGLVSPQQGRGTFVTGLPPNDRWLQVQTTLAELAKVYRDTKPK
FT                   IVNIDETITNPPLTAQDGVAAERYVYMRRVHEREGRPYCVINIYLDEQIFRRDPVRYRN
FT                   ETVIPLLVSDPALRIARAHQVLTIGTADMEVAGHLQVPVNTPIAEVRRLFLDEAGKVVY
FT                   LSEVSYRGDFIHLEMNLIP"
FT   misc_feature    178082..178261
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 8.6e-18"
FT   misc_feature    178142..178207
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1250.000, SD 3.44 at aa 36-57, sequence
FT                   PSLEELVAEFGVARVTVRQAID"
FT   CDS_pept        178770..179918
FT                   /transl_table=11
FT                   /locus_tag="BB2459"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /db_xref="GOA:A0A0H3LM82"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:3DDM"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM82"
FT                   /protein_id="CAE32953.1"
FT                   /translation="MTRDAASITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVED
FT                   SDGAVGWGEVWCNFPACGAEHRARLVETVLAPLLTARAFADPAQAFAHLEARTAVLAIQ
FT                   TGEPGPLAQAIAGLDIALCDLAARRAGQPLWAWLGGSGDRIGVYASGINPENPEDVVAR
FT                   KAAEGYRAFKLKVGFDDARDVRNALHVRELLGAATPLMADANQGWDLPRARQMAQRLGP
FT                   AQLDWLEEPLRADRPAAEWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLA
FT                   KWGGFSGCLPVARAVVAAGLRYCPHYLGAGIGLQASAHLLAAVPGLASPGLLEVDANDN
FT                   PLRSLLSPALATLHEGRITLGGAPGLGVTPDLAALRAACAAR"
FT   misc_feature    178791..179186
FT                   /note="HMMPfam hit to PF02746, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   4.6e-13"
FT   misc_feature    179148..179906
FT                   /note="HMMPfam hit to PF01188, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   7.8e-11"
FT   misc_feature    179367..179462
FT                   /note="PS00909 Mandelate racemase / muconate lactonizing
FT                   enzyme family signature 2."
FT   CDS_pept        complement(179934..180854)
FT                   /transl_table=11
FT                   /locus_tag="BB2460"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LSW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSW4"
FT                   /protein_id="CAE32954.1"
FT                   /translation="MDRFDSLQLFTRIVELGSFSRAAAALDIPRATATHAIKQLEARLG
FT                   ARLLDRTTRHVRATPDGQAFYERCVHVLSELDDAQSSLQRVASNPRGLLRVDMHSTHAT
FT                   KIVLPRIDDFRARYPGIDLAVSGGDRLVDLVREGIDCVIRAGNPRDSSLVARRLAVMPQ
FT                   VICASPEYLAAFGAPRHPDELAAHRVVKFFAASAAVDYPLELRIGGEIRAFALNGWISV
FT                   SDAENYVVCALRGCGLIQLPRFHVEDDLRAGRLVEVLSDWPSPDLPVSALYPSHRHLSP
FT                   RVRVFVDWLGKLYEEAFPAAAPARR"
FT   misc_feature    complement(179970..180596)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.3e-46"
FT   misc_feature    complement(180666..180845)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 6.4e-17"
FT   misc_feature    complement(180711..180803)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(180741..180806)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1200.000, SD 3.27 at aa 17-38, sequence
FT                   GSFSRAAAALDIPRATATHAIK"
FT   CDS_pept        180969..181709
FT                   /transl_table=11
FT                   /locus_tag="BB2461"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND1"
FT                   /protein_id="CAE32955.1"
FT                   /translation="MNMDISKAAIVTGGSRGIGRAIAARLAADGFAVVVNYAGNGAKAH
FT                   ETVAAIESAGGKAIAIQGDVGKPQDVANLFAQARAAFGRIDVVVNSAGVMPMASIDVAN
FT                   LDAFDQVIATNLRGAFLVLAQAAANLGDDGRIIALSTSVIAKSLPGYGPYIASKAGVEG
FT                   LVHVLANELRGRNITVNAIAPGPVGTDLFFNGKSEEAVASIARQAPMERIGMPDEIAAA
FT                   VSFLAGPDGRWVNAQVLRVNGGFA"
FT   misc_feature    180981..181703
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 1.1e-65"
FT   CDS_pept        complement(181841..182533)
FT                   /transl_table=11
FT                   /locus_tag="BB2462"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:A0A0H3LVF7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVF7"
FT                   /protein_id="CAE32956.1"
FT                   /translation="MDTNSLLSAGSDMAKAANLSDADIIQLSDAACKQSDQESKIAPAG
FT                   NKYSVRLTKLMRGFGNMTLNGQKVNYKVYMTEDVNAWAMGNGCVRVYTGLMDLMNDDEL
FT                   RGVIGHEMGHVALGHTKKAMQTAYAVSAARQAAGAAGNSVVASLSASQLGEMTEKFINA
FT                   QFSQSQETAADDFSFDLLTEKKMNRKGLVTAFQKLAELDGGESSMFSSHPSSPDRAARM
FT                   EKRLQAGK"
FT   misc_feature    complement(181847..182347)
FT                   /note="HMMPfam hit to PF01435, DE Peptidase family M48,
FT                   score 5.2e-05"
FT   CDS_pept        182894..183316
FT                   /transl_table=11
FT                   /locus_tag="BB2463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM90"
FT                   /protein_id="CAE32957.1"
FT                   /translation="MQANLTVITLGVDDLERALRFYRDGLGLPTAGIVGREFEHGAVVF
FT                   IDLQAGLKLALWPRRSLAHDTGLPLAPPSATELSLGHNVTSRAEVDAVMAQAAQAGAAI
FT                   VKPAGDTFWGGYAGYFQDPDGHLWEVVHNPQLAPAG"
FT   misc_feature    182924..183307
FT                   /note="HMMPfam hit to PF00903, DE Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily, score 4.7e-12"
FT   CDS_pept        183438..184631
FT                   /transl_table=11
FT                   /locus_tag="BB2464"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LM88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM88"
FT                   /protein_id="CAE32958.1"
FT                   /translation="MPSRSAQSSSNVLRLAAAQALAGANTTVVYATAAIIGEALAPSKS
FT                   LATLPISVFVVGMAASTLPAGAVAQRHGRRAAFMLGTLCGVLLGLLAALGIYLESFALF
FT                   CAAMAFGGAYAAVVLTFRFAAAECVEPHRKARALSTVLAGGVLAGVLGPQLVSYTMDAW
FT                   SGHVFAGTYLAASAVAVLAAVVLGGVDLPRPARAAAAGGRPLRVIARQPRFIAAVVCGV
FT                   VTYMLMNFLMTSAPLAMRMHGLSQHASNLGVQWHVIAMYAPSFVAGGLITRHGAVPVVA
FT                   AGLLLTAAAAVVGLAGMDAWHFWVSLTLLGVGWNFGFAGASAMVLECHLPQERTRVQAA
FT                   NDFIIFGTMVVGSFVSGDLLMRYGWEVVCWLALPPLAVAAFALRWFKPLPAGAAGSA"
FT   misc_feature    183438..183530
FT                   /note="Signal peptide predicted for BB2464 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.971) with cleavage site
FT                   probability 0.415 between residues 31 and 32"
FT   misc_feature    join(183495..183563,183576..183644,183663..183731,
FT                   183744..183812,183849..183908,183936..184004,
FT                   184080..184148,184191..184250,184263..184331,
FT                   184359..184427,184464..184532)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2464 by TMHMM2.0 at aa 20-42, 47-69, 76-98, 103-125,
FT                   138-157, 167-189, 215-237, 252-271, 276-298, 308-330 and
FT                   343-365"
FT   CDS_pept        complement(184638..185609)
FT                   /transl_table=11
FT                   /locus_tag="BB2465"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LSW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSW8"
FT                   /protein_id="CAE32959.1"
FT                   /translation="MKNEKILEFHNPLVMSYPTPMLTNWIDRLRPRHLRLLIRLCETGN
FT                   LTEVANEYGISQPALSKWLKDLEADIGQRLFVREPRGVTPTACARELQAHARAIIGRLE
FT                   RARTAVDHIASGFAGHLSVGFSPVVGPVVLPESIRRFRAAYPDVLVSVIEASIDLLLPG
FT                   LRNGDFDIVVGRLEEVAMPEDVRCETLYDEPVCLVAGRAHPLAGRRRISWEDAQAYPWI
FT                   SPQQGTPLRMRLEMELAVAGQPLPRHAVESTSVQTNVALLDRSDMIAPMSRRLAEHFQR
FT                   QGVLRILPLTLGSGGPIGMLWRADGVHGTHTAHFIACLRQAV"
FT   misc_feature    complement(184644..185270)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 5.3e-41"
FT   misc_feature    complement(185340..185519)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.6e-18"
FT   misc_feature    complement(185385..185477)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(185415..185480)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2346.000, SD 7.18 at aa 44-65, sequence
FT                   GNLTEVANEYGISQPALSKWLK"
FT   CDS_pept        185676..187262
FT                   /transl_table=11
FT                   /locus_tag="BB2466"
FT                   /product="probable sulfatase"
FT                   /db_xref="GOA:A0A0H3LND5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND5"
FT                   /protein_id="CAE32960.1"
FT                   /translation="MSQPNFLLFITDQHRADHLGAYGNSQIRTPALDALARRGWLAERF
FT                   YVASPICMPNRATLMTGRMPSAHGARHNGIPLSQRATTFVERLRQAGYGTALVGKSHLQ
FT                   NMTGNGPVWPRPQDPPAEGEAWAPEPGDYDQEWGPLWREDPAHDLATPFYGFSQVDLAV
FT                   DHGDRVWGHYWRWLQREHPEVAAQAGPDHALPAPGFELVRAGQAWRTRVPESCSTTAYL
FT                   GRRTMQALDGYAQRGQPFFIQCSFPDPHHPFTPPGKYWDMYRPEDVELPASFHASAAAG
FT                   RQPPPHVQWMYAQRDSGRAVKHTPAMFACTEREAREAIALNYGSISHIDHTVGEVLAHL
FT                   QRLGLADNTVVIFTSDHGDYLGDHQLLWKGPVHYQSVIRTPFIWADPAGAQGARSDALC
FT                   STTDIAPTILARAGLLPYNGIQGADLGALMRGEQAAPREAVLIEEEGQRVMFGFDKRVR
FT                   MRTLQTGRYRMSVYHGVSWGELYDLREDPLELRNLWDEPGSAALRQDLLFQLAQNLIGH
FT                   GETSPHPTALA"
FT   misc_feature    185685..187136
FT                   /note="HMMPfam hit to PF00884, DE Sulfatase, score 7.9e-27"
FT   misc_feature    185955..185978
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        187304..188281
FT                   /transl_table=11
FT                   /locus_tag="BB2467"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVG2"
FT                   /protein_id="CAE32961.1"
FT                   /translation="MRIFQALRHAALAAALSLGAAAAATAAYPDKPVRLVVNFTPAGPL
FT                   DLLARLVAERASRELGQTVIVENRAGAGGNIGADVVAKSAPDGYTLLITTDTLATVNPF
FT                   VYASMPADPFKDLQPVALTGTFNQVLVVQPSLGVRNLADYMAYLRQHGGTYASAGNATP
FT                   GHLTFESLRQALDLDVTHVPYRGTAPAVNDLLGGQVEAGFLVVPGVLQHIQAGKLVPLA
FT                   VSGAQRDAALPDVPTIAESGLAQVRDFDTSFGYLLMAPAGVPDEAVQAWQRVLARIYAS
FT                   PEFLERLAALDIAPTFGDAQQAAQWMRTRAARWEKVVAAAGIKP"
FT   misc_feature    187304..187381
FT                   /note="Signal peptide predicted for BB2467 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.605 between residues 26 and 27"
FT   misc_feature    187445..188272
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.7e-80"
FT   CDS_pept        complement(188302..188814)
FT                   /transl_table=11
FT                   /locus_tag="BB2468"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LM97"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM97"
FT                   /protein_id="CAE32962.1"
FT                   /translation="MMRHERLRFWLAGLAAAATGWLCYAGLARLAGALGVATWIPYPAP
FT                   RRQWLLIGESWQSAEFSGAIADASVFLTALAAVAAYYCARIVYHLSFAPVRQRRARWLI
FT                   AGWIVGTVAMVALSQGLGWLYGAFPGFARIGWLSAALGFAVLAGAASGFARAWGRLMRA
FT                   RKVPATE"
FT   misc_feature    complement(join(188344..188412,188440..188508,
FT                   188545..188613,188728..188796))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2468 by TMHMM2.0 at aa 7-29, 68-90, 103-125 and 135-157"
FT   misc_feature    complement(188722..188814)
FT                   /note="Signal peptide predicted for BB2468 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.348 between residues 31 and 32"
FT   CDS_pept        189313..190818
FT                   /transl_table=11
FT                   /locus_tag="BB2469"
FT                   /product="probable membrane protein"
FT                   /db_xref="GOA:A0A0H3LM91"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM91"
FT                   /protein_id="CAE32963.1"
FT                   /translation="MELLQNLALGFSVAFTPENLLYALLGCVLGTLVGVLPGLGPVPTI
FT                   AMLLPITYVLPPVAGLIMLAGIYYGTQYGGSTTAILVNLPGETSAVVTVLDGHQMARNG
FT                   RAGAALALAAIGSFFAGTVATMLIAAFAPPLAEVAFKFGPAEYFSLMVLGLIGAVVLAS
FT                   GSILKAVAMIILGLLLGMVGTDVNSGVARYDFGIPELQDGIDFAIVAMGVFGFAEILTN
FT                   LEQKENRVDITDKVGSLYPNKQEMREAAPAIVRGTALGSCLGILPGGGSVLSAFASYSL
FT                   EKKLSRNPERFGKGHPAGLAGPESANNAGAQTSFIPLLTLGIPGNAVMALMVGAMTIHN
FT                   IQPGPQVMTSHPELFWGLIASMWIGNLMLVVLNLPLVGLWVKLLKVPYRILYPAILVFC
FT                   TIGVYSLNYNVFDVFVTAIFGVVGYVWSKLKCEGAPLLLGLVLGPMMEENFRRALLLSR
FT                   GDFLTFVERPLSASLLGAAALLVIIVALPSIRKKRDETFVEEE"
FT   misc_feature    189367..190626
FT                   /note="HMMPfam hit to PF01970, DE Integral membrane protein
FT                   DUF112, score 6.5e-116"
FT   misc_feature    join(189370..189438,189451..189519,189529..189597,
FT                   189634..189702,189745..189813,189817..189885,
FT                   189928..189981,190261..190329,190387..190455,
FT                   190474..190542,190702..190770)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2469 by TMHMM2.0 at aa 20-42, 47-69, 73-95, 108-130,
FT                   145-167, 169-191, 206-223, 317-339, 359-381, 388-410 and
FT                   464-486"
FT   misc_feature    189505..189552
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT   CDS_pept        complement(190916..191380)
FT                   /transl_table=11
FT                   /locus_tag="BB2470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LSX1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSX1"
FT                   /protein_id="CAE32964.1"
FT                   /translation="MSDVQTSSPSPAPPRGRKLDKADFAALADLRYALRRFMAFSEAAA
FT                   TESGLTAQQHQALLAIKASDDTLSVGELADRLLIRHHSAGELVDRLARMDMVRRIPSNA
FT                   DRRRVLVALTPLAEHTLDTLSAAHVEELRSVGPLLRTLLSYFDSPAYRRK"
FT   CDS_pept        complement(191490..191915)
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="BB2471"
FT                   /product="putative plasmid stability protein"
FT                   /db_xref="GOA:A0A0H3LNE0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE0"
FT                   /protein_id="CAE32965.1"
FT                   /translation="MILLDTDVLLEPLRPAPDPAVAAWLDGQHVETLYLAAPGAAEIQL
FT                   GLARLPRGKRAEALRHEFERRILPLFMGHVLPFDTAAADAYAAVMMRAAAAGHALCAID
FT                   GCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA"
FT   misc_feature    complement(191508..191912)
FT                   /note="HMMPfam hit to PF01850, DE PIN domain, score
FT                   2.8e-09"
FT   CDS_pept        complement(191912..192151)
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="BB2472"
FT                   /product="putative plasmid stability protein"
FT                   /db_xref="GOA:A0A0H3LVG6"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVG6"
FT                   /protein_id="CAE32966.1"
FT                   /translation="MSSITVRNVPEEVHRALRVRAATHGRSTEAEIRAILENAVLPDGR
FT                   VKLGTLLSHIGRGARGMDLTIERNPAPARPASFE"
FT   CDS_pept        complement(192225..193067)
FT                   /transl_table=11
FT                   /locus_tag="BB2473"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LMA2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMA2"
FT                   /protein_id="CAE32967.1"
FT                   /translation="MDRLSALLERFRVRTALFHAGTLCGHHRFEAQPGRAFLHVLRRGD
FT                   MEVRHRPGETALPRLRLAEPTLLFYPRPLHHEFINPPAEGPDLTCATLDFEGGDRHPLV
FT                   RSLPPVVCVPLDAVAGLRPALDLLFAEADQVRCGSRVLADRLFEVVLIQLLRWMLDHPA
FT                   QVGVSNGLIMGLSDPRLAKALAALHGAPGQAWPLTRMADIAGMSRSAFAAAFKTATGVT
FT                   PAAYLADWRLSLAASMLRAGHPMKRIAPELGFAGVPALSKAFRQRMGASARQWLDAQR"
FT   misc_feature    complement(192237..192365)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.85"
FT   misc_feature    complement(192252..192377)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(192384..192521)
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 8e-07"
FT   misc_feature    complement(192399..192533)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(192420..192485)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1446.000, SD 4.11 at aa 195-216, sequence
FT                   WPLTRMADIAGMSRSAFAAAFK"
FT   CDS_pept        193205..193750
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="BB2474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LM95"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LM95"
FT                   /protein_id="CAE32968.1"
FT                   /translation="MSRVPLIDPSQAGAERQAILAQIQGAFGATPNMFKAVANSAAALK
FT                   SMWEAFGALGGGVIAARLGEQIAVAVANRNRCEYCLAAHTALGRKAGASAGDMAAAQDG
FT                   RSADPRTAAALRFALQLVEARGQVGEAEVQAVRAAGFSDEEIVEILAHVALNLFTNYVN
FT                   VAFAVPVDFPKVALRQAA"
FT   CDS_pept        193809..194321
FT                   /transl_table=11
FT                   /locus_tag="BB2475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LSX6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSX6"
FT                   /protein_id="CAE32969.1"
FT                   /translation="MSRHEALATVTAPPLQVDAWLNTPHPLELARLRGQVVVLHAFQML
FT                   CPGCLAHGLPQAERLHRLFRDDGVVVIGLHTVFEHHAVMGPEALRVFNHEYRWSFPIGI
FT                   DRPDPEGDMPMTMRAYSLGGTPSLVLLDRRGRIRLHHLGRLDDLALGAAIGRLLAEDAE
FT                   SAGAPPA"
FT   CDS_pept        194348..194635
FT                   /transl_table=11
FT                   /locus_tag="BB2476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE8"
FT                   /protein_id="CAE32970.1"
FT                   /translation="MREARPRAGRAFATGGDGMTGKTAFRIGDHVAWNSEAGQVSGTII
FT                   AIHTRDFDYKGHTHRASPDHPQYEIKSDKTDHIAAHRGEVLRRVRAKGGA"
FT   misc_feature    194393..194416
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    194426..194512
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        194632..195192
FT                   /transl_table=11
FT                   /locus_tag="BB2477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVH0"
FT                   /protein_id="CAE32971.1"
FT                   /translation="MRPPFHTIGHSNRSLEAFVALLEAAGIELVVDIRTVPRSRANPQF
FT                   NQDALPGSLDGRGIAYEHLAALGGLRPRSRTVPREVNGYWDNDSFHNYADYALSQAFHA
FT                   GLEHLVARGRAQRSAVMCSEAVWWRCHRRIVADHLLARGETVFHIMEAGRIDPASLTPG
FT                   ALVRPDGMVVYPGADAAVRPPMP"
FT   CDS_pept        195270..196316
FT                   /transl_table=11
FT                   /locus_tag="BB2478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LMA6"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMA6"
FT                   /protein_id="CAE32972.1"
FT                   /translation="MPQNNPEPQAVVSPITRSAIFLVATVGADNEAADKVRALCGKLAD
FT                   LARAVGKRVPAGNLSCVCGFSAAGWDRLFGQPRPAELHPFREFSAGERRAPATPGDLLL
FT                   HIRAEQMDLCFELATHVMAQLGDAVTVVDEVHGFRYFDLRSLVGFVDGTENPTGREALD
FT                   FTLVDDADPDFAGGSYVLVQKYLHDMDGWNALSVETQERIIGRTKLSDIELDEAVKPSN
FT                   SHSALTTLEENGQEIKILRDNMPFGRPGSGEFGTYFIGYARSPAPIEQMLENMVVGRPP
FT                   GNYDRLLDFSRAVTGGLFFAPSADLLEALAERDPQDTDGSRPDPAPAARAPHDGSLNIG
FT                   SLKGNPQQ"
FT   CDS_pept        196313..197116
FT                   /transl_table=11
FT                   /gene="linM18"
FT                   /locus_tag="BB2479"
FT                   /product="bacteriocin"
FT                   /db_xref="GOA:A0A0H3LMA0"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMA0"
FT                   /protein_id="CAE32973.1"
FT                   /translation="MNNLYRDLAPISAAAWAQIEEEVARTFKRSVAGRRVVDVKDPGGF
FT                   GLAAVGTGHLRGIAAPQKGVDAKLREVKALVELTVPFELQRDEIDAVERGANDADWQPA
FT                   KDAATELAYAEDRAIFDGYKAAGIVGIREGSSNSRLELPTDAADYPAAVGRALEQLRLA
FT                   GVDGPYSVLLGADAYTALSEGSDDGYPTIDHIKRIVSGDIIWAPALNGGCVLSTRGGDF
FT                   ELHLGQDLSIGYQSHTDKVVRLYLRETLTFLMLTSEASVPVAPKG"
FT   CDS_pept        complement(197171..198469)
FT                   /transl_table=11
FT                   /locus_tag="BB2480"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LSY1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSY1"
FT                   /protein_id="CAE32974.1"
FT                   /translation="MDAVLILTVILGLFGLLLVLGIPIFAALGVPSILGIYLVGGASAL
FT                   NVVPSVLHRGIASYSLICIPLFILMGETLARTSIGARLYTLFYTWLSRVRCSLAIASVG
FT                   ASAIFGAMSGVSVAGAATIGRVAIPEMLKRRYDPGLAGGSVAAAGSLALLIPPSVGFVL
FT                   YGEIASQSIGKLFSAAIVPGLLLSVLMMLYLYGLSRIKPSVAPDEAQKVSWRERWQALR
FT                   DVWAAIVLIVAVLGTIYLGIATPTEASGLGAAGALLVALGYRELDRAKLREIVRSTIVT
FT                   SSMILLIVAAALLFGHVLMRLQAPQMLIAWVAALAQPDWVILLLILVFLLIVGMFLDIV
FT                   SIILITTPIVLPVITSLGLDPIWFGVVMIIMCEMAVITPPIGLNLYVIKGVAPEISLRD
FT                   ITMGALPFVLVEALAVLILVLFPQLALWLPSHM"
FT   misc_feature    complement(join(197189..197257,197318..197386,
FT                   197444..197512,197573..197641,197732..197800,
FT                   197879..197947,197984..198052,198113..198181,
FT                   198239..198307,198326..198379,198389..198457))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2480 by TMHMM2.0 at aa 5-27, 31-48, 55-77, 97-119,
FT                   140-162, 175-197, 224-246, 277-299, 320-342, 362-384 and
FT                   405-427"
FT   misc_feature    complement(198383..198469)
FT                   /note="Signal peptide predicted for BB2480 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.952) with cleavage site
FT                   probability 0.644 between residues 29 and 30"
FT   CDS_pept        complement(198473..198994)
FT                   /transl_table=11
FT                   /locus_tag="BB2481"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNF1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF1"
FT                   /protein_id="CAE32975.1"
FT                   /translation="MKSLLDRLTRIGHGTNRAAVFIAQAALLLMMLLTVYSVIARYVLQ
FT                   QPSVHAVEISIYLLLLVTWLSVGWTHLLERHVSMEMLSIRVRGRGKRLLNVFRELVVLV
FT                   FCGFLLHAGVQIAATALARNYRSTSLLAFPMWIAYGLIAVGALLLAIAAACKLNHPDGN
FT                   AAIAPPSPEA"
FT   misc_feature    complement(join(198536..198604,198647..198715,
FT                   198776..198835,198878..198937))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2481 by TMHMM2.0 at aa 20-39, 54-73, 94-116 and 131-153"
FT   misc_feature    complement(198860..198994)
FT                   /note="Signal peptide predicted for BB2481 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.714) with cleavage site
FT                   probability 0.340 between residues 45 and 46"
FT   CDS_pept        complement(199036..200043)
FT                   /transl_table=11
FT                   /locus_tag="BB2482"
FT                   /product="putative extracellular solute-binding protein"
FT                   /db_xref="GOA:A0A0H3LVH5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVH5"
FT                   /protein_id="CAE32976.1"
FT                   /translation="MNKTWIAKLLPAVLLALSANAGAADKPIELTLSTYAPPSYEYMWK
FT                   PLETFIAYVEKESQGRVKIKAFHSAQLFDGYEELPALSRGDIDITTVVSTYASGAMPVL
FT                   NLFTMPFVFQDTAHLERAAKAGLLDVSIRGEMRDKHGIEVLGLAPIDPYQIYSRRAPVR
FT                   TAADFKGKVWATTGAADARAIQLLGGSPTSMPSSELYLALDRGVVDGTPRPLITGLGRS
FT                   LHEVVKHLSLATLAIDTSLLSMNKAKFDSLPPDIQDIIRRGAQVRDEEQFRQVYAYIEQ
FT                   GVAKFEKNGVSVYTIEPAALQDMRAATQPAVQEWVAQEPAASRHLELLEKTRAN"
FT   misc_feature    complement(199087..199950)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 2.7e-49"
FT   misc_feature    complement(199975..200043)
FT                   /note="Signal peptide predicted for BB2482 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.987 between residues 23 and 24"
FT   CDS_pept        complement(200068..200694)
FT                   /transl_table=11
FT                   /locus_tag="BB2483"
FT                   /product="putative isochorismatase"
FT                   /db_xref="GOA:A0A0H3LMB1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMB1"
FT                   /protein_id="CAE32977.1"
FT                   /translation="MLDLDNARGGFIGSHPFGRRPALVVIDFQRAFTDPDVSPLASDCA
FT                   PAIAQANRLIQAMRGRGPVVFTVVGYDGNHGDGGCFHRKCPPLKDLVRGSAGCALDERL
FT                   DYDAATDVLLHKTQASAFFGTPLAAMLAHAGCDAVLIAGCTTSGCVRASAVDAMQHGFP
FT                   PFVAQDAVTDRSAAQHLSNLIDLKSKYAEVLPTDALLPLLLNPTA"
FT   misc_feature    complement(200092..200640)
FT                   /note="HMMPfam hit to PF00857, DE Isochorismatase family,
FT                   score 4.1e-09"
FT   CDS_pept        complement(201269..202090)
FT                   /transl_table=11
FT                   /locus_tag="BB2484"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2117"
FT                   /db_xref="GOA:A0A0H3LMA7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMA7"
FT                   /protein_id="CAE32978.1"
FT                   /translation="MILGGAPGHEYDLHYIPAPLRRRHHSQAMSQAANPTALPAWDPPA
FT                   ILAQLRANTCFGHMAEPTLAAFAAIAQWRRLDHGELLAGRGTPAPGVVIILKGAIHTSS
FT                   FSDDGHEFALSMLEFDGLWGVAAVLDGGGMLRDSRAYQQTDILLLPRAAFLDILDGDPG
FT                   LYRYFVKLLCSRIRTAHAIIDELALRSLPQRLPRLLGALTAGRPGDDERGIAVAQTQDA
FT                   LATLLGVSRHAVNRELRQLANQGLVGLGYGEIWVRDLERLKRLWHERGAQP"
FT   misc_feature    complement(201374..201439)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1508.000, SD 4.32 at aa 218-239, sequence
FT                   QTQDALATLLGVSRHAVNRELR"
FT   misc_feature    complement(201602..201883)
FT                   /note="HMMPfam hit to PF00027, DE Cyclic nucleotide-binding
FT                   domain, score 0.042"
FT   CDS_pept        202129..203100
FT                   /transl_table=11
FT                   /locus_tag="BB2485"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2116"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSY6"
FT                   /protein_id="CAE32979.1"
FT                   /translation="MKIKSMLLAVLAVSMAGVSAAALSQGFPERALRVVVPYPPGGTTD
FT                   VLVRLLQKPVADAAGQSVVVDNRPGGASVIGTSHVAQAAPDGYTVLGGDLSMLVNPSLM
FT                   KDLPYDTLRDFRGVTMLARAPLVLLVHPSVPANTLDELIALAKAKPGTLNFASGGYGTS
FT                   THMAGEMFRRAAGIDVVHVPYQGVAPAMSALLGGQVQMYFGGTTTGLPHIQSGKLRALA
FT                   VTGEAPSPLLPEVPTFVSRGIQGVNADTYWGVYAPARTPDAVIEKLNAYYTGALRDPAV
FT                   QQRTRDLGLTLIGNSAAEHTAQMKTMIGDWGAFVKEADIRLE"
FT   misc_feature    202129..202200
FT                   /note="Signal peptide predicted for BB2485 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.485 between residues 24 and 25"
FT   misc_feature    202267..203088
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.2e-92"
FT   CDS_pept        203104..203958
FT                   /transl_table=11
FT                   /locus_tag="BB2486"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2115"
FT                   /db_xref="GOA:A0A0H3LNF7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF7"
FT                   /protein_id="CAE32980.1"
FT                   /translation="MAAKQSLVCLTFDFDAISVWLARGMDSPTPVSRGEFCAVAADRVL
FT                   DLLERLGLPSTWFIPGHTLASYPEHCRRVHEAGHEIGHHGWTHVAPNLMTREEELDGLV
FT                   RANEAIRALTGRAARGYRSPSWDLSPHTLALLLEHGFDYDSSMMGHDYLPYPVRQGDSF
FT                   PLDEPAVFGAPTRLIEVPVSWSLDDYPHFEFVRAGQSVIPGLMNANSVMDNWIEDFLYL
FT                   KENFDWGVITYTFHPFVIGRGHRMRMLERLLRRLIDEGATFVRMEEAVDAYRQRQALAA
FT                   GAA"
FT   misc_feature    203182..203637
FT                   /note="HMMPfam hit to PF01522, DE Polysaccharide
FT                   deacetylase, score 2.1e-11"
FT   CDS_pept        203977..204795
FT                   /transl_table=11
FT                   /locus_tag="BB2487"
FT                   /product="putative hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2114"
FT                   /db_xref="GOA:A0A0H3LVH9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVH9"
FT                   /protein_id="CAE32981.1"
FT                   /translation="MMQHYYERDGVRLSYYLDDYTDPWTQAPTLLLLHGAMANAQRFYS
FT                   WVPGLSRDYRVVRADLRGHGLSDVPPADKPLDLQVLTEDILALLDHLGCERVHLAGNSA
FT                   GGYVGQHLAMQHPQRIETLALFGSAPGLRNSQASTWLERVAEKGLRQFLADTIDDRFPP
FT                   ELVGTPRCEQFLDALSDHDMAYIGRFVGYMAQQEWGDQLHRITCPTLVVIPGAGRIGAM
FT                   DAYQPMRDHLKRAEILVYEGERHSICEYLPQRCVADLRSFLARHGGPAWP"
FT   misc_feature    204136..204765
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 6e-19"
FT   CDS_pept        204815..206275
FT                   /transl_table=11
FT                   /locus_tag="BB2488"
FT                   /product="putative amidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2113"
FT                   /db_xref="GOA:A0A0H3LMB6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMB6"
FT                   /protein_id="CAE32982.1"
FT                   /translation="MASVMNIEQYVQQDGLALSAQLRAGATDPQALMQCAITLARQRAE
FT                   PLNALCYPDYDAALARAAAWRPTGVFGGLPFLLKDSGLACDRLPSSIGLALCKDMRFAG
FT                   NATLVERFDAAGLLPFARTTVPALCMAPTTEALVNGGPARNPWAPQRSAGGSSGGAAIA
FT                   VATGVVPLAHGSDGGGSIRIPASCCGVFGLKPSRGLVPLGPARGEAWGGMAGDGVLSRS
FT                   VRDTAAALDAIAGMERGAPYAAPASPAGGYLAALARPFERPLRIGVWQHAWDGIEVDPA
FT                   CSAALAQAEALCRQLGHATEAIAAPPIDYQAFVRAHIGILCTHIALAVDARLAVLRRGL
FT                   RDDDLEPAILDGYRRARGISATDYAGMIQALHAVGRAMAACMQGYDLLLSPTLTRPPVP
FT                   LGEISMADDFVSFRQKAARYTTFLAVINASGQPAASVPLHIDGQGLPIGVQLIGALGRD
FT                   DLVLRLAAQLERAAPWAGRFPPAAGAGA"
FT   misc_feature    204920..206200
FT                   /note="HMMPfam hit to PF01425, DE Amidase, score 8.2e-67"
FT   CDS_pept        206278..207066
FT                   /transl_table=11
FT                   /locus_tag="BB2489"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2112"
FT                   /db_xref="GOA:A0A0H3LMB3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMB3"
FT                   /protein_id="CAE32983.1"
FT                   /translation="MAGRTDCAPAAGRLAGRVALITGAAGGIGSAAALRFAAEGAALAL
FT                   LDRRPDAIEQLAGRICGQGGQAIGVAADVTDDDSVRQAVRRAVEHFGRIDTLFNCAGGS
FT                   VAGDTAVDKVELALWNRTLRLDLDGTMLCCRHAVPAIVRAGGGAVVNMSSGAGLRGSFG
FT                   GHAYTAAKGAVIALTRALAAEYAPHGVRVNAICAGRIRTERILRNLDAGAPAQAGAAQR
FT                   YPCREGDPIDIAHIALFLASHESRMITGEAIAANGGYSAF"
FT   misc_feature    206320..207054
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 4.6e-72"
FT   misc_feature    206737..206823
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    207441..213309
FT                   /note="Low %GC phage-related region."
FT   CDS_pept        207468..209462
FT                   /transl_table=11
FT                   /locus_tag="BB2490"
FT                   /product="abortive infection phage resistance protein"
FT                   /note="Similar to Lactococcus lactis abortive infection
FT                   phage resistance protein abiu SWALL:Q9F9J7 (EMBL:AF188839)
FT                   (589 aa) fasta scores: E(): 2.3e-36, 30.17% id in 570 aa"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSZ1"
FT                   /protein_id="CAE32984.1"
FT                   /translation="MAKNDRILLDGIVDDRIATRTPSEKRDEAFEYLAFEQLLKDYDLS
FT                   HDELLHGAVDGERDGGIDGFFILVNGHLLDDPESFVWPRSSAELRLILVTCKHHETFKQ
FT                   ATLDSLVATLTELLDFAIDDKDLKGAYSDRLLRVRSNLKFAYRKLSPRLNSFSVSAYYA
FT                   SRGDTQELGAEVAARGEQIALLIRESFGACQAEFAFVGATELVELHRKIRNYTLELPFV
FT                   EALTKGVRYVLLARLTDYFNFVTDGGRLRRYLFDSNVRDFMGMNRVNEDIQNTLRGAES
FT                   PDFWWLNNGVTMLASSAAITGKSIQISDIQIVNGLQTTESIFRYFQGRDLAKDQRCVLV
FT                   KVIITNDEAVRDAIIRATNNQTDVELASLHATDKIQRDVEDIFLRHGLFYERRKNYYAN
FT                   QGRSPAELVTPLYAAAGYLALALKEPHKASKLRSRFMRVPASYEQIFDESAPLDVWPKI
FT                   VQTLKRVDEALEALRPRGKGTERFLKGWRYVIALILVAQHFGKFSYSKRELTTFDVSTV
FT                   TFDSVKGVWAELYAPDNGVRMVGWTSLRDVVAACQIVSKSRGIRDVEAISRGSQGVHMR
FT                   SQDLSAQFIESVRQALPAQPWKPGVHIEVSRKLKCDIPAYRAAVEQLIEDGIFLRQKDG
FT                   VLYDEEGSVVSFDPERVDPETLQLRPADE"
FT   CDS_pept        complement(join(209777..209983,209986..210597))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BB2491"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="Similar to Xanthomonas campestris transposase
FT                   SWALL:Q9Z3E4 (EMBL:U62552) (350 aa) fasta scores: E():
FT                   3.5e-47, 50% id in 254 aa, and to Ralstonia solanacearum
FT                   isrso14-transposase orfb protein SWALL:Q8XF72
FT                   (EMBL:AL646083) (275 aa) fasta scores: E(): 7e-52, 54.21%
FT                   id in 249 aa"
FT   misc_feature    complement(join(209834..209983,209986..210306))
FT                   /note="HMMPfam hit to PF00665, DE Integrase core domain,
FT                   score 8.4e-31"
FT   misc_feature    complement(210529..210597)
FT                   /note="Signal peptide predicted for BB2491 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.785) with cleavage site
FT                   probability 0.784 between residues 23 and 24"
FT   CDS_pept        complement(210636..210896)
FT                   /transl_table=11
FT                   /locus_tag="BB2492"
FT                   /product="transposase"
FT                   /note="Similar to Caulobacter crescentus insertion sequence
FT                   IS511 orfa and orfb genes, complete cds cc2741 and cc0514
FT                   and cc2291 and cc2689 SWALL:Q45992 (EMBL:U39501) (88 aa)
FT                   fasta scores: E(): 8.2e-19, 67.81% id in 87 aa, and to
FT                   Agrobacterium tumefaciens IS3 family transposase orfa or
FT                   atu4605 or agr_l_545 SWALL:Q8U750 (EMBL:AE009388) (88 aa)
FT                   fasta scores: E(): 2.9e-21, 75.29% id in 85 aa"
FT                   /db_xref="GOA:A0A0H3LNG1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG1"
FT                   /protein_id="CAE32986.1"
FT                   /translation="MKKRFTEEQIVGVLKEAEVGAKVAELCRKYGISEATYYNWKVKFG
FT                   GMAVSEAQRLKELEQENNKLKKLLAESMLDKAALQDLLSRK"
FT   misc_feature    complement(210642..210890)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01527, DE Transposase, score
FT                   4.9e-27"
FT   misc_feature    complement(210771..210836)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1304.000, SD 3.63 at aa 21-42, sequence
FT                   AKVAELCRKYGISEATYYNWKV"
FT   CDS_pept        complement(211125..212336)
FT                   /transl_table=11
FT                   /locus_tag="BB2493"
FT                   /product="putative phage-related DNA-binding protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   DNA-binding protein sco3537 or sce2.18C SWALL:Q9X8B2
FT                   (EMBL:AL049645) (390 aa) fasta scores: E(): 1.3e-17, 29.85%
FT                   id in 345 aa, and to Neisseria meningitidis transcriptional
FT                   regulator, hth_3 family nmb2012 SWALL:Q9JXJ6
FT                   (EMBL:AE002551) (363 aa) fasta scores: E(): 6.9e-18, 27.83%
FT                   id in 370 aa"
FT                   /db_xref="GOA:A0A0H3LVI4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVI4"
FT                   /protein_id="CAE32987.1"
FT                   /translation="MSRGGVQGFQQERLSQILAARRLTQVQLASMVEVSPATISKWRSG
FT                   AQAPERDALERLATVVNVTPEWFTRSPATKMSLPLFRSNASAHVAARAMLEARLEWTQD
FT                   VAAALMEYVDYPDVNLPIRTYTDPEEITAEDIEKAACECRDMWRLGRSAIQDLALAVEG
FT                   AGIILVREETGIAQIEGLSAWSEVLGRPLILLSADKDNGYRSRFDLAHEIGHLVLHRYI
FT                   KRPTERTRHKLLEQQAHRFAGAFLLPAETFATEVRVPPTLDDLLLLKRRWGVSAAAIIM
FT                   RLKALHLVNEDGALMLFKRRSARWGAKSEPGDNDRKPEKPRLLRRTIDLLVEEKVMPLE
FT                   AIPRHIGLAAVDVEALAGLPEGYFQEKASVVLEFARLKTAQKPSTDHPGQGNNVVQFRP
FT                   LSKS"
FT   misc_feature    complement(212133..212297)
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   8.5e-09"
FT   misc_feature    complement(212205..212270)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1764.000, SD 5.19 at aa 23-44, sequence
FT                   LTQVQLASMVEVSPATISKWRS"
FT   CDS_pept        complement(212333..212989)
FT                   /transl_table=11
FT                   /locus_tag="BB2494"
FT                   /product="putative phage-related hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMC0"
FT                   /protein_id="CAE32988.1"
FT                   /translation="MSQPTQETIQDLLVRNIPRGLVMALEEAMLVGAQRAYAAARGMDD
FT                   GHLPSVVGHLRHFHMNESFHRTLTVGGASPSPLRGNRIVTGRAGIFTLARFNTKYGTWN
FT                   SARRSETRKQMSLANAAIEPLVQPGFFSEYVPPSDGVVFIVAGFAGSLHTQPETPISID
FT                   LAVPDRNMYGWLFREPITAFLKRYDQKSTTAQNDLAKPKLKKNIGKQQDKDGTGS"
FT   tRNA            complement(213422..213497)
FT                   /note="tRNA Ala anticodon CGC, Cove score 84.28"
FT   CDS_pept        complement(213585..215090)
FT                   /transl_table=11
FT                   /locus_tag="BB2495"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2111"
FT                   /db_xref="GOA:A0A0H3LMB8"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMB8"
FT                   /protein_id="CAE32989.1"
FT                   /translation="MHILVAGFQHETNTFAPSKAGYDNFLRGEGFPALVRGDDLLALRA
FT                   VNIPAGGFLNAALADGHSVHPVIWAGASPSAHVTRDAFERIAGEIEAAARAGRYDAVYL
FT                   DLHGAMATEHHDDGEGELLRRLRDAVGPATPIVASLDLHANVTRAMLAHASALVAYRTY
FT                   PHVDMADTGARAAALLQARAQAGKHWHGAARRLPFLIPINGMCTQLEPARGVYALLAEL
FT                   ERSEPGIASLSCALGFPAADFPECSPVVWAHGPDRDAVERAVQTLADRIAGLEAQWAPD
FT                   FLAPDEAIRQARQLAQGARRPVVIADTQDNPGAGGDANTTGMLRALIDADADNAAIGLM
FT                   CDPQAVAQALAAGVGKRVRLRLGGQSGVAGDAPCEAEFIVEHQSDGKTRYDGPMMHGMA
FT                   ADLGSTVCLRHRGVRVIVSSNKSQTLDRNLIRLGGIDPEDLAILVVKSSVHFRADFEPI
FT                   AHAVLIAKAPGPMQADPADLPWTRLAPGMRTRPRGRPFVPARP"
FT   CDS_pept        complement(215132..215914)
FT                   /transl_table=11
FT                   /locus_tag="BB2496"
FT                   /product="putative exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2110"
FT                   /db_xref="GOA:A0A0H3LSZ5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSZ5"
FT                   /protein_id="CAE32990.1"
FT                   /translation="MKLATWNVNSLNVRLPQVLDWLAANPVDALCIQELKLTDDKFPLD
FT                   AFTEAGYHAAWAGQKTYNGVAIISREPGFALVRNNPRYEDPQQRILAVTLPSPAGDVRV
FT                   ICAYCPNGQSVDSDKYVYKLAWFDGLRDWLEEEMRTYPRLAILGDYNVAPADADVHNPE
FT                   KWEGQVLVSEPERAAFRALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHV
FT                   LLSDALKPHCVACVIDKAPRANEQPSDHAPVIATLAFG"
FT   misc_feature    complement(215144..215914)
FT                   /note="HMMPfam hit to PF03372, DE
FT                   Endonuclease/Exonuclease/phosphatase family, score 7e-42"
FT   misc_feature    complement(215240..215275)
FT                   /note="PS00728 AP endonucleases family 1 signature 3."
FT   CDS_pept        complement(215984..216430)
FT                   /transl_table=11
FT                   /locus_tag="BB2497"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2109"
FT                   /db_xref="GOA:A0A0H3LNG5"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG5"
FT                   /protein_id="CAE32991.1"
FT                   /translation="MTYPILLALHLLAAFVFIGTVFFEVLILESVRRQVPREAMNAVER
FT                   GIGNRARAIMPWVLLALFGAGIGMAWQHRGALEQPLASSFGLLLSLKIVLALSVLGHFA
FT                   AAMRWRRRGQLRGRRSRRLHLSVFCHVVAIVLLAKGMYYIDALR"
FT   misc_feature    complement(join(215996..216064,216122..216190,
FT                   216218..216286,216347..216415))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2497 by TMHMM2.0 at aa 6-28, 49-71, 81-103 and 123-145"
FT   CDS_pept        complement(216427..217653)
FT                   /transl_table=11
FT                   /locus_tag="BB2498"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2108"
FT                   /db_xref="GOA:A0A0H3LVI8"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVI8"
FT                   /protein_id="CAE32992.1"
FT                   /translation="MAELLQIDEPAAARAAPQWRAFLELGFRPLYLVGAAWGALSVALW
FT                   IGAPQWLGGAMAGVIWHAHEMLWGFIGAIAVGFLLTAAATWTGVNPLRGAPLAALAALW
FT                   LAARAAFLLPGMAAFWTGVACELLFFAWAAAALGRAIYRRGASRRNDGVPLLVLGLGAA
FT                   DALYLLAARAGDYPLLLQRFNAGLLCMAVIALLIARRIIPFFAMRAIAGLQIPMHTRSG
FT                   QWQLAAGLVAVAATLAQAGALTAVALAAAGLIALAQWLSWRPWATRGVPLLWILYAGYL
FT                   GLAAGLLVAAASAAGGIARAAWPAHVIGMAGFGLLIIGMITRTALGHLGRPLRTDRLML
FT                   ACYLLVIGAAALRLAALWPGPHTLAALHGATAAWVLAFVLYLWRFAPLLVRPRLRAPTA
FT                   AATPVRSRP"
FT   misc_feature    complement(join(216496..216564,216583..216642,
FT                   216685..216753,216772..216840,216883..216978,
FT                   217036..217104,217132..217200,217261..217329,
FT                   217387..217455,217492..217560))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2498 by TMHMM2.0 at aa 32-54, 67-89, 109-131, 152-174,
FT                   184-206, 226-257, 272-294, 301-323, 338-357 and 364-386"
FT   CDS_pept        complement(217646..218050)
FT                   /transl_table=11
FT                   /locus_tag="BB2499"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2107"
FT                   /db_xref="GOA:A0A0H3LMC5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMC5"
FT                   /protein_id="CAE32993.1"
FT                   /translation="MGAPDLCTEEDITQLVHQFYAEVRRDAELGPIFNTHVDDWDVHLA
FT                   KLVDFWSSILRGTGRFRGTPMPRHVALPGLHAGLFERWLRLFRATAAAQPNQAMAEQAC
FT                   LMAGRIAQSLWYGYQLHRSPDQAPTDLAHG"
FT   CDS_pept        218210..218512
FT                   /transl_table=11
FT                   /locus_tag="BB2500"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2106"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMC3"
FT                   /protein_id="CAE32994.1"
FT                   /translation="MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVAL
FT                   VPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHLDPGRPLGHIDGRPKP"
FT   CDS_pept        complement(218509..219279)
FT                   /transl_table=11
FT                   /locus_tag="BB2501"
FT                   /product="putative amino-acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1362"
FT                   /db_xref="GOA:A0A0H3LSZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LSZ9"
FT                   /protein_id="CAE32995.1"
FT                   /translation="MIGLQGIDKSFGGNRVLHGVDVVIPEGSVTALIGPSGSGKSTLLR
FT                   CVNLLEIPEAGVLRLGPETLAFDGRRPARDAVQRIRRQTGMVFQNFQLFPHQSVIDNVM
FT                   EGLVTVQRWDKPRARARAMELLEKVGMTAKADAWPVTLSGGQQQRVAIARALAPSPRVL
FT                   LCDEPTSALDPSLAIEVVDVLRRLAGEGMTMLMATHDLRLAASIAQQVVFLEGGAVVEA
FT                   GTPREVFAQSRDARTAAFVSTLTQGLPEEWSAPA"
FT   misc_feature    complement(218629..219201)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.1e-62"
FT   misc_feature    complement(218812..218856)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(219157..219180)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(219276..219956)
FT                   /transl_table=11
FT                   /locus_tag="BB2502"
FT                   /product="putative amino-acid ABC transporter, permease
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1363"
FT                   /db_xref="GOA:A0A0H3LNG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG9"
FT                   /protein_id="CAE32996.1"
FT                   /translation="MPAWLQLMLDSFWPLLHAGLMFTVPLTLLSFAAGLALAFVVALLR
FT                   LFGPWPIVALMRFYVWLIRGTPLLVQLFVIFYGLPSVGIVLDPLPAALIGFTLNVGAYN
FT                   SEVIRGAIESIPRGQWEAAYSLSMTRGQAMRRTVLPQAARVAVPPLANSFIALVKDTSL
FT                   AAVLTVPEIFQAAQRIAAVTYEPLILYTEAALIYLVFSSALSSLQVRLEKRFGQHAVFA
FT                   EQHR"
FT   misc_feature    complement(219414..219626)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.3e-17"
FT   misc_feature    complement(join(219720..219788,219825..219893))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2502 by TMHMM2.0 at aa 22-44 and 57-79"
FT   misc_feature    complement(219843..219956)
FT                   /note="Signal peptide predicted for BB2502 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.635) with cleavage site
FT                   probability 0.379 between residues 38 and 39"
FT   CDS_pept        complement(220023..220811)
FT                   /transl_table=11
FT                   /locus_tag="BB2503"
FT                   /product="putative amino-acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1364"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVJ2"
FT                   /protein_id="CAE32997.1"
FT                   /translation="MNFSLRKLLLAGLVPLAMVGTAAQADDLAAIKAAGVIKIGTEGTY
FT                   APFSYHDASNKLTGFDVEIGRAIAQKLGVKAEFVEGKWDGLIAGLDVKRYDAVINQVGI
FT                   TDARKAKYDFSDPYISSQAALIVREDNQAIKSFADLKGRKSANTLTSNFGKLAQSYGAE
FT                   VVPVQGFNEAIDLLMSGRVEATVNDNLSFLDFKKQKPNAKVKVAAYDKSKEFSESGVLI
FT                   RKNNPELQAAINKALAELKADGTYRKISEQYFGADLSAAQ"
FT   misc_feature    complement(220044..220703)
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 1.9e-82"
FT   misc_feature    complement(220596..220637)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   misc_feature    complement(220737..220811)
FT                   /note="Signal peptide predicted for BB2503 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.981 between residues 25 and 26"
FT   CDS_pept        complement(221086..223422)
FT                   /transl_table=11
FT                   /locus_tag="BB2504"
FT                   /product="putative membrane transport ATPase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2722"
FT                   /db_xref="GOA:A0A0H3LMD0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMD0"
FT                   /protein_id="CAE32998.1"
FT                   /translation="MPSTTRDLALDTPSGQRTDAHGHDHAGHDHAGHDHAGHDHAHDHG
FT                   IPACCGHGHGQPAAPAAAPAWQPGPGQQVTRVRIGQMDCPTEETLIRKKLASLPEVHEL
FT                   DFNLMQRVLTVLHADGALDRIDAAIRSLGMTPEPLAGDAPATPAGAAAPSRGWRLLAAG
FT                   GVLAALSELAHFTGQPVYVAAALALAAILACGLSTYRKGWIAVRNGNLNINALMSIAVT
FT                   GAMLIGQWPEAAMVMFLFNVAELIEARALDRARHAVRGLLDLAPQTATARQPDGSWAEV
FT                   PAARLRPGDLVRVRPGERIAADGTISEGQSAIDQSPITGESLPVEKGPDDDVYAGTVNA
FT                   SGSFDYRVTAAAGNTTLDRIIHAVEQAQGARAPTQRFIDRFSRIYTPAVVGLAVLVALA
FT                   PPLLLGHAWLDSVYRALALLIIACPCALVISTPVSVVSGLTAAARRGILIKGGVYLEEG
FT                   RKLRWLALDKTGTLTQGKPVQTDLELLHDASAGGRPALRAAVSLAARSDHPVSRALAQA
FT                   DHALDAPLDEVNGFAALPGRGVQGEIGGERFQLGNRRLMRELDVSTPDIEARIDAYEAA
FT                   GKTAIALADGQRVLLLAAVADTLKASSAAAVADLHRLGVRTLMLTGDNTRAAQAVAAQA
FT                   GIDEARGDLLPQDKLDAVEAKLDPALRVGMVGDGINDAPALARADIGFAMGAAGTGTAI
FT                   ETADVALMDDDLRKIGTFVRLSRATHRILTQNIVLALGIKAVFLVLAMAGQATLWMAVF
FT                   ADVGASLLVVANGLRLLRAGRHQAS"
FT   misc_feature    complement(join(221113..221181,221191..221259,
FT                   222103..222171,222214..222282,222832..222900))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2504 by TMHMM2.0 at aa 175-197, 381-403, 418-440, 722-744
FT                   and 748-770"
FT   misc_feature    complement(221356..222042)
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 1e-26"
FT   misc_feature    complement(221359..221427)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT   misc_feature    complement(221686..221709)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(222004..222024)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   misc_feature    complement(222052..222720)
FT                   /note="HMMPfam hit to PF00122, DE E1-E2 ATPase, score
FT                   5.6e-97"
FT   CDS_pept        223505..223939
FT                   /transl_table=11
FT                   /locus_tag="BB2505"
FT                   /product="putative MerR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2723"
FT                   /db_xref="GOA:A0A0H3LMC7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMC7"
FT                   /protein_id="CAE32999.1"
FT                   /translation="MKIGELARTAGTTVETVRYYEKEGLLPAPERGLNNYRSYGEAHVE
FT                   RLRLIRNCRALDMTQDEIRTVLALADNHEAGCAPINQVFDEHIAHVDARIAELTQLKAQ
FT                   LGELRQRCASARPDAEDCGILHGLSEMQVEERPERHTHLG"
FT   misc_feature    223505..223570
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1885.000, SD 5.61 at aa 1-22, sequence
FT                   MKIGELARTAGTTVETVRYYEK"
FT   misc_feature    223514..223621
FT                   /note="HMMPfam hit to PF00376, DE Bacterial regulatory
FT                   proteins, merR family, score 1.8e-11"
FT   CDS_pept        224042..224626
FT                   /transl_table=11
FT                   /locus_tag="BB2506"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2703"
FT                   /db_xref="GOA:A0A0H3LT02"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT02"
FT                   /protein_id="CAE33000.1"
FT                   /translation="MTVSPLHALTSRRSMKFLRAPAPKQDELEQILQAAMSAPDHGALR
FT                   PWRFVLIRGEAIGRLADLAIEAVKRSGDKRMTPEKEKSVREWAAGVPLFIAVAQKISHD
FT                   NTRIPEQEQLLATGAAVMNILNAAHMLGYGAFWSTGLGTYVEDVQDALGLDAMDYRFLG
FT                   FVALGTPGCAVPPAQRPDFREFVSEWQGVTA"
FT   misc_feature    224051..224500
FT                   /note="HMMPfam hit to PF00881, DE Nitroreductase family,
FT                   score 3.7e-14"
FT   CDS_pept        complement(224696..226117)
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="BB2507"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2702"
FT                   /db_xref="GOA:Q7WJI7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJI7"
FT                   /protein_id="CAE33001.1"
FT                   /translation="MANTSHSSQDQFANKAQAWSARFSEPVSDLVKRYTASVDFDKRMA
FT                   RHDIRGSLAHADMLAAQGIISAQDLADIQRGMQQILSEIDAGSFQWLLDLEDVHLNIEK
FT                   RLVELVGDAGKRLHTGRSRNDQVATDIRLWLRDEIDTLVDLLRQLRHALATVALENAAT
FT                   IMPGFTHLQVAQPVTFGHHLLAYAEMFGRDAERLADCRRRVNRLPLGAAALAGTSYPID
FT                   RERVARTLGFDGVCRNSLDAVSDRDFGIEFCAAGALIMTHISRLSEELVLWMSPRVGFI
FT                   DLADRFCTGSSIMPQKKNPDVPELARGKTGRVNGHLVALLTLMKGQPLAYNKDNQEDKE
FT                   GLFDTADTLRDTLTIFADMAGGIKVKADNMRAAALQGFATATDLADYLVKRGLPFRDAH
FT                   EIVAHAVRDCEQRGCDLADLSLADLQAYHPSIGEDIHQVLTLEGSVAARKHIGGTAPER
FT                   VREEAQRVLAETAGA"
FT   misc_feature    complement(224780..226057)
FT                   /note="HMMPfam hit to PF00206, DE Lyase, score 5.1e-112"
FT   misc_feature    complement(225221..225250)
FT                   /note="PS00163 Fumarate lyases signature."
FT   CDS_pept        226225..227571
FT                   /transl_table=11
FT                   /locus_tag="BB2508"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2701"
FT                   /db_xref="GOA:A0A0H3LNH4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH4"
FT                   /protein_id="CAE33002.1"
FT                   /translation="MLPKELENVVATLDNYVPDTAWGQTLVGIGVLVLTALFVQWVVAR
FT                   VVLYFAHRLLVLSGREDWDRALSRRRAYQNFWYAVPFAVVSMGIELVPHAERAVTVVGR
FT                   LSHAGAWICVFVAFSGVLSAWQDTYSATTRAQTRSIKGYIQIGKLILCAVGAVLVLSIL
FT                   LDRSPLWMISGLGALSAVLLLVFKDTLLSLVASTQLTSNDMLRIGDWIEMPQANADGFV
FT                   KDIALHTVKVQNWDNTVTTVPTYKLFSESYRNYRHMFESGGRRIKRTLRLDAASVRFMN
FT                   EEEGGRLKRFVLLRDYLQAKEDALLEANRQLGELAEVPANRRRLTNIGTFRGYALAYLR
FT                   QHPEVRQDMAMMVRMMEPQPNGIPIEIYCFTAITAWVEYERIQGDIFDHLLAILPELGL
FT                   RLFQEPSGSDLGNLAGGMREAALHEFRREQVAAGEAPLALRGDGAAPVR"
FT   misc_feature    join(226282..226350,226450..226503,226546..226599,
FT                   226648..226716,226729..226782)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2508 by TMHMM2.0 at aa 20-42, 76-93, 108-125, 142-164 and
FT                   169-186"
FT   misc_feature    226657..227430
FT                   /note="HMMPfam hit to PF00924, DE Mechanosensitive ion
FT                   channel, score 4.6e-25"
FT   CDS_pept        227610..229244
FT                   /transl_table=11
FT                   /locus_tag="BB2509"
FT                   /product="putative NAD synthetase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2700"
FT                   /db_xref="GOA:A0A0H3LVJ6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVJ6"
FT                   /protein_id="CAE33003.1"
FT                   /translation="MSLARVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPEL
FT                   VLTGYPPEDLLLRPRFIQEQQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVC
FT                   EGRVLGSYCKRELPNYSVFDEQRYFSAHGEAFGFTVKGVRFGLNICEDIWFERAPRAAA
FT                   ADGAQVLLVPNASPYNTGKQEERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFAL
FT                   DAQGRMSARLPDFTEGVNVLEVDARGTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLG
FT                   KNGFPGAIIGLSGGIDSAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLG
FT                   VQYDVIAIGEVVDRFEAALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTG
FT                   NKSEMTTGYCTLYGDMAGGFAVIKDVPKTLVYRLANWRNRRQPIIPERIITRPPSAELR
FT                   PDQTDQDSLPPYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQA
FT                   PPGPRITPRAFGRDWRYPVTNGFRETV"
FT   misc_feature    227616..228395
FT                   /note="HMMPfam hit to PF00795, DE Carbon-nitrogen
FT                   hydrolase, score 4.7e-12"
FT   misc_feature    228564..229175
FT                   /note="HMMPfam hit to PF02540, DE NAD synthase, score
FT                   3.3e-77"
FT   CDS_pept        229288..229626
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BB2510"
FT                   /product="nitrogen regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2699"
FT                   /db_xref="GOA:A0A0H3LMD6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMD6"
FT                   /protein_id="CAE33004.1"
FT                   /translation="MKQVTAIIKPFKLDEVREALAEVGVSGLTVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIRVEVVLADDMVDPAIEAIVKAARTGKIGDGKIFVTPVEQAIRIRT
FT                   GESDEEAL"
FT   misc_feature    229288..229620
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00543, DE Nitrogen regulatory
FT                   protein P-II, score 6.7e-61"
FT   misc_feature    229423..229440
FT                   /note="PS00496 P-II protein urydylation site."
FT   misc_feature    229534..229575
FT                   /note="PS00638 P-II protein C-terminal region signature."
FT   CDS_pept        complement(229651..230025)
FT                   /transl_table=11
FT                   /locus_tag="BB2511"
FT                   /product="endonuclease"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2698"
FT                   /db_xref="GOA:A0A0H3LMD1"
FT                   /db_xref="InterPro:IPR004260"
FT                   /db_xref="InterPro:IPR021143"
FT                   /db_xref="InterPro:IPR024796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMD1"
FT                   /protein_id="CAE33005.1"
FT                   /translation="MTRINCVPVEELSGPHLVAEYRELPRVFALAHKAAARGALVQPAA
FT                   YTLGKGHLLFFYTRLGYLARRHRALVEEMRRRGYRPAFAGVTREDFPDIPAPFWNDWTP
FT                   TEEALALNRARIAARSGGKA"
FT   misc_feature    complement(229657..230025)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03013, DE Pyrimidine dimer DNA
FT                   glycosylase, score 8.5e-24"
FT   CDS_pept        230111..230491
FT                   /transl_table=11
FT                   /locus_tag="BB2512"
FT                   /product="putative heat shock protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2697"
FT                   /db_xref="GOA:A0A0H3LT07"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT07"
FT                   /protein_id="CAE33006.1"
FT                   /translation="MDKIRLDKWLWAARFYKTRSLAVQEIGKGRVQVNGQPAKPAREVA
FT                   PGDVVCIRKEDPPIHVRVCAVSGVRGPAPVAQQLYEETPESAAARERAAEMRRLAPEPA
FT                   MDIVAGRPTKRDRRLIDKWRDA"
FT   misc_feature    230120..230260
FT                   /note="HMMPfam hit to PF01479, DE S4 domain, score 8e-13"
FT   CDS_pept        230608..232545
FT                   /transl_table=11
FT                   /locus_tag="BB2513"
FT                   /product="putative phosphatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2696"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH8"
FT                   /protein_id="CAE33007.1"
FT                   /translation="MHEPTMSKRRLVLKMLGGAPMLPLGAVGAATLLAGCRAGADGAQA
FT                   AARGAGPRGDFAAAAFTSMAAPSLDAPEKMAVTTVESTLEVRFSDGGRQTFQLGYEPFF
FT                   MTGDSVPDGQGATLVAGGYLDIQGRPIMDSSVPGKARQFFSDCPDGMSLLALPSARVPG
FT                   VKGNTVFAVVQFEYASHNQKGESMYGLLPSPIAVLTLAQDPATGRLALVKYSPVDTAPA
FT                   HGLWITCGASLSPWNTHLASEEYEPDATTARASAQFQGFSRNLYGDAAKANPYHYGHLP
FT                   EVVVHPDGTGTIRKHYCLGRISHELIQVMPDQRTCLMGDDATNGGLFMFVADRKADLSA
FT                   GTLYVAKWRQTSGEGPGAGTLGWINLGHARSADIEALADTLTAADIMDVRTADPGDPAF
FT                   KAIRVNGKANWVRLAPGREQAAAFLETHRYAALAGGTMAFSKMEGTTVNARDRIAYSAM
FT                   SRIETSMVDGTSPDLRVQGPEPGAVYALNLRGGQRDSAGTAIDSEWVPVDMAAVPALVG
FT                   EKLAAPDALGNRHHADRISNPDNIKFSEKLRTLFIGEDSNGHVNNFLWAYNVDSGALSR
FT                   ILSCPAGGESTGLQAVDEINGWTYITSNFQHAADWGGVHAVVRATLDPLVKASYRDGFG
FT                   ASVGYITIKP"
FT   misc_feature    230608..230694
FT                   /note="Signal peptide predicted for BB2513 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.972) with cleavage site
FT                   probability 0.408 between residues 29 and 30"
FT   misc_feature    230683..230715
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(232695..233240)
FT                   /transl_table=11
FT                   /locus_tag="BB2514"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVJ9"
FT                   /protein_id="CAE33008.1"
FT                   /translation="MLPIVIVSGPPGSGKTTACGLLAQADPQGLHLPSDLFYGFPAHPI
FT                   PPYRPQADAQNAAVIRAVCRSAASFAADGYRVYLDGIFGPWFLPLIAAQLQAARCPAAY
FT                   ALLDIGLDEALARVEQRSGPGQASMVRTMHDAFRAAGSLAGHRVVTAGRPAAEIADEIA
FT                   GRLQAGALALDLARWAPG"
FT   misc_feature    complement(233193..233216)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(233313..234194)
FT                   /transl_table=11
FT                   /locus_tag="BB2515"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2694"
FT                   /db_xref="GOA:A0A0H3LME1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LME1"
FT                   /protein_id="CAE33009.1"
FT                   /translation="MSSIRFLRTFLAVAQHGTFSEAAEQVALTQAAVSFQMRALEAELG
FT                   RELFDRGGRLAILNAAGRELVPEIKRLLDLYDHLKAPRNVPGELAGSVSVGAIVSCMGT
FT                   LSKVVSQLKRDHPALDVRVFSGKASELAGKVEAGELDAALVVEAGRKMASTRWTPLYEE
FT                   PLVVLAHPHAPGADAREVLAANPFLRFDRTQRTGRQIDRIVRRLGGGLNEFLELNAIET
FT                   LVELVRQEVGVTLLPLLNGANWQASPQLRVLPLPAELGPAVRAIGMIERRDHARLAVTA
FT                   EICAQCGALFGR"
FT   misc_feature    complement(233319..233939)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 8.5e-29"
FT   misc_feature    complement(234006..234185)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5.8e-20"
FT   misc_feature    complement(234051..234143)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(234081..234146)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1314.000, SD 3.66 at aa 17-38, sequence
FT                   GTFSEAAEQVALTQAAVSFQMR"
FT   misc_feature    complement(234129..234194)
FT                   /note="Signal peptide predicted for BB2515 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.716) with cleavage site
FT                   probability 0.571 between residues 22 and 23"
FT   CDS_pept        234302..235930
FT                   /transl_table=11
FT                   /locus_tag="BB2516"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2693"
FT                   /db_xref="GOA:A0A0H3LMD7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMD7"
FT                   /protein_id="CAE33010.1"
FT                   /translation="MKAFNWVNPYPSTRIPVFARNVVSTSHPLAAQAGLRMLLKGGNAV
FT                   DAAIAAAATIVLVEPVSCGLGGDCFAIVWDGRQLHGLNSSGVAPAAWNVEYFKRKYGTG
FT                   PDGLAVQPKRGWDAVTVPGVVAGWAALHEKLGKLPFEQLFEPAIEIAERGYTVPPVVAH
FT                   KWAAAAAELSEQPGYAQAFMPEGRAPRVGEHFRFPDAAYALRRIAASGGRDFYEGELAE
FT                   RIAAFSKECGGAMTLDDLRNYRPEWVKPISRSYRGYELHEIPPNGQGIAALIALGICER
FT                   FDLADMPVDSVQSQHLQIEAMKLAFSDLYRYVADPRSMEVTPQQMLDDAYLDSRARLID
FT                   PDRATHFEAGRPHAGGTIYLTAADENGMMISFIQSNYMGFGSGVVVPGTGISLQNRGVG
FT                   FSMNPASANVVEGGKRPFHTIIPGFLTRGGKPVMSFGVMGGDMQPQGHLQTVIRMLDYH
FT                   QQPQAACCAPRWKVNRDFTLDIESTMNRATVEGLKNLGHRLKAVDDPYMDFGAGQFIWR
FT                   MAESDNDLGYVAASDSRRDGQAVGF"
FT   misc_feature    234404..235915
FT                   /note="HMMPfam hit to PF01019, DE
FT                   Gamma-glutamyltranspeptidase, score 8e-171"
FT   misc_feature    234485..234529
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT   CDS_pept        235972..237489
FT                   /transl_table=11
FT                   /locus_tag="BB2517"
FT                   /product="ABC-transport protein, solute-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2692"
FT                   /db_xref="GOA:A0A0H3LT10"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT10"
FT                   /protein_id="CAE33011.1"
FT                   /translation="MTKTKSLSMMMGAAVLAGAGGAALAQDLRIGLQEDPDVLDPHRAR
FT                   TYVGRIVFTSLCDKLVDIDEKLQFVPQLAQSWSFSEDNKTLTFKLRTDVQFHDGSKFDA
FT                   AAARANLERAMTLQDSMRKGELASVEKIEAPDPATLVLTLKRPDATLLAQLSDRAGMML
FT                   SPKAFEGDAAAVGRKPVCSGPYKFVERVQNDRIVLQKFDQYYGAKDYHFDKLVFLPIPD
FT                   TTVRLSNLRAGGLDILERMNPSDAPQVKNDASVQFMPVSGLGYQEVFFNTGNGKRAETN
FT                   PFKDKRVRQALALSIDRAIINEVVGGGIFDPASQPFPPASPYHSDKFPVPKRDVERARA
FT                   LLKQAGLQKVKAEFAFGNNTTTSAIAEMIQAMAAEAGFELSLRPTEYAAMLNEAQAGNF
FT                   EMIMRGWSGRVDPDGNIYQFVTCKGALNDGRYCNAEVDKLLAEARTVPDQAKRKVIYDQ
FT                   AQALLQADTHDIYLYYQPWPFVLGKNVRGFKPYPDGMVRLKGVTLAK"
FT   misc_feature    235972..236046
FT                   /note="Signal peptide predicted for BB2517 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 25 and 26"
FT   misc_feature    235972..237480
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 2.1e-60"
FT   CDS_pept        237584..238528
FT                   /transl_table=11
FT                   /locus_tag="BB2518"
FT                   /product="ABC-transport protein, inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2691"
FT                   /db_xref="GOA:A0A0H3LNI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI3"
FT                   /protein_id="CAE33012.1"
FT                   /translation="MFKLILRRVVVAIPTLILVSMIVFMLQKILPGDPVLTLAGEERDP
FT                   AVLDYLREKYRLNDPLPVQYGAWVAQVLQGDLGKSMRTDVPVLTLIAQKLPVTLQLAVM
FT                   AMAFALLVGIPLGIVAAVRKGTAVEMGANMAALSGMSIPNFWLGIILIMVVSVQWKLLP
FT                   ASGYVSPAEDFWLSIKTMLMPALVLSTAIAAYLMRHTRSAMLEALSADYVRTARAKGVA
FT                   PRKVVLRHALRNALMPIVTLVTLLFGELLAGAVLTEQVFTIPGFGKLIVDAVFNRDYAV
FT                   VQGVVLCVAVGFIVMNLLADILYILVNPRLRHA"
FT   misc_feature    237584..237658
FT                   /note="Signal peptide predicted for BB2518 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.821) with cleavage site
FT                   probability 0.559 between residues 25 and 26"
FT   misc_feature    join(237596..237664,237881..237949,238007..238060,
FT                   238103..238171,238283..238351,238436..238504)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2518 by TMHMM2.0 at aa 5-27, 100-122, 142-159, 174-196,
FT                   234-256 and 285-307"
FT   misc_feature    238193..238408
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.8e-07"
FT   misc_feature    238196..238282
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        238525..239400
FT                   /transl_table=11
FT                   /locus_tag="BB2519"
FT                   /product="probable ABC-transport protein, inner membrane
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2690"
FT                   /db_xref="GOA:A0A0H3LVK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVK3"
FT                   /protein_id="CAE33013.1"
FT                   /translation="MSAPIASAGMAAPRRANRSWGKFRRNRIAMLGALIVLAFVVLALL
FT                   APWVASHDPFQTSFMTIRKAPSAAFWMGTDELGRDIFSRMVYGARASLMAGMVSVLIAL
FT                   AVGVPFGLAAGYFGGWTDSVISRATEALLAIPFLILAIALAAFLGPSLTNAMIAIGVSA
FT                   APKFIRLTRGQVLAVKNEDYVQSARALGASDLRIIGRHVFPNVMPPLIVQATITIATAI
FT                   IAEASLSFLGLGLQPPNPSWGSMLNTAKNFMTQAPWMSIFPGSAIFLVVLGFNLLGDGL
FT                   RDALDPRQEK"
FT   misc_feature    238525..238653
FT                   /note="Signal peptide predicted for BB2519 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.988) with cleavage site
FT                   probability 0.824 between residues 43 and 44"
FT   misc_feature    join(238606..238674,238810..238878,238915..238983,
FT                   239161..239229,239290..239358)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2519 by TMHMM2.0 at aa 28-50, 96-118, 131-153, 213-235
FT                   and 256-278"
FT   misc_feature    238765..238851
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    239047..239277
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.3e-10"
FT   misc_feature    239050..239136
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        239403..241262
FT                   /transl_table=11
FT                   /locus_tag="BB2520"
FT                   /product="probable ATP-binding ABC transporter protein"
FT                   /db_xref="GOA:A0A0H3LME7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LME7"
FT                   /protein_id="CAE33014.1"
FT                   /translation="MDANRVVQVDGLSVRFNTPGRVVQAVNDVSFHVDRGETLAIVGES
FT                   GSGKSVTSLALMRLVEYGGGRLSATDMRLRRRGGDVLDLARADERTLQRVRGADVAMIF
FT                   QEPMTSLNPSFTAGNQIAEALQLHQGLDAAGARAEALRMLERVRIPEARAILDRYPHQL
FT                   SGGMRQRVMIAMALSCKPQLLIADEPTTALDVTIQAQILQLIRQLQEEMDMGVIFITHD
FT                   MGVVAEVADRVLVMYRGDKVEEGGCDGVFAAPRHAYTRALLSAVPRLGAMQGTDQPAPF
FT                   PLLQVDQQALAPAPQAGAAEVDTVRRDGGPVLKVRGLVTRFDIAGGIFGRIDKRVHAVE
FT                   QVSFELFPGETLALVGESGCGKTTTGRSLLQLVKSQGGSIEFDGRDIGVLRGAAMQSLR
FT                   RHIQFIFQDPFASLNPRMTVGDSIMEPLLVHRTASGRAARERVRWLMDKCGLLPEMTDR
FT                   YPHEFSGGQRQRICIARALALNPKVVIADESVSALDVSIQAQIVNLLLDLQRELGVSYL
FT                   FISHDMAVVERVSHRVAVMYLGQIVEIGPRRAIFENPQHPYTRKLMAAVPIADPRRRHR
FT                   ERSLLVDEIPSPVRKVGDEPVVAPLVRVGEGHYVARHPVGVYA"
FT   misc_feature    239508..240119
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.4e-57"
FT   misc_feature    239529..239552
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    239889..239933
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    240447..241019
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.4e-58"
FT   misc_feature    240468..240491
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    240789..240833
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(241265..241909)
FT                   /transl_table=11
FT                   /locus_tag="BB2521"
FT                   /product="LysE-family efflux protein"
FT                   /db_xref="GOA:A0A0H3LME2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LME2"
FT                   /protein_id="CAE33015.1"
FT                   /translation="MTPLAALLAFTVAATLLTITPGLDTALVLRTAAIDGPRRALLAGL
FT                   GVCAGCLAWGVAAALGLGALLAASSLAYDALRIAGAIYLCWLGARLLARSLRRRAGDAA
FT                   PGMLPAAPAGGGALQWFWRGCLTNMLNPKVGVFYVTFLPQFIPAGVDVLAFSLLLAALH
FT                   AALGLLWFAALVAATRPLSRWLARPSVARGLDRLSAGVFIAFGLKLALERR"
FT   misc_feature    complement(241355..241702)
FT                   /note="HMMPfam hit to PF01810, DE LysE type translocator,
FT                   score 4.7e-05"
FT   misc_feature    complement(join(241388..241456,241484..241552,
FT                   241634..241687,241724..241792,241829..241897))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2521 by TMHMM2.0 at aa 5-27, 40-62, 75-92, 120-142 and
FT                   152-174"
FT   misc_feature    complement(241832..241909)
FT                   /note="Signal peptide predicted for BB2521 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.955) with cleavage site
FT                   probability 0.451 between residues 26 and 27"
FT   CDS_pept        242001..242537
FT                   /transl_table=11
FT                   /locus_tag="BB2522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT14"
FT                   /protein_id="CAE33016.1"
FT                   /translation="MALRATIYKADLHVADTDRHYYASHGLTIARHPSETDERMMVRVL
FT                   AYALHADEQLAFTKGLSDTDEPDLWRKDLTGDIELWVEVGQPDERRILKACGRAAEVVV
FT                   YCYGGHASQVWWDGVRGKLERARNLRVVCLPAAQTEALAQLARRTMQVHVNISDGAAFV
FT                   STDEGQVQVEPQSWR"
FT   CDS_pept        complement(242671..243861)
FT                   /transl_table=11
FT                   /locus_tag="BB2523"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0980"
FT                   /db_xref="GOA:A0A0H3LNI8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI8"
FT                   /protein_id="CAE33017.1"
FT                   /translation="MPMTTTAESPNIRRNTRLLSCAQALGGASPAIVISMGGLVGQMLA
FT                   GDPGLATLPVSLYNLGLAAGILPAAAMMRRRGRRGGYQLGALLGLLGGLLAAWGIWSGR
FT                   FALFCTGTALAGLYGAYVQSYRHAVTDGVRPEHRPRAISAIMSAGLVAAVLGTNAAIWT
FT                   RNLWPAAPFAGSFVSQAALALLALGVVSRLRAVPVGLAAAQAGRPLARIARTPRFIIAA
FT                   AAGVVSFGLMSLVMTAAPLAMVDCGHSVAAAALGIQWHVLAMYAPSFVTGRLIERFGKL
FT                   PVTALGLALMLAAAGVSLTGLSVPHFWAVLVLLGVGWNLGFIGATAMLADCCEPHERLR
FT                   VQALNDLLVFGCVAAASFSSGQLLAHGGWSIVNLTVFPAAAAVLLLLAWQERKARG"
FT   misc_feature    complement(join(242695..242763,242773..242841,
FT                   242875..242943,242953..243021,243046..243114,
FT                   243142..243210,243292..243360,243373..243441,
FT                   243496..243549,243559..243612,243646..243714,
FT                   243742..243801))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2523 by TMHMM2.0 at aa 21-40, 50-72, 84-101, 105-122,
FT                   141-163, 168-190, 218-240, 250-272, 281-303, 307-329,
FT                   341-363 and 367-389"
FT   CDS_pept        complement(243928..244500)
FT                   /transl_table=11
FT                   /locus_tag="BB2524"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0981"
FT                   /db_xref="GOA:Q7WJH0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJH0"
FT                   /protein_id="CAE33018.1"
FT                   /translation="MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRL
FT                   RVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGM
FT                   RRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFW
FT                   RAGQPLLVAECFLPAFWSLARAPVAPR"
FT   CDS_pept        244560..245291
FT                   /transl_table=11
FT                   /locus_tag="BB2525"
FT                   /product="putative RNA pseudouridylate synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0982"
FT                   /db_xref="GOA:A0A0H3LVK6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVK6"
FT                   /protein_id="CAE33019.1"
FT                   /translation="MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARAF
FT                   PDQAITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPLR
FT                   FERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGL
FT                   ALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIG
FT                   RVSLGDLPVGQWRYLRADERF"
FT   misc_feature    244569..244709
FT                   /note="HMMPfam hit to PF01479, DE S4 domain, score 0.00021"
FT   misc_feature    244749..245183
FT                   /note="HMMPfam hit to PF00849, DE RNA pseudouridylate
FT                   synthase, score 6.5e-08"
FT   CDS_pept        complement(245343..246260)
FT                   /transl_table=11
FT                   /locus_tag="BB2526"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0983"
FT                   /db_xref="GOA:A0A0H3LMF2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMF2"
FT                   /protein_id="CAE33020.1"
FT                   /translation="MELFVEVARTLSFSRAAENLAIPKSTLSRQVAELERSVGLRLLSR
FT                   TTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEA
FT                   FTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYAS
FT                   PDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMV
FT                   RNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFV
FT                   EFLMERLSNKTLAGQNNPAFLNLR"
FT   misc_feature    complement(245394..246020)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 4.7e-39"
FT   misc_feature    complement(246090..246260)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.3e-18"
FT   misc_feature    complement(246135..246227)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(246165..246230)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1328.000, SD 3.71 at aa 11-32, sequence
FT                   LSFSRAAENLAIPKSTLSRQVA"
FT   misc_feature    complement(246195..246242)
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   CDS_pept        246511..247701
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /gene_synonym="mtcA"
FT                   /gene_synonym="lir"
FT                   /locus_tag="BB2527"
FT                   /product="acriflavine resistance protein a precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0984"
FT                   /db_xref="GOA:A0A0H3LME8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LME8"
FT                   /protein_id="CAE33021.1"
FT                   /translation="MKNNYLVGRGIAALSLAALTLTLAACGKEQQAAQQGGQPQVGVVT
FT                   LKTQSVALSSELPGRTAAYRIAEVRPQVSGIVQKRLFTEGGEVAAGQQLYQIDPALYQA
FT                   EVDSRRAALARVQAQLKTATLLVQRYKPLVDTRAVSRQAYDDAVAARDQASADVLAAKA
FT                   ALDTARINLVYTKVLAPIGGIIGRSNVTEGALVTANQSAAVAAVQQIDPIYVDVTQSSV
FT                   QLLRLKSALDSGLLQREAGEQSARVTLTLEDGTQYDQDGKLQFSEVTVDPGTGSVLLRA
FT                   VFPNPQRKLLPGMFVRARLAEGVASEGLLVPQRGVTRNQRGLPTALVVNAENKVELRTL
FT                   KTDRAIGDQWLVSSGLAAGDRVIVEGLQSVRPGAEVKAAEWSPPASKAAAQPAAAK"
FT   misc_feature    246511..246591
FT                   /note="Signal peptide predicted for BB2527 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.682 between residues 27 and 28"
FT   misc_feature    246556..246588
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    246703..247602
FT                   /note="HMMPfam hit to PF00529, DE HlyD family secretion
FT                   protein, score 8.5e-69"
FT   CDS_pept        247714..250893
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /gene_synonym="acrE"
FT                   /locus_tag="BB2528"
FT                   /product="acriflavine resistance protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0985"
FT                   /db_xref="GOA:A0A0H3LT18"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT18"
FT                   /protein_id="CAE33022.1"
FT                   /translation="MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISI
FT                   NVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQ
FT                   VQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQ
FT                   DPISRTPGVGDFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQ
FT                   PAVRGQQLNATVIGPSRLQTPEAFGRILLKVNSDGSQVRLKDVASIELGAQTYAIDSYY
FT                   NGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGV
FT                   VKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMSQITGALIGIAMVLAAVFVPMAF
FT                   FGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNR
FT                   TFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQ
FT                   APAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNE
FT                   RKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEK
FT                   LLAARNQLLQEAGTSPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAW
FT                   GSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGP
FT                   QKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQ
FT                   APALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATLTRGLSNDVYFQVGL
FT                   LTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAI
FT                   STGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGG
FT                   AQPATHGGQPQ"
FT   misc_feature    247714..247815
FT                   /note="Signal peptide predicted for BB2528 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.961) with cleavage site
FT                   probability 0.721 between residues 34 and 35"
FT   misc_feature    247714..250797
FT                   /note="HMMPfam hit to PF00873, DE AcrB/AcrD/AcrF family,
FT                   score 0"
FT   misc_feature    join(247750..247818,248722..248790,248809..248877,
FT                   248887..248955,249025..249093,249121..249189,
FT                   249331..249399,250318..250386,250405..250473,
FT                   250486..250554,250627..250695,250723..250791)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2528 by TMHMM2.0 at aa 13-35, 337-359, 366-388, 392-414,
FT                   438-460, 470-492, 540-562, 869-891, 898-920, 925-947,
FT                   972-994 and 1004-1026"
FT   CDS_pept        250890..252356
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /gene_synonym="ibeB"
FT                   /locus_tag="BB2529"
FT                   /product="probable outer membrane lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0986"
FT                   /db_xref="GOA:A0A0H3LNJ3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ3"
FT                   /protein_id="CAE33023.1"
FT                   /translation="MKPAVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYG
FT                   APGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARAQYRIQRA
FT                   DLAPSVGVGGTGSVQRTPADLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQ
FT                   LYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGV
FT                   ATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDG
FT                   VVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASL
FT                   GGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDA
FT                   LAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVET
FT                   RLARLSNLIQLYKALGGGWSERTVAAAQAS"
FT   misc_feature    250890..250961
FT                   /note="Signal peptide predicted for BB2529 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.604 between residues 24 and 25"
FT   misc_feature    250920..250952
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    251100..251705
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 1.1e-44"
FT   misc_feature    251751..252344
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 3.3e-55"
FT   CDS_pept        complement(252426..252677)
FT                   /transl_table=11
FT                   /locus_tag="BB2530"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0987"
FT                   /db_xref="GOA:A0A0H3LVL0"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVL0"
FT                   /protein_id="CAE33024.1"
FT                   /translation="MSIIIMIIVGFVVGLIARAIMPGDQNMGYIMTTILGIIGSVVAGF
FT                   LGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA"
FT   misc_feature    complement(join(252441..252500,252528..252596))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2530 by TMHMM2.0 at aa 2-24 and 34-53"
FT   CDS_pept        complement(252823..253473)
FT                   /transl_table=11
FT                   /locus_tag="BB2531"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0988"
FT                   /db_xref="GOA:A0A0H3LMF7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMF7"
FT                   /protein_id="CAE33025.1"
FT                   /translation="MRAPHRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSL
FT                   YNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQL
FT                   GEQARDVRILFVSVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRVAYQIE
FT                   KPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ"
FT   misc_feature    complement(252877..253401)
FT                   /note="HMMPfam hit to PF02630, DE SCO1/SenC, score 1.4e-26"
FT   misc_feature    complement(253351..253473)
FT                   /note="Signal peptide predicted for BB2531 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.981) with cleavage site
FT                   probability 0.737 between residues 41 and 42"
FT   misc_feature    complement(253366..253398)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(253629..255743)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /gene_synonym="opdA"
FT                   /locus_tag="BB2532"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0989"
FT                   /db_xref="GOA:A0A0H3LMF3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMF3"
FT                   /protein_id="CAE33026.1"
FT                   /translation="MACAPFGPRPLVHGIPKPMTQNPLLAPVADLVDYAAVKPEHIVPA
FT                   VQALLDIARAAVEHAADPALPATWDAVVAPLDSASERLWRAWSVAGHLNAVVNTPVLRE
FT                   AYNAALPLVTEFSTWVGLHEGLYRQYQRLQAAEDFAAWPPVRRRVVELALRDFRLSGVE
FT                   LQGAARERYAEISDREAQASQKFSENVLDAIDAWSLLVDDQARLDGIPADVLAAARKAA
FT                   EDDGATGWKLTLKMPCYLPVMQYARDRALRETLYRAYGTVASEHGDAAYDNSPLIEELL
FT                   QLRADEAGLLQYPTFAALRLQTRMARDATEVVDFLRDLARRAKPYAERDLAELQAFATG
FT                   ELGLAELQPWDVPFAAERLRESRYAYSEDEIKQYFTEPRVLAGLFEVIETLFDVRLREV
FT                   PVSSWHADVRGVRVESPAGATLGHLYLDLYARAGKQSGAWVDSERSRRRVQGDLQTPVA
FT                   YLTCNFSRPNGDKAALLTHDDVITLFHETGHALHALLSEVDEPGAAAFASVEWDAIELP
FT                   SQFMENFCWEWSVVQKLSAHVETGQPLPRDLYDRLVAARNFQSGMQTVRQIEFALFDMM
FT                   LHDRPQGAPIADVLALLQQVRQEVAVLFPPAWHRLPHSFSHLFAGGYGAGYYSYKWAEV
FT                   LSADAYEAFEEAARQGEPAATTLDGATGARFRKEILAVGGARPAADSFRAFRGREPRID
FT                   ALLRHSGMQA"
FT   misc_feature    complement(253638..255020)
FT                   /note="HMMPfam hit to PF01432, DE Peptidase family M3,
FT                   score 4.2e-154"
FT   CDS_pept        complement(255819..256670)
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BB2533"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate dehydrogenase and
FT                   methylenetetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0990"
FT                   /db_xref="GOA:Q7WJG1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJG1"
FT                   /protein_id="CAE33027.1"
FT                   /translation="MTARIIDGAALSQRIREEVAQRVQALTAKGVRPGLAVVLVGDDPA
FT                   SQVYVRNKVAACEKAGLHSVKEQYPADLTEAQLLERIDALNRDPSIHGILVQLPLPRHM
FT                   DAHKVIEAIAAEKDVDGFHISNAGLLMTGQPLFRPCTPYGVMKMLESEGVALRGAEAVI
FT                   VGASNIVGKPMAMLLLQAGATITICNSKTRDLGAQTRRADVLVVATGKPGMIDGSMIKP
FT                   GAVVIDVGINRGADGKLCGDVDMASAREVAGAISPVPGGVGPMTIAMLLVNTVEAAERA
FT                   AA"
FT   misc_feature    complement(255825..256307)
FT                   /note="HMMPfam hit to PF02882, DE Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain, score
FT                   3.5e-92"
FT   misc_feature    complement(255870..255896)
FT                   /note="PS00767 Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 2."
FT   misc_feature    complement(256311..256670)
FT                   /note="HMMPfam hit to PF00763, DE Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain, score
FT                   5.5e-67"
FT   misc_feature    complement(256371..256448)
FT                   /note="PS00766 Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 1."
FT   CDS_pept        complement(256667..257293)
FT                   /transl_table=11
FT                   /locus_tag="BB2534"
FT                   /product="two-component response regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0991"
FT                   /db_xref="GOA:A0A0H3LT22"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT22"
FT                   /protein_id="CAE33028.1"
FT                   /translation="MNTPHLSSTVFIVDDDEAVRDSLRWLLEANGYRVRAYASGENFLD
FT                   EYDASQIGVLIADVRMPGMSGLELQEQLIARNAPLPIVFITGHGDVPMAVSTMKKGAVD
FT                   FLEKPFNESDLREIVARMLEQAVQRISKFQAQKDHEAMLARLTAREQQVLERIVAGRLN
FT                   KQIADDLGISIKTVEAHRANIMEKLEVTTVADLMKVALAKPEAHA"
FT   misc_feature    complement(256673..256867)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00196, DE Bacterial regulatory
FT                   proteins, luxR family, score 8.9e-20"
FT   misc_feature    complement(256733..256816)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(256913..257272)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 6.6e-40"
FT   CDS_pept        complement(257290..259044)
FT                   /transl_table=11
FT                   /locus_tag="BB2535"
FT                   /product="tw-component sensor kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0992"
FT                   /db_xref="GOA:A0A0H3LNJ8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ8"
FT                   /protein_id="CAE33029.1"
FT                   /translation="MSSPPKSNIPMSFRDHARARRRGVYWLTPALVLVLYICVMGVFFW
FT                   LQRIHDDSVMFVTIDQELRQQRLIWVVLALSCVIVISLLMLWRYTRFRSEAEAALIAET
FT                   GFRRAMENSMSTGMRVLDMEGRIAYVNPAFCRMIGWNEADLIGRSPPFPYWVPGRHEQH
FT                   QHTLEVLTSGKTPSSGLEVEAQRRDGSRFTARMYVSPLLDPNGDQIGWMTSMTDITEPK
FT                   RIREALTAAHERFMTVLEGLDDAISVTADTHDGLELLFANRTYRRVFGAQTGGHDELLA
FT                   GRRGRFTDESVEVFAPSVQRWFEVHHRMLAWTDGRRVRMQVARDITERRVHEEASRVQQ
FT                   EKIQLTSRLTTMGEMASSLAHELNQPLTAIANYSMGAVALVKAGHTSPNMLLPALEKAA
FT                   SQAERAGKIISRIREFVKRSEPRRQRVAISRIVDNAIGFAEIDARKRRIRIERFVPSNA
FT                   PDVLADPILIEQVLLNLLKNGLEAMEKSESDELKVAVIPHEQHIEVAVVDRGHGLPEPE
FT                   RLFEPFFSTKSQGLGMGLNICRTIIESHHGRLWADPNPAGGTIFRFTLPCATPQSQAQN
FT                   DQSEELHA"
FT   misc_feature    complement(257341..257658)
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.6e-32"
FT   misc_feature    complement(257782..257994)
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 1.3e-08"
FT   misc_feature    complement(258382..258510)
FT                   /note="HMMPfam hit to PF00785, DE PAC motif, score 4.2e-07"
FT   misc_feature    complement(258535..258732)
FT                   /note="HMMPfam hit to PF00989, DE PAS domain, score
FT                   6.7e-10"
FT   misc_feature    complement(join(258778..258846,258907..258975))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2535 by TMHMM2.0 at aa 24-46 and 67-89"
FT   CDS_pept        259337..262042
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="BB2536"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0993"
FT                   /db_xref="GOA:A0A0H3LVL5"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVL5"
FT                   /protein_id="CAE33030.1"
FT                   /translation="MSSFAQAGALAAANDEDTLETQEWLEALAAVLDREGPQRAHYLLE
FT                   RLIDEARRSGAHIPFSPNTAYVNTIPPGLEPAHPGNLELEARIRSYVRWNAMAMVVRAN
FT                   KHNPPDGGDLGGHIASFASLATMIGCGQNHFWHGETEEHGGDLVYFQGHTSPGMYGRAY
FT                   LEGRLTEDQLNHFRQEVDGKGLSSYPHPKLMPDFWQFPTVSMGLGPLMAIYQARFLKYL
FT                   HARGIADTSNRKVWVFCGDGEMDEPESLGAIALAAREKLDNLIFVINCNLQRLDGPVRG
FT                   NGKIIQELEGDFRGSGWNVIKLIWGGYWDPLLAHDKEGILRRIMEEAVDGEYQAYKAND
FT                   GKYVREHFFGKHPKLLEMVARMSDEDIWRLNRGGHDPHKVYAAFDAASKHAGQPTVILA
FT                   KTIKGYGMGHVGQAKNPTHQQKKLELDSIREFRDRFGIPIPDDKLEELPYYKPAEDSPE
FT                   MQYLHERRKALGGYLPKRRAKADEQLKAPALDAFKAVLEPTAEGREISTTQAFVRVLNQ
FT                   ILRDKDLGPRVVPILADESRTFGMEGLFRQIGIYAPEGQKYTPVDKDQVMYYKESADGQ
FT                   LLQEGINEAGAMSSWMAAATSYSTNNRIMVPFYIYYSMFGFQRVGDLAWAAGDMQARGF
FT                   LLGGTAGRTTLNGEGLQHEDGHSHLLASTIPNCVSYDPTFAHELAVIIQHGLKRMVEDQ
FT                   ENVYYYLTVMNENYPQPGLTAGDEEGIIRGMYKLKSHGKGKQRVQLMGSGTILREVMAA
FT                   QELLEADWGVASDIWSVTSFTELRRDGLDAERHNLLHPEGKQQVPYVTTQLAKSEGPII
FT                   ASTDYMKLFADQIRPFVPKDRTYKVLGTDGFGRSDFRYKLREHFEVDRHFVVLASLRAL
FT                   ADEGKIPAAKVAEAIKKYGINPNKANPHHA"
FT   misc_feature    259586..260758
FT                   /note="HMMPfam hit to PF00456, DE Transketolase, thiamine
FT                   diphosphate binding domain, score 5e-06"
FT   CDS_pept        262055..263710
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="BB2537"
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0994"
FT                   /db_xref="GOA:A0A0H3LMG2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMG2"
FT                   /protein_id="CAE33031.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKA
FT                   SMEIPASAAGVVKSVKVKVGDKIAEGTVILEVEAAGEAAAAPKAEQAPEAAEAPKADAA
FT                   KAEAPQAEAPAAAGPIEVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASME
FT                   IPASAGGVVQSLKVKVGDKVAMGTVIAVVQGQGAAAPAAKAEAPAAAPAAAEPAAPASP
FT                   AAPAPAPAQRPAPAAALQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITA
FT                   DDVRAYVKQALSAGAPAGASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGAN
FT                   LHRNWVMIPHVTNNDEADITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPE
FT                   FNASLDGDNLVLKQYYHIGFAADTPNGLVVPVVRDADKKGILELARETSELARKAREGK
FT                   VSPAEMQGGCFSISSLGGIGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLP
FT                   LSLSYDHRVIDGASAARFNAYLGQLLADFRRIAL"
FT   misc_feature    262067..262285
FT                   /note="HMMPfam hit to PF00364, DE Biotin-requiring enzyme,
FT                   score 1.4e-23"
FT   misc_feature    262136..262225
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    262412..262630
FT                   /note="HMMPfam hit to PF00364, DE Biotin-requiring enzyme,
FT                   score 1.7e-22"
FT   misc_feature    262481..262570
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    262802..262918
FT                   /note="HMMPfam hit to PF02817, DE e3 binding domain, score
FT                   2.3e-13"
FT   misc_feature    263018..263704
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00198, DE 2-oxo acid dehydrogenases
FT                   acyltransferase (catalytic domain), score 2.3e-122"
FT   CDS_pept        263723..265498
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /gene_synonym="lpd"
FT                   /locus_tag="BB2538"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0995"
FT                   /db_xref="GOA:A0A0H3LMF8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMF8"
FT                   /protein_id="CAE33032.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKA
FT                   SMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAAGEAAAAPKAEAPKTEAPKAEAPKA
FT                   PAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVERYATLGGVC
FT                   LNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDSVVAKLTGGLAGM
FT                   ARARKVRVVTGTGEFADPHHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPDDERIV
FT                   DSTGALQLRAIPKKMLIIGGGIIGLEMGTVYSTLGARLDVVEMLDGLMQGADRDLVKVW
FT                   QKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPNGKKI
FT                   GAERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEAAHGEK
FT                   SFFDARVIPSVAYTDPEVAWVGLTEDEAKKQGVKVEKGLFPWAASGRAIANGRDEGFTK
FT                   LLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMVDIGKTIHPHPTLGESVGMAAE
FT                   VAEGVCTDLPPMRKK"
FT   misc_feature    263735..263953
FT                   /note="HMMPfam hit to PF00364, DE Biotin-requiring enzyme,
FT                   score 8.7e-24"
FT   misc_feature    263804..263893
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    264098..265048
FT                   /note="HMMPfam hit to PF00070, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.4e-83"
FT   misc_feature    264200..264232
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   misc_feature    265118..265447
FT                   /note="HMMPfam hit to PF02852, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 1.2e-49"
FT   CDS_pept        complement(265721..266896)
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="BB2539"
FT                   /product="flagellin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0996"
FT                   /db_xref="GOA:Q06064"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06064"
FT                   /protein_id="CAE33033.1"
FT                   /translation="MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDA
FT                   AGQAIANRFTANVKGLTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTN
FT                   SASDIDSIQQEVNQRLEEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKI
FT                   DRNSNWNLYDAVGTVPGGTVNGEARTVNALGFDVLSAVTTTIASDTVTFDAAVAAAEQA
FT                   AGAAVGDGSVVSYGDTANPQYAVVVDNAGTMTSYALTFDKDGKAALGDQLGAVASQAAE
FT                   AAVGTNDVAAGANVTVSGGAADALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNTI
FT                   TNLSAARSRIEDSDYATEVSNMTKNQILQQAGTSVLAQANQVPQNVLSLLR"
FT   misc_feature    complement(265790..266005)
FT                   /note="HMMPfam hit to PF00700, DE Bacterial flagellin
FT                   C-terminus, score 7.9e-41"
FT   misc_feature    complement(266381..266812)
FT                   /note="HMMPfam hit to PF00669, DE Bacterial flagellin
FT                   N-terminus, score 2.6e-78"
FT   CDS_pept        complement(267283..268020)
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /gene_synonym="flaD"
FT                   /locus_tag="BB2540"
FT                   /product="RNA polymerase sigma factor for flagellar operon"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1021"
FT                   /db_xref="GOA:A0A0H3LT27"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT27"
FT                   /protein_id="CAE33034.1"
FT                   /translation="MPNPEDSLVQYAPLVRKLALQLLARLPSSVQLDDLVQAGMIGLLD
FT                   AVRRYQESPDAQFETYATARIRGAMLDELRSQDWLPRSVRSKSRRIETAIQRKEQELMR
FT                   APSEGEIAEELGVPLAEYQGMLADAQGVQILHYEDFNTDGDSDSPWAESSAEHADPLDA
FT                   LLAGDLRRALIDAIDGLPEREKLLLSLCYEQGLNLKEIGAVLNVTEARVCQLRAQATAR
FT                   IRARLKEQAWARLPTAHHLAQVV"
FT   misc_feature    complement(267346..268017)
FT                   /note="HMMPfam hit to PF00140, DE Sigma-70 factor, region
FT                   1.2, score 2.8e-59"
FT   misc_feature    complement(267370..267435)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1172.000, SD 3.18 at aa 196-217, sequence
FT                   LNLKEIGAVLNVTEARVCQLRA"
FT   misc_feature    complement(267880..267921)
FT                   /note="PS00715 Sigma-70 factors family signature 1."
FT   CDS_pept        268456..268779
FT                   /transl_table=11
FT                   /gene="flhD"
FT                   /gene_synonym="flbB"
FT                   /gene_synonym="frlA"
FT                   /locus_tag="BB2541"
FT                   /product="flagellar transcriptional activator FlbB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1022"
FT                   /db_xref="GOA:Q44730"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44730"
FT                   /protein_id="CAE33035.1"
FT                   /translation="MKTADSSLLADIREVNLSYLLLAQRMLRDDYAASMFRLGFSNEVA
FT                   DILMRLSPAQLVKLASSSSLLCRFRFDDYSLLSALTQDVLGGALQQAHATILLARQPVE
FT                   ELA"
FT   CDS_pept        268814..269374
FT                   /transl_table=11
FT                   /gene="flhC"
FT                   /gene_synonym="flaI"
FT                   /gene_synonym="frlB"
FT                   /locus_tag="BB2542"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1023"
FT                   /db_xref="GOA:A0A0R4J910"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J910"
FT                   /protein_id="CAE33036.1"
FT                   /translation="MATKSVSQEADEILLASSMITLGARLQVLQAETGLSHDRLARLYR
FT                   EIRGCSPPKGMLPFSVDWFMTWLPNIHSSLFYNVYTFLNQRTSSRGIRAVIDAYRLYLE
FT                   HAPADAAEPVLSFTRAWMLVRFFDGGMLQLSGCRQCGGHFIAHAHDPQTDFVCAICRPP
FT                   PRAGKTRAAARARAGQLAAPARP"
FT   CDS_pept        269495..270370
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BB2543"
FT                   /product="chemotaxis protein MotA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1024"
FT                   /db_xref="GOA:A0A0H3LVM0"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVM0"
FT                   /protein_id="CAE33037.1"
FT                   /translation="MLIVIGYAVVILAVVGSFIGLGGHLGALYQPFELTLIAGAAVGAF
FT                   MAGNSRKSLGLVAKAIPEAFRSSPYSKDVYMELMALLYVLLNKARREGLMAIESHIEDP
FT                   LSSPIFNEYPRIMKDAKLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPTH
FT                   ALQQVADALPAFGIVAAVLGVIKALAAVDQPPAILGDLISKAMVGTFLGVLLAYGFVAP
FT                   MAARIERRTSESVKVLECIKVTLLASMNGYPPQLAVEFGRKVLFSAVRPSFGELEEHVR
FT                   QAKSAATGRA"
FT   misc_feature    join(269498..269566,269576..269644,269996..270064,
FT                   270107..270175)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2543 by TMHMM2.0 at aa 2-24, 28-50, 168-190 and 205-227"
FT   misc_feature    270107..270160
FT                   /note="PS01307 Flagellar motor protein motA family
FT                   signature."
FT   CDS_pept        270383..271330
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BB2544"
FT                   /product="chemotaxis protein MotB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1025"
FT                   /db_xref="GOA:A0A0H3LMG7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMG7"
FT                   /protein_id="CAE33038.1"
FT                   /translation="MSTVNNHRVVIRRRKVRRGGHHGGSWKIAYADFITAMMAFFLVMW
FT                   LISIVPREELKGIAEYFRMPLRVALTGGPSSSAETSAIPGGGQDPLRSQGDVRRAEGNR
FT                   VEAQPMGDAERRDRHRLERLKVRLENLIEESPVLKNFRPQLLIDMTTEGLRIQIVDNQN
FT                   RPMFATGSADVQPYMRDILRELGPVLNDLPNKISIAGHTDASQYARGERAYSNWELSAD
FT                   RANASRQELVAGGMHEGKVLRIQGLASSMSLVKDDPFAAVNRRISLVVLNASTQRRIEN
FT                   ENAAAADVNARDAQGVGAALAGQLAASGSDGGAR"
FT   misc_feature    270464..270532
FT                   /note="1 probable transmembrane helix predicted for BB2544
FT                   by TMHMM2.0 at aa 28-50"
FT   misc_feature    270878..271174
FT                   /note="HMMPfam hit to PF00691, DE OmpA family, score
FT                   7.9e-21"
FT   CDS_pept        271345..271725
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BB2545"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1026"
FT                   /db_xref="GOA:A0A0H3LMG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMG3"
FT                   /protein_id="CAE33039.1"
FT                   /translation="MTARILVADDSATMRMIVQAALTGAGWQVVTASDGKQALELAQAQ
FT                   AVDLVVSDWNMPVMGGLDLIRGLRGQARYQDLPVLVLTTEDDGDSKAAARDLGVCGWLN
FT                   KPLDPDVLVDLAAELLGVAPGA"
FT   misc_feature    271351..271716
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 7.6e-29"
FT   CDS_pept        271752..273815
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BB2546"
FT                   /product="chemotaxis protein CheA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1028"
FT                   /db_xref="GOA:A0A0H3LT32"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT32"
FT                   /protein_id="CAE33040.1"
FT                   /translation="MSSGLDLSQFYETFFDEADELLAQMEQLLLELDVGAPDIEQLNAI
FT                   FRAAHSIKGGAATFGCFQKLAGTTHLLENLLDAIRRGEMGLRAGMVDIFLETKDVLKSQ
FT                   LDAYRASEEPEDAVFERICAVLRQLALEGGQAPAAAAPAPVAAPEPGPEPAPAPQPAAA
FT                   STAAGLPLRVRFSKVSDKDAQSLLEEMGNLGDVRASERAGQTLTVWVDTTCSPDDIEAV
FT                   CCFIIDADQLEIAREAEPAHASAQAAVAAAPDAAATPAPAPVAAPAAAQAAEPARAARP
FT                   SIAPAHADKESTSIRVGVEKVDQVINLVGELVITQAMLAQTASTLDPVLHDRLLNGMEQ
FT                   LERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDIAGKMGKQIELQTYGRATELDKSLIE
FT                   RIIDPLTHLVRNSLDHGIETPDKRVAAGKEPVGQLVLSAQHNGGNIVIEVSDDGGGLSR
FT                   ERILRKAVAQGLTVNENSPDDEIWQLIFAPGFSTADQVTDISGRGVGMDVVRRNIQDMG
FT                   GHVQLSSVPGQGTTTRIVLPLTLAILDGMSVRVGEETFILPLNHVTESLQPQADQIYSV
FT                   AGNERVMQVRGEYLPLVEMHRVFSVGQAQADPTQAIAVIMQAEERRFALLVDHLVGQHQ
FT                   VVVKNLESNYRKVPGISAATILGDGSVALIVDVFALARANREKWSQPEAILN"
FT   misc_feature    271770..272087
FT                   /note="HMMPfam hit to PF01627, DE Hpt domain, score 2e-35"
FT   misc_feature    271791..271817
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT   misc_feature    272625..272816
FT                   /note="HMMPfam hit to PF02895, DE Signal transducing
FT                   histidine kinase, homodimeric domain, score 1.6e-22"
FT   misc_feature    272949..273368
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.1e-25"
FT   misc_feature    273375..273779
FT                   /note="HMMPfam hit to PF01584, DE CheW-like domain, score
FT                   6.1e-32"
FT   CDS_pept        273830..274330
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BB2547"
FT                   /product="chemotaxis protein CheW"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1029"
FT                   /db_xref="GOA:A0A0H3LNK8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNK8"
FT                   /protein_id="CAE33041.1"
FT                   /translation="MAAKPHTQATRAEDVGNEFLVFTLGEEEYGIDILKVQEIRGYDAA
FT                   TVTRIANVPSFIKGVTNLRGIIVPIVDLRIKFNLGSVEYNEQTVVIILNLDRRVVGIVV
FT                   DGVSDVLMLNAAQVRPAPEFGATLSTEYLTGLGTVDERMLILVDIEKLMTSDEMALVEK
FT                   VAS"
FT   misc_feature    273875..274300
FT                   /note="HMMPfam hit to PF01584, DE CheW-like domain, score
FT                   5.6e-49"
FT   CDS_pept        274404..276110
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BB2548"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1030"
FT                   /db_xref="GOA:A0A0H3LVM5"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVM5"
FT                   /protein_id="CAE33042.1"
FT                   /translation="MRKFLANLSIRGSLLGVLAFFSFMLVVGAALGVLSLRVSNDTLQG
FT                   VKQTQDVADAMDRVVNSYKDALNGLGRAAASHYGAIVSAIGQPVQVEQGLGSEAAGLLQ
FT                   RAKASLNRAETEYEYYKGLARPASAADSLKEVENAFEALVGQGLHPLAAALEKGDMAGY
FT                   QLHAQNVLDALEGRFSGAIAAFDFWRASELLDAHEVAETRYRFVLAAVAAGGVLAALLV
FT                   FSTYLFLRRRVLQPLREVGQHFDKIAAGDLTARVDVRNSNEIGQLFAGLKRMEESLTRT
FT                   VAAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQ
FT                   ANQLAGVASDVAERGGSAVSEVVATMQDISASSRKISEIVSVIDGIAFQTNILALNAAV
FT                   EAARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVGKVGTGSQQVERAGATMQ
FT                   EIVASVKRVTDIMGEISAASDEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQ
FT                   EQAQRLAEAVAVFRINAGEVIDLPARQLGSRQAPGARETALAHDDALALGH"
FT   misc_feature    274404..274490
FT                   /note="Signal peptide predicted for BB2548 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.658 between residues 29 and 30"
FT   misc_feature    join(274446..274514,275019..275087)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2548 by TMHMM2.0 at aa 15-37 and 206-228"
FT   misc_feature    275034..275243
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   9.7e-14"
FT   misc_feature    275304..276002
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 3.7e-111"
FT   CDS_pept        276119..276979
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /gene_synonym="cheX"
FT                   /locus_tag="BB2549"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1031"
FT                   /db_xref="GOA:A0A0H3LMH3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMH3"
FT                   /protein_id="CAE33043.1"
FT                   /translation="MATAMTTPAFSAERQFEFRDADFARVRQMIYARAGISLGAHKREM
FT                   VYSRLARRLRALGQQEFRVYLDGLENEPAAPEWEDFVNALTTNLTAFFRESHHFPILAD
FT                   FARQRGGPVSVWCCAASTGEEPYSIAMTLVESLGARAQASQLLATDIDTNCLQRARAGV
FT                   YPYERVAKLDPARLKRFFMRGRGANEGQVKVRAELADMVRFETLNLLAPHWPINEKFDA
FT                   IFCRNVMIYFDKPTQARILRRFVPLLKPGGLLFAGHSENFTYISRDFRLRGQTVYEQAS
FT                   GELPV"
FT   misc_feature    276173..276343
FT                   /note="HMMPfam hit to PF03705, DE CheR methyltransferase,
FT                   all-alpha domain, score 5.8e-16"
FT   misc_feature    276380..276955
FT                   /note="HMMPfam hit to PF01739, DE CheR methyltransferase,
FT                   SAM binding domain, score 9.7e-77"
FT   CDS_pept        276976..278028
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BB2550"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1032"
FT                   /db_xref="GOA:Q7WJE7"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJE7"
FT                   /protein_id="CAE33044.1"
FT                   /translation="MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELI
FT                   KKHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDF
FT                   VTKPKLGIRDGLIEYSEVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVG
FT                   ASTGGTEAIREVLQPLPADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVL
FT                   PGHVYLAPGGETHMRLGRSGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVI
FT                   LTGMGKDGAAGLLAMKRAGARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERIL
FT                   TRLGDRGHRV"
FT   misc_feature    276985..277356
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 1e-31"
FT   misc_feature    277450..278001
FT                   /note="HMMPfam hit to PF01339, DE CheB methylesterase,
FT                   score 2e-110"
FT   CDS_pept        278081..278470
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BB2551"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1033"
FT                   /db_xref="GOA:A0A0H3LMG9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMG9"
FT                   /protein_id="CAE33045.1"
FT                   /translation="MVDKGMKILVVDDFPTMRRIIRNLLKELGFENVDEAEDGAIGLEK
FT                   LRNGAFQFVVSDWNMPNLDGLEMLKQIRADAALKSLPVLMVTAEAKKENIVAAAQAGAN
FT                   GYVVKPFTAATLEEKLNKIFEKLAG"
FT   misc_feature    278096..278464
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 2.3e-41"
FT   CDS_pept        278479..279111
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="BB2552"
FT                   /product="chemotaxis protein CheZ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1034"
FT                   /db_xref="GOA:A0A0H3LT37"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT37"
FT                   /protein_id="CAE33046.1"
FT                   /translation="MNATDTGMQADPTDLIQRIASLTRMLRDSMRELGLDQAIKDAAEA
FT                   IPDARDRLRYVAQMTEQAANRVLNATEAAGPIQDGMARGAQALDARWQQWYDQPLELPQ
FT                   ARVLVQDTRAFLAAVPQHTQQTQAKLMEIVMAQDFQDLTGQVIMRMMDVVGAIERELLQ
FT                   VLLDNVPQERRDEANSLLNGPQVNPGGKADVVTSQDQVDDLLASLGF"
FT   CDS_pept        279339..280493
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BB2553"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1366"
FT                   /db_xref="GOA:A0A0H3LNL3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNL3"
FT                   /protein_id="CAE33047.1"
FT                   /translation="MAEESDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVAG
FT                   VWLSGSMLYQGLTGVLRRGLGFEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVA
FT                   VLSAVLLGGFVFSTKPLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWV
FT                   IWHYHDDMLGLMHVAPSAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRM
FT                   TKEDVRQEHKESEGDPHVKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYAD
FT                   GEAGAPRVVAKGTGLIAARIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAV
FT                   AEVLAWVFQLRSWRPGLGREPQAPTALAVPAELDPHSPPATQGA"
FT   misc_feature    279354..280382
FT                   /note="HMMPfam hit to PF01312, DE FlhB HrpN YscU SpaS
FT                   Family, score 4.2e-143"
FT   misc_feature    join(279444..279512,279618..279686,279765..279833,
FT                   279891..279959)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2553 by TMHMM2.0 at aa 36-58, 94-116, 143-165 and
FT                   185-207"
FT   CDS_pept        280497..282614
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BB2554"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1367"
FT                   /db_xref="GOA:A0A0H3LVM9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVM9"
FT                   /protein_id="CAE33048.1"
FT                   /translation="MSALLSMLKTNGAANAKLLAGPILIVLVLGMMVLPLPTFLLDLLF
FT                   TFNIALSVMILLVAMFTRKPLDFAAFPSVLLFATLLRLSLNVASTRVVLLNGHQGPDAA
FT                   GKVIEAFGHFLVGGNFAVGIILFVILTIINFIVITKGAGRIAEVGARFTLDAMPGKQMA
FT                   IDADLNAGLIGEDEARKRRAEVAQESDFFGSMDGASKFVRGDAIAGLLIMVINVIGGLI
FT                   VGVAQHDLSVGESARVYTLLTIGDGLVAQIPALVISTAAGVVVSRVATDQDVGQQILSQ
FT                   LFSNPNVMFLTAAIVGIMGLIPNMPHLAFLTLAALLAGCGWMVYKRNLAAASQAQQPAE
FT                   TAAAQAQAAASEATWEDVSMVDQLGLEVGYRLIPLVDHAQNGELLHRIRSLRKKFAQDV
FT                   GFLPPVVHIRDNLELKPNDYRILLSGVEIGRGVAMPGQWLAIDPGGVAMQVKGTPTTDP
FT                   AFGLPALWIDSGQRDQAQVAGYTVVDASTVVATHLNHLMHRHGDNLLGRQEVQALIERI
FT                   GRESPKLVEDLVPKTLSLTTLQKVLQGLLAEEVPIRDMRTIVDTLSEHAPRLAALAANA
FT                   GGQPDVHELVALTRRSLGRAITQQWFPGEGELRVIGLDVRLERVLTQAMATSGGLEPGL
FT                   AETLLRETEAALARQEAQGNAPVLLTSPPLRAPLSRFLRHHLPQLGVLSNAEIPDERVV
FT                   RVTALIGGNGE"
FT   misc_feature    join(280530..280598,280611..280679,280713..280781,
FT                   280839..280907,281112..281180,281238..281306,
FT                   281343..281402,281412..281471)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2554 by TMHMM2.0 at aa 12-34, 39-61, 73-95, 115-137,
FT                   206-228, 248-270, 283-302 and 306-325"
FT   misc_feature    280575..282578
FT                   /note="HMMPfam hit to PF00771, DE FHIPEP family, score 0"
FT   misc_feature    280926..280997
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT   misc_feature    281424..281456
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        282611..284983
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BB2555"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1368"
FT                   /db_xref="GOA:A0A0H3LMH9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMH9"
FT                   /protein_id="CAE33049.1"
FT                   /translation="MKLSRFVAASSREVMRLVREALGPDALIVSNRSVAEGIEVVATLD
FT                   ETPAAAPATPLPDAPAAPPADMPAADAAAPLSMARLPDAPMPAAMPAGRVAPGLEAGVQ
FT                   AAIDALRGSLESRMDGLLWSTREGPGREPVGAGLFRALLEAGFSMPLARILLERLPQAL
FT                   DATQALAWARNELVTHLPVLRREDDLLAGGGVFALVGPTGVGKTTTLAKLAARCVAREG
FT                   REQVAMLTTDNFRIGALEQLQIYGRLMGIPAHSVRDADELRDALGSLGNRRIILIDTTG
FT                   ISQRDRQVAGQAAMLCNAGKPVRRLLVLNAASQGDTLDEVAHAYRNGVGEDVVGCIITK
FT                   LDEASRLAPALDTAIRHRLPIHYVSYGQKVPEHMALARADELIDRTLATLQRVKPLYAP
FT                   SEADLAALCSASREQARDEPAQRRQMLAATLLGQGGAAARDLDGALDWLRDDPACAQAR
FT                   SDWRAAMAGPATARALGDAGLALARQAYPAASSRYLLAMHGKAALRAAGLPQATLLSAL
FT                   LMSDRGAALAAPAQQLMLQHGLLAAYAPGEPAGANPIQALLARTDYLSGALAQLPHVHV
FT                   FDAGSAPPWQALAGQDAGWLARCAGATRVQQDLCPTLLRAVARGLGYLPVGNVAVPGKG
FT                   SAPLALWAGSADVSLAARGQAPLAVRMVSARLLDPSSGRQVAQWFGLTNLAATQADAAT
FT                   LARWLVQYEQARGAFRYMAHAWAALPPDAGDAAALAARALAAGQLGAACWQLEHQAQAA
FT                   AMRQALPGLLGPGARKTPARLAPAALMKLFALLEMAG"
FT   misc_feature    283181..283777
FT                   /note="HMMPfam hit to PF00448, DE SRP54-type protein,
FT                   GTPase domain, score 2.5e-23"
FT   misc_feature    283208..283231
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(285001..285483)
FT                   /transl_table=11
FT                   /locus_tag="BB2556"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1370"
FT                   /db_xref="GOA:A0A0H3LMH4"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMH4"
FT                   /protein_id="CAE33050.1"
FT                   /translation="MNSAALKSCLERENALVVEFLHALEAETEALMDRRAHESLQAAVQ
FT                   RKEALADDLARLGAERDTLLSGAGLASGPAGTDAAAAAHPELGPLWQALQANAAQAREH
FT                   NQRNGTLIAVNLRHTQESLDALRQAAGTGAAATYDAQGRGKRGYSSAASGRAIVAT"
FT   CDS_pept        complement(285500..285790)
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="BB2557"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1371"
FT                   /db_xref="GOA:A0A0H3LT41"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT41"
FT                   /protein_id="CAE33051.1"
FT                   /translation="MKIQSSTSHPVGPNAVGARAEHAVAQAYGGGAQAGSGSAQVALSP
FT                   ASRQLLAQEGGSDIDVERVAAIRAAIASGQLRIDPTRIADSLIASARDLLK"
FT   CDS_pept        complement(285917..286627)
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="BB2558"
FT                   /product="flagella basal body P-ring formation protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1372"
FT                   /db_xref="GOA:A0A0H3LNL9"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNL9"
FT                   /protein_id="CAE33052.1"
FT                   /translation="MKSPRSRSIARLAALAILAGAMPRAAAEPPAQDPAELAAAAESYL
FT                   RQQLAALPGEPSITLDPLRTDRLDACEALTPFMPSGMRVRARMTVGLRCVAPRTWTVYA
FT                   QATVSVPGQYYVAARQIAPGKTIEAADLTTRDGDLVALPPGVITDAAAILGMRPAHRIA
FT                   AGQPIKGAGLRSAESVSRGQSVRITARGNGFVVSSEGQALDNAPPGATVQVRTASGQVV
FT                   SGIVQAAGLVEIQL"
FT   misc_feature    complement(285923..286426)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03240, DE FlgA family, score
FT                   1.5e-29"
FT   misc_feature    complement(286550..286627)
FT                   /note="Signal peptide predicted for BB2558 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.647 between residues 26 and 27"
FT   CDS_pept        286811..287218
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /gene_synonym="flbA"
FT                   /gene_synonym="fla FII"
FT                   /locus_tag="BB2559"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1373"
FT                   /db_xref="GOA:A0A0H3LVN3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVN3"
FT                   /protein_id="CAE33053.1"
FT                   /translation="MLDRLNEDFRFFQQSIALRAQRQEVLSSNIANADTPNYKARDFDF
FT                   KAAMQGALEQRMRLPDTNLALTSARHIPGQATTPSPAELMYRLPYQPSLDGNTVDMDSE
FT                   RVRFADNTLHYQSSLQVLSGRIRSLMSAIQE"
FT   misc_feature    286835..286927
FT                   /note="HMMPfam hit to PF00460, DE Flagella basal body rod
FT                   protein, score 1.9e-06"
FT   CDS_pept        287231..287650
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /gene_synonym="flaW"
FT                   /gene_synonym="fla FIII"
FT                   /locus_tag="BB2560"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1374"
FT                   /db_xref="GOA:A0A0H3LMI4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMI4"
FT                   /protein_id="CAE33054.1"
FT                   /translation="MSLLSIFEIAGSALSAQSQRMNVSASNMANADSVAGPDGQPYRAR
FT                   QVVFQVNPPPGQAFGQEIGGVRVAGVVEDQSPFKKIYDPKHPMADAQGYVNMPNVDPVA
FT                   ETVNMIAASRSYQANVEVLNTAKQLMLKTLTIGQS"
FT   misc_feature    287249..287344
FT                   /note="HMMPfam hit to PF00460, DE Flagella basal body rod
FT                   protein, score 1.1e-08"
FT   misc_feature    287267..287329
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT   CDS_pept        287698..288402
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /gene_synonym="flaV"
FT                   /gene_synonym="fla FIV"
FT                   /locus_tag="BB2561"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1375"
FT                   /db_xref="GOA:A0A0H3LMI1"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMI1"
FT                   /protein_id="CAE33055.1"
FT                   /translation="MTTVNETTSQAGLALAQAGSNSAAQGIQDQFLTLLVTQLRNQDPL
FT                   NPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMDAVSMIGKGVLMPGDKVS
FT                   LGTDPNDPAQRGATPFGIDLQGDATKVTVKVLDPSGAVVRTMELGDLKTGVHTLQWDGK
FT                   NDGGQPLADGKYSITVSASDAEAVPVKAEALTYGQVKSVAYSTNGLRLDLGLAGQISML
FT                   DVRKVIGASGSA"
FT   misc_feature    287698..287766
FT                   /note="Signal peptide predicted for BB2561 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.780) with cleavage site
FT                   probability 0.389 between residues 23 and 24"
FT   misc_feature    287701..288138
FT                   /note="HMMPfam hit to PF03963, DE Flagellar hook capping
FT                   protein, score 6.1e-32"
FT   CDS_pept        288469..289890
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /gene_synonym="flaK"
FT                   /gene_synonym="fla FV"
FT                   /locus_tag="BB2562"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1376"
FT                   /db_xref="GOA:A0A0H3LT46"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT46"
FT                   /protein_id="CAE33056.1"
FT                   /translation="MGFGQALSGLNAASQNLDVIGNNIANSGTVGFKSGAASFADVYAS
FT                   SRVGLGVKVSAINQRFTVGNISMTNGEYDMAIDGGKGFFRLTDQSGGVFYSRNGEFMVD
FT                   KNFYVVNAQGFRLTGYPAGAVGAQPVDLQLPPGNIAPRPASTAGLQGNLNANAKLINPN
FT                   DTPAVDGTVELDGTSYSFTNAGGVFAWVAPGPVDGTYNGGDIVIAGGAVTGDLASQPGY
FT                   QPYQPLVAGIPFDPTNPLSYTDQVPTTVYDSLGNSHQMVQYFAKRPAVGTESVYEVYYV
FT                   LDGQPMQVNGGASQTLNFDTAGNLLNQPPTAQVTFANPGGNAAPADPLAITVSYNGVTQ
FT                   YGSDFAPKVVQNGYSSGEYMGLSVGEDGSLVAKYTNGETQTIGTVVLANFNNVQGLKPV
FT                   GNNAWAETSESGQATLGQPGTNGLATIVGQALEGSNVDLSSELVNMIVAQRTYQANAQT
FT                   IQTQNEVMQVLMNMR"
FT   misc_feature    288475..288567
FT                   /note="HMMPfam hit to PF00460, DE Flagella basal body rod
FT                   protein, score 2e-10"
FT   CDS_pept        289929..290693
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /gene_synonym="flaX"
FT                   /gene_synonym="fla FVI"
FT                   /locus_tag="BB2563"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1377"
FT                   /db_xref="GOA:A0A0H3LNM3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNM3"
FT                   /protein_id="CAE33057.1"
FT                   /translation="MDRIIYTAMNGAARIAEHQTVLGNNMANVNTPGFREQIALYRSVP
FT                   MADGTSLPTRVSTVASTPGNNFEMGNMMTTGRELDVALAGPGWFALQTPQGEAYTRAGA
FT                   LQVGVNGLLQTATGQPVLSDQNAVIEVPDQASLTIASDGTVTAIGAGDPPNNILNLGRL
FT                   KMVNPPPQQLVHGDDGVFRMPQQPGGQPAAPLPADPSQRLLSGVLEGSNASPMGAMVGM
FT                   IQNARRFEMQMQVIREADKNAERANGILAAAS"
FT   misc_feature    289941..290033
FT                   /note="HMMPfam hit to PF00460, DE Flagella basal body rod
FT                   protein, score 1.7e-06"
FT   misc_feature    289959..290021
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT   CDS_pept        290737..291522
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /gene_synonym="flaL"
FT                   /gene_synonym="fla FVII"
FT                   /locus_tag="BB2564"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1378"
FT                   /db_xref="GOA:A0A0H3LVN8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVN8"
FT                   /protein_id="CAE33058.1"
FT                   /translation="MMRSLWVAKTGLEGQQTSMDVISNNLANVQTNGFKRGRAVFQDLM
FT                   YQTLRQPGAQVGDANQLPSGLQLGTGVQVAATQRVFSQGNMNNTGGEMDIAIQGRGFLQ
FT                   VELPDGTQAYTRDGSLQVDQNGQLTTAGGYVIQPPINVPDNALSLTIGKDGTVSVTQPG
FT                   AAGTNVQIGQLQVATFINPTGLQSVGENLYLETDSSGPANLLQPGIDGAGQILQQYVET
FT                   SNVNVAEELVNMITTQRAYEMNSKAVKTSDEMLARLTQL"
FT   misc_feature    290749..290841
FT                   /note="HMMPfam hit to PF00460, DE Flagella basal body rod
FT                   protein, score 1.1e-10"
FT   CDS_pept        291519..292211
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /gene_synonym="flaY"
FT                   /gene_synonym="fla FVIII"
FT                   /locus_tag="BB2565"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1379"
FT                   /db_xref="GOA:Q7WJD2"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJD2"
FT                   /protein_id="CAE33059.1"
FT                   /translation="MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQP
FT                   SARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLEEKTNAAKGVATNTSRDGSATLG
FT                   VAAAPRFMDGIINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAG
FT                   EKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQR
FT                   FFLIASPF"
FT   misc_feature    291519..291614
FT                   /note="Signal peptide predicted for BB2565 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.424 between residues 32 and 33"
FT   misc_feature    291552..291584
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    291582..292205
FT                   /note="HMMPfam hit to PF02107, DE Flagellar L-ring protein,
FT                   score 3.1e-68"
FT   CDS_pept        292214..293347
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /gene_synonym="flaM"
FT                   /gene_synonym="fla FIX"
FT                   /locus_tag="BB2566"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1380"
FT                   /db_xref="GOA:Q7WJD1"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJD1"
FT                   /protein_id="CAE33060.1"
FT                   /translation="MTFPTSLSVLLIPLARAVLALALLGAGAAHAERLKDLASIQGVRG
FT                   NQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNMQLKNVAAVMVTAT
FT                   LPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQGNLLVGGAGASAG
FT                   GSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQNAAAAINRQFGA
FT                   GTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVIINARTGSVVMNRTVM
FT                   IEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQDGGALQRVTTSANL
FT                   ADVVKALNALGATPQDLLAILQAMKTAGALRADLEII"
FT   misc_feature    292214..292306
FT                   /note="Signal peptide predicted for BB2566 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.990 between residues 31 and 32"
FT   misc_feature    292232..292300
FT                   /note="1 probable transmembrane helix predicted for BB2566
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    292310..293341
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02119, DE Flagellar P-ring protein,
FT                   score 4.1e-196"
FT   CDS_pept        293365..294384
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /gene_synonym="flaZ"
FT                   /gene_synonym="fla FX"
FT                   /locus_tag="BB2567"
FT                   /product="peptidoglycan hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1381"
FT                   /db_xref="GOA:A0A0H3LMI9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMI9"
FT                   /protein_id="CAE33061.1"
FT                   /translation="MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQ
FT                   FEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMADEQLALQLASPGIGLAQALLGQMQ
FT                   QGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDVLRS
FT                   NRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELR
FT                   HEDGSTSYNLFGIKAGASWKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARL
FT                   IGNSPRYEAVTQAGNEIEAARRIQEAGYATDPRYAEKLISIMGQLRTSVARADFSGGL"
FT   misc_feature    293902..294354
FT                   /note="HMMPfam hit to PF01832, DE Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase, score 1.1e-39"
FT   CDS_pept        294454..296100
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="BB2568"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1382"
FT                   /db_xref="GOA:A0A0H3LMI5"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMI5"
FT                   /protein_id="CAE33062.1"
FT                   /translation="MNLYNLALTGLNASQAGLETTSHNINNATTVGYSRQRVITSTAGA
FT                   GETGQGFFGRGVQVDTVTRQYDSFLYRQLVGAQGSSAQLSTHLAQVSQVNNLFGDRTVG
FT                   ITPALAGLFTSTNAAATKPADPAVRADMIGKANSLVTQINTAYQELENQRNGLNTQIST
FT                   TVEQVNSYLERINDLNKQIVIARGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDTF
FT                   NITLQSGQTLLSGTTVYPLQAVPSASDPKRLAVAYTLPSGPGTTIQVEMNDSEVTGGQL
FT                   GGLLSFRSQSLDAVQDQLGQLAIGLAMAFNAQHREGYDLDGQPGGDMFGLQAPAAIRNS
FT                   GNTSTGEWQSAYTDADAIRASAYRIQYDGANYTVTRLSDGSSFDVTPSGTPPTLSFDGL
FT                   TLTGSGTPAAGDAWTLQPARDAARDLKQLISDPSKLALADSALGTTNGNNGLKLAELQT
FT                   AKVLGNGSMSLNEMFSQLVNNVGVQTQQVSTANTAQANLVKQQATAHLSVSGVNLNEEY
FT                   VNLTIFQEQYQASAKILDVASTVFDTLLGLR"
FT   CDS_pept        296134..297666
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /gene_synonym="flaT"
FT                   /gene_synonym="flaU"
FT                   /locus_tag="BB2569"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1383"
FT                   /db_xref="GOA:A0A0H3LT52"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT52"
FT                   /protein_id="CAE33063.1"
FT                   /translation="MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLA
FT                   AALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTLQSVVKNMQEMLKRVVEAGNGTMSD
FT                   ADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGDLGQ
FT                   RGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYV
FT                   GRDFRIEFTRDAVTDELQYSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQP
FT                   EAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGLTGKNLSVAFLDDGAGGLLYS
FT                   VTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLND
FT                   LIGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGA
FT                   QKGLSYVKQLSDLEDVNIYQATSDLLLRQVALQAASLALQRIQGNSLFSMGR"
FT   misc_feature    296212..296634
FT                   /note="HMMPfam hit to PF00669, DE Bacterial flagellin
FT                   N-terminus, score 3.7e-09"
FT   CDS_pept        297745..299577
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BB2570"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1384"
FT                   /db_xref="GOA:A0A0H3LNM7"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNM7"
FT                   /protein_id="CAE33064.1"
FT                   /translation="MWSNLKVRTCITLVLGLFLVAMLVSNAMAWLGMSSSNDKLERVNN
FT                   AYSNQAVPAYEAYVMLLRARLNMVSSMMDLQEGRLKESADTLAHAQRQAGEARERFEAF
FT                   LAVAKASSGADRVGAVETAFHAYLEVAARQMEAMQNQKLGEFVQLNPSAQRLNTAFDTA
FT                   ASAYLDQIDTDTDALVDDARAEHLRANTVTLVLIVLALALCAGCGVFIGRAVLRPLKEA
FT                   GQHFDRIAAGDLTARVDVRSTNEIGQLFAALKRMQESLTRTVAAVRRGVDEINVGSREI
FT                   SAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQANQLAGVASDVAERGGSA
FT                   VSEVVATMQDISASSRKISEIVSVIDGIAFQTNILALNAAVEAARAGEQGKGFAVVAGE
FT                   VRSLAQRSAQAAKEIKVLIEDSVGKVGTGSQQVERAGATMQEIVASVKRVTDIMGEISA
FT                   ASDEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQEQAQRLAEAVAVFKINAG
FT                   EVIDVSARQLAQQRQAPRVGAAPASAAAPEAPPEPAPASAPRLARPAARADVAAEAASA
FT                   RRPARRPAATEPAARTMAAPSRRRPPADDDWESF"
FT   misc_feature    297745..297831
FT                   /note="Signal peptide predicted for BB2570 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.782) with cleavage site
FT                   probability 0.390 between residues 29 and 30"
FT   misc_feature    join(297775..297843,298324..298392)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2570 by TMHMM2.0 at aa 28-50 and 211-233"
FT   misc_feature    298321..298530
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   1.7e-14"
FT   misc_feature    298591..299289
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 3.2e-111"
FT   CDS_pept        join(299698..300993,300997..301533)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /gene_synonym="cheM"
FT                   /locus_tag="BB2571"
FT                   /product="methyl-accepting chemotaxis protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1385"
FT                   /note="Similar to Escherichia coli methyl-accepting
FT                   chemotaxis protein II tar or CheM or b1886 SWALL:MCP2_ECOLI
FT                   (SWALL:P07017) (553 aa) fasta scores: E(): 3.2e-54, 44.96%
FT                   id in 556 aa, and to Salmonella typhimurium
FT                   methyl-accepting chemotaxis protein I, serine sensor
FT                   receptor tsr or stm4533 SWALL:Q8ZJY4 (EMBL:AE008913) (553
FT                   aa) fasta scores: E(): 3.2e-54, 45.6% id in 557 aa"
FT   misc_feature    299698..299784
FT                   /note="Signal peptide predicted for BB2571 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.457 between residues 29 and 30"
FT   misc_feature    join(299725..299793,300271..300339)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2571 by TMHMM2.0 at aa 10-32 and 192-214"
FT   misc_feature    300280..300489
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   1.6e-13"
FT   misc_feature    300550..300990
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 1.6e-31"
FT   CDS_pept        301563..302006
FT                   /transl_table=11
FT                   /locus_tag="BB2573"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVP3"
FT                   /protein_id="CAE33066.1"
FT                   /translation="MPRWIAGLGAMLAVLWLAGCAATGHNFDPGRLSRLTPGQTTLEEA
FT                   ARELGAPPDTIYGQRDGGVLALWQFKITFVTDGFYSRKEALLQFGPDGRLMRLVDSTNI
FT                   LLEPWERRKLLGPEPPWPAEPAVPQVAPQAAPVAIPVPAAPAQ"
FT   misc_feature    301563..301634
FT                   /note="Signal peptide predicted for BB2573 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.993) with cleavage site
FT                   probability 0.580 between residues 24 and 25"
FT   misc_feature    301590..301622
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    301680..301745
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1025.000, SD 2.68 at aa 40-61, sequence
FT                   TTLEEAARELGAPPDTIYGQRD"
FT   CDS_pept        302233..303843
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /gene_synonym="cheM"
FT                   /locus_tag="BB2574"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Salmonella typhimurium methyl-accepting
FT                   chemotaxis protein ii tar or chem or stm1919
FT                   SWALL:MCP2_SALTY (SWALL:P02941) (553 aa) fasta scores: E():
FT                   1.8e-65, 47.92% id in 530 aa, and to Escherichia coli
FT                   methyl-accepting chemotaxis protein ii tar or chem or b1886
FT                   SWALL:MCP2_ECOLI (SWALL:P07017) (553 aa) fasta scores: E():
FT                   1.1e-63, 47.81% id in 525 aa"
FT                   /db_xref="GOA:A0A0H3LMJ3"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMJ3"
FT                   /protein_id="CAE33067.1"
FT                   /translation="MWVLGVFALMIAGVGAMAAYFLQQNYQSVGEINALTDRVAQVEII
FT                   NSDMLRARVSLMVSARQLQESGWGSGANAAQAAAASLKDATDLLAGVRTRFADFQKNML
FT                   EDDTGRQLSMNLVRRYRSYIDDGVDTMVEALRSEDYSTFYMVNNEYGTPRSAAFIAAIG
FT                   DFSKYINEQQQATMEAARTNFDRALMAVTAAVVLALVLMLVARTVFGRLVVRPLKEAGQ
FT                   HFDRIAAGDLTARVEVRNSNEIGQLFAALKRMQESLTRTVATVRRGVDEINVGSREISA
FT                   GNTDLSSRTEEQAASLEETAASMEELASTVKQNADNARQANQLAASASDVAERGGSAVS
FT                   EVVSTMDGISASSRKISEIVSVIDGIAFQTNILALNAAVEAARAGEQGKGFAVVAGEVR
FT                   SLAQRSAQAAKEIKVLIEDSVDKVGTGSQQVERAGATMQEIVASVKRVTDIMGEISAAS
FT                   EEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQEQAQRLAEAVAVFKINTGEV
FT                   IEVPAHQLSGYAAPLVAQS"
FT   misc_feature    join(302233..302298,302791..302859)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2574 by TMHMM2.0 at aa 38-60 and 225-247"
FT   misc_feature    302365..303663
FT                   /note="HMMPfam hit to PF03915, DE Actin interacting protein
FT                   3, score 5.1"
FT   misc_feature    302803..303012
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   3.7e-13"
FT   misc_feature    303073..303771
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 4.5e-111"
FT   CDS_pept        304022..305620
FT                   /transl_table=11
FT                   /locus_tag="BB2575"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1386"
FT                   /db_xref="GOA:A0A0H3LMJ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMJ2"
FT                   /protein_id="CAE33068.1"
FT                   /translation="MRVNLPIYDVETKLREDQYLISRTDTKGRIVYANPAFVEVSGFER
FT                   DELIGKAHNLVRHPDMPPQAYEDLWRTLQAGQSWLGVVKNRRKDGGFYWVLANATPIYE
FT                   DGEVVAYSSVRVKASDEQIEAAEAAYAQLRAGTLRGRRLWRGQVVSTGWRRVLAAAAFP
FT                   LRGGLSARMLRQSLLAALAVAGAGAAALAPWWPQWSGAQAGAASAAVALAALGVLAMQW
FT                   RLRGAVLRTMEGAADMARQVAAGNLTTQIGSDANDEVGKLAFSLDVMRKSLVGIARDVY
FT                   GGIEGTTQAALGIARGNQELSARTDDQSASLQNTAASMEELTSTVRQNADNARQANDLA
FT                   ARSMDVARRGGDAVGRVVDTMHGISDSSRKIADIVNIIEGIAFQTNILALNAAVEAARA
FT                   GESGKGFAVVAGEVRSLAQKSAQAAREIKDLIEDSVSRVTEGSLQAEQAGATMQEIVDA
FT                   VRGVTDIIGEISVASQQQASGIEQVDEAVSQMDGMTVQNSGLVQQLGNTVAQLGQQSAA
FT                   LRETIRVFRMAREQG"
FT   misc_feature    304259..304384
FT                   /note="HMMPfam hit to PF00785, DE PAC motif, score 1.5e-05"
FT   misc_feature    304637..304846
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   9.8e-06"
FT   misc_feature    304907..305605
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 2.3e-86"
FT   CDS_pept        complement(305725..306513)
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BB2576"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1389"
FT                   /db_xref="GOA:A0A0H3LT58"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT58"
FT                   /protein_id="CAE33069.1"
FT                   /translation="MIAFTMEQLNGWLAQFLWPFVRILALVGAAPLFSESTIPTRVKIG
FT                   LAFMLTIAVAPAIGPMPAVPPSSYAGLFLLGQQVLIGIALGLSMRVVFAAVQTAGEFVG
FT                   LQMGLSFASFFDPATGANTAVLSRLFNIVAMLVFLALDGHLLVLGALVRSFDTLPVAVG
FT                   VLDRNGWGILAEWGTTIFVSGLLLALPLICALLTINLAMGILNRAAPQLSVFAIGFPVS
FT                   LIVGLVLLAIVLPHSGPFLERLFEQGLNTMNNVANGLAGK"
FT   misc_feature    complement(305755..306495)
FT                   /note="HMMPfam hit to PF01311, DE Bacterial export
FT                   proteins, family 1, score 2e-77"
FT   misc_feature    complement(join(305812..305880,305914..305982,
FT                   306061..306129,306226..306294,306322..306390,
FT                   306415..306483))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2576 by TMHMM2.0 at aa 11-33, 42-64, 74-96, 129-151,
FT                   178-200 and 212-234"
FT   CDS_pept        complement(306536..306805)
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /gene_synonym="flaQ"
FT                   /locus_tag="BB2577"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1390"
FT                   /db_xref="GOA:A0A0H3LNN0"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNN0"
FT                   /protein_id="CAE33070.1"
FT                   /translation="MTAETVMSMTYQALKVALALAGPLLLVTLIVGLVISIFQAATQIN
FT                   EMTLSFIPKLLAMCGTLVLLGPWLLGLLTDYIRQLIGQIPMLVS"
FT   misc_feature    complement(306569..306796)
FT                   /note="HMMPfam hit to PF01313, DE Bacterial export
FT                   proteins, family 3, score 1.9e-36"
FT   misc_feature    complement(join(306590..306658,306701..306769))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2577 by TMHMM2.0 at aa 13-35 and 50-72"
FT   misc_feature    complement(306686..306805)
FT                   /note="Signal peptide predicted for BB2577 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.889) with cleavage site
FT                   probability 0.864 between residues 40 and 41"
FT   CDS_pept        complement(306822..307613)
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BB2578"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1391"
FT                   /db_xref="GOA:A0A0H3LVP6"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVP6"
FT                   /protein_id="CAE33071.1"
FT                   /translation="MSISFRFSDTRPRAPWWPAMAAVAVAAAALWPSGALAQATLPALT
FT                   ATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGLLRSAMGTAMSPPN
FT                   HVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGSPLHNFMLHQTREN
FT                   DLTLFANLANLPAMEDPSQVPMRILIPAFITSELKTAFQIGFTIFIPFLIIDLVVASVL
FT                   MALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSFYQ"
FT   misc_feature    complement(306840..307421)
FT                   /note="HMMPfam hit to PF00813, DE FliP family, score
FT                   7.9e-108"
FT   misc_feature    complement(join(306843..306911,306939..307007,
FT                   307245..307298,307341..307409,307503..307571))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2578 by TMHMM2.0 at aa 15-37, 69-91, 106-123, 203-225 and
FT                   235-257"
FT   misc_feature    complement(306864..306902)
FT                   /note="PS01061 Flagella transport protein fliP family
FT                   signature 2."
FT   misc_feature    complement(306999..307046)
FT                   /note="PS01060 Flagella transport protein fliP family
FT                   signature 1."
FT   misc_feature    complement(307503..307613)
FT                   /note="Signal peptide predicted for BB2578 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.988 between residues 37 and 38"
FT   CDS_pept        complement(307625..307966)
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /gene_synonym="flbD"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BB2579"
FT                   /product="flagellar protein FliO"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1392"
FT                   /db_xref="GOA:A0A0H3LMJ8"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMJ8"
FT                   /protein_id="CAE33072.1"
FT                   /translation="MTESAVLRVVIGLALVIAAILVSAWLARRSGLIQRHGGALLRQVG
FT                   GMSLGPRQRVVVLEIEGTWLVLGVTPNQLTTLHTLPAGQLPDPSPAAAGTFAAKLGQAL
FT                   QRGHRVDRP"
FT   misc_feature    complement(307886..307954)
FT                   /note="1 probable transmembrane helix predicted for BB2579
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(307898..307966)
FT                   /note="Signal peptide predicted for BB2579 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.646) with cleavage site
FT                   probability 0.347 between residues 23 and 24"
FT   CDS_pept        complement(307977..308495)
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /gene_synonym="motD"
FT                   /locus_tag="BB2580"
FT                   /product="flagellar motor switch protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1393"
FT                   /db_xref="GOA:A0A0H3LMJ7"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMJ7"
FT                   /protein_id="CAE33073.1"
FT                   /translation="MTDTNERPDQTGAGAPAPAADDWADALAEQNRAAAPTQADGLKPQ
FT                   DDWADALAEQNAAPAAAPAVQPAAQSVFKPLATKETGQGTDIDLIMDVPVQMTVELGRT
FT                   RLTIKNLLQLGQGSVVELDGLAGEPMDIFVNGYLIAQGEVVVVDDKYGIRLTDIITPSE
FT                   RINRLNSRR"
FT   misc_feature    complement(308010..308240)
FT                   /note="HMMPfam hit to PF01052, DE Surface presentation of
FT                   antigens (SPOA) protein, score 5.5e-34"
FT   CDS_pept        complement(308488..309498)
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /gene_synonym="fla AII"
FT                   /gene_synonym="fla QII"
FT                   /gene_synonym="CheC2"
FT                   /locus_tag="BB2581"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1394"
FT                   /db_xref="GOA:A0A0H3LT63"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT63"
FT                   /protein_id="CAE33074.1"
FT                   /translation="MAYEAFLSQDEVDALLAGVTGESDEKQPAGDEAGAPRAYDLSSPE
FT                   RVVRRRMQTLELINERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLN
FT                   MIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTL
FT                   ESYGKSWDPVYPIEFEYVRSEMHTKFASITGNNEVVVVSPFHIEFGATGGDLNICLPYS
FT                   MIEPVRDLLTRPLQDTALEEVDQRWAQQLQRQVRSADIDLVAEFGHIPSSIGELMRMKT
FT                   GDVLPIAVPETVTAHVDGVPLMECGYGVFNGRYALRVQNLINYDDTDSNEAPDHD"
FT   misc_feature    complement(308524..308748)
FT                   /note="HMMPfam hit to PF01052, DE Surface presentation of
FT                   antigens (SPOA) protein, score 0.0047"
FT   misc_feature    complement(308806..309384)
FT                   /note="HMMPfam hit to PF02154, DE Flagellar motor switch
FT                   protein FliM, score 5.8e-95"
FT   CDS_pept        complement(309501..310073)
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /gene_synonym="fla AI"
FT                   /gene_synonym="fla QI"
FT                   /gene_synonym="cheC1"
FT                   /locus_tag="BB2582"
FT                   /product="flagellar protein FliL"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1395"
FT                   /db_xref="GOA:A0A0H3LNN3"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNN3"
FT                   /protein_id="CAE33075.1"
FT                   /translation="MATTKTSTMPPRTTLPLRPGGAGRLLRPLLMLLVLALVVAASVAG
FT                   TWYFMKRMQPPVAVPVQLGVGQPQATPMQFVAPPATPPVVPAPIFIPLEAFTVTLQNAD
FT                   SERILHVGITLRVSDEQTRQRIEKYMPEVRSRILMVLSSQSPQAVQTLQGKTEMAHAIT
FT                   EAVKRPFSPLPDGQYVTDALFTAFVVQ"
FT   misc_feature    complement(309507..309929)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03748, DE Flagellar basal
FT                   body-associated protein FliL, score 5.3e-17"
FT   CDS_pept        complement(310215..311558)
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /gene_synonym="flaE"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BB2583"
FT                   /product="flagellar hook-length control protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1398"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVQ1"
FT                   /protein_id="CAE33076.1"
FT                   /translation="MSRNRTAAMTTATLPIPALTPAPGPAAQGGPAAAGKGPSFSQVLA
FT                   RQQGGKPGEAGTPAAPGAQAGAPAQGPATQNPAGAGKPGDTAALPVDGQQEPAAETAAD
FT                   AADAADAATLAALAAQTAPAPALPLQALEIAAEAAAVNAQVAAATQAAGAAARQPAHAA
FT                   LLAGQPAAPAAPAAAGAPPADTAPAMPPALPQTAQPAVAAQAAVAASAPNAPAAETAET
FT                   AATPPAAPSLPHPLPSTGGTPQDGGEAAEPPATAPAQPQPLAAAEHGAALHAAAQAHIA
FT                   ARQAVGNPAPASLPAAAQPLGLEVASPVGSSQWGQELGRQLVTISHDARQGHHTAELRL
FT                   DPPDLGPLRVSINLHEGVASAAFVSVHAAVRQAVEAALPQLQQALAQAGISLGQTSVGD
FT                   QSAQQGFAEQQGRGAGASGGSAAGADSETVVVAATPARNADALVDTFA"
FT   misc_feature    complement(310836..310853)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   misc_feature    complement(311472..311558)
FT                   /note="Signal peptide predicted for BB2583 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.341 between residues 29 and 30"
FT   CDS_pept        complement(311564..312010)
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /gene_synonym="flaO"
FT                   /gene_synonym="flaS"
FT                   /locus_tag="BB2584"
FT                   /product="flagellar protein FliJ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1399"
FT                   /db_xref="GOA:A0A0H3LMK4"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMK4"
FT                   /protein_id="CAE33077.1"
FT                   /translation="MPSQLPLDMLIGLAKDSTDEAARELGRLSAERNNAEQQLNMLQDY
FT                   RQDYLQRMQTAMQSGMSAADCHNYQRFIATLDDAIGQQRHVLHRAEAHLNDGRLNWQQQ
FT                   KRKLNSFDTLAQRESRTQALLEARREQRANDEYSARLVRRQAGF"
FT   misc_feature    complement(311570..312010)
FT                   /note="HMMPfam hit to PF02050, DE Flagellar FliJ protein,
FT                   score 1.6e-13"
FT   CDS_pept        complement(312003..313478)
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /gene_synonym="fla AIII"
FT                   /gene_synonym="flaC"
FT                   /locus_tag="BB2585"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1400"
FT                   /db_xref="GOA:A0A0H3LMK3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMK3"
FT                   /protein_id="CAE33078.1"
FT                   /translation="MNPPALPLPADTAAVPVADRWQTQLQIGSIRAASTEPWLVSGRIT
FT                   RAAGLVLHATGLRLPVGAACRIELARGHDHWADAEVVGFDGHTLYLMPQSDISGLPPGA
FT                   RVVPAEPAVQRPVPLPRKAELNGNAKPQVGRHLPVGNAMLGRVVDGAGRPLDGLGPLAG
FT                   AEQAPLTALPINPLSRAPIDSVLDVGVRAINGLLTVGRGQRMGLFAGSGVGKSVLLGMM
FT                   ARYTRADIIVVGLIGERGREVKEFIEHNLGPEGLARSVVVAAPADVSPLLRLQGASYAT
FT                   RLAEHFRDQGLDVLLIMDSLTRFAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTG
FT                   MGAPGPNGKAGSITAFYTVLAEGDDQQDPIADSARAILDGHVVLSRHLAEAGHYPAIDI
FT                   EASISRAMTSLITTEQFQQVRRFKQILSRYQRNRDLISVGAYVAGADPQLDDAIARYPR
FT                   LEAYLQQNIGDSVDYGTAIDQLQRSLETREAYA"
FT   misc_feature    complement(312249..313076)
FT                   /note="HMMPfam hit to PF00006, DE ATP synthase alpha/beta
FT                   family, nucleotide-binding domain, score 1.8e-131"
FT   misc_feature    complement(312267..312296)
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT   misc_feature    complement(312831..312854)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(313475..314230)
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /gene_synonym="fla BIII"
FT                   /gene_synonym="fla AII.3"
FT                   /locus_tag="BB2586"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1401"
FT                   /db_xref="GOA:A0A0H3LT69"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT69"
FT                   /protein_id="CAE33079.1"
FT                   /translation="MSEALAREPAALPRSAAWRRWQMLSFDEPAEAETPEPAALEPEPE
FT                   PAPDPEELLREWRATAERAGHAAGHQAGQEQGQREGYAAGHAQGLAAGRAEGHAEGLAQ
FT                   GREEARQQAERLHALAQACAASVARLEDNMGQSLLTLALDIAGQVLRTTLAEHPETMVA
FT                   AVREVLHINPATGAAMRLWVHPDDLELVRTHLADELNEANWRLQADESITRGGCRTETA
FT                   YGDVDATLQTRWRRVAASLGRSAAWEETA"
FT   misc_feature    complement(313517..314230)
FT                   /note="HMMPfam hit to PF02108, DE Flagellar assembly
FT                   protein FliH, score 1.2e-12"
FT   CDS_pept        complement(314223..315233)
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /gene_synonym="fla BII"
FT                   /gene_synonym="fla AII.2"
FT                   /locus_tag="BB2587"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1402"
FT                   /db_xref="GOA:A0A0H3LNN6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNN6"
FT                   /protein_id="CAE33080.1"
FT                   /translation="MKNDGKPLDGMTRSAVLMMSLGEDAAAEVFKYLSAREVQQVGAAM
FT                   ASLKQVTRGDVAVVLEEFRQEADQFMAVTLGSDDYIRTVLTKALGSDRAAGLIEDILEA
FT                   GEGGSGIDALNWLDPHTVAELIGDEHPQIIATILVHLERDRAASVLAMLSERMRNDVML
FT                   RIATFGGVQPAALSELTDVLNSVLAGQGAKRSKMGGVRTAAEILNMMNSSQEEAVVESL
FT                   RERDSDLAQKIIDEMFVFDNLLDVEDRAVQLILKEIDNDTLMVALKGAGDELRNKFLRN
FT                   MSSRAAEMLREDLEAQGPIRMSKVEGEQKKILQIARRLAESGQIVLGTQGDDAYV"
FT   misc_feature    complement(314250..314579)
FT                   /note="HMMPfam hit to PF01706, DE FliG C-terminal domain,
FT                   score 3.4e-52"
FT   CDS_pept        complement(315223..316899)
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /gene_synonym="fla BI"
FT                   /gene_synonym="fla AII.1"
FT                   /locus_tag="BB2588"
FT                   /product="flagellar M-ring protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1403"
FT                   /db_xref="GOA:A0A0H3LVQ5"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVQ5"
FT                   /protein_id="CAE33081.1"
FT                   /translation="MNQQATLSASLLARFPVLEKLRALPKPVLLGAAAALIAVVAAVAM
FT                   WSREPDYKVLFSNLDDRDGGAIVSALGQMNVPYRFSDNGSALLVPAERVYDTRMQLASQ
FT                   GLPRGGSVGFELLDNTRFGASQFAEQINYQRGLEGELARSIEAMHTVQHARVHLAMPRQ
FT                   SLFVRDRQAPTASVLLNLYPGRSLSDAQVSAVAWLVASSVPELTAENVSIVDQNGRLLS
FT                   APLGEGRGMDADQLRFVREMEQRTVERILTILNPLVGPGNVHAQASAEIDFARREETSE
FT                   VYRPNQEPGQAAVRSQQTSDSRQTGPNAAQGVPGALSNQPPANAQAPIVNPPAVAGTPQ
FT                   QQQQQRAQQQAAGATTTQTQPGAAAPSNDRHDATINYEVDRTISHVKQPVGMLKRLSVA
FT                   VVVNYLPNKEGESEALPPEELNKLTNLVREAMGYSEARGDSLNLVNSQFNDTPVAVPLW
FT                   RDPELIAMIKTALGWMFGLILAFWLYRKIRPVVTDYFYPQVDPEVAAAQRQEAEREAQA
FT                   AARTREVNRYEDNLQLARDMAGKDPRAVAMVLRSWMSKDEK"
FT   misc_feature    complement(join(315445..315513,316759..316818))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2588 by TMHMM2.0 at aa 28-47 and 463-485"
FT   misc_feature    complement(316213..316839)
FT                   /note="HMMPfam hit to PF01514, DE Secretory protein of
FT                   YscJ/FliF family, score 5.5e-78"
FT   misc_feature    complement(316768..316899)
FT                   /note="Signal peptide predicted for BB2588 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.814) with cleavage site
FT                   probability 0.509 between residues 44 and 45"
FT   CDS_pept        317212..317544
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /gene_synonym="flaN"
FT                   /gene_synonym="fla AI"
FT                   /locus_tag="BB2589"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1404"
FT                   /db_xref="GOA:A0A0H3LMK7"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMK7"
FT                   /protein_id="CAE33082.1"
FT                   /translation="MAVSGLSGIESMLSQMRAVVRAAQSGGATEAELAPGPSGFAAELQ
FT                   RSIRRVSQAQNAASDQAKAFELGAPGISLNDVMIDLQKASLGFQTSVQVRNRLVAAYKE
FT                   ISSMAV"
FT   misc_feature    317230..317538
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02049, DE Flagellar hook-basal body
FT                   complex protein FliE, score 6.7e-20"
FT   CDS_pept        complement(317558..317953)
FT                   /transl_table=11
FT                   /locus_tag="BB2590"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMK9"
FT                   /protein_id="CAE33083.1"
FT                   /translation="MTAQDQIVVLTQSDQIRSTLQELRHPDCQIVISGIDQRPWPVRIL
FT                   GPDAKDGYFFWRPLDLACPDPVMLARMADEDEPPLAFHAQTADGARIHFCVDSPVTLRF
FT                   GDGSIAVLSLFPSAVRHTCARPPQAPA"
FT   CDS_pept        complement(317963..318277)
FT                   /transl_table=11
FT                   /locus_tag="BB2591"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1406"
FT                   /db_xref="GOA:A0A0H3LT74"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT74"
FT                   /protein_id="CAE33084.1"
FT                   /translation="MNTPAPPAADDASRPVAVALSYDGGEAAPRVVAKGYGQLADTIVR
FT                   TAREHGLHVHESRELVGLLMQVDLDAHIPPQLYTAVAELLAWLYRLEARELPEVLAPQA
FT                   "
FT   CDS_pept        complement(318274..319545)
FT                   /transl_table=11
FT                   /locus_tag="BB2592"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1407"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNN9"
FT                   /protein_id="CAE33085.1"
FT                   /translation="MSVGPPALGSILVQRLDAVLGTTMSAQSNLVSGARPDAVAQPGEA
FT                   ARPGASQTATRDPRQAVQAGGERGARQGAAGVDAKTAAALALAARGLQTSTGTTASAPT
FT                   TLGQTARTILALLAQYPGQAPAVSARAPLWTPPAQDGASPPAGGQPAAAAPNAPAQASA
FT                   AAGGAASTPSRPEAAQAGAASARTPAQTPPATLAALAGRAVLPAAPALAQALRQTLQAS
FT                   GLFYESHLSDLAFGKRSVQQLQAEPQARLPAAGAEPAATPRAPENATPARALPAAEPAP
FT                   PGQPATHTPGAPVPGIHQDATLLVRQQLDVLANQMLAWQGQAWPGTPMEWEVAREHGDD
FT                   AAGQPGTHWATRLKLNLPRLGTVEARLNLAANQLVLHVVAPDSAAEIGAAADALRQQLS
FT                   AAGLTLTNLSVDAIGAPGFDLPEA"
FT   CDS_pept        complement(319542..319922)
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /locus_tag="BB2593"
FT                   /product="flagellar protein FliT"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1408"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="PDB:3H3M"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVQ9"
FT                   /protein_id="CAE33086.1"
FT                   /translation="MSSRPQREKSMTALTQHAPVLEIYQDIANLTSRMLAAANASNWDL
FT                   VLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSD
FT                   LLGRMKRQQSLLATYSGKANGT"
FT   CDS_pept        complement(319940..320368)
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BB2594"
FT                   /product="flagellar protein FliS"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1409"
FT                   /db_xref="GOA:A0A0H3LML2"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LML2"
FT                   /protein_id="CAE33087.1"
FT                   /translation="MTYAARRPTGSYSVKSYSDIGLETQVMSATPERLITLLYAGARAA
FT                   IAQARLHLEAGRIVERGQAIGKAIRIVDEGLKLGLNQDAGGEVAANLARLYDYITRTLL
FT                   TANLKADKEQLDIADRLLADLSEAWQASVDHPAPAVPA"
FT   misc_feature    complement(319961..320335)
FT                   /note="HMMPfam hit to PF02561, DE Flagellar protein FliS,
FT                   score 6.4e-23"
FT   CDS_pept        complement(320376..321749)
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /gene_synonym="flbC"
FT                   /gene_synonym="flaV"
FT                   /locus_tag="BB2595"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1410"
FT                   /db_xref="GOA:A0A0H3LML5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LML5"
FT                   /protein_id="CAE33088.1"
FT                   /translation="MATISSLGSSGLELEGILEKLQAAEEKKLTLITARQASYETRISA
FT                   YSKIQAAVEAVQKAAATLGSIDTLSAVKAVVSGDGLSVKTAAGAVPGQYTVNIDKLATA
FT                   QNLQSGELDSRTDKHGTGGSIEIVQKDGTTTTVTLGEDTSLNGIVKAINGTDGLDVRAT
FT                   VISDGNGKHYLMLNNKTEGTEAAVTRITVSGNQEVADILDFDAANAGASNLTVQLAAQK
FT                   AELTINGIPVVSDTNTVETAIDGLTLTLTKQTAAPLTVTVSSDPSVAATAVNDFVKAYN
FT                   GLQTTIADLTAFDVKAEKQSALTGDGTTRNIQSAIAAALRVATGEGTLRTLSQLGITTD
FT                   PKTGSLKTDTEKLEAALRDNPADVARIFSGPFGLGEKVKLATEQILGDEGSIKIRQEGL
FT                   EETLESLQNQYDRQKLSIAATIEAYRKQFVQLDVFVTQMNNTSNYLSQQFAALSGTKK"
FT   misc_feature    complement(320430..321725)
FT                   /note="HMMPfam hit to PF02465, DE Flagellar hook-associated
FT                   protein 2, score 1.2e-58"
FT   CDS_pept        complement(321890..322267)
FT                   /transl_table=11
FT                   /gene="flaG"
FT                   /locus_tag="BB2596"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1411"
FT                   /note="Similar to Pseudomonas aeruginosa FlaG SWALL:O33420
FT                   (EMBL:L81176) (128 aa) fasta scores: E(): 0.035, 31.35% id
FT                   in 118 aa, and to Aeromonas salmonicida FlaGellin protein
FT                   flaG SWALL:O30378 (EMBL:AF002709) (146 aa) fasta scores:
FT                   E(): 1.9, 35.48% id in 62 aa"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT80"
FT                   /protein_id="CAE33089.1"
FT                   /translation="MAVSPINAAAPALVSAAPAPVPAQPAAAVAPAAAAANGGGAQSAT
FT                   QDQYGAPKLPMDRALEEINAQLKAWSTQLQFEIDPDVHQVVVSIVDAETGDVLRTIPSE
FT                   AVIRIAKMIVKMQGNAVETTA"
FT   misc_feature    complement(322199..322267)
FT                   /note="Signal peptide predicted for BB2596 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.565 between residues 23 and 24"
FT   CDS_pept        322757..324064
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /gene_synonym="dedC"
FT                   /locus_tag="BB2597"
FT                   /product="FolC bifunctional protein [includes:
FT                   folylpolyglutamate synthase and dihydrofolate synthase]"
FT                   /EC_number="6.3.2.17"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1412"
FT                   /db_xref="GOA:A0A0H3LNP1"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNP1"
FT                   /protein_id="CAE33090.1"
FT                   /translation="MSTSRPDASADLPAWLQYLESIHAKAIDLGLDRVRQVAGRLDLSL
FT                   DGVKFMVGGTNGKGSTCAMLESILLAAGYRVGLYTSPHLIDFNERARINGEIASDAALV
FT                   QQFEAVEAARGDISLTYFEFTTLAILRLFAQSRLDAVVLEVGLGGRLDAVNIVDADCSI
FT                   ITSIDLDHTDWLGDTREKIGFEKAHIYRAGRPAICADPVPPQSLLDHVQAIGADLWLLG
FT                   RDYNYSGDRQQWAYGGRAQRRNALAYPALRGANQLLNAAAALAALEAVRDRLPVPQQAV
FT                   RVGLLQASLPGRFQILPGQPTVILDVAHNPHAAAVLAQNLDNMGFHPYTHAVFGMLADK
FT                   NVDGVIARLGSRVDHWYCAGLPGPRGLDGQALAGHVRQVLPEAEGAAETPTVQACADPA
FT                   AAYAAAREKAGEGDRIIVFGSFLTVASVLQALGRKI"
FT   misc_feature    322796..323605
FT                   /note="HMMPfam hit to PF01225, DE Mur ligase family,
FT                   catalytic domain, score 1.9e-14"
FT   misc_feature    322904..322975
FT                   /note="PS01011 Folylpolyglutamate synthase signature 1."
FT   misc_feature    323624..323878
FT                   /note="HMMPfam hit to PF02875, DE Mur ligase family,
FT                   glutamate ligase domain, score 0.0025"
FT   CDS_pept        324125..324955
FT                   /transl_table=11
FT                   /locus_tag="BB2598"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1413"
FT                   /db_xref="GOA:A0A0H3LVR3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR3"
FT                   /protein_id="CAE33091.1"
FT                   /translation="MGLFTSKDSASETQSSRPRPSVSSEAQAAELRARARRRLAGAVAL
FT                   VLAAVIVLPMILDSEPVPVDSDIPIRVPDRNSAFQPTVNDPQAAAPQPEQPAPQAPAGT
FT                   PEAGAPQPPALASAPPQTPPPGQTPAQPQTPPAAQPPATPPQQAATPPAAPKPEAKPEP
FT                   KPAKPAAPARSDDGARAMALLEGRSPPPAQPKPAANGNFVLQVASYTTQADAQARRGKL
FT                   HQAGVTNAFVEQASINGKQQYRLRVGPFPSREAAQAAQARLRTLGYDNGFIAAQ"
FT   misc_feature    324239..324295
FT                   /note="1 probable transmembrane helix predicted for BB2598
FT                   by TMHMM2.0 at aa 39-57"
FT   CDS_pept        324952..325440
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /gene_synonym="dedE"
FT                   /locus_tag="BB2599"
FT                   /product="colicin V production protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1414"
FT                   /db_xref="GOA:A0A0H3LML7"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LML7"
FT                   /protein_id="CAE33092.1"
FT                   /translation="MTGFDFVVLTILAVSAVLGLVRGLLKEILSLLAYLLAFVAAIWWG
FT                   PTVYVWLEPYIETALLRMGIAYAVVFIIVLLAVGLVNMTLAALIRTTGLTPADHGLGAM
FT                   FGLARGLVLVLVLVALAGFTPLPQEDWWRDAMFSHSATEAVRQVKSWLPPSLATWLPY"
FT   misc_feature    324958..325413
FT                   /note="HMMPfam hit to PF02674, DE Colicin V production
FT                   protein, score 4.4e-30"
FT   misc_feature    join(324967..325026,325039..325107,325150..325218,
FT                   325252..325320)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2599 by TMHMM2.0 at aa 6-25, 30-52, 67-89 and 101-123"
FT   CDS_pept        325482..327002
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BB2600"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1415"
FT                   /db_xref="GOA:A0A0H3LMM1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMM1"
FT                   /protein_id="CAE33093.1"
FT                   /translation="MCGIVGVIGRGPVNQLLYDSLLLLQHRGQDAAGIATLQGNHFNMY
FT                   KAHGLVRDVFRTRNMRALPGTSGVGQVRYPTAGSSASEEEAQPFYVNAPFGIMFAHNGN
FT                   LTNWRELRESLYRVDRRHINTNSDSEVLLNVLAHELQSAASGVSLDDDTIFRAVSAVHQ
FT                   RVKGAYAVVAQISGYGMLAFRDPHGIRPLCIGRQETEEGVEWMAASESVALEGSGFAFV
FT                   RDVEPGEAIFVDLDGRMTSRQCADNAQLVPCIFEYVYFARPDSLIDGVSVYDARLRMGE
FT                   YLADKVARSMRLGDIDVVMPIPDSSRPAAMQLAHRLGLDYREGLIKNRYVGRTFIMPGQ
FT                   AVRRKSVRQKLNAIGMEFKGKNVLLVDDSIVRGTTSREIVDMARAAGANKVYFASAAPP
FT                   VRFPNVYGIDMPTQKELIATGRTDDEIARTIGADALIYQDLQDMQQAVRDINPRLSRFE
FT                   ASCFDGEYVTGDITAEYLARLGQSRDSSAGDEEAGGLQFNMGYAANDA"
FT   misc_feature    325482..325499
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT   misc_feature    325485..326066
FT                   /note="HMMPfam hit to PF00310, DE Glutamine
FT                   amidotransferases class-II, score 2.8e-65"
FT   misc_feature    326250..326741
FT                   /note="HMMPfam hit to PF00156, DE Phosphoribosyl
FT                   transferase domain, score 3.9e-12"
FT   misc_feature    326568..326606
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        complement(327046..327522)
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /gene_synonym="roxB"
FT                   /locus_tag="BB2601"
FT                   /product="disulfide bond formation protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1416"
FT                   /db_xref="GOA:A0A0H3LT86"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT86"
FT                   /protein_id="CAE33094.1"
FT                   /translation="MTRYRERLLFLIAILCFGAVGLALLSQHVFDMPPCAWCVLQRLIY
FT                   LCIGVVALAGALAGAIAARLAAMLAALLAICGIVAAWYQYSVAAKMLSCDQTFADRFMS
FT                   ATGLDGALPWLFGIYATCMDATVAVLGIEYAIWSLALFVIVLALALPAALRRNA"
FT   misc_feature    complement(join(327064..327123,327127..327195,
FT                   327259..327327,327340..327408,327436..327504))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2601 by TMHMM2.0 at aa 7-29, 39-61, 66-88, 110-132 and
FT                   134-153"
FT   misc_feature    complement(327454..327522)
FT                   /note="Signal peptide predicted for BB2601 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.573 between residues 23 and 24"
FT   CDS_pept        complement(327573..328286)
FT                   /transl_table=11
FT                   /gene="marC"
FT                   /locus_tag="BB2602"
FT                   /product="putative multiple antibiotic resistance protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1416A"
FT                   /db_xref="GOA:A0A0H3LNP6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNP6"
FT                   /protein_id="CAE33095.1"
FT                   /translation="MPYNEYLLVFGRSFFFALATLLPFLNPPAITPIFWTLTEGASKQT
FT                   RAQLSKRVAINVALMMIGAMIAGNVVLSFFGISLAIVRVGGGMLVIYSAWRLVNSPDAD
FT                   TSRHAQMAESFTPEMAQARAFYPLTFPISCGPGTIAACITVGASLRDENHMLSLARLAG
FT                   SLPGVALVAFTLFICLRFAAQMLHRLGDNGTAVFMRLSAFIMLCLGVQIFWSGASELLL
FT                   DVMRQIMQPIAAPPA"
FT   misc_feature    complement(327624..328256)
FT                   /note="HMMPfam hit to PF01914, DE MarC family integral
FT                   membrane protein, score 2.9e-24"
FT   misc_feature    complement(join(327636..327704,327738..327806,
FT                   327849..327917,327993..328052,328062..328130,
FT                   328176..328244))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2602 by TMHMM2.0 at aa 15-37, 53-75, 79-98, 124-146,
FT                   161-183 and 195-217"
FT   CDS_pept        complement(328325..330922)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BB2603"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1417"
FT                   /db_xref="GOA:Q7WJ96"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ96"
FT                   /protein_id="CAE33096.1"
FT                   /translation="MPHVDLNPLKQRMQAARAAAVAQFRQHPRPDMLLTELRRIVDQAL
FT                   RELVKLCPLPAGATLAAVGGYGRGELYPHSDVDLLILLPQPPSAADARAVEALVAALWD
FT                   LGLEPGHSVRTLEDCEREARGDITVETALLESRWLAGSRTLMKRLDSAMQARLDAAVFF
FT                   QAKRVEMQQRHARYQDTPYALEPNCKESPGGLRDLQVILWMARAAGFGHSWREVAQAGL
FT                   LTSSEARDLRRAEQAFKRLRIELHLLTGRREDRVLFDLQPGLAAVYGIASTATRRASEL
FT                   LMQRYYWAARLVTQLNVILVQNIEERLFPRPDSDARLIDDDFRNLRERLDIVREDGFER
FT                   NPTLLLRAFLVMQQHPELIGMSARTLRAIWHSRHRIDAQFRRNPVNRKLFLQILQQPRG
FT                   IVHELRRMTMLNILPRYLPVFRRIVGQMQHDLFHVYTVDQHTLAVVRNLRRFTMPEHAQ
FT                   EYPLASQLIAGLDRHWLLYVAALFHDIAKGRGGDHSELGAREVRRFAQDHGLDPADAEL
FT                   VEFLVRHHLLMSAVAQKRDLSDPQVVRDFAAQVGDERRLAALYLLTVADIRGTSPRVWN
FT                   AWKGKLLEDLFRLTLAALGGAHADAHTVLTERKDEAARLTRLAGLRDDAREAFWNQLDI
FT                   AYFLRHDASEIAWHTRHLYYQVAPDEPVVRVRPTEHGEGLQVMVYTRDAPDLFVTTCGY
FT                   FDAKSLSVQDARVHTTRHGWALDSFIVLAPEGFADLRAQATLVEHELAERLRDPHAARH
FT                   AHAPRRLPHSHARRSRVFPVMPQAELSPDERSQSWRLSVTATDRPGLLYALARVFAEHG
FT                   VDLIMAKIMTLGERVEDVFIVSGSALERPRSQMQFERAILDALAGDEPRQQAA"
FT   misc_feature    complement(328352..328561)
FT                   /note="HMMPfam hit to PF01842, DE ACT domain, score
FT                   0.00012"
FT   misc_feature    complement(328688..328900)
FT                   /note="HMMPfam hit to PF01842, DE ACT domain, score 18"
FT   misc_feature    complement(329210..329614)
FT                   /note="HMMPfam hit to PF01966, DE HD domain, score 3.7e-10"
FT   misc_feature    complement(330521..330814)
FT                   /note="HMMPfam hit to PF01909, DE Nucleotidyltransferase
FT                   domain, score 3.6e-08"
FT   CDS_pept        complement(330952..331773)
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BB2604"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1418"
FT                   /db_xref="GOA:A0A0H3LVR8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR8"
FT                   /protein_id="CAE33097.1"
FT                   /translation="MGIVTDPADLAKMRAACQDAAKILDFITPYVKPGVTTGELDKLCL
FT                   AYLTDELKVKSATIGYAPPGYPPFTGAICTSVNHQVCHGIPGDKVLKNGDSLNIDVTII
FT                   KDGWFGDTSRMYHVGEPSILSRRLTDITYDCMWKGIEQVRNGATLGDIGHAIQKYAEAQ
FT                   GFSVVREFCGHGIGQRFHEDPQVLHYGKPGTGVKLVTGMLFTVEPMINAGRREIRQLAD
FT                   GWTVVTRDHSLSAQWEHTVLVTDTGYEVLTVSPGMPAPPAFVTRPVEIPAL"
FT   misc_feature    complement(331027..331767)
FT                   /note="HMMPfam hit to PF00557, DE metallopeptidase family
FT                   M24, score 2.5e-73"
FT   misc_feature    complement(331207..331263)
FT                   /note="PS00680 Methionine aminopeptidase subfamily 1
FT                   signature."
FT   CDS_pept        332500..333249
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BB2605"
FT                   /product="30S ribosomal protein S2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1419"
FT                   /db_xref="GOA:Q7WJ94"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ94"
FT                   /protein_id="CAE33098.1"
FT                   /translation="MSLMREMLEAGVHFGHQTRYWNPKMAPYIFGHRNKIHIINLEQTV
FT                   AKYQEASKFVKQLVARGGNILFVGTKRAARELVATEAARCGMPYVDARWLGGMLTNFKT
FT                   VKSSIKRLKDMEAMVADGGFERMTKKEGLLFQRELDKLNKSIGGIKDMNGLPDALFVID
FT                   VGYHKIAVAEAKVLGIPVVAVVDTNHSPDGIDHVIPGNDDSARAIALYAKGMADAVLEG
FT                   REQNINGLVEEIGEGQEEFVEVQDNQA"
FT   misc_feature    332509..332544
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT   misc_feature    332518..333168
FT                   /note="HMMPfam hit to PF00318, DE Ribosomal protein S2,
FT                   score 3.5e-100"
FT   CDS_pept        333382..334311
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BB2606"
FT                   /product="elongation factor Ts"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1420"
FT                   /db_xref="GOA:Q7WJ93"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ93"
FT                   /protein_id="CAE33099.1"
FT                   /translation="MSRFMLAGPCLSEFGANMAEITAALVKELREKTDAPMMECKKALT
FT                   EAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYIAADGKQGAVIEVNCETDFVAK
FT                   NTDFIDFINKLAELVATQNPADVAALSALPFGEGTVETTRTALVGKIGENISVRRFERI
FT                   QTPNSLASYVHGGKIGVLVEFSGAEEVGKDLAMHIAATKPKALNADGVNAEDIAAERSV
FT                   AEQKAAESGKPAEIVAKMVEGSVQKFLKEVTLLSQPFVKNDKQTIEQMLKEKGASITKF
FT                   VLFVVGEGIEKKTADFASEVAAAAAGRA"
FT   misc_feature    333382..333438
FT                   /note="Signal peptide predicted for BB2606 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.750) with cleavage site
FT                   probability 0.575 between residues 19 and 20"
FT   misc_feature    333442..333564
FT                   /note="HMMPfam hit to PF00627, DE UBA/TS-N domain, score
FT                   0.0022"
FT   misc_feature    333601..334245
FT                   /note="HMMPfam hit to PF00889, DE Elongation factor TS,
FT                   score 6.1e-88"
FT   misc_feature    333661..333693
FT                   /note="PS01127 Elongation factor Ts signature 2."
FT   CDS_pept        334463..335125
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /gene_synonym="smbA"
FT                   /locus_tag="BB2607"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1421"
FT                   /db_xref="GOA:Q7WJ92"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ92"
FT                   /protein_id="CAE33100.1"
FT                   /translation="MGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGVAP
FT                   GAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRY
FT                   LEEGKVVIFAAGTGNPFFTTDTAAALRGAEIGAEIVLKATKVDGIYSADPNKDPTATRY
FT                   ARISFDEAIVRRLEVMDATAFALCRDQKLPIKVFSINKSGALKRAVSGEDEGTLVHV"
FT   misc_feature    334463..335056
FT                   /note="HMMPfam hit to PF00696, DE Amino acid kinase family,
FT                   score 4.8e-46"
FT   CDS_pept        335140..335700
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /gene_synonym="rrf"
FT                   /locus_tag="BB2608"
FT                   /product="ribosome recycling factor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1422"
FT                   /db_xref="GOA:Q7WJ91"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ91"
FT                   /protein_id="CAE33101.1"
FT                   /translation="MSVADIRKSAETRMAKSLETLKASLAKIRTGRAHTGILDHVQVEY
FT                   YGSPVPISQVANVNLVDARTISVQPYEKSMAGPIEKAIRESDLGLNPVSMGETIRVPMP
FT                   ALTEERRRDLTKVVKSEGEDAKVAVRNLRREANEALKKLVKDKEISEDDERRAQDDVQK
FT                   LTDRAVGDIDKMIVQKEAEIMTV"
FT   misc_feature    335197..335691
FT                   /note="HMMPfam hit to PF01765, DE Ribosome recycling
FT                   factor, score 6.6e-85"
FT   CDS_pept        335738..336631
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /gene_synonym="rth"
FT                   /locus_tag="BB2609"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1423"
FT                   /db_xref="GOA:Q7WJ90"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ90"
FT                   /protein_id="CAE33102.1"
FT                   /translation="MSISESVPYAPSRPRWSCRIWRRRDGAGFCNTFLLAALRQAPAMA
FT                   LSSTQAIPETGDIPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVR
FT                   YLTLFAFSSENWRRPADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQE
FT                   LIAQAQERTEHNDRLHLTVAANYGGRWDILQATRAMLRADPGLAQDPDRIDEARLAEHL
FT                   SMAWAPEPDLFIRTGGEQRISNFLVWQLAYAEFYFTEQFWPDFGADELDAAFEWYRTRE
FT                   RRFGRTSAQLRGGAKR"
FT   misc_feature    335930..336595
FT                   /note="HMMPfam hit to PF01255, DE Putative undecaprenyl
FT                   diphosphate synthase, score 4.1e-98"
FT   CDS_pept        336651..337508
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /gene_synonym="cds"
FT                   /locus_tag="BB2610"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1424"
FT                   /db_xref="GOA:A0A0H3LMM2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMM2"
FT                   /protein_id="CAE33103.1"
FT                   /translation="MLGQRIITAAVLLAVLALTLALANPWWFVALLALGAACAAWEWLR
FT                   LTVRQPPSGALCVGLAAALLAAMLAMAQAWIQGGVSGLRLEVWVGYWLTPAVVAVWLLG
FT                   AGTAVARGRADAPAASLGWTLFAIPAVLAAWSVLALMYLSRGGAYVVSLLALVWVADIA
FT                   AYFAGRAFGKRKLAPRVSPGKTVAGAVAGVLGAVAWIALSSQWDGTYGQALVERWSWWL
FT                   ALPAAALLGVVSIVGDLFESLLKRRAGRKDSSALLPGHGGVYDRIDAILPVAPLALLMS
FT                   GVLF"
FT   misc_feature    336651..336719
FT                   /note="Signal peptide predicted for BB2610 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.637 between residues 23 and 24"
FT   misc_feature    join(336663..336716,336726..336794,336813..336881,
FT                   336909..336977,337011..337079,337092..337151,
FT                   337188..337256,337314..337382)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2610 by TMHMM2.0 at aa 5-22, 26-48, 55-77, 87-109,
FT                   121-143, 148-167, 180-202 and 222-244"
FT   misc_feature    337089..337502
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01148, DE Phosphatidate
FT                   cytidylyltransferase, score 3.4e-51"
FT   misc_feature    337374..337454
FT                   /note="PS01315 Phosphatidate cytidylyltransferase
FT                   signature."
FT   CDS_pept        337505..338704
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="BB2611"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1425"
FT                   /db_xref="GOA:Q7WJ88"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ88"
FT                   /protein_id="CAE33104.1"
FT                   /translation="MTRFQRVAVLGSTGSIGDSTLDVIARHPDRLGVYALSAYSRMDKL
FT                   AAQAAACGAAVVVVPDDAAAARFRAAWRGKAAMPEVRVGPRALAETAAAPECTTVMAAI
FT                   VGAAGLPAALAAAQAGKRVLLANKEALVAAGSLFMAAVRENGAELLPIDSEHNAIFQCM
FT                   PQGARAAAPTAPAPGVRRLLLTASGGPFRRQDPADLHEVTPAQACAHPNWSMGRKISVD
FT                   SATMLNKGLEVIEAHWLFAMPSERIDVLIHPQSVVHSMVEYDDGSVLAQLGQPDMRTPI
FT                   AYGLGFPERLASGVGLLDLTRWGRLDFEQPDLQRFPCLALSFAALRAGQPACVALNAAN
FT                   EVAVAAFLEGRLRYTWIARVIEAVLEWQAKQASVTLTSLDDVLDLDARARSFAGNLGLA
FT                   "
FT   misc_feature    337523..338683
FT                   /note="HMMPfam hit to PF02670, DE 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase, score 1.3e-175"
FT   CDS_pept        338744..340078
FT                   /transl_table=11
FT                   /locus_tag="BB2612"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1426"
FT                   /db_xref="GOA:A0A0H3LMM6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMM6"
FT                   /protein_id="CAE33105.1"
FT                   /translation="MLFTLLAFVVALGTLITFHELGHYWIARLCGVRVLRFSVGFGRVL
FT                   ARRTDRHGTEWAISAIPLGGYVKMQDDPPAGASAAEAARSFNAQPVGRRIAIVAAGPLF
FT                   NLFLAVVLYAGLNLAGTEVPAPVVGQPAAGTPAAQAGLMAGDRIEAVQGRAVDSWNDAR
FT                   WRLLDVLSSQGEAQLEVRGPGGAARGLVLQVPGGNRLDPADGDPLAETGLRLAQPKPVV
FT                   REVIAGGAGEQAGLRGGDLIVAAGQAADLDAGALVALIQRHAGQPLALTVQRGADRLTL
FT                   TVVPRAESVQGQEVGRIGVQLGGDIPMVTVRYGVIDSVWRGAQRTWDTAWLSLRMMGRM
FT                   VLGEVSWRNISGPVTIADYAGQTARIGLEAYIAYLALISISLGVLNLLPIPMLDGGHLL
FT                   YYLVEIVKGSPVSDRWIDIGQRAGIGLLAGLMGLALFNDFARLFT"
FT   misc_feature    join(338756..338824,339026..339094,339854..339922,
FT                   339995..340063)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2612 by TMHMM2.0 at aa 5-27, 95-117, 371-393 and 418-440"
FT   misc_feature    338789..338818
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   misc_feature    339272..339568
FT                   /note="HMMPfam hit to PF00595, DE PDZ domain (Also known as
FT                   DHR or GLGF), score 0.01"
FT   CDS_pept        340131..342467
FT                   /transl_table=11
FT                   /locus_tag="BB2613"
FT                   /product="probable surface antigen"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1427"
FT                   /db_xref="GOA:A0A0H3LT90"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT90"
FT                   /protein_id="CAE33106.1"
FT                   /translation="MSLRRMFHHKKGVIPGLLAAALLAPALAHAFEPFVVRDIRVEGIQ
FT                   RTDAGTVFGYLPVKVGEKFTDEEATEAVRRLYGTGFFSDVQIQTDNNVVVVVVQERPTI
FT                   ASISFNGMREFDSKAITKSLAQVGFGEGRIFDQSMLERAEYELKEQYLAKGKYGVEVTA
FT                   TVTPLPRNRVGVSFDVFEGEVAKIREIRVVGSKAFSEGELLDQFDLTTPGWLTWYTNTD
FT                   KYSREKLEGDIERLRSFYLDQGYLEFTVEPPQVTISPDRKDIYITITVHEGEPYKVREV
FT                   KLAGNLMGLDSEINNLVEIKPGEVFSAAKANNSAKAITDYLGDLGYAFANVNPNPQLDR
FT                   AKHEADVTFYVDPSRRVYVRRIQIGGNTRTRDEVVRREMRQQEAAWYDAGDIKVSRDRV
FT                   DRLGYFNEVNVKTDPVPGSPDQVDVNVDVKEKPTGIINLGVGYGSSEKAILSAGISEDN
FT                   VFGSGTNLTLQLNTSKTNRAVVLSHTDPYFTKDGISRTTSAYYRVTEPWDNNDGDYRVK
FT                   AMGLGMNFGVPISEYDRIFLGGTFERNQIDLYNNSPQAYRDFVDQYGDSTNALIFNTGW
FT                   SKDTRDSALAPTKGAYTRLKGDFSTMDLKYYLLTAQQQYYLPLGRSYTLALNGMIDYGR
FT                   SYGGLDYPVIKNVYAGGIGTVRGYEGASLGPRDRLTGDYIGGSRRMVANAQLYLPFPGA
FT                   SKDRTLRWFVFTDAGQVAAGSGMSCTAGKPGSEVEDPCGWRFSAGIGLSWQSPLGPLQL
FT                   SYARPLNSKSGDDTQAFQFQIGTGF"
FT   misc_feature    340131..340220
FT                   /note="Signal peptide predicted for BB2613 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.755 between residues 30 and 31"
FT   misc_feature    340158..342461
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01103, DE Bacterial surface
FT                   antigen, score 6.8e-208"
FT   misc_feature    340164..340223
FT                   /note="1 probable transmembrane helix predicted for BB2613
FT                   by TMHMM2.0 at aa 12-31"
FT   misc_feature    341343..341366
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    342255..342287
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        342593..343156
FT                   /transl_table=11
FT                   /locus_tag="BB2614"
FT                   /product="putative outer membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1428"
FT                   /db_xref="GOA:A0A0H3LNQ1"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNQ1"
FT                   /protein_id="CAE33107.1"
FT                   /translation="MMSDFALNTSGSKRAKRGAGKLGVSLALAGALLFGSSAAVTAQAQ
FT                   GTKIGFVNTERILRESGPAKAAQSKIESEFKRRDDELQRLSSSLRSQAEKFDKDAPVLS
FT                   ESDRVKRQRELSNLDMDLQRKRREFQEDFNRRRNEEFSSIVTKANDAIKRIAEQENYDL
FT                   IIQDAVTVNPRIDITDKVIQSLGR"
FT   misc_feature    342593..342724
FT                   /note="Signal peptide predicted for BB2614 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.488 between residues 44 and 45"
FT   misc_feature    342650..343150
FT                   /note="HMMPfam hit to PF03938, DE Outer membrane protein
FT                   (OmpH-like), score 5.8e-27"
FT   misc_feature    342656..342724
FT                   /note="1 probable transmembrane helix predicted for BB2614
FT                   by TMHMM2.0 at aa 22-44"
FT   CDS_pept        343165..344256
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /gene_synonym="firA"
FT                   /locus_tag="BB2615"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1429"
FT                   /db_xref="GOA:Q7WJ84"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ84"
FT                   /protein_id="CAE33108.1"
FT                   /translation="MPVLLDPENALALDVLLAGTDAQGLDWHLSAPDAADLPRIRGIGT
FT                   LSSAGSEEISFLSNPRYQNQLATTRAAAVIVTPDVAQARQEQGASGHVLVVCKHPYLLY
FT                   ARLAQWFERASRPAGPAGVHPSAVVDPSAEIDADARVGAQCVIEAGARIGRGARLGPGC
FT                   VIGAGSTVGADSLLHPRVTLYAGVHVGERAIIHSGAVLGADGFGFAPDPTLGRGAWGKI
FT                   PQLGGVRVGNDVEIGANTTIDRGALDDTIVGDGVKLDNQIMVAHNVRIGAHTAIAACVG
FT                   IAGSTTIGERCTIGGASMLSGHLAIADDVNISGGTAVTSNIAKAGRYTGVYPYAEHSEW
FT                   QRNAAVIQQLALLRRRLRALERE"
FT   misc_feature    343558..343611
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 39"
FT   misc_feature    343612..343665
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 0.016"
FT   misc_feature    343621..343707
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    343666..343719
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 33"
FT   misc_feature    343720..343773
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 0.47"
FT   misc_feature    343843..343896
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 0.3"
FT   misc_feature    343909..343962
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 41"
FT   misc_feature    343918..344004
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    343963..344016
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 14"
FT   misc_feature    344017..344070
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 65"
FT   CDS_pept        344328..344783
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /gene_synonym="sefA"
FT                   /locus_tag="BB2616"
FT                   /product="(3R)-hydroxymyristol-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1430"
FT                   /db_xref="GOA:Q7WJ83"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ83"
FT                   /protein_id="CAE33109.1"
FT                   /translation="MELDIKGIMDRLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEPF
FT                   FTGHFPHHPVMPGVLIVEAMAQASALFSFTDENGGLKCDGAKTAYYLVGIDGARFRKPV
FT                   VPGDQLRLEVEAERLSRTICKYQGRALVDGQLVAEAKLMCAIRSLEE"
FT   misc_feature    344334..344744
FT                   /note="HMMPfam hit to PF01377, DE Thioester dehydrase,
FT                   score 7.5e-67"
FT   CDS_pept        344784..345578
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BB2617"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   amine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1431"
FT                   /db_xref="GOA:A0A0H3LVS2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVS2"
FT                   /protein_id="CAE33110.1"
FT                   /translation="MSGNIHPTAVVDPAAQIDSSVVIGPYSVVGPGVSIAAGTEVGAHC
FT                   VLDGVTSIGRDNRFYRFCSIGGMPQDKKYSGEPTRLVIGDRNTVREFTTFNTGTVQDGG
FT                   VTSIGDDNWIMAYVHIAHDCHIGNNTILANSVQLGGHVQVGDWAIVGGLTGVHQFAKIG
FT                   AHSMTGGNSSLMQDAPPFVLAAGNPCRPVGVNVEGLKRRGFSAAAISALRDAYKSIYRR
FT                   GLSLDEARAELRARQQAEPDVAEHLQTMLDFLDASTRGIIRP"
FT   misc_feature    344823..344876
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 62"
FT   misc_feature    344877..344930
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 17"
FT   misc_feature    344931..344984
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 2.5e+02"
FT   misc_feature    345096..345149
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 36"
FT   misc_feature    345150..345203
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 2.1"
FT   misc_feature    345204..345257
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 2.5e+02"
FT   misc_feature    345258..345311
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (four repeats), score 2.2e+02"
FT   CDS_pept        345575..346756
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /gene_synonym="pgsB"
FT                   /locus_tag="BB2618"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1432"
FT                   /db_xref="GOA:Q7WJ81"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ81"
FT                   /protein_id="CAE33111.1"
FT                   /translation="MSLRIGMVAGEPSGDLLAGRIIAGLQARAPGVHCAGIGGPQMAAR
FT                   GFEAWHPMHALTVFGYIDAFKRIPSLLSTYGDVKRRLLAEPPSVFVGIDAPDFNLRLEH
FT                   QLRQAGTPTVHFVGPSIWAWRYERINKIRAAVSHMLVLFPFEEALYRKEGIPVTYVGHP
FT                   LAGVIPMQPDRAAARARLGIDADARVLAILPGSRSSEIRLLAPRFLQAAAELVRRDPRL
FT                   QCVVPMVNPQRRAEFEAIAAQHPVPGLRCVTAAEGQGETPVAWSVMEASNAVLVASGTA
FT                   TLETALYKRPMVISYVLSPWMRRIMAWKSGQQRPYLPWVGLPNVLLRDFAVPELLQDEA
FT                   TPAALAEATWQALTDEAGAARIEARFTALHQDLLRDTPALAAQAILEVADGAA"
FT   misc_feature    345587..346729
FT                   /note="HMMPfam hit to PF02684, DE Lipid-A-disaccharide
FT                   synthetase, score 4.5e-97"
FT   CDS_pept        346743..347348
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BB2619"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1433"
FT                   /db_xref="GOA:Q7WJ80"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ80"
FT                   /protein_id="CAE33112.1"
FT                   /translation="MEQPDLFGTLAPLPAIIAGVDEAGRGPLAGAVYAAAVILDPDRPV
FT                   DGLADSKVLKAEQREALAVQIRAQALAWFVASASVQEIDSLNILRATMLAMQRAVAGLA
FT                   MAPELAMVDGNQAPKLRCAVQTVIKGDALVPAISAASILAKTARDADLLRLHALYPQYG
FT                   FDQHKGYGTPQHLSLLREHGPCPEHRRSFAPIKAYGAP"
FT   misc_feature    346794..347327
FT                   /note="HMMPfam hit to PF01351, DE Ribonuclease HII, score
FT                   1.3e-65"
FT   CDS_pept        347345..348118
FT                   /transl_table=11
FT                   /locus_tag="BB2620"
FT                   /product="putative RNA methyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1434"
FT                   /db_xref="GOA:A0A0H3LMM9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMM9"
FT                   /protein_id="CAE33113.1"
FT                   /translation="MKHLSSRDNPAVKALHKLAAGGGRRDGRILLDGVHLCQAWLAHQG
FT                   TPLQALFDVARLDHPEIRALAGQVPPQHCLALDSRLLQGLASVESGQGVVFVARAPEPA
FT                   LPERIDENCVLFDRIQDPGNVGTLLRTCAAAGVRRVLLAAGTAAAWSPKVLRSGQGAHF
FT                   ALHIHEHLDLEAVLPRLDVPLVATTLARSGSLYDTDLPACCAWVFGHEGQGVAEALLRA
FT                   AALRVHIPHESAAVESLNVGAAAAICLFEQRRQRR"
FT   misc_feature    347675..348094
FT                   /note="HMMPfam hit to PF00588, DE SpoU rRNA Methylase
FT                   family, score 2.3e-18"
FT   CDS_pept        complement(348130..348957)
FT                   /transl_table=11
FT                   /locus_tag="BB2621"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1435"
FT                   /db_xref="GOA:Q7WJ78"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ78"
FT                   /protein_id="CAE33114.1"
FT                   /translation="MTSTPIERAVYIVSDSTGITAETFSHSVLSQFDEVNFKPVRLPFI
FT                   DTLDKAREVVARINRNALEAGVPPIVFSTLVNPEILALVRQSNGVFLDLFGTFVSHIEQ
FT                   ALGLKSSHSIGRSHMAANSEKYRNRIDAINFSLAHDDGQFVNQLDQADVILVGVSRCGK
FT                   TPTSLYLAMQYAVKAANFPLTPDDFERGALPKTIAPYRGKLFGLSIQPERLAEVRNERR
FT                   PNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKSIEEIATTVLQEVGLERV"
FT   misc_feature    complement(348142..348945)
FT                   /note="HMMPfam hit to PF03618, DE Domain of unknown
FT                   function (DUF299), score 6.7e-120"
FT   misc_feature    complement(348466..348489)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
XX
SQ   Sequence 349008 BP; 54337 A; 115717 C; 124670 G; 54284 T; 0 other;
     gtgatccagc cacagtcgcg ccagcctttg ccctggttgt aggtgaggtc gttgtgattg        60
     agaaatttcc tacagataca tgggtatttg gcgacttatt tagttcgcgg taatcgataa       120
     agttccctcc tgtgttcgga gatatgtagg cgaaatcctc gtcaagtcag cgacttcgcc       180
     tttttcgacc actcctttat ccaaatcgat atatagccgc ttccaagcag gcagggcgtc       240
     gctttgcctg cgattagcgg gcagtgcgcc gaacattcag ggagcttcca tgaacaagaa       300
     catttaccgt gttgtctggt cattggtccg cggggcctgg gtggtcgccg gcgaatgggc       360
     gcgtgctggc cgcaagtcga gcagcccgcg tcgccagaac cgccagcgtg cgcgccgggg       420
     cgtggccgcg atggtgggcg gcagcatcct ggcacaggcc ttgctgccct tgtcggcgct       480
     ggcccaggga gcgccgacgc tgcgcccggc ccgggtggcg caggaggagg cggggcagga       540
     tgcggcatgg acccgcaagc tggccgccca ggccgagtcg ctggcccggc gccaggccga       600
     gcgccaaccc ggcgcccggg tcgacggcga ctatctcaag cgtgaagcgc aggcccaggt       660
     caatgatgtc ttgcgcgatg gcgtgaacct ggctcgggaa tcgggtctgc cctttctgcg       720
     caatctgcaa ggcgggttga gccacgattt cgagtcgggc cgcacgtcgc tgcaactgaa       780
     cacgatagat gaggtctacc gcgccggacg caacacgggc ctgctgcagc tgggggcgca       840
     caaccagaac gatcgtccca cggccaatgc gggcgcggtg tatcggcgcg aggtcaacga       900
     tgcgctgatg gtcggcgcca acggcttcct ggattacgag tttggcaagc agcatctgcg       960
     cggctccgtg gggctggagg tgatcgcgcc ggagttcagc ctgtacggca atgtgtatgc      1020
     gccgctgtcc gactggaagg gcgccaagcg caataatcgt cgcgaggaaa agcccgcctc      1080
     gggcatggat gtgggggtcg gctaccgtcc ggcgttcgcg cccgggctga gtctgagcgc      1140
     gacgcatttc cgctggaatg gcgccgaagt ggactacttc gacaacggcc gcacccaggc      1200
     cggcgccaag ggcttcaagg tcggcgtgga gtatcgcccc gtgtcgctgg tcagcgtggg      1260
     actggagcag accaaggtga tcggcggcgg acgcgaaacc cgcatgcagc tgggcctgaa      1320
     catcaatctc tcggaaccgc tgtccaagca attgcggcgc gacgcttcgg gcacgccggc      1380
     cttctcgccc gacgcccggc ggcacgccct ggtcgagcgc gagaaccgca tcgtcctgaa      1440
     cacgcggcgc aaggagatca ttctgccgct ggtcgtgagc gaggtctcga ccctgcaggc      1500
     cgatggccgg gtgacggtga tcggcgcgac ccagccgttc gcgacggtga cggtgcgcat      1560
     gcccgacggc acgacgggca ccgccacggc ggatgccagc ggtcgttttg cctatacctc      1620
     cgccggcgat caaccgtccg gcgtcctggc gctgcgcgcc cgtaacgccg agggcgacag      1680
     cagccgcgaa gtgacttatc ggtacgtcga cgaggtggtg ctgggcgatc tgcaggtcgc      1740
     ggtgatggcg ctggtgccgc tgccggcgga tcgcgcgctg gaggtacggg gcaagaccga      1800
     accgaagatc gacgtcaagg tgtcgtttcc caatggcgaa tcggtgctcg ccaaggcgga      1860
     tgcgaagggc ctgttcacgg tgcgttcgac gcgcaaagtg gcgcagggga aagtgctggt      1920
     tcaggcgact catccgcaga cgcgcaagga agcgcgtgcc gtcgcggatt atctgccgcc      1980
     cgcgacgctc gcgccgacga tcgatgccgt gacggcgcaa gccgataccg gccgcgtgac      2040
     cgtgacgggc caggcggagc cgggtgcgca ggtggacgtc cactttccgg acggcaccgc      2100
     caagaccgtc gatgccggtg ccgacggcgc ctatgcggcg acttcggatg gcgacatggt      2160
     gtcgggcgac atccgtgtgc aggccgtgga caaggcgggc ggcaagagcc ccgagactat      2220
     ccgcgcctat gtggacaccg tggacaagac tgcgccggtc gttcccacca ttgctgatgt      2280
     ggccaccgat gccaagagcg gccatatcac ggtgacgggt atgaccgagc ccggcgccga      2340
     ggtcgtggtc agcttcccgg acggcacgcg caagacggtc gtcgcgggcg acgacggcgc      2400
     ctataccgcg acttcggatg gcgacatggt ggcgggcgac atccgcgtgc aggccatcga      2460
     caaggcgggc ggcaagagcc cggaggcgac gcgccactat gacgacgccg tggacattac      2520
     cccgccggcc gctcccacca ttgccaatgt ggcgaccgat gcggccagtg gtcgcgtcac      2580
     ggtggcgggc gtggccgagc ccggcgccaa tgtggcggtg aatttcccgg acggcacgcg      2640
     caagaccgtc gtcgctggcg gcgatggcgc ctatacggcg acttcggatc gcgacatggt      2700
     gtcgggcgac atccgcgtgc aggctgtcga caaggcgggc aaccagagcc ccgagaccac      2760
     tcgcgcctat gcggatgccg tggacaagac cgcgccggag gtgccgacca tcgccaatgt      2820
     gaccaccgac gccaagagcg gccgcatcac ggtgacgggc atggccgagc ctggcgtcaa      2880
     tgtggcggtg gacttcccgg acggcacgcg caagagcgtc gtcgccgatg gcgccggcgc      2940
     ctatacggcg acttcggatc gcgacatggt gtcgggcgac atccatgcgc aggccaccga      3000
     caaggcgggc aaccagagcc ccgaggccac gcgccactat ggtgacacca cggacatcac      3060
     cccgccggcc gctcccacca ttgacaatgt ggcgaccgat gccacgagcg gtcgcgttac      3120
     ggccgcgggc gtggccgagc ccggcgccaa tgtgacggtg aacttcccgg atggcacgcg      3180
     caagaccgtc gtcgctggcg gcgatggcgc ctatacggcg acttcggatc gcgacatggt      3240
     gtcgggcgac attcgcgtgc aggcgaccga caaggcgggc aaccagagcc ccgaggccac      3300
     ccgcgcctat gcggatgccg tggacaggac cgcgccggag gtaccgactg tcacccatgt      3360
     ggccaccgac gccaagagcg gccgcatcac ggtgacgggc atggccgagc ctggcgccaa      3420
     tgtgacggtg aacttcccgg acggcacgcg caagacggtc gtcgctggcg gcgatggcgc      3480
     ctatgccgcg acttcggatc gcgacatggt gtcgggcgac atccgtgtgc aggccaccga      3540
     caaggcgggc aaccggagcc ccgaagccac ccgcgcctat gcggacaccg tggacaccac      3600
     cccgccggcc gtacccacga tcaccgatgt gacgaccgat gccagcaacg gtcgcatcac      3660
     ggtgacgggc gtggccgagt ctggcgccaa tgtgacggtc gatttcccgg acggcacgcg      3720
     caagacggtc gtcgctggcg gcgatggcgc ctatacggcg acttcggatc gcgacatggt      3780
     gtcgggcgac gtccgcgtgc aggccatcga caagggcggc aaccacagcc ccgaggccac      3840
     ccgcgcctat gcggatgccg tggacaagac cgcgccggag gtgccgacca tcaccaatgt      3900
     gaccaccgat gccgccagcg gtcgcatcac ggtgacgggc atggccgaac ccggcgccaa      3960
     tgtggcggtg aacttcccgg acggcacgcg caagacggtc gtcgccgatg gcgccggcgc      4020
     ctatgcggcg gactcggatg gcgacatggt ggcgggcgac atccatgtgc aggccaccga      4080
     caaggcgggc aaccggagcc ccgagggcac ccgcgcctat gtggacaccg tggacaagac      4140
     cccgtcggcc gcgccgacga tcgcacgcgt gacgaccgac cgctcgtcgg gcgtggtgac      4200
     ggtggcgggc acggcggatc cggacaacga tgtgacggtc cacttcccgg atggtggacg      4260
     caagaccgtc aaggcgggca aggacggcag ctattcggtg acgtccgaca acgacatttt      4320
     ctcgggcatc attcaggtgt ccgccaggaa ccccgccgga aatgccagcc cggaggtgcg      4380
     gcaagactat cgtgacgaat tcgtgccggc caacgcgatc acgaacatgg agaccaattc      4440
     gaggaacggt atcgttaccg tctccggcaa gacctcgccc gatgcgaccg ttgtggtgag      4500
     tttcccgggc ggcgacgagg cgcggacgcg ggcgaagggg gatggcactt tcagtgtctc      4560
     ctcgcccatg gacgtcccgc ggggtgtcgt gtcgctgagc acggaagtcg atggtgtccg      4620
     gaccgtcgtc gcgacgcgca cctatgagga caagttcacg aagggagggc aggattacaa      4680
     cgcgatcctg ccgtacacgc cggggttcaa cggcgtctcg acttcggaca cctcggcggt      4740
     tctcctctcc gtgcctcagt acttttactc gggcggcgcg cccgtggcca agatcatgcc      4800
     gccggacgcg cacgacagtg aatttaccaa gcgggcggcc gcggccatgc gtgtccaggt      4860
     gacgtcgcgc cgtaattcgt cggagtacga catcagggtg agctggcccg cgggaacctt      4920
     caccccggcg gatgtggggc agcaggccga cctcgtggtg aagatctttg acgtaggtac      4980
     tggcaaattc atgttggctc cgggggaagt ccgttttcgt cggtaagcgt cgcgagacgg      5040
     gggggcgatg acgggcgcct cccgctgtcc ggcgagcagg cgggtagcgc gacggcgcca      5100
     tatccgcctg gccggtccag gggcctgtgg cgattaccga tggatcgccg cgttcaccac      5160
     gcatccgcgg cggcccggcg cgcgcctatc gtgtcgcttt gacggcgatg gatgcggcga      5220
     tggggcgggt gatgggggta gccttcgtgg ccggcacggc catggtacag gggctggcga      5280
     cgctggacgg cgtcgtgggg ttcgcctgcc tggcggcgct gggcgcgctg gcggcatggc      5340
     gggccgcgcg gcgggccggc cggccatggc gggtctgcgg caagctggcc ttgcccgcgc      5400
     tggccgccag cctgggcgtg gcgtcggccg ccggacaggc gcagtggcgg ctggccgatg      5460
     ccgtcgaccc ggcacgccac aatcgtgtgg cgcgggtgga ggcgcgggtg gcgcagctgg      5520
     cgcagggcga cgccgggtcg cggcgcttcg tggcgcggct gccggacgat cggccggcag      5580
     gcctgcccgc gcgcctgctg gtgacatggc gggccctgcc tggacaggcg ctgcccgagg      5640
     tcgtgcccgg gcagcgctgg cgcatggcgc tgcgcgtgcg ccgcccgcac gccaaccaga      5700
     atccgcatgc cccggacagc gaggcgcgcc tgctggcgcg cggcgtgcgc gggctggcca      5760
     gcgtgcgcgg ccgcccgctg ctgctcgacg atgatccctg ggccgacgcc ggcatcgcga      5820
     tcgagcgtgc gcgccatcgc gtgcgcgccg gcatgcgcca ggcgctggcg gggttgcgct      5880
     acgcgccggt gctggtggcg ctggccatcg gcgaccaggc cggcgtggcg cgggaggact      5940
     ggcaggtgtt ccagcgcagc ggcatcatgc atctggtatc gatcagcggc atgcatgtca      6000
     ccgcggtcgc ggcgctggga ggctggctgg cgggctggct gtggcggcgc gcgcgttggc      6060
     gcggcgtccc gctggccgag cgcgcgccgg cgcagcgggt ggccgtgctc gccgcgctcg      6120
     gccccgcgct ggcgtattgc ctgctggcgg gttggagcgt gccgacgcgg cgcgcttttt      6180
     tcatgctggc cgcggtggcg gcggcggtcg cgctgcgctg gccggcaacg ccctcgcgcc      6240
     tgctgacgct ggctgccgtc gcggtggccg tgctcgatcc atgggcgccg ctggcgccgg      6300
     gcttctggct gtcgttcggc gccgtggcgg tgctggtcgg gacaggggcg ggcgcgcggc      6360
     cgcgcggcat gcgggcccgc ctgcgcgccg cgctgctggg cttcgggcgc acgcagatgg      6420
     cggtgacgct ggccttgacg cctttgctgg ccttcctggt gcgccaggtg tcgctggggt      6480
     cgccgctggc caatgctctg gcgattccgg tggtgagcct ggcggtcacg ccgctggcct      6540
     tgctgtgcgg ggcgctgtcg gcgctgccgg gcgggcaggg gccggcctgg ctggccggcg      6600
     ccgcgggcca cgggttgttc gcgctgctga tggcgccggt gggctggata gggcgtgccg      6660
     agtggtccgg cctggacgtg gcggcggcgc cctggccctg gctggccttg gcgctggccg      6720
     gggcggcatg ggccctgcag gcgccgggct ggccggcgcg ccattgcggc tggctgtgca      6780
     tgctgccgct gctggcgtgg cgccccgagc ggccgccgcc cggctactgg accctgaccg      6840
     cgctggacgt gggccagggt ggcgccgtgg tgctggaaac cgcgcgccat gtgctgctgt      6900
     tcgataccgg gccgcggcac ggcgacgcct cggacgccgg cgagcgcgtg attgccccgt      6960
     tcctgcgggc gcgcggctac cgccatatcg ataccctggt ggtgtcgcat gccgacctgg      7020
     accataccgg cgggttgcgc agcgtgctgg cggccttgcc ggtggggcag gcctacgcgt      7080
     ccttcgatct ggcggcgtgg ctggcgcgcc aggcgcgggt gcggccggac ggctggcgcg      7140
     ccgcgccgcg catgccgccg gcgacgcgcg ggtgcgaggc gggcgtgcaa tggcgcgtcg      7200
     acggcgtccg cttgcgcttc gtgtatccgc cgccgcttgc cgcgcccttg ccctggcgca      7260
     gcagcaatgc gcgcagttgc gtgctgctgg tcgaaggcgt cggccaccgc gccctgttga      7320
     ccggcgacgt ggggctggtc caggaggccg cgttcgcggc ggcgttgccg ccggtggacc      7380
     tggtgatggc gccgcatcac ggttcggcca tgtcgtcggg gtccttgctg gccgccgcca      7440
     cgcggcccgc gcacgccatc gcgcaggccg gctacctgaa ccgtttcggg catccggccg      7500
     cgtccgcgat caatcgctgg cggcgggccg gcgccgccgt gtggcggacc gacctggacg      7560
     gcgcggtgcg ggccgattcg acgccgcgcg gattgttcgc cagcgggcag cgccaggtcg      7620
     cgcggcgcta ttggcgcgac agccgcgccg gtcccgatgc gccgctgcga taatggggca      7680
     tcgccggccg tccgggccgc ggcgcggaga catcatgcag gaacctcgtc tggatttcgt      7740
     tacgtgcgcc agccccactg gctttcatcg catggcctat tgggaatggg gcgacccgct      7800
     caatgatcgc gtgctggtct gcgtgcatgg actgacccgc accggccgcg acttcgacca      7860
     tctggcgcgg cggctggccg gccagtggcg ggtggtgtgc cccgacgtgg ccggacgcgg      7920
     caagtccgac tggctgtcca accccgcgct gtacgcggtg ccgcagtatg tatccgacat      7980
     ggcgacgctg atcgcgcgcg tgcggcccgc gacgctggcc tgggtgggca cctcgatggg      8040
     cggcctgatc ggcctgggcc tggccggcgc ggccaccatg atgcgcctgg cgcgcgccat      8100
     gcgcccgcgc ccggacggcc tgccggcgca ggccgacgac ctgcgcctgc acaggctggt      8160
     gctcaacgac gtggggccgc gcctgaacgt cgaggccttg cagcgcattg ccggcaatgt      8220
     ggcggcgcag gacagctatc cgaccttcga agcggccgtg gcggccatgc ggcagatcag      8280
     caccacgttc gggccgcata ccgatgcgca atgggacgag ctggcgcgcc atatctatgt      8340
     gcggcagggc ggcggctggg tcaggcactt cgaccccgcg ctggccgtgc cgctgggcgc      8400
     gcaagtggcg caggccttcg aggcgggcga gcgcattctc tggcaagcgt acgacagcct      8460
     ggattgcccg gtgctgatcg tgcgcggcca ggactcggac ctgctgtcgg cggcgacggc      8520
     ggccgaaatg ctggggcgca atccgcgcgc gcgcctgcac gaggtgcccg gcgtggggca      8580
     tgcgcccacg ctcatgacgc ccgagcagat cgaaccgatt gcccggttcc tgcaggacta      8640
     gcggcccggg ggacggagcg cggcgaagcc gcgctacccg aggccttgca ggacctctac      8700
     aataggtcgt atgaacattg ccgcgcccaa cgtcgatctg cattgccact ccaccgtgtc      8760
     cgacggcagc atgccgccgg ccgcggtggc gcggcgcgcg cacgccaatg gcgtggacgt      8820
     ctgggcgctg accgatcacg acgagatcgg cggcgtggcc gaggccgcgc aggccgccgc      8880
     cggattgggc atgcgtttcg tcgccggcgt cgagatttcg gtgacctggg cgggcctgac      8940
     ggtgcacatc gtgggcttgc gggtggatcc ggccaacgag gcgctggtgc aaggcttgcg      9000
     cgatacgcgc gccggccgcg ccgcgcgcgc ggtgcagatc ggcgagcggc tggcggggct      9060
     gggcatgccg ggcgcctacg agggcgcgct gccgttcgcg ggcaaccccg aactgatcag      9120
     ccgcacgcac ttcgcgcgct tcctggtcga ggccggctat tgccccgatg tgcagacggt      9180
     gttcaacaaa tacctgggcg acgattgccc gggccatgtg ccgatgcaat gggccagcct      9240
     ggccgaggcc gtgggctgga tccgcggcgc gggcggttgc gccgtcatcg cgcatccggg      9300
     acgctacaag tacagcccca tgcagttcga cgcgttgtac gacgagttcc tgcaactggg      9360
     cggcacgggt atcgaggtcg tgaccggcag ccatacttcc gaagaggcgc gccggtatgc      9420
     cgaggtggcg cgccgccacg gtttcctggc ctcgcgcggc tcggacttcc acagtcccac      9480
     cgaaagcagg gtggacctgg ggcgcttgcc gccgctgccg cccgatctca agccggtctg      9540
     gcacgactgg ttctgaaccg cgcctttcgc gccgggccgt tggcgctccg gctgcccttg      9600
     aatccctatg cagcaggcaa ggcatgaaca aagcatttgt caaagaatcc gaccgcgacg      9660
     acgaggacga cctgcccgag gcgcaggcgc tgccggccgg cacgcgcaac tacatgacgc      9720
     cgcaaggcta cgcgcgcttg cgcgatgagc tgtcgcacct gatgaacgtc gagcgtcctt      9780
     cggtcgtgca ggtggtgtcg tgggccgcgt ccaacggcga ccgctccgag aatggcgatt      9840
     acctgtacgg caagaagcgc ctgcgcgaaa tcgaccggcg catgcgcttc ctgaccaagc      9900
     gcctggatat cgccgaagtg gtggatcctg ccgcgcagcc caaccgcgat caggtcttct      9960
     tcggcgccac cgtgctctac atggaccgcg ccggcgaaga gcgcaccgtg accatcgtgg     10020
     gcgtggacga ggccgagccg ctggccggca agatcagctg gatctcgccc gtggcgcgcg     10080
     cgctgaccaa ggcgcacgaa ggcgataccg tgaccctgcg cacgccgggc ggtgtcgaag     10140
     aactggagat cctggaggtg cgctacccgg acgcgtagcg ggcggagggt gagttcccat     10200
     ggagacggat gccgtcttgg caggctagcg ttcgtggcgt atggcggggt gcctgtcccg     10260
     gcggaaaaga aacggacgcc agcttttggc cggcgtccgt tgggttggag ggttgtgcgc     10320
     ccctgccttg cgtggcggct tgcgccgccg ttccccttgg gctgctgctt atttcttgcg     10380
     ggccgcgatc gatttctcgg ccaggtcgac cagctccgcg ccgatctgct tcttccattt     10440
     ttcatagacc ggcttggtgg ccgccacgaa ttcggcgtgc tggccggcgt ccagtctgct     10500
     gacggtgacg ccgtggccgg cgatttcctt cagcagcgac gggtcttcgg gcgtgacccc     10560
     cttgcgggcg atgacgatct gctgcttgcc ggcgtccagc gcggcctggc ggacgatgtc     10620
     gcggtccttc tcggaccagg agttccatac ctcgcggttg accacgaaga tcagcgggtc     10680
     ggcgacgtag ttccacaggg tgaggtactt ctggcccacc gtgtacagct tggagccggt     10740
     gtagatagac agcgggttct cctggccgtc caccgcgccg ctggccagcg ccggctgggc     10800
     gtcggcccag ctcatctgcg tggggttggc gcccagcgcc gtgaaggtgt cgatgtacag     10860
     cggcgagccc acgacgcgca gcttcaggcc cttcatgtcg gccggcgtct tgatctcatg     10920
     cttggagttg ctgagctggc gatagccgtt ctcgccccag gccagcggca ccacgccggc     10980
     cttgtcgatc agcttgaaga cttccttgcc gacctcgccc tgcaccagcg cgtcgatggc     11040
     ggcatagtcg ggcatcagga agggcagcga gaacaggttg agctgcttga cctgcggcga     11100
     ccagttgatg gtcgaaccca cggccatgtc gatcacgccc tggcggatgg cggtgaattc     11160
     acgggtctgg tcgccctgca ccagcgaggt gcccggatag accttgatgt tgatgcggcc     11220
     ctcggtgcgt tcgcgcacca ggtcggacca gatcacggcg ccctggcccc acgggaaggt     11280
     ggtgcccacc acgatggaca gcttgtattc ggacttgtag ttctgggcct gggccggcgc     11340
     cacgcccagc gcgaaagcgg cgcaaagggc ggcgcccacg atgttgcgga atttcatcgg     11400
     ttgtctcctc gtgtcgtgct cggttgctcg aaaatggcgg gcgagccttc ggcttctgcc     11460
     ctttcccccg tattcatcaa tatcccagcc ggtgcggcag ccacagcgcc agttgcggaa     11520
     aaatcagcac ggccaccagc accaggaaca tgccgcccag cagccagacc acccagccca     11580
     cggtggactc catcggcacg cgcgcgatgc ggcaggaaac catcaggttg accgccaggg     11640
     gcggcgtgaa ctggcccagc gccaccttca gcgtcaggat gacgccgaac cagaccggat     11700
     cccagccata ggcattggcg atcggcatga gcagcgggac gaaaatcagg aagatggaga     11760
     tgccgtcgag gaacatgccc acggtcatca gcagcacgat gagcagcgcc agcacgcccc     11820
     attcgcccag cccggaattg acgatggcgt gcgtgatggg gtcgatcacg ctgagcgtgg     11880
     acagggccca ggcgaagatg ccggccagcg tcaccaccag catgatgacg gccgacagtt     11940
     cggcggcctc gcgcaggatc acgaacaggt cgcgtacctt gatggtgcga tggatgcaca     12000
     tgcccacgaa cagcccgtag aacacggcca cgaccgcggc ttcggtgggg gtgaaccagc     12060
     ccatccgcat gccgcccagg atcagcaccg gcgcggccag gccccaggac gcctcgcgca     12120
     ggctggccca cagcggcgga cgcggcaggt gcgcttcgcg tgcgcccatg ccatggcggc     12180
     gcgccagcca gaccgcagga atgatgagcg cgaagccggc caggatgccc ggtaccatgc     12240
     ccgcggcgaa cagcgccggc accgaggcgc ccggcaccag caccgaatag atgatgaagg     12300
     ccaccgaagg cgggatcagg atatcggtgg cggcgccggc ggcgaccacg gcggccgagt     12360
     agggcgccgg atagccggcg cgcgacatgg cggcgatcat caccgcgccc acggccgccg     12420
     cgcatgccgg acccgagccg gaaatcccgc ccaggaacat cgccacggcg atcgatacca     12480
     gcggcagcat gcccgggccg cggcccacca gcgccacggc gaagtcgacc agccgcctgg     12540
     ccacgcccga gcggtcgaag atcgagccca ccagcacgaa catgggaatc gccagcagcg     12600
     ggtacttggc caggccggcg tagaaattct gcggcacggc cagcaggccg aaccaggaca     12660
     catcgaggtt ggacagcacg atggcgaccg tgccgcccag gcccagcgcc acgccgaccg     12720
     gcacgccgat cagcatcagg gtaatgaata cggcgaacag cagcgccgcg atcatgtctc     12780
     ggccttgtgc cgggcgatca gccggcgcgc ggcgccggcc acgcgcagcg tgatgaccgc     12840
     cgccagcagc ggcatccaca ccgagtacca ccaggtcggc acgccgatgg cgggcgaggt     12900
     ttcctcgtag cggaactcgt cgtacaccag ccgggccgac agcacggtga gcagcgcgaa     12960
     gaagaacacg accaggctgt gggcggtcag cgccatcagg tactggcgcc gcggcgagcc     13020
     gttgtcggcc aggatctcga tgcggatatg gtggttgcgc acgaacgcca tggacgcgcc     13080
     gaccatggtc agcacgatca gcaggaagac ggagatctcc tcggtccagg cgaaggactg     13140
     gtcggtcagg tagcgcacca gcacgttcag gaaggtgatg atggccagcg cggccagcag     13200
     gatgacggcg agccagtctt ccagcgccag cgggaccttg acggcgggat cggcttccgg     13260
     ggggatgatg ggttcgacgg gctcgtcaga tgcgtcgggg cggtgcattg gcaacagcgt     13320
     ggagcaaagc gcaggcaata tgagaggctg catcctaccg tcggctcgcc atggcgttag     13380
     ttcgtgtttt cccgcggtgc ggggcgtttg caacatgctg catagcagca tgcaaaccgg     13440
     gccagcctgt tttcgaagac tttcatccgg gtttcaacct cggcgagtcg tctatattgc     13500
     aatgcacaaa atcgggtggc cgtggatgga attattttgt aactccggcg cgacaggacg     13560
     gcacggcgcg gttttgcggc gggttatggg gttaccacgg gtaaaccccg gcaaaaaggt     13620
     aaaatcatgt tttgattcct cctttttcct aacggcgccc gcatcgtgtc ccttgtccag     13680
     catctgcccg gttcctccgt cctttccgct ttccgtcgcg agcgcctgct ggcgcaactg     13740
     aagaaggccg gcctgccggt tgccgatatc tccgcgcgct acgagcattt catccatacc     13800
     gacagcgcct tgccggccga gcagcaggcg cgtctggcgc aactgctgga ctacggcacg     13860
     ccggccgccg aggcgccggc caagagcctg gagctgctgg tgattccgcg cctggggacg     13920
     atgtcgccgt gggccagcaa ggcgaccgat atcgcgcaca actgcggcct ggacgccgtg     13980
     cgccgcatcg agcgcggcgt gcgctacgcg ctgacgcccg agcgcggtct gctgggcgcc     14040
     aagtcgttcg acgccggcat gctggcccgc gcggcggcct gcctgcacga ccgcatgacc     14100
     gagaccgtgg tcgacggcac cttcgacggc caggcgctgt tcgagacgct ggccggcaag     14160
     ccgatgcgca ccgtggcggt gcaggccgag ggccgcgccg cgctggagca ggccaacgtg     14220
     gcgctggggc tggcgctgtc cgaagacgaa atcgattacc tggcgcagtc gttcggcgac     14280
     ctggggcgcg atccgaccga cgtcgagctg atgatgttcg cgcaggccaa cagcgagcac     14340
     tgccgccaca agatcttcaa cgcgcagtgg gtcatcgacg ggcaggcgca gtccaacacc     14400
     ctgttcggca tgatccgcgc cacccacaag gcccagccgg ccggcaccgt ggtggcctac     14460
     tcggacaacg ccgccatcat ggaaggcggc ccggcgcagc gtttccaggc cggcgtgccg     14520
     ggcgtcgcgg gcgagggcgc gcaggccgcg cgctacgtgc gccgcgacac caccgtgcac     14580
     accctgatga aggtcgagac gcacaaccac ccgaccgcga tcgcgccgtt tccgggcgcg     14640
     gccaccggcg ccggcggcga gatccgcgac gagggcgcca cgggccgcgg ctccaagccc     14700
     aaggccggcc tgaccggctt caccgtttcg cacctgcgct tcgacgatgc gctgcaaccg     14760
     tgggagaacg accaccacgg cctgcccgag cgcatcgcct cgccgctgtc catcatgatc     14820
     gatggcccga tcggcggcgc cgccttcaac aacgagttcg gccggcccaa cctgctgggc     14880
     tatttccgcg ccttcgaaca gaccgcgggc ggcacgcgct ggggttacca caagcccatc     14940
     atgattgccg gcggcctggg cagcatcgac gccggcctca cgcacaagga agtgattccg     15000
     ccgggcgcgc tgctgatcca gctgggcggc ccggggctgc gcatcggcat gggcggcggc     15060
     gccgcctcca gcatcagcat gggcagcaat tcggccgaac tggacttcga ttcggtgcag     15120
     cgcggcaacc ccgagctgga gcgccgcgcg caggaggtca tcgaccgctg ctggcagcag     15180
     ggcgagcaca accccatcgt cgcgatccac gacgtgggcg cgggcggcct gtccaacgcg     15240
     tttcccgaac tggtcaatga cgccggccgc ggcgcgatct tcgacctcag gcgcgtgccg     15300
     ctggaagagt cgggcatgtc gccggccgag atctggagca acgagtcgca agagcgctac     15360
     gtgctgtcga tcctgccgca ggacctggag cgcttcgacg ccatcgcgcg gcgcgagcgc     15420
     tgcccgtacg cggtggtcgg cgtggcgacc gaagagcgcc agctgcgcgt ggtcgacggc     15480
     gagggcctgc ccgggctgga cacgatccgc gcgcagggcg agaacgaagt gcgtccggtg     15540
     gacgtgccca tcgacgtgat cctgggcaag ccgccgcgca tgacgcgcga cgtgcagcgc     15600
     ctgcccggcg tgagcgagcc gctcgacctg gccggcctgg atctcaccga ggcggcctat     15660
     cgcgtgctgc gccacccgac ggtggcgaac aagtcgttcc tgatcaccat tggcgaccgc     15720
     accgtgggcg ggctgtccag ccgcgaccag atggtcggcc cgtggcaggt gccggtggcc     15780
     gattgcgccg tgacgctggc cgatttcgaa ggcacgcgcg gcgaagccat gtccatgggc     15840
     gagcgcacgc cgctggcgat gctggacgcg ccggcttccg gccgcatggc ggtggccgag     15900
     gcgctgacca acctggcggc cgctgacgtg gcgcgcctcg aagacatcaa gctgtcggcc     15960
     aactggatgg ccgcctgcgg cgtgcccggc caggatgccg cgctgtacga caccgtgtcg     16020
     gcggtcagcg aactgtgcca gtcggtggga ctgtcgattc cggtgggcaa ggattcgctg     16080
     tcgatgaaga cgtcctggga cgaggcgggc gagcagcgcc aggtggtggc gccggtctcg     16140
     ctcatcgtga cggcgttcgc gccggtgggc gacgtgcgcg ccagcctgac cccgcagctg     16200
     cgcaccgatg ccggcgatac ggtgctgatc ctgatcgacc tgggtcgagg ccggcaccgc     16260
     atggccggct ccatcctggc gcaggcctac aaccaggtcg gcgagacggt gcccgatatc     16320
     gacgcgccgc aggacctgcg cgccttcttc gtgacgatcc gcacgctggc cgaggccggc     16380
     accatcctgg cctaccacga ccgttcggac ggcggcctgt tcgccacgct ggccgaaatg     16440
     gcgttcgccg ggcgcaccgg cgtgtcggtc aacctggaca tgctcacctt cgatccgcag     16500
     tcggccgact ggggcgatta caagatccgt cccgaacagg tggcggtgca gcgcgaagag     16560
     ctcaccctca aggcgttgtt ctcggaagag gcgggcgcgg tcatccaggt gccggcctcg     16620
     cagcgcgacg cggtgatgca agtgctgcgc ggcgccggcc tgtccgcgca ttcgcatgtc     16680
     atcggcggcc tgaacggggc cgacgaggtc gagttctacc gcgatggccg caaggtctgg     16740
     agccagccgc gcgccgacct gggccgcgcc tggagcgagg tcagctaccg catcatggcg     16800
     cggcgcgaca acccggcctg cgcgcaggcc gagctggaca tctggaacga cgccaaggac     16860
     ccgggcctgg cgccgcgcgt ggcgttcgat ccgcaggaag acgtggcggc tccgttcatc     16920
     gccaccggca agcggccgcg cgtggcgatt ctgcgcgagc agggttgcaa cagccaggtc     16980
     gagatgggct gggccttcga caccgccggc ttcgaggcca tcgacgtgca catgaccgac     17040
     ctcctgtcgg gccgcatcga cctggccggc atgcaggggc tggtggccgt gggcggcttc     17100
     agctacggcg acgtgctggg cgccggcgaa ggctgggccc gcaccatccg ctacaacgac     17160
     aagctgtcgg atcagttcgc ggcctacttc gcccgccccg atacctttgc gctgggcgtg     17220
     tgcaacggct gccagatgat ggcggcgctg gcgcccatga tccccggcgc cgagcactgg     17280
     ccgcgcttta cccgcaacca gtccgagaag tacgaggcgc gtctgtcgct ggtggaagtc     17340
     acggcttcgc cgtcgatctt cttcgcaggc atggagggcg cgcgtatccc ggtggccgtg     17400
     gcgcacggcg agggctacgc cgacttcacc cagcagggcg acgcggggcg cgcgttgatg     17460
     gcggcccgct atatcgacaa ccacggcgcg gccaccgaaa cctatccgtt caaccccaat     17520
     ggcagccccg gcggcctgac cgcggtgacg acggccgacg gccgcttcac ggtcatgatg     17580
     ccgcaccccg aacgcgtgac ccgcaacgtc atgatgtcgt gggcgccggc gcagtggggc     17640
     gagcgcgatg ccggcggcgc gttcagcccc tggatgcgta tcttccgcaa cgcgcgcgcc     17700
     tggctgaaat aaacccttcg cttcgctcca ttcgaacggc ctttcgcgag aaaggccgtt     17760
     ttttattgtc cggtgctgtc gggtttgaat gcattttgga agtattgatt ggggtgattg     17820
     ggttgtaggc gggtgggtat ttgctgtttt gtgtgcgtga gttttcttcg ggtgggttga     17880
     atcggggatg gcgtatttat gctgattgag cagcgacgcc gatcagacct acataacgac     17940
     atcaggagac aacatgaacg cgttttgctt tcgattggtt tatagccaat gtcgcgccat     18000
     gtatgtgccg gtggcgctcc ggcgccgcgc ggcgcggcgt ggatgtggcg gggcgggccg     18060
     gcgactgcgg cgcgcgctgg ccgcggcggg agtcgccctg gcgtgcggcg cgatggcggc     18120
     gccgcaacgc tcgccatccg gcgtgccggt catcgatatc gccgccccga acgcccatgg     18180
     cctgtcacac aaccgcctgc gcgaactcga tgtcgagccg ccgggcctgg tgttcaacaa     18240
     cagtctgacc gagggccggt cgcaactggc cggccacctc aatcgcaacc ctggcctgcg     18300
     ccaggcagcg acggccatcc tgaccgagat cacgggaacg cgtcccagcc gtctgcacgg     18360
     cgcgctggag gtgttcggcc ggcgcgcgga cctcatcatc gccaacccca acggcatcag     18420
     cgtcaacggc ctgagcacgc tcaacgccag caacctgacg ctcacgacgg gtcgtcccag     18480
     cgtcaacggc ggccgcatcg gccttgatgt ccaacagggc accgtcacga tcgaacgagg     18540
     cggcgtcaac gccaccggcc tgggctattt cgacgtggtg gcgcgcctgg tcaagctgca     18600
     gggcgccgtg tcgagcgagc agggcaagcc cctggccgat atcgcggtgg tcgccggcgc     18660
     caaccggtac gaccacgcaa cccgccgcgc cacgccgatc gccgcaggcg cgcgcggcgc     18720
     cgccgctggc gcctacgcga tcgacggcac ggcggcgggc gccatgtacg gcaagcacat     18780
     cacgctggtg tccagcgatt caggcctggg cgtgcgccag ctcggcagcc tgtcctcgcc     18840
     atcggccatc accgtgtcgt cgcagggcga aatcgcgctg ggcgacgcca cggtccagcg     18900
     cggcccgctc agcctcaagg gcgcgggagc cgtgtcggcc ggcaagctgg cctccggtgg     18960
     cgcggtgcgc gtcgcgggcg gcggagcggt gaagatcgcg tcggccagca gcgtcggtag     19020
     cctcgcgatc caaggcggcg gcaaagtgca ggccacgcag ttgaacgcgg gcggtccgtt     19080
     gcaggtgtcg agtcgccagg ctgtccggct tggcgcggca agcagcggcc agacgctgtc     19140
     ggtgcgcgcg ggcgcggcgc tgcaggcgga ccagctgtcg gcgacgcggc ggctcggcgt     19200
     ggacggcaag caggccgtca cgctgggttc ggttgccagc gacggtgcgc tgtcggtaag     19260
     cgctggcggg aacctgcagg cgaagcaatt ggtctccaat gccggactgg acgtgcgcgg     19320
     ccagcgggag gtgtcgctgg aagcggcgtc cagcgtgcgc ggcatgacgg tggctgccgc     19380
     aggaacattg gcggcccgca atctgcagtc gcagggtgcc atccgcatac agggcggaca     19440
     ggcggtcagc gtggccaacg cgaacagcga tgcggaactg cacgtgtccg ggcgcggcca     19500
     ggtggatctg ggcgatctga gcgcagcgcg cggcgcggat atcaccggcg agcaacgcgt     19560
     cagcatcggc cgtgcgcaca gcgatggcga tgtgaatgtc gccgcgcgcg gcgccttgtc     19620
     gatcgatagc atgacggccc tcggtgcgat cggcgtccag gcaggcgaca gcgtgtcggc     19680
     caaggatatg cgcagccgtg gcgccgtcac agtcagcggc ggcggctccg tcaacctggg     19740
     cgatgtccag tcggatgggc aggtccgcgc caccagcgcg ggcgccatga cggtgcgaga     19800
     cgccgcggct gccgccgacc ttgcgctgca ggccggcggc gcattgcagg ccggattcct     19860
     gaaatcggcc ggcgccatga ccgtgaacgg ccgcgatgcg gtgcgactgg atggcgcgca     19920
     ggcgggcggg caactgcggg tttccagcga cgggcaggct gcgttgggca gtctcgcggc     19980
     caagggtgcg ctgacggtat cggccgcgcg cgcggcgacc gtggccgagt tgaagtcgct     20040
     ggacagcatc tccgtgacgg gcggcgaacg cgtatcggtt cagagcgtca acagcgcgtc     20100
     cagggtcgcc atttcggcgc acggcgcgct ggaggtaggc aaggtttccg ccaagagcgg     20160
     tatcgggatc gaaggctggg gcgcggtcgc agcggactcc ctcggttccg acggcgcgat     20220
     cagcgtgtcc gggcgcgatg cggtcagggt cgatcatgcc cgcagtcttg ccgacatttc     20280
     gctgggggcg gaaggcggcg ccacgctggg cgcggtggag gccgccggtt cgatcgacgt     20340
     gcgcggcgga tccacggtgg cggcgaactc gctgcgcgcc aatcgcgacg ttcgggtcag     20400
     cggcaaggac gcggtgcgcg taacggccgc caccagcggg ggcggtctgc atgtgtcgag     20460
     cggccgccag ctcgatctgg gcgccgtgca ggcgcgcggc gcgctggccc tggacggcgg     20520
     cgccggcgtg gcgctgcaat cggccaaggc tggcggcacg ctgcatgtgc agggtggcga     20580
     gcacctggat ctgggcacgt tggctgctgt aggggccgtg gacgtcaatg gcgcgggaga     20640
     cgtgcgcgtt gcgaagctgg tgagcgatgc aggcgccgat ctgcaagcgg ggcgctccat     20700
     gacgctgggt accgtcgaca cgaccggcga tctgcaggcg cgcgcgcagc aggcgctgga     20760
     gctcgggtcg gtcaagaccg agggcggcct tcaggccgcc gccggcgggg ccctcagcct     20820
     ggcggcggcg gaagtcgcag gggcgctgga gctctcgggc cacggcgtca ccgtggaccg     20880
     ggccagcgcc ggccgggcac gcatcgacag caccggttcg gtcggcatcg gcgcgctgaa     20940
     ggcaggcgct gtcgaggccg cttcgccacg gcgggcgcgc cgcgcgctgc ggcaggattt     21000
     cttcacgccc ggcagcgtgg tggtccgcgc ccagggcaat gtcacggtcg ggcgcggcga     21060
     tccgcatcag ggcgtgctgg cccagggcga catcgtcatg gatgcgaagg gcggcacctt     21120
     gctgctgcgc aacgacgtct tgaccgagaa cgggacggtc accatatcgg ccgattcggc     21180
     cgtgctcgag cattccacca tcgagagcaa gatcagccag agcgcgctgg ctgccaaggg     21240
     ggacaagggc aagccggcgg tgtcggtgaa ggtcgcgaag aagctgtttc tcaatggtac     21300
     gttgcgggcc gtcaacgaca acgaggaaac catgcccggg cgccagatcg acgtcgtgga     21360
     cggacgtccg cagatcaccg acgcggtcac gggcgaagag cgtaaggacg aatcggttgt     21420
     gtccgacgcc gcgctcgtgg ccgatggcgg tccgatcgtg gtcgaggccg gcgagctggt     21480
     cagccatgcc ggcggtatcg gcaacggccg caacaagggg gatggcgccg acgtcaccgt     21540
     gcgcacgacg ggcaacgtga tgaacaaggg ctacatctcg gccggcaagc agggcgtgct     21600
     cgaggtgggc ggcaccttga cgaacgagtt cctggtcagc tcggacggca cccagcgtat     21660
     cgaggcgcag cgcatcgaga acaggggcac cttccagagc caggcgccgg ccggcacggc     21720
     cggcgccctg gtggtcaagg ctgccgaggc catcgtgcac gacggtgtca tggctaccga     21780
     aggcgagatg cagatccctg gcaagggcgg caggtctccg gccgtcaccg ccggcgcaaa     21840
     ggcgacgacc agcgcgaaca agctgagcgc cgacgtggcg agctgggaca acgcgggaag     21900
     cctggatatc aagaagggcg gcgcgcaggt cacggtggcc gggcgctacg ccgagcacgg     21960
     caaggtttcg atacagggcg attacacggt ctcggccgac gccatcgcgc tggcggcgca     22020
     gatcacccag cgtggcggcg ccgcggacct gacctcgcgg cacgataccc gtttctccaa     22080
     caacattcgc ctgatggggc cgttgcaggt cagcgctggc ggcgcggtgt ccaataccgg     22140
     caatctgata gtgcgcgagg gcgtgcgcgt gacggcggcg tcgttcgaca acgaggccgg     22200
     ggccgaggtc atggccaaga gcgccgcgct aacgacttcc ggggccgtgc gcaacgcggg     22260
     caagatgcaa gtcaaggagg ccgccacgat cgttgccgcc agtgtttcca atcccggcac     22320
     attcacggcc ggcaaggatc tcactgttac ctcgcgcgga ggattcgaca acgacggcaa     22380
     gatggagtcc aacaaggaca tcgtcatcaa ggcggagcag ttcagcaatg ccgggattct     22440
     cgatgccaag catgatctga cggtcacggc gagcgggcag gcggacaacc ggggcagcct     22500
     gaaggccggc cacgatttca cggtgcaggc ccagcgtatc gacaacagcg gcaccatggc     22560
     cgccggccac gacgccacgc tgaaggcgcc gcacctgcgc aatacggggc agatcgtggc     22620
     gggacacgac atccatatca tcaacagcgc caagctggag aacaccgggc gcgtggatgc     22680
     gcgcaacgat ctcgtgctgg atgtggagga tttcaccaac acgggatccc tctacgccga     22740
     gcatgacgcg acgctgacgc ttgcgcaagg cacgcagcgc gatctggtgg tggaccagga     22800
     tcatatcctg ccggtggcgg aggggacgtt acgcgtcaag gccaagtcgc tgaccaccga     22860
     aatcgagacc ggcaattccg gcagcctgat cgccgaggtg caggaaaata tcgacaacaa     22920
     gcaggccatc gtcgtcggca aggacctgac gctgagttcg gcgcacggca atgtggccaa     22980
     cgaagcgaac gcgctgctgt gggccgccgg ggacctgacc gtcaaggcgc agaacatcac     23040
     caatgaacgg gccgcgctga tcgaggcggg cggcaacgcc aggctgacgg cggccgttgc     23100
     cttgctcaac aagctgggcc gcattcgcgc gggcgaggac atgcatctgg atgcgccgcg     23160
     catcgagaac acggccaagc tgagcggcag catacaaccc aaaggcgtgc attacgtcgg     23220
     gggcggcaag tatggccggt ggagcggtat cggctatgtc aattaccact tgagttccgg     23280
     ctccggcgct atcgcggcgc cgtggtacga cagtgatctg acggcggaac agtcgctcat     23340
     cgaggtcggc aaggatctct atctgaatgc cggggcgcgc aaggacgagc atcgccatct     23400
     gctcaatgaa ggcgtgatcc aggcgggcgg ccatggccac atcggcggcg acgtggataa     23460
     tcggtcgatg atgcgcaccg tgtccgccat ggagtatttc aagacgcccc tgccgctgtc     23520
     tatgacggat atcttccaca atttagcgcc gtcgcccttg accctgactg ccgtggacaa     23580
     ccgcgcaggc ctgtctccgg cgagctggaa cttcaactcc acgtatgaac tcctggatta     23640
     tctgctggac cagaatcgct acgagtacat ttggggggtg tatccgacct acaccgaatg     23700
     gtcggtcaat acgctgaaga acctcgacct gggctaccag gccaagccgg ctcccacggc     23760
     gccgccggtg cccaaggtgc ccacgctcga tctgcgcgga cacaagctgg agtcgccgga     23820
     aggcctgaag atctatggcg agtacaagaa gctgcaaggc gagtacgaga aggccaaggc     23880
     ggccgcccag gcggtggagg cttacggcga agccacccgg cgggtccacg accagttggg     23940
     tcagcgttac ggcgcggccc tgggcgggat ggataccgag acccaggcgg tcgatggcat     24000
     catccaggcg tttgccgcgg atctgcgaac ggtctatgcg aagcaggccg accaggcgag     24060
     catcgatgca gagacggata aggtcgccca gcgctacaag tcgcagatcg acgcggtgcg     24120
     gctggaggcg atccagcctg gccgggtcat gctggccaag gcgctgtcgg ccgcgctggg     24180
     agccgattgg cgcgcgctgg gccacgccga attgatgcag cgctggaagg atttcaaggc     24240
     gggcaagcgc ggcgcggaca tcgcgttcta tcccaaggag cagaccgtgc tggccgccgg     24300
     cgccgggctg accctgtcca acggggcggt ccacaacggc gagaacgccg cgcagaatcg     24360
     cggccggccg gaaaacctga aaatcggcgc acactcggcg acttcggtgg gcggctcgtt     24420
     cgatgccttg cgcgacgtgg ggctggaaaa gcggctggat atcgacgatg cgctggctgc     24480
     cgtgctcgtg aatccgcata ttttcacgcg gatcggggcg gcccaggcgt cccttgccga     24540
     cggcgccgcc gggccggcgc tggcgcgcca ggccaggcaa gcgctgggga ccgacggcat     24600
     cgtggatgcg cgagggctgg gcagcgccga cgcgctcgct tccctggcca gcctggacgc     24660
     ggcgcaggga ccggaggttt ccggcaagcg caatgcgcag gtggcggacg cccggcttgc     24720
     cgcgccgaac gcggtggcgg cgccggctgg cggggcggtc cgggtcgcgc cgccagccgt     24780
     cgcgttgccg cggccgctgt tcgaaacccg catcaagttt atcgaccaga gcaaattcta     24840
     cggctcgcgt tatttcttcg agcagatcgg ctaccagccc gatcgcgcca cgcgcgtggc     24900
     gggcgacaac tatttcgata ccacgctggt gcgcgagcag gtgcggcgcg ccctgggcgg     24960
     ctacgaaagc cgcctgcccg tgcgcggtga cgcgttggtg gccaggctga tggcgtcggc     25020
     cgggacggtc ggcaaggcgc tgggcctgaa ggtgggtgtc gcgccgaccg cgcagcagct     25080
     caagcaggcg gaccgcgatt tcgtctggta cgtggatacc gtgatcgacg gccagaaggt     25140
     cctcgctccc cggctgtacc tgaccgaggc gacgcgccag ggcatcacgg atcagtacgc     25200
     cggcggcggg gcgctgattg cctccggcgg cgacgtgaac gtcgacacga acggccatga     25260
     cgtcagttcg gtcaacgggc tgatccaggg caagcgtgtc aaggtggatg ccggcaaggg     25320
     ccgtgtcctg gtggccgaca gcaaggggat gggcagcggc atcgaggccg acgaagaagt     25380
     cgacgtctca ggccgggata tcgacatcga gggcggcaag ctgcgcggca aggatgtcag     25440
     gctcaaggcc gacacggtca aggtcgcgac ctcgatgcgt tacgacggca agggcaggct     25500
     ggcggcgcgc ggcgacggcg ccctggatgc ccaaggcggc cagctgcata tcgaggccaa     25560
     gcgcctggag acggccggcg cgacgctcaa gggcagcaag gtgaagctgg atgtcgatga     25620
     cgtcaagctg ggcggcgtgt acgaggcggg gtccagctac gagaacaaga gctcgacgcc     25680
     gctgggcagc ctgttcgcca tcctgtcgtc gacgacgcaa accaaccagt cggcacgcgc     25740
     gaaccattac ggtacgcgca tcgaagccgg cacgctggaa ggaaagatgc agaacctgga     25800
     gatcgagggc ggttcggtcg aggccgcgca tacggacctg tccgtggcgc gcgatgcgag     25860
     gttcaaggcc gccgcggatt tcgaacacgc cgagcacgag aaggacgtgc gccaactgtt     25920
     tgtcagcggc acggtggggg ccggcggcta ccaggcgaca ggcacgctgg gcagcgaaac     25980
     cggcgccagc agctacgccg gccgcggcgc ggcggccagc gcgagcggcc ggatcggctg     26040
     ggaaagcacg tgggagcaga gcacctcgtc gcgcaagaaa taccgcaacg ccgacctgcg     26100
     cctgggcgat ggctcggtcg tcgccggcgg cgtgctggat ttcggcggcg ccgacgtcaa     26160
     tcgcgaccgc tacggcggcg gcgccgaagg cgggtccggc ttgcggctac gcggcggcga     26220
     ggtgcgcacc acgaagtacg tggataccga gagcaccgtg cgcagcggcg ggcgcgtcgg     26280
     gctggagctg ggcgtcgacg ccagcgtcaa tccgcaggtg accgccagcc gcctgggcca     26340
     gagcctggcg cagaccgggg acggccgggg aatcgatggc ggcctgatgt tcggccaggc     26400
     gctgagcacg gtgttccaga gcgtcatggc ggataccgcc aacagcacgt tgagcatgag     26460
     cctgcagggg gattggtgga acgagcgtcg cagcgccact tcggagaacg tgacgcacgt     26520
     gggcggcaac gttcgcatcg aaagcggcgc gggcgacatg accctggccg gcgtacgctt     26580
     tgacggcggt cgcgaggtcg acttgcggtc ggccggcgcg ttgcgcatgc ggtcggccga     26640
     atcgcgcgag cagcgcacgc gcgacgcgca cagcctgtcg ctcgacgctc gcatgaccat     26700
     gggcgccaat ctcgtcaagg ccgacgccta tgtccgcggg acggtggggc tgagcggacg     26760
     ccatgagcac gaggcttccg aacggcgcac gcatgaccag acgggcatcc gggccgccaa     26820
     tgtgcgtctg caggcggcgc gcgacctggt catgcagggc gcgcgcgtgg acgccgcgca     26880
     aagcgcgcag gtggaggtcg gcggcacgct gtccatggcc agcgtgcagg acgtgcatga     26940
     cgaaagccgc acatcggcaa gctggatgct ggcggcgggt gcgcatgcgt cgagcggcaa     27000
     cggattcaag ccgcagccgg tcgtgcaggt cgcggcgtca ttcagccacg gtcacgaccg     27060
     tggcgccgtg gtggcgcagc gtacgggtat tgccgcgggc ggccccttgt cggtgcgggt     27120
     ggcgggcgat gcgcacctga ccggcgccga cctggcgtcg gccgatcggc agggcagtgt     27180
     gcaggtgggc ggccgggtgc gcgccggcca gctggccgac tggcgcgacc gcgacggcgg     27240
     ttcggcgggt gtgtcggcgc cggccattct ttcgaccagc acccggccca cgctggtggt     27300
     cagcggcgga cggctggcgc gcgaccatta tgctgcgacg cagcgctccg tcatcgcggt     27360
     ggcgccggac ggattcacgg cggccggtgg ggtgtcgggc catttgcagc gcgatccggc     27420
     ggcggggcgg gaggtcttgc gcgatgagca ttgggccggc ggcgatatgg cgttcacgct     27480
     gggctcggtg cccaagttcg accgcggcag gtacgcaccg ccgcggcccg atacctcggt     27540
     gccgggaggg tcgccctttt cgctgcatcg ctagcgcgag ggcggtaatc ggggacgcgt     27600
     ggccgtgcgg caaggcgccg gcaggcataa aatggcggct tcgttcccgt actggatggt     27660
     tccgccatga acgcccgcat acccgacgac gccctgccgc ccgctctcga ccccgatgcg     27720
     ctgcaagcct tcgtggacga caaatgggac aacgagatca tcccggcgct caccgactac     27780
     atcgcgatac cggccaagag cccggcgttc gatgcggact gggaaaagaa cgccttcatc     27840
     gagcgggtgg tgcgcgatgc ggcgcaatgg gtcgagagcc agaaggtgtc cggcctgacg     27900
     ctggaggtgg tgcgcctgcc tggccgcacg ccggtgatct tcttcgacgc gccggccacg     27960
     cgcgccgaca acggcgatac cgtgctgctg tacggccacc tggacaagca gcccgaattc     28020
     tcgggctggc gcgccgacct gggcccgtgg acgccgaagt acgagaacgg caagctgtat     28080
     ggacgcggcg gcgccgacga cggctacgcc atctacgcat cgctgaccgc catcatggcg     28140
     ctggacaagc aggggattcc ccggccgcgc tgcgtgggca tcgtcgagac ctgcgaggag     28200
     tccggcagct acgacctgct gccctatgtc gatgtcctgc gcgagcgcct gggcaacgtg     28260
     gccctggtgg tctgtctgga ctcgggcgcg ggcaactacg accaattgtg gatgaccacg     28320
     tcgctgcgcg gcatggtggc cggcacgctg gaggtccagg tgctggacga aggcgtgcat     28380
     tcgggcgatt cgagcggcgt ggtgccgtcc agcttccgca tcctgcgcca tcttctggac     28440
     cgcctggaag acagcgccag cggccgcctg ctgccgcaaa gcctgcattg cgagattccc     28500
     gccgagcgca tcgagcaggt gcatgccacc gcacgcatcc tgggcgacga agtgtggcgc     28560
     cgcttcccct ggagctgcgg cgccgagggc ggcttcgtgc tgcccatgac caccgagccc     28620
     gaagaggcgc tgctcaaccg cacctggcgg cccacgctgt cggtgaccgg cgccgaaggc     28680
     ctgccgccgc tgaccagcgc cggcaacgtg ctgcgcccgc gcacggcgtt caagctgtcg     28740
     ctgcgcctgc cgccgctggt ggacgcggtg gccgcggcgc aggagatcaa ggggctgctg     28800
     gagaacgacg cgccgtacaa cgccaaggtc atttttcacg ccaacgaagg cgcggccacg     28860
     gggtggaacg cgccggcgtc ggcgtcgtgg ctgagccagg cgctcgacgc cgcttcgcag     28920
     cagtactatg gcgcgccgtg cggctatatc ggccagggcg ggacgatccc gctgatgagc     28980
     atgctgcaga aggggtttcc caaggcgcag ttcatggtgt gcggcgtgct gggccccaag     29040
     tccaacgcgc acggtcccaa cgaattcctg cacgtgccgt acggcaagaa actcaccgcg     29100
     gccgtggcgc agaccatggc ggcgctgccc accgaatagg gctcgtgccc gcaagttatc     29160
     aaggatgaac gcgtgattgt cgatgtacag accggcgcgg ccgtggcggc cgaagtcagg     29220
     ctatgggtgg acaaggccgt gatcggcctg aacctctgtc ctttcgccaa ggcggtgcag     29280
     gccaagggcc aggtgcgcta tgccgtcagc gacgccaccg atgccgaagg ggcgctgagc     29340
     gacctggaag acgagctgat gcgcctgagc cagaccgacc cgcaggagat cgacacgacg     29400
     ctgttgatcc tgcccgacgc gctggacgac ttctacgatt tcaacgattt cgaggatctc     29460
     tcggaccgcc tgctcaagcg catgcggctg gtgggcgagc tgcaggtcgc caccttccac     29520
     ccgcgcttcc agttcgccga gaccgggccg gacgatatcg agaactacac caaccgttcg     29580
     ccttatccca tcctgcatct gctgcgcgaa gccagcatcg acaaggcggt cgaagccttc     29640
     cccgatgccg ccgagatcta cgagaagaac atcgagacca tgcgcgagct gggcgaggaa     29700
     ggctggcgca agctgatgga gtaagcggtg ccggtcccca cgcggggacc ggcgccgtcc     29760
     tggcagtcaa gtgttcgcgg ggtgcctgtc cccgccggga caggcaccct ggccgatgcg     29820
     gggacgggtg cgccgccgtc aagacgcccg cgcgcgttcc aggaagtcca gcatggcccg     29880
     gtacgagccg gcgttgccat gggcgttggc cgggggcgtg ccgccggcgt cgagcagcag     29940
     gcccgacatg gcatgtggct tgctgatcaa cgtggcgggc aggttggggt agtgcacgtg     30000
     atgcccggcg ccacggcaca cgtagtgctc ggcgggccgc gcgggccatg cggcctggcg     30060
     ttgccgcgcc acgatttccg aataggcggt gctgggccag aagccatcgt ccgaggcgct     30120
     gatcagcatg agcggccccg ggtagcgttc gatgggaatg cgggcgcgct cgaaggcgcg     30180
     cgcatcgcgc gaggcgctca tgaaggcgtg ggtctggcgg tagggcgggt cgctggcata     30240
     ggcggcctcc caatcggccg tcgcgttgtc ctgccacaga tgcggcagcg gcttgccgcc     30300
     cagcgtccag acctgcgcgt cgcggcccgt gccgggcgcg ccggcgctga ccacgccatg     30360
     catgaccggc gacggcacgt aggccaccac ggcgctgacc agttcgggaa agtggctggc     30420
     cgccagcaac gacatctccc cgccccggct gatgccggag atggccacga agccgtcgcg     30480
     cgggttcagg gtgtcgcgca cccagcgcag cgcctgttcg aggtactcca acggcatgtc     30540
     gttgaggtac ttcgggcggt cttcatagtt gaagacgccc agcgccaggc actggtagcc     30600
     gcgcgcggcg aacagcgcgg cgcgcggcgc gttgacgccg cccgatgaac cgttcatgta     30660
     gatgatcgcc ggatgcgggc ccgggccggg cggcgtgtac agctcgcccg acaggctcat     30720
     gccgccggcc cgcgcgcgca ccgcctggtg gcgtacgcct tcggcgagga actcctgcac     30780
     cagcgtcgcg tgggcttcgt gccggccgtc gctggccgtg atgtgcacgg tcagcgcgtc     30840
     ggtgcgatcg ggcggaaaca cggcccgggg cgggtcctgg cactgcatcg accagaccag     30900
     gcccatggcg tcgggctcgg catagtcgcc gctgaccgga ctgtcgcggc ccaggtccag     30960
     gctgccgtcg gcgccggcca ggaaggtggc gcgcgagcgc cacggcaccc cgcacatgcg     31020
     catctcggcc gtgacgtcga tgcaggcgta agggccgaag ccgtcgatgc ggatctcgcg     31080
     atccacatcg atcagggcgc gttcgggggc gacgctcatg cgtggcggca tctcggggct     31140
     cctcagcttt tcaggtcggt gcgcggcacg ttgttggcct tgatcacctg ttcccacatg     31200
     gccgactctt cggcgatgac acggtccatg tcggcggccg aggtgaactc gatggtcacg     31260
     ccctggtcgg cgaactgctg gatcaggccg ggatccgccg tgccggcgcg caccgctttc     31320
     tccagctttc cgaccacctg cgccggcatg gccgccggcc cggagatcat catgcgcgtg     31380
     tagagctcga agccgtccag gccggcctcc ttcatggtgg ggacatcggg caggctgctc     31440
     agccgctggt ccgccgtgac ggccagcgcc ttgtatttgc cggcgcgcag attggcgatc     31500
     gacgaggtgg ggaagtcgaa cgtgctcttg accgtgccgg ccatcaggtc cagcagcgcc     31560
     gggccgctgc ccttgtatgg cacgtcctgg aactgcgtgc ctgtcttgga ctggaagtgc     31620
     agcagcgcca ggtggttgat gatgccgcgg cccgcatggg cgcaggtgat ctcgcccggc     31680
     ttctgcctgg ccagggcaat gaattcctgc acgttccgca cgcccaggtc cgggtgcacg     31740
     atcagcagca tgggcgactt gcccatcgag cccagttgct tgaagtcggc ctgcttgtag     31800
     ggcaggttgt tgtagagcag cgggttgagg atcatgccgt tggtgccggc aaagcccagc     31860
     gtatagccat cgggctcggc gcgggccacc gccacggtgg cgatgatggc ctggccgccg     31920
     gggcggtttt ccaccacgac gctggcgttc atggccttgg acatgcgttc ggccagggcg     31980
     cgcgcggcga tgtcggtcag gccgccaggg gcaaagccca ccagcaggcg gatcgggcgg     32040
     gatgggtagg cgtcctgggc ccaggacggg cgtacggcga agggcagggc cgcgagggcc     32100
     tgcaggacat ggcgtcgggt caagcgcata caacggcctc cctggaacaa ggaaacgggt     32160
     tggcggcgcg gccggcgcgg gccgcgcggc gccccggtgg atcgggatac gcggtgcgct     32220
     ggccggctat tggccaggca aacagaatat tgtatgcagt ttgccggggc gtccagctag     32280
     ggttattccc aggcgcgcgg gcttgcgcgg cggcgcggcc gccggatcag ggttgcgcgg     32340
     ggacctggaa gcgctcgctc agctcctgca ggccgatgcg ttccagcatt tcgcgcaggc     32400
     ggcgcgcggg ctcgcggcgc ggcctgccgg gttgatggcg ggcgatgatc agttcgttct     32460
     tcatcgagtg ttcccagccc accagctcgg tcacgctgag ctggtagcca tgggcctcga     32520
     gctgcaggca gcgcagcaca ttggtgagct ggctgccgaa ttcgcgcgta tgcagcggat     32580
     ggcgccacag ttcggccatg gggtcggcca gggcgcgcgc cttgttcttg cgcagcacgg     32640
     ccgccacttc cgcctggcag cagggcacca gcacgatgct ttgcgcctgc ttggccaggg     32700
     cgaagcggat ggcgtcgtcg gtggcggtgt tgcaggcgtg cagggcggtc acgatgtcga     32760
     cccgcggcgg cagctgttcc gacgcgatgg aatcggccac cgagaggttg agaaacgaca     32820
     tgccgccaaa gcccaggcgc gcggccagtt cggtcgcgct ttggaccagt tcggcgcggg     32880
     tctcgatgcc gtagatgtgc gaggcgtcgc gccggtcctt gaagaacagg tcgtacagga     32940
     tgaagcccag gtacgacttg cccgcgccat ggtccaccag ggtgacggcg ccgcgcgcgt     33000
     ccctggcgtt ttgcagcagc ggttcgatga actggtagag gtggtagacc tgcttgagct     33060
     tgcgccggct gtcctggttc atcttgccgt cgcgggtcag gatgtgcagg gccttgagca     33120
     gttcgatcga ctggccgggg cggacttcgt gcgtgttgga cattgccgta atcggtaaac     33180
     cggcccgcgc ctggcggcgc gggcaaagac ggcagtttaa ccaatcgggc cgcgcgtccc     33240
     gggccggccg gcccggccga tccggcgtcg acagggggcg catcgccacg cccatcctcc     33300
     tgcctacgac cgagacgcgg cacgcgctcc gacaatcccg acgggcaaca aggcaaacgg     33360
     ctgtccgtat agcgtcccgg cgcattgatc cgtctttcta aattatttat aataatttgc     33420
     ttatttcttt tggtaataat acgcggtggg cggcatggca ggcggattcc tgggcatatt     33480
     gataggcctg accctggggc tgacaggggc gggcggcggc atcctggcgg tgccggcgct     33540
     ggtgctgggc ctgggcatgg acatgcccca ggccgcgccg gtcgccctga tggcggtcgg     33600
     gctggccgcc gcggtcggca gcgccgaagg cctgcgccgc ggcacggtgc gctacaaggc     33660
     cgccgcgctg atgtccgtcg tcggcggcct ggcggcgccc tggggcgccc agttggcccg     33720
     gctggcgccc ggcccctggc tgagcggcct gttcgccatg gtcatgctgc tggttgccgg     33780
     ccgcatgctg cgccagtcgc tggccgcgcc ggccggcgcc cagacgcagg ccgagcggcc     33840
     ctgccacatc tcgccgcaaa ccggcaaatt cgtctggacg ccccgcgccg ccgccacgct     33900
     gggcggcatc ggggcgattt cgggactgtt caccggcctg ctgggcgtgg gcgggggctt     33960
     catcatcgtg ccggcgctgc gccagttcag cgatgccccg atgcacgcca tcgtttccac     34020
     ctcgctgatg gtcatcgcgc tcatttcggc ggtcaccgtc ggccatgccg tggccgacgg     34080
     cctgacgctg gacgcggccg cctggacttt cgtcgccgcc gcggtgctgg gcatggtgct     34140
     gggccgcgcg ctcgcgccgc gcctgcccac cgcgcgcctg cagcagctgt ttgcgctggt     34200
     gtgcgtggtc gtggccgggg tgctgctgtg gcgcacgggg tggcaggcat gagcgcgatg     34260
     gtgcagctcg gccccctgat gctgccgacc gccttgctgc tgatgctggc ctgcgtggcg     34320
     gcaggcagcc tggcggcgcg ctggcgggcc ggcagtgccg gcgcgggcga gatgccgctg     34380
     atgcgggtgc tgctggccgg gctgctggcg gcgcggctgg cgttcgtctg gcgccaccgc     34440
     gaggcctatc tgcaatcgcc atgggacgtg ctggatatcc gcgacggcgg ctggctggcc     34500
     tgggccggtt tcgccggcgc ctgggcctgc ggcctgtggt tcgcccggcg ccgcgggcca     34560
     cggcgccggc cgctgctggc cggcctggcg gccgccacct tggcatggac agtcggggcg     34620
     gccgtgctgg gcatcggcgc acccgcggcc atcaaggcca tgccgccgct gcagctggcg     34680
     acgcccgacg gcgcgccgcg cagcctggcc gccttcgccg gccagcccgt ggtgctgaac     34740
     ctctgggcca gctggtgtcc gccgtgccgg cgcgagatgc ccatgctgca acgcatgcag     34800
     gcggcccggc ccgacgtgca cttcgttttc gtcaaccagg gcgagagcgc gcaacaggtc     34860
     aacgcctacc tgcgggaact cggcatgccg ctgcgcaacg tactgctcga ccccggcgcg     34920
     caggccggcg cgtatttcgg ccaccgcgcc ttgcccgcca ccctgttctt cgatgcgcaa     34980
     gggcgcctgg tcgacacgcg gctgggcgaa ctgtcgcagg ccagcctggt ccagcgcctg     35040
     ggcgcgttgc gtcccgcacc ctgatctttc ccgtttcaag gagtccgtcc gtcatgtccg     35100
     atcccatcct gccgcgcgcg gccgccggtt tgcggcgcgc ctgcgccgtg ctcgccggcg     35160
     ccgtgctggc cgccggcgcc gcgcaggccc agcagccgcc ggcgcccgtc gcggcgctgg     35220
     cccagcacgg cattgaaatc ctcggcacct ttcccgcgcc cggcgggctg accgcctggg     35280
     ccgcgcacgc cggcgaccgt ccggtcgcgc tgtacgccac gcccgatggc aagcatgtca     35340
     tcgtcggcac catgttcgac gccgaaggtc gcgacgtgac ccaggccgcg ctcgagcagg     35400
     ccatcgagcc cgcgctgtcg gacaagctgt ggagcgcgct ggagcaaagc gcctgggtgg     35460
     ccgatggcaa ggccggcgcg gcgcgtatcg tgtacgtatt caccgacccc aactgcccgt     35520
     actgcaacaa gctgtgggcc gatgcgcggc cctgggtcga ggccggcaag gtgcaactgc     35580
     ggcatatccc ggtcggcatc ctgaccgcca gcagcgaagg caaggcggcc gccatcctgg     35640
     ccgcgcccga tccggccaag gccctgcacg accacgaggc cggccacgtc gccagcaaca     35700
     cgcgcgccct ggccgcgggc gaacgcaaac ccctggacga acgcggcatc cagccgctgg     35760
     ccgacatccc ggccgagatt gcggcacggc tcaacgccaa cgaaacgctg atggcgcaat     35820
     ggggcctgcg cgccacgccg gccatcgtct ggcgcgagca gggcggccgc gtgcgcaagc     35880
     gcaccggcgc gccgccggcg ctgttgccgc agcttttcgg ggccttgtga tgacggccgc     35940
     cccgtgcgtg cgcgtgctgc tgcatgcccc caccgcgggc gcgctcgaac gcgcccgcaa     36000
     caatgccgcc aacctgctca aggaggcgcc cggcgcgcaa gtgcgcatcg tcgccaacgc     36060
     cgcggcggtc gcggccgcgc tggatgcgcc gcctcatccg gccgatgcgc atacctggct     36120
     gtgccccaat acgctggccc gcctggagcg gccggcgcgc gcgcccctgc gcgcgctgcc     36180
     ccaggcggcg gtgctggcgc tcgcgctgct gcaggaagag ggctggaggt atatccgggc     36240
     ataggaggtc gtaccacgct ccgacgctac ttgtaatgat caactgctgc gagtctcggc     36300
     gaccgatatt ggcatttcgt ccttgtcggc actgactgga cagaatttgt tgatatccga     36360
     ggtgaacgtg acagtcgtgc cgtggcgtgt gcacgtacgg gtggtctcgt gcgtcggatc     36420
     gatgtgtaaa tcctcccccc gcagtcctag ccacattgcc aagtattgat aggtgccgta     36480
     gcgcgcagcg gttttcaatg ctttgtcgcc gccaccacgc cagggaagga caggtagttc     36540
     gccgcttcgc gcacgttgtg ccagactggg atcttccagg gccttgtctc gtccgcgctc     36600
     ccaacaggcg atcaatcctg agtcgggccc gtgccagcgt tgggcggttg tcaatccttc     36660
     gcgacgtggc tctgtggccg gtatgtgcag cgcgtccgtg ggcttcatga cagcagatgc     36720
     tcgtaccaag cctgttcgct gatgatgcgc agcgcgacgc ctgaactccg gtaatccact     36780
     gccttcttga ttttcaaccc gaaagttgag tggagccagt cgggattgcc cagttcgcca     36840
     atgactagat agtccagctt cttggtgaca ttgctcaagc tggagccgcc gcgctccact     36900
     acttgttgcg agcaccagtc ccgcgtgccg ctcgtaaatt ttccagtgaa gcagaaagta     36960
     tgtgcgtcga aatgaatatc cggtacggga ctgcacaacg gcagagctgt gctcttgttg     37020
     atggcgggct gccccgtagc gtcttcgctc cccacggttg ccagcagtag cgccatgatc     37080
     tcggcttctt ccatcgcatc catatgcccg tcggccagcg ccgcagcaat gcgtggataa     37140
     agggcctttg cgggccactt gttcgatgca tcctgattgg tctgcatcca tcgcagcaga     37200
     aaggcaactt cttcctggca tattgcgcca tcggccagca cgccttttac caggccgatg     37260
     agttcgtcta cctgacgggc ctgaactgca tgtgcacgat agatgtgata ggcgggtgcc     37320
     gcctccactt cgcttgtcgc cgttgctggt gcgccaaaat tgtcggtcaa ccaacccatt     37380
     gcagcctcca tggatgcttg gccggccgag ggcggtataa gtgacagggc ccgcggtccg     37440
     gctgtacaca gcgacctagg ccgccagagg gtgtaacatc atcaaagtaa catatattta     37500
     ctttatcgcc gagctaacct tccaagcggc tgatatagcg gtaatgtgtt gctgtgcgtc     37560
     ccaagcgcgg gcaatagtga atgatatttt tggtgttaca tcaatgcaac gatgcgttac     37620
     tttcgttgca acaatggtgt atctttacgg catatcgcgc cgtatttcta tcgcccctcc     37680
     cggatcgccc catggacgcc acgctgcatg ccgacgcgga tgccattacc cagctcctgt     37740
     acgacggtat cgtcgatagc ggggattggt acgcgggcgt agagttgctg cgcgcgcgca     37800
     tgggcgcggc ctttttccac cagatgaccg tcgactgcgc caacggcgcg gtctccgacg     37860
     gattggccac gttcgaggcc ccgcaggaca aggcgcgcga gtacgagcag cactatgccc     37920
     gcaccgacga gcgcatgcac gcggtgctgg ccatgccggc cggcagcatg gtgatcgacc     37980
     acgagcgctt cgatacttcg gccatgtctt ccagcgccat ctacagcgac tggctgccgt     38040
     cggtggggct gcgccacacc gtgggcctga cgctgcgcga ggacggctcg cgcaaggaag     38100
     tgatcggcat catgcgcgcc cgcgaagacg gcatgttccg cgcctccgag atcgccctgt     38160
     gccagcgcgc gctgccgcac ctggcgcgcg ccagcgcgct gcgcgcacgc gtggccggcc     38220
     tgcaggaccg ggccgggttc ggactggccg cgctggatgc gttgcgccag ggcatcgtgg     38280
     tgctcgatgc gcaggcagcc gtgcagtacg ccaatccggc tgcgcgcgcg ctggccgcgg     38340
     ccggcgcgct gtgccgcgtg cgccacgata cctggcgctt tgccgacgcg ccggtgcagg     38400
     cgcgtttcca gcaggcgctg gccggcgcct gcgcgcgcgg cgagccgtcg tgcgccgggg     38460
     ccttcatggt gcacacccct caaggtccgg tggcggtttc ggtgctgccg ttgaaggccg     38520
     gccatccctt gctggcctgg cgcggcgtgc cgctggccat gctgtcgatc ggcgccggcg     38580
     cgcaaaccga cgtggcgccg cccgacctgc tgcggcaggc gctgggcgtc acgcttgccg     38640
     aggcgcgcct ggcgcatgcg ctggcccagg gcctgaccgt caagggctac gcgctgcgcg     38700
     ccgacctgag cgagcagacc gtgcgcggcc atctcaagaa cctgctgcgc aagaccgatt     38760
     gccaccgcca ggtagagctg gtcacgctgg cgcagtcggt gcaggcccca ccggagtagc     38820
     gcatgccggc gtcaggcgcc ccattgccgg gggcgcgccg cgccggcgac atccatcctg     38880
     ttttccattt ccgatgccgc ggcaacgcgg caccgtacgg cgcgctgtgc catgcgaaat     38940
     ccgcgcacgg ccgcgccggg tcttgcggtg cgccggccat tccggtcggc ggccttttcc     39000
     acactgcgtt ccaggcctga gggccggcag acaacagttc cggccaggga gccggacaga     39060
     ggggtttcat gaagaagcag gtagttgaat acgtgcggtg cggcgtgccg cgtctgcggc     39120
     ccgtcatggc cagcctggcg ctggccgcat gccacggact ggcaagcgcc gcgccggcct     39180
     tgccgccggc caccgtcggc atggggatgc accaactggc ggtacccatg ggcacgactt     39240
     tcattcccat ggccatgagc agcgacgcga cagtcctggc cggcaccggg tccgtgcccg     39300
     gactcggtcc gcacgcggcg atgtggccgc tgtccaatcc ctttccgtat tacgtcatcg     39360
     cgggcgacag gagcagcttt cacgcgctca gccaggatgg cagcgtcggg gtgggggtgg     39420
     tggtcagcgg ggggctgtcg caggccgtgc ggtgggacaa tggcagttgg ttccagcccc     39480
     tgggcgtagg cacggacggc gccacgcaat cgtacgcctc gggcgtgagc gccgacggca     39540
     gcgtggtggt cgggtggctg acatgggatg gtgcgggaga gcgccgtccg ttccgttgga     39600
     cgcaggcgac aggcgtccag acgttgagcg gattcgagtc ctattcgttt gcgctggcca     39660
     gcggcataag cgccgacggc aaggtcgtgg tgggcgatgt atacactgat ggcgcgctga     39720
     tcaccccgaa cgcctaccgc tggaccgcca ccgacggcat tgacttgctg ccgcatgtcg     39780
     ccggcggtac gtcgtcgcgc gcagcggcca ccaatagcga tggctcggtg gtggtgggaa     39840
     ccgcgtacgg cagcagcttt ggcggggcgc gcgccttccg ctggacgcag gcgggcggct     39900
     cggccaacct gggcaccatc gccggcggcg aggcagggca gtcgttcgcc agcgccgtca     39960
     acgcggacgg cagcgtcgtg gtgggctacg tcgatcgcac cggcatcggc ttgctcaccg     40020
     agcagagcgc attccgctgg acccaggcag gcggcatgct caccgtcgag caatggctgc     40080
     gcggccacgg ctatacgatt gccgatggcc agacctggcg tgcgctcgcc gtcaacgccg     40140
     acggcaccat cgtcatgggc atgatgcaaa acggtgacac cttcgtggca cgcacacccg     40200
     ccgacaaggt gcccgatccc gtttcgcccg gcggcggcga gcccgctccc cagccgggcg     40260
     gccagcctgg cagccagccc ggcggaggcg gcctgatcac gctgcgcgag ttcgcttcca     40320
     gcctgggcgg gaccgccgcg ctgccggcca gcctgaccag ctccaccgac atgctgctgc     40380
     acggcgcgca cggctcgccc ttgcgcagcc tggtgcccgc cggcaaggtc ggcatgtgga     40440
     ccaccggcga ttggggccgt accgagcacg gcggccagga cggcatcgcc gcggtgggcg     40500
     aggcgggcct atcgtatcgc ttcaacgaac aggtgcagct gaacctggcc gtgggcggcg     40560
     gcaacatgcg ccagtatctg gagtacgacg gcaagagcac ggccaggcag acctacgtca     40620
     tgcccgaact gctgtggaac ctgcccagca cgccgctgtg gctgaccgcc agcgcgctgt     40680
     atgccgatgg cgacctcaac gtgcggcgcg gctacccgaa cgccggcgtg gacgaccgca     40740
     gcagcggcaa ggcctcgctg cgcaccacgg ccgcgcgcct gcggctggac tggcgcgacg     40800
     cgctggcctg ggagcgcgcc gcgttgaccc cgtacctgga ctacagctac atccgtaccc     40860
     gcgtgggcag ctataccgag catggcggcg gcttcccggc gcgctgggat gcgcgcaccg     40920
     accacgccaa cgtggcgcgg ctgggcgtgg acgcgaccgt gcaggtgggc ggcaacgtgc     40980
     agctgctggg cacggtggaa gcctcccatc gcttcgaaag ccataactcc ggcgccagcg     41040
     gccaggtgat cggcctgatg ccgttcgagc tggacggcgc ctccacccag cgcaactggc     41100
     tgcgcttcgg cgcgggcgtg caggcgccgg tgggcccggg cacggccacg ctgatgctca     41160
     acacgaccac gcacagcagc atgccgtcgt actggctggc cgccacctac cgcctggcgt     41220
     tctaggccgg caggtccgcc gcgccggcca ggcgcagggc gtaggcgcgc acatcggccg     41280
     gccagccggc catgtgcgca gccagccgct cggcgtcgcc ggcatacagt gcgcggacgg     41340
     cttcctcgaa gccgggcagg ttgcccgccg ctgcgctcat gaaggtgtag gcggcgtcgc     41400
     gtccgcggcg cagcgcgtcg gcgccggcat gctcgcggcg cgcctgctcg accagcttgc     41460
     gcaacgccac cgaggcgccg ccgggctgtc cggccagcca atcccagtga cgcggcagca     41520
     gcgtcacttc gcgcgccacc acgcccagcc tgggccggcc ccggccgcgc ggccgggcag     41580
     ggctaccctc cggctcggcc tcggcctcgg gctcgacggg cgtcggcagc ggcaggcgcg     41640
     cgacgatttc cgcgtcggtg ccccgggtgt ccacatcgat ggcgcgtccg gtggcatcct     41700
     cgtaaatgaa cactgcggcg ccggcatcgc catcggcggc gcgccgcgcc gccagcgcca     41760
     cctcggccag cgggccggcc gccagcaggg catggccggc gaaggcggta tagacaggca     41820
     tgggagtcgt catgatggat atttgatccg ggtaaaaatg taatgatgca aatattgccc     41880
     gggtaaatat cgaatgtcaa tatgatccgg gtaaaaatag gccgcgacac cagcgcagag     41940
     ggcgggcact gttgccgcgg gcgtacaccc ggcaaaattc cccccgcaac ctagggttcc     42000
     tactagtaac ttcttacagc cggcgtataa tcttgctttg cgcccggagt ctcccatgcg     42060
     tctcgttcaa aaagcactca ccttcgacga cgtgttgctg gtgcctgctt actccgaagt     42120
     gttgccgcgc gacacctcgc tgaccacccg ccttacccgc aacatcaccc taaacattcc     42180
     gctcgtgtcc gccgccatgg acaccgtgac cgaagcgcgc ctggccatcg ccatggcgca     42240
     ggaaggcggg atagggatca tccacaagaa tctgtcggcc gatgaccagg ccaaggaagt     42300
     cgcgcgcgtc aagcgccacg aattcggcat cgtcatcgac ccggttaccg tcacccccga     42360
     catgaaggtg cgcgacgcca tcgcgctgca gcgccagcat ggcatctcgg gcctgccggt     42420
     ggtcgagggg cgcaagctgg tcggcatcgt caccaaccgc gacctgcgtt tcgaagaccg     42480
     cctcgaccag cccctgcgca acatcatgac gccgcaggac cgtctggtca ccatgaagga     42540
     aggcgccacc ctcgacgaag cccaggcgct gatgcacaag caccgcctcg agcgcgtgct     42600
     catcgtcaac gacgccttcg agctgcgcgg cctggccacc gtcaaggaca tcgtcaagaa     42660
     caccgaacac ccctacgcct gcaaggacag ccagggccag ctgcgcgtgg gcgcggccgt     42720
     gggcgtgggc gccggcaccg aggaacgggt cgagaaactc gtggccgccg gcgtcgacgt     42780
     catcatcgtc gacaccgcgc acggccactc ggccggcgtg ctcgagcgcg tgcgctgggt     42840
     caagcagaac taccccaagg tcgaagtcat cggcggcaac atcgccaccg ccgccgccgc     42900
     gcgcgcgctg gtcgaagccg gcgccgacgg cgtcaaggtc ggcatcggcc cgggctccat     42960
     ctgcaccacg cgcatcgtgg ccggtgtggg cgtgccccag atcagcgcca tctccgacgt     43020
     ggccaaggcc ctcgaaggca ccggcgtgcc cctcatcgcc gacggcggca tccgctactc     43080
     gggcgacgtc gccaaggcgc tggccgccgg cgcgttcgcc tgcatgatgg gcggcatgtt     43140
     cgccggcacc gaggaagccc ccggcgaagt cgtgctgttc cagggccgct cgtacaagtc     43200
     gtaccgcggc atgggcagcc tgggcgcgat ggccgacggc tcggccgacc gctacttcca     43260
     ggatcccgcc aacaacgccg acaagctggt gcccgaaggc atcgaaggcc gcgtgcccta     43320
     caagggcagc gtgctggcca tcatctacca gctggtgggc ggcatccgcg cctcgatggg     43380
     ctactgcggc tgcgccagca tcgacgacat gcgcaccaag acgcagttcg tcgaaatcac     43440
     ctccgccggc gtacgcgaat cgcatgtcca cgacgtgcag atcaccaagg aggcgccgaa     43500
     ctaccgcgcc gactgacccc ggggccagtc atcatcacgc aatgcatcgc gcaccggcag     43560
     agcccgccag gttctggccg gtgcgctttt atttccaacc ggcagaatct ccatgcacca     43620
     gcgcatcctc attcttgact acggttcgca agtcacccag ctgatcgccc gccgcgtccg     43680
     cgaagccggc gtctactccg aaatccacgc cggcgacgtc gacgacgcct tcgtgcgcga     43740
     ccaggtcgcg cagggcctca aaggcatcat cctctcgggc agccacgcat cggcctacga     43800
     agagggctcg atgcgcgtgc cggcggccgt gttcgaagtc ggcgtgcccg tgctgggcat     43860
     ctgctacggc atgcaatcca tggcccagca actgggcggc accgtcagct tcagcgacca     43920
     ccgcgaattc ggctacgccg aagtgcgcgc ccatggccac accaaactgc tcgacggctt     43980
     ggccgacttc accaccgacg aaggccacgg catgctcaag gtgtggatga gccatggcga     44040
     caaagtcacc gaactgccgc cgggcttcaa gctgatggcc tccaccgcct cctgccccat     44100
     cgccggcatg gccgacgagg atcgtggctt ctacgccgtg cagttccacc ccgaagtcac     44160
     ccacaccgtc cagggcaagg ccatgctggc gcgcttcgtc aaggacatct gcggctgcga     44220
     gggcgactgg aacatgcccg actacatctc ggaagcggtc gcccgcatcc gcgaacaggt     44280
     cggcagcgac gaagtcatcc tcggcctgtc cggcggcgtg gactcctcgg tggccgccgc     44340
     gctcattcac cgcgccatcg gcgaccagct cacctgcgtc ttcgtcgacc acggcctgct     44400
     gcgcctggac gaaggcaaac aggtcatgca gaccttcgcc gagaacatgg gcgtcaagat     44460
     cgtccatgtc gacgccacca gccagttcat gggcaagctg accggcgtcg ccgaccccga     44520
     agccaagcgc aagatcatcg gccgcgaatt cgtcgaagtc ttccaggacg aagccggcaa     44580
     actgcagggc gccaaatggc tggcgcaagg caccatctac cccgacgtca tcgaatcggc     44640
     cggcgccaag accggcaagg ccacctcgat caaatcgcac cacaacgtcg gcggcctgcc     44700
     cgatacgctc aacctgcaac tgctcgagcc gctgcgcgaa ctgttcaagg acgaagtgcg     44760
     cgaactgggc gtggccctgg gcctgccgcc gcagatggtc taccgccacc cgttccccgg     44820
     ccccggcctg ggcgtgcgca tcctgggcga agtcaagcac gagtacgccg aactgctgcg     44880
     ccgcgccgac gccatcttca tcgaggaact gcgcaacgcc aaggacccgg ccagcggcct     44940
     gacctggtac gaactcacct cgcaagcctt cgccgtgttc ctgccggtca aatcggtcgg     45000
     cgtcatgggc gacggccgca cctacgaata cgtcgtcgcg ctgcgcgccg tgcagacctt     45060
     cgacttcatg accgccgact gggcgcccct gccgcacccg ctgctggcac gcgtctcctc     45120
     gcgcatcatc aacgaagtgc gcggcatcaa ccgggtggtg tacgacgtat cgagcaagcc     45180
     gcctgcgacg attgagtggg agtgagtcgg gcatccgatt cattgatttc acatttaatg     45240
     ccatcgatga ttgcgaccgc gtcatcgatg gcattttttc ttggagtcgc agattgccaa     45300
     agcccaggct ggatgcaata gcgctgatcc agcgcgtcga cgtgcatcgg cctatagcgg     45360
     cgaaagcgct gcttgccgga ttcatggagg gcgggttggc gccttggttg aggagcgggc     45420
     gcaggtttct cgcttgctac gttcatggct gcagcttatg tgccgggcgt aagctggcgg     45480
     actgatagct gacattcaga tactttgtag atatttgatt ttcagctatt cagcttttag     45540
     ctgaatatca ggtatttcca atgccgtcgc tttcacatcc tctgctcact accggccagc     45600
     tgggcgcggt cttgcaggct acacagatcc tgtcttggtt gctgcgggcg tccgatggcc     45660
     acgccaagta tttcagcatc cagttgctgc cgcgtggccg cttcccgttg actagactgt     45720
     acgacgtgat gtcggcctat ccggtactgg gcgatagccg gaatcagtgg tcgccgttcg     45780
     aaatcaaacc ggcgatgtcc tcagcccgca ccgcccgcaa gcatttgcgc cacggcggcc     45840
     tttgcgcgct tgaactccgc ggcgtcgtcc atcgacgcgg cgacgttggc gaatgcctgg     45900
     taggcgagca ggtccatggc cagtctggct tcgttggtgt cggcggcgag ctggccctgg     45960
     gccttggctt ggcgaatcag ttcgcgcagg cgcgcgcggg cgccatcgcg gtattgccgg     46020
     atggcgtccc gtagcggtcc ggggcgggcg cggtattcgc tgcttgccgc ggtaatgacg     46080
     cagccgcccg gcagctgacg ggtctccacg aagtcgaacc agccgttcat cagcgcgcgc     46140
     agccgcgcca gcggcgtgcg cttgcgcatg gccggttcga tgacctgggc ctggtacagg     46200
     gcgatggcgt ggtcgagcgc cgccagttgc aggcgttcct tgtcgccgaa cagtacttgc     46260
     agattgcttt tccctacttc ggcccgctcg gcgacctggc cgaaggtgat gccgtccagt     46320
     ccctcgatgg agaggagttt gacggcttcg tccaggacgc gtgcgcgcgc gcgttcgccg     46380
     cgcagccggc ggccgtcgac ggtgggggcg ggggcaggtt gagtcatggc agggttcggc     46440
     gtatttgcgc ggacggggtt tttcatcata ctataaatac gatcgtacat atatttataa     46500
     ggatgacgga cgcgatgcct ccccccaatg ttgaaaggcg ccacccttgg cgcgcgctgg     46560
     ccgtgctgtt gacgggcaat ttcgtgacga ttctggatct gttcatcgtc aatgtggcgt     46620
     tgcccagtat ccagcaaggt ctgtcggcga cggatacgga tttgcagctg gtggtggtgg     46680
     cctatgcgtt ggcttatggt ctgtgcctga tcaacggcgc gcgcctggga gatctgttcg     46740
     gccggcggcg gctgtttatg gccgggatgg ggctgttcac gctggcgtcg gcgttgtgcg     46800
     gggtggcggt gacgccctgg cagcttatag ccgcgcgcgc gttgcaaggc gtgggcgcgg     46860
     gggtgttgat gccgcaggtg ctggcgtcga tcagggtgct gttcgagggc gaggcgcgca     46920
     ggcgcgcgtt cggggtgatg ggcgcggtcc agggggtggc ggcgacggtg tcgcaattgc     46980
     tgggcggcgt gctgatcacg atgaatgcgt tcggcctggg gtggcggctg gtgttcctga     47040
     tcaatgtgcc tgtgggtatc gcggcgttgc tggcggggcg gcgagccttg cccgagtggc     47100
     gcgcgccggt tgcgacgaag gtggatatgt ggggcgcgct gctcggcgcc gtcgggctgg     47160
     ccttgatcct ggtgccggtg atggaggggc gcgagcacgg ctggccgtgg tggtcgctgg     47220
     ccgggccggt gctggcgttg ttggtgctgg ggtatttcgt tcactatgag caagggctgg     47280
     tgcgccgcgg cggcgtgccc atgctggata tggggctgtt tgccaaccgg ccgttcgtgg     47340
     cggggatcgg cgccgtgttt ttctttttct cggcgatcag ttcgtttttc tttgcgctga     47400
     cgttgttgct gcagttcggg cttggcatgg cgccgctggc ggcgggcgcg gtgttcacgc     47460
     cgtcggcgtt ggcgtttttc ggcgcgtcgc tggtcgggcc gcggctggcg gcgcgctatg     47520
     gccgtggcgc gctgctgttc ggggtgctgg tgtttgccgc gggcgtggcg ctctcggctg     47580
     tcaccgccgc gacgcagccg caccatctgc cgctcctggt ggcgtcgctg gtgctcaacg     47640
     gggcgggcca ggggctggcg atcccgctag cgttcaatgc gattctgggc gcggtgcgag     47700
     aggagcaggc cggcatggcg tcggggatgc tgagcacctt gcaggtcgtg ggtacttcgg     47760
     ttggcgtggc ggtggtgggc gcggtggtgt tcgcggcgct ggaggcggcg gggcgctggc     47820
     cggctgccga tggcgccatg gtctatgggc gggcgctggc cgtcgcgatg gtctataacg     47880
     ttgccgcggc cttggccagc tgggtgttgt tcaggttggc gacgcgcagg tagccccggg     47940
     ccatacgccg gtgcggcggg gaggcctacg ggcggctggc gcggtatggc gctgcgggat     48000
     gtcctgtgcg ccgcgtcgcc caccagaaca gcagcgccag caggctgacc gccgcgccca     48060
     gcaggcatac gccgcgccag ccggcatggg cataggcggc cgtcgtgccg atcgcgccca     48120
     gtccgctgcc gattgcgtag aacagcatgt agaggccaac cagacggcca tgggcctggg     48180
     gccgggtgcg caggatcagg ctctggttgg tgacgtgcag cgcctgtccg cccagatcga     48240
     gcagcaggat gccgatgacc agcgcgccga gcgattcctc catcagcgac agcggccacc     48300
     aggccagcag cagggcggcc agcgccgcgg cgctggtgcg ttgggcatgg ccctggtcgg     48360
     cccattgccc ggcccgcgcg gcggcaagcg cgccgaccac gccgaccagg ccaaaggcgc     48420
     cgatggcggt gtgcgagaag ccgtagggcg gggcgctcaa gggcagcacc agcgcgctcc     48480
     agaagatgtt gaacgcggca aacatgagca aggccagcat gccgcgcact tgcagggctt     48540
     tttcttcgcg cagcaaggtc agcagggagg cgatcagccg cgggtagcgc atcgcgccgg     48600
     gcgcggcggc cagggtgggc agccagcgcc agagcggcag cgcaagcgcc agcatcagtg     48660
     cggcggcgca gaggtacacg ccgcgccagc cggccaggtc gctgacgccg ccggcaaata     48720
     cccgggccag cagcagaccg atgaagacgc cgctttgcgc cgcgccgacc acgcgccctt     48780
     gctcatgggg cgcggcggcg ctggccgcgt aggcgatcaa gccctgcgtc attgccgtgc     48840
     ccagcaagcc cacggccagc atgcccgcca gcagggcggg cgcggagcgc gccgcgccca     48900
     ccgctgccag cgcgcccacc agcgccagca gttgcatggc catgaggcgg cggcggttca     48960
     tccggtcgcc cagcggcacc agcagcagca gggccagcgc gcacccgatc tgggtggccg     49020
     tgaccacgcc gccgatcgcc gcatggctaa tgcgaaagtc gcgcgccagg gcgtcgagca     49080
     agggctgggc gtaatagaca ttggccacgc tcaagccact ggcgatggcg aacagccata     49140
     ccaggccgcg gggcatgccc gcggaccagg ctggcgcgct gcctgaacag ggcggtaacg     49200
     cagatgcgag agaggttttc atggttgcgg gttcgcgcat tgtggtttca aattaaaacc     49260
     agttgaatgc taggccatgc agttttaaaa tgcaaccgga gatcgccagg accgcctggc     49320
     aaggagcatc catgccgccc cgcaagccta tgaacgacga accttgtccc gttgcgcgct     49380
     gtgtcgacct gatcggcgat cgctggtcgc tgctcatcgt gcgcgatgcc ttcgatggcg     49440
     cgcgccgctt cggggatttc cagcgcggcc tgggcgtggc gcgcaatatc ctttccgacc     49500
     ggctgcgcaa gctggtggag gcgggcgttc tcgaaatgca ggacgcctcg gatggctcgg     49560
     cgtatcagga gtatgtgctc acggccaggg gggaaagcct gtttccggtc ctggtggcgt     49620
     tgcggcaatg gggcgaacgg cacctgttcg agcgtggcga acgccattcg gtgctgatcg     49680
     acaggcgcac gggcaagccg gttgccttca tggcgcctgt cgcgcaggac ggcacggcgc     49740
     tggcgccggc cgcggccgag gtgcgcaagg taaagtgagg ctcgcggcgc gggcctggcc     49800
     agccggggtt atatggtatt ttgcccgata gcttgatccc tgaaccccat tctccgtcaa     49860
     aacatgtccc cgcgcggtcc tgagctcgct ccttcctcgg cccctgcaaa tccgggcctg     49920
     ctggccgggc tgtcgccggc cagtttcggc atcgtcatgg ctaccggcat agtgtcgctg     49980
     gcctgtgctt cgctgggctt gccgtcggtg gggcgctggc tgttcgcgct gaacgtactg     50040
     ctgtatgcgg tggtgtgggg gctgaacctg gcacggctgc tgcgccatcc gcggcgcatg     50100
     cgcaacgacg cctgcgatca cgggcgcgcg ccgggtttct tcacggcagt ggcggccagc     50160
     ggcgtgctgg gcgggcagtg cctgttgctg gccgatgcgc gaggggcggc gatgtggctg     50220
     gaagcggtgg cggtggtgct gtgggtggtg ttgagctacg gcattttcgc ggcggtgatg     50280
     gtcaagcgcg acaagccgcg cctggagcag ggcatgagcg gcggctggct gctggcggtg     50340
     gtggcgacgc aggcgctggt ggggctgggg gcgttgctcg cgccgggcct gggcgaggcg     50400
     tggcaggggc gcttggcgct ggcgctgctg ggtctgtggc tgtggggcgg cgtgttgtat     50460
     gccttgctga tgtcgctgat tttctaccgc atcatgttcc tgccgctgtc gccgaccgat     50520
     ctgtcgccgc cgtactggat caatatgggc gcgatggcga tttcgacgct ggccggcacg     50580
     ctgctgttgc agcagtcgca tgcctggcct ttgctgcaga cagtgcagcc gttcgtgcag     50640
     ggtgtgaccc tgctgttctg ggccggcggc agctggtgga ttccgctgct gctggtgctg     50700
     ggcgtgtggc gccatggcct gcagcgccat cccttgcgct atgagggcct gtactgggca     50760
     atggtgtttc cgctgggcat gtacgcgatg gcgacgcacc atctggcgtt ggcgctggag     50820
     caggcctggc tggagccgct ggcgcgggct ttcatgtggg tggcgctggg cgcctggacg     50880
     ctggcggcgc tggggctgtt gggggcgctg tcccaggcgc tgcggcggcc cgcccgggcg     50940
     tgagcgccgc cccggggcga cggccaggcc gttggcctgt tcatgcgtgc gcggccagtt     51000
     tgcgcgcggt cagggcggtc agcatggcgc agaccgtcag caacacggcg ctcatgacga     51060
     aggcgctctg gtagccgctg cggtcgaaca gcaggccgcc cacggtggag cccagcgcaa     51120
     tcgatagctg gacgacggcg acgaacaaac cgccgccggc ttcggcgtct tcggggaaca     51180
     ccttggcgat ccaggcccac cagcctacgg gggccgacgt accggtcagg ccccacaggg     51240
     cgagcagcgc gacgacgata ccgatcacgt cgccgaagac gatcagggcc agggcggtcg     51300
     cggccatcaa tagcgggatg acgatcagcg tttggtagaa acgccgctgc aggacccggc     51360
     cgatgagcgc cgtgcctatg aaacctgccg caccgatggc gagaagaatc agggagatcg     51420
     tggcgccatg tacgccggtg acgatttcca ggaaggggcg cacgtaggtg aagagcgaga     51480
     actgccccat gaacagcagg ctgctggcca gcatgcccac ggcgacgccc ggatgcctga     51540
     agagggtgag caccttgaag gcattgccgg cgccgggcgc gcgtgcggca gcgggcatgg     51600
     agggcagcgt tttccattgc caggccaatg cgatcagcga caccggcacc aggcacagga     51660
     aggcgccgcg ccagccgacg acggtgccga gataggcgcc catcggggcg gccacgacgg     51720
     tggcgagcgc gttgccgccg ttgacgatgg ccagggcgcg cggcacgtcg cgcgtcggca     51780
     ccattctgat ggcggtggcg gccgacatgg accagaagcc gccgacgacc acgccgatca     51840
     gggcgcggcc cagcatgtag atgaagtagt tcggagccag ggcgacgatg gcgccggaca     51900
     cgcccattgc cagcgtcagg atcagcagca gcgttttgcg attcaggctg ccggccagcg     51960
     tcgagatgaa caggctggtg agtacggcga aggcgccgga gatggagatg ccctggccgg     52020
     tcatgccttc ggtgacgtcc aggtcgcggg ccatgggagt cagcaggctg acgggcagga     52080
     attccgaggc gatcagcgcg aaggcgcaaa ccgacatggc gaagacgccg ttccaggacg     52140
     tcggcttctg ttggaagtgg tcggaggtgt cggcgttttc ggggccgtcg atgagggggg     52200
     tggccatgaa atgttttctg tcggtctatg ggatgtcgcg tccggggcct tgggtctgga     52260
     tggcgaggtt gttccggagg aaggcggtca gcctgtcgag ggggatcttg tccatcccgt     52320
     cgtacaggtc cacgtggacg gcgcccggga tgatcatgag ttccttggga tagccttggt     52380
     catgatggtt ctcatcttgc gtggaccgcc gtcttgggga ggcggttcaa ggctcgatgc     52440
     gctcgatgcg catctcgtag ggaccggacc gggatacgat cgccaggcct tcgtcgatcc     52500
     ggcccaacgg cagcaggctg cgcgcatagg cacgcggctg gatgaagatc gccaggttgc     52560
     accatggggc gtagtgggtc agctcgccga ccatgggggc catgcccccg ggcgcgccct     52620
     gcgtggacag tttgcgcggc aggtcggcga cgcgctcgat cgtgtcgtag tcggtcatcg     52680
     tcaaggacag cggcagcagc gacgcgaagt cccgggcggt ggcgttgtca tacagggtgg     52740
     cgctggcgat ttgcccggcg atggtgaggc ggattttcat ggcgggttcc tgccggggcg     52800
     cgagagcgag agcggggcgg gccggcgcgc cggcggccag gccggccagc agcgccagcg     52860
     ctttgcgccg cgtgcggttc atgggcaagg cgaagaggtt cttcatgacc cgcattttcc     52920
     cggccgaggg gcggattgac tatctgatta atgcttaaaa gccttataag ctatgctaat     52980
     taattcctga tgcaatccat ggcagagcag ggcatggcca gacgcaatct caacgacctt     53040
     ctgtacttcg tcaccatcgc gcgcgagggc agcttcacgc gcgcggcggc attgctgggc     53100
     gtgacgcaat cggcattgag ccaggcgatc agcggcctcg aggcgcgtct gaggatccgg     53160
     ctgctgaccc gcaccacacg cagcgtgtcg ccgacggcgg caggcgagcg cctgttgaat     53220
     gcgatcggcc accggttcga cgaaatcgag tcggaactgg acgagttgac gcaactgcgt     53280
     gacaagcctg ccgggacggt gcgcatcacc tgcggcgacc acatcctgcg cgccacgatt     53340
     cttcccaggc tgacgccgct ggtgcgcgag tacccggaca tcaagctgga gttcgacgtg     53400
     aactacggat tccgggacat cgtcgcggac cgcttcgacg caggcgtacg gctcggggac     53460
     acgatcgaca aggacatgat cgcggtgccc atcgggccgc cactgcgcat ggcggttgtc     53520
     gcctcgccgg cctatttcga ggctcattcc acgcccgggc agccgcgcga tttgctgcgg     53580
     cacaattgca tcaacatgcg gatgcagagc ggccgcgggg tctatgcatg ggacttcctg     53640
     aggcgaggca ggcgcttgaa cgtgcgggtg gatggacagc tcattttcaa cacgacgccg     53700
     cccatggtgg aagccgcgct ggccggactc ggcatcgcgg ccctgccgga ggaggagttt     53760
     gcgccgcatc tggaaaacgg cagcctggtg cgggtgctgg aggactggtg cgagcccttc     53820
     tcggggtact ttctgtacta ccccagccgg cgccaaccgt ctccggcctt ttcgctggtg     53880
     ctggctgccc tgcgctatgg cgagggcagt tcgggaaagg cgcagttggg cggttcgctg     53940
     aagaagggcc ggtcgcgaag aaaggccgat tgaggccttt cggctggcgt cgagcgtcga     54000
     gtggggcgaa ccgctgcctg ataggtgtcg caggccgcca tggcgcttgg cgatatgcag     54060
     gacgatggcg cccgattcga acacgacgag gtcgtcttct gcgtgggttg gaatccgtcc     54120
     ggatggatgg agcgcacggc cagggcggtc gttgctgcgg acgcgccgcg ccacgggtat     54180
     tcgagttgca tggcgacgac gctggcggtg ggcgcgccat agcggccggc gatggcgcgt     54240
     agggtccggt ccagggtttg cgccggcgcc tggtcggtgt aggtgtcgat gcgccgcgtg     54300
     gccggccagt cggcggccgc cgcgtcgggg atgacgcgga tcctgttgcg ggttgcgatg     54360
     gcgccggatg cctgggcgta ggagacggct tgggagcggt aggtgcgcga ccaggcgtcg     54420
     gcggccaggg ccagcgagac ttcgtccatg ccgggtcgca gttcgatgcc gatttgctcg     54480
     cggttccaga acgcgagcac gttgccgagc acggtggtcg cgaacgggcg tgtcagggcg     54540
     aaggcgccgc tggcgtggcg gatatcccag gcggggatgg ccaggtcctg ggcgacggcg     54600
     cgggccttgt ggcgcccggc gatggcttcg atcagcagca gcgtcatggg catggacgcg     54660
     gtgacgccgg tagtggtgac gacgccgcgg tcggccacca cgcgccggtc cgcgacgtag     54720
     cggatcgacg ggtgccggcc tagcagttcc ttcaggtagt accagtgggt ggtggcgcgc     54780
     ttgccgtcga gcaggctcgc ggcggcgacg accttggcgc cggcgcacac gccgatgatg     54840
     gttgcgccct tgcgcgcctg ctcgcgcagc caggcgagca cggcggggtc gtcgtcgcgg     54900
     ctcatggcgg ggacgatgac gtagtcggcg ccggcggggt tgcgcgcgtc gaaggcgtcg     54960
     agggtcgcgt cggcttcgac ggtgagcgcc ggaaacagtc tgaccgggcc ggggccggtc     55020
     gccagcgtga cgacgtcggc cacgtcggcg cgccgcagga tgccggtggg caccaggtag     55080
     tcggtggttt cggtggcgtc gttgatgccg acgacggcga tgagcggccg ttgccgccgg     55140
     gtgggcgcca gcgaggccag cagggcggtt gtttcgctgg ccgcgatggg cgggctggcc     55200
     aggccggcgg gagcggacgg caggctgatc agccaggcgc cgaagcctcc cagcgagagc     55260
     agcaggaggg gcagtgcggc ccggaggagg cggcgcttga acatgatcgg ggttctccgc     55320
     gggggaggcg tcagccgtca ggttcaacgc taccactacc tgggctacgg gtcgatggtc     55380
     ccttgcgggg gccgcttcag atagtcgtcc acggcgctct ccaccgtcgg atggaagcgg     55440
     tcggcgccga atacctcgga cagttcgaag cgcttgagtt tgtcgcgcac ggggtccttc     55500
     atttcggcga agtgcagggc gatgccggac tcggccaggt gatggctcag ctcgcgcagc     55560
     atgtcggccg aggtgacgtc gacgctggtg acgggctcgg ccgtgaccac gacgcgccgc     55620
     accggggtgg gcgaggcttg cacggcttcc agcagccgct gctggaacag ttcggcgttg     55680
     gcgaagaaca gcggcgcgtc ccagcggaac agcaccaggc cgtcgatcag cgcggcgtgc     55740
     gggtagcgct tgaggtcgtg gtagccgcgc aggtcgggca cgcggccgag cacggcgaag     55800
     tgcggccgcc agccgtccca gaggaattcg aggacggcga ccacgacggc caggcagatg     55860
     ccggggatgg cgccgaatgc gaccacggcg gcaaagcaca gcatggacag ccagaattcc     55920
     cattgctgga tgcggaagat gcgccgcagg tccttgaatt cgaacaggcc gatggccgcg     55980
     gcgatcacga cggcggccat ggcgctgctg ggcaggtggc gcagcaggtt gggcgcggcc     56040
     agcagcaggg cggccacggc cagcgcgccg accacgccgg ccagctgggt gcgcgagccc     56100
     gcggcttcgg ccacgggcgt gcgcgaggcg ctgctgctga ccggaaagcc ctggaagaag     56160
     ccggtcgcga ggttggccac gcccaggccg accatttcct ggttcgggtc gacgcgcgta     56220
     tgcgtgcgcg cggcgtaggt gcgcgaaagc acgctggtgt cggcaaacga gatcagggcg     56280
     acggcgcagc cgcccagcac gatcctggcc aggtcggcgt tgctgagcca cggtatggtg     56340
     aaaccgggca gcccctgcgg gatctcgccc aatacttgga cgccgcggcc gtccaggccg     56400
     aacaggctga cggccagcgt ggccaggacg acggcgatca ggatgccggg caggcgcttg     56460
     aagcgcttga gcagcaggat gaggcccagg gtcgcgcttc ccaccgcaag gctgtatccg     56520
     ttggtcctgc cgtcgagcac ggcctgcgcg agctgccaga gttcgcgcag cgggccgccg     56580
     tcgtcggtgg ggatggcgaa cagcttgggc agctggctcg ccagcacgac cagcgcgatg     56640
     ccgttcatgt agccgtagcg gatgggcttg gacagcagct cggtgatgaa gcccagtcgc     56700
     agcaggccca ggatgatgca gaacagcccg gagacgatgg ccatgaggct ggccgtggcc     56760
     accgcgcgca tggggtcgcc ctccgagacg ctgagcacga ccgcgaggat gggcgcggcc     56820
     agcgccgaat ccggacccag gacgaggatg cggctggggc cgaacagcgc gtaggcgagc     56880
     agcgggacga tggtggcgta caggccatag acgcccggca cgcccgacgc ttcggcatag     56940
     gcgatgccca ccggcaccag catggccgtg agcaccaggc cggcggccag gtcgcgcggc     57000
     agccaggcgg cctggtaggt cttcaatacg gccagtccgg gcagccagcg cagccagttt     57060
     cggtggggcg tatcggcagg ggaggaagcc atgcagcgtc tgtgcggaga gtggtacggt     57120
     ggggccgatt ctaccgaccc ggcccgtctg atccataatc aggatgaccc gcctggcggc     57180
     gcggccattc ggaggaagca accatgctta cactgacctg cctgggcggc gctggcaccg     57240
     tcaccggatc caagcacctg ctgcgccacg gcgacacccg cctgctggtc gactgcggcc     57300
     tgttccaggg gctgaagaac ctgcgcgaac tcaactggca gcccttgccg gtcgcgccgg     57360
     ccgatatcga cgcggtggta ctgacccatg cccatctcga tcactgcggc tacctgccgc     57420
     ggctggtggc cgaaggcttc cggggcagga tccacgccac gccggcgacc cgcgatgtgg     57480
     ccgagctgat cctgctcgac agcgccaacc tgcaggagaa ggacgcggag ttcgccaacc     57540
     gcaaggggta ttcccgccac gcgccggcgc tgccgcttta tcgcgtggtc gacgccgaac     57600
     gcgccttggc gcgcttctcc gacgtggcgc tgcaccggga gaccgccttg ccgggcggcg     57660
     cgacgctgac attgcgccgc gccgggcata tcctgggcgc ggccacggcg cagatcgaca     57720
     tcggcggcat gcgcgtggtt ttctccggcg atctgggccg ctacaacgac ccggtgatgc     57780
     acgatcccga agatgtgcgc aacgccgact acctcgtcat cgaatccacc tacggcaacc     57840
     ggcgccatga cgccgccgat cccgtcgagg cgctgggcgc ggtcatcgag cgtaccgtgc     57900
     tgcgcggcgg caccgtcgtc attcccgcct tcgccgtggg ccgggcgcag accctgatcc     57960
     atgcgctgtg gaagctgcgc caggcgggcc ggctgcacaa cgttccggtc tacctggaca     58020
     gccccatggc gaccagcgcc accgaactgc tggcgcgcca cgccagcgaa cacaagctga     58080
     gcgcgcagga ctgcgaggcc gcctgcgcgg ccgtgaccta tgtgcgcgac gtcgagggtt     58140
     ccaaggcgtt gtcggccaac cgctatccca aggtcatcat ctcggccagc ggcatggcaa     58200
     ccggcggccg ggtcctgcac cacatggccg ccttcggcgc cgaccatcgc aataccttgc     58260
     tgttcgccgg tttccaggcg gccggcacgc gcggccgcaa gctgctcgat ggcgccaccg     58320
     aaaccaggat ctacgggcag tggatgccgg tcagggccga agtcgccgag ctgccgatgc     58380
     tgtcggcgca tgccgacagc gatgaactca tgcgctggct ggcgggcttt caggaggcgc     58440
     cgcggcgggt cttcatcgtc catggcgagc cgcaggcctc gcaagccctg cgcgagcgca     58500
     tccagcgcga attgaactgg caggccatcg tacccgtgca ggatcggcgc tacacgctgt     58560
     gagcggcgcg gcggaccgag gctagccagc ctggccgcgc ggcggatgcc aggcggcggg     58620
     cgaggtgtag cggcgcggcg gcacgccgac gatgcgcttg aaatagcgcg tgaaatggct     58680
     ctggtcgaag aagccggtgg acagggcggc gtcggtgatc gacgtgccgc gcagcagcag     58740
     gcgcttggcg cgctcgacgc gcagctgcgt ctggtaggcg tgcggcggaa tgccgatctc     58800
     gcgcgcgaac aggcggttca ggtggtatgg gctggtatgg gccacgtcgg ccagctgcgc     58860
     catgctgagg gtgtcgcggt aatgggcatc gatgtagtcg cgcaccagca gggccttgcg     58920
     gcggttgcga gccaccggcc ggggcgcgat gggcccggcg ctgaagccgc cgaccaggca     58980
     ttgcagcaag gccagcaggc gcgattcctg ttccagcgga ttggcgtggg cgcgggtgcg     59040
     cgcatgggta tcggcgaagc gccggatgaa ggccgcgtcg cgtatcacca ggtcgtcgaa     59100
     tacgggcagg ccgcagtcta cgccgcgcag gctcgtggcg atgtcctgca tctggcgcgg     59160
     atcgacgaac atcagcagcg aggtgtcgcg gcgattgcgc acgcccaccg tgacgacgct     59220
     gtggacgtcg cccggatgga acaggatgac gctgcccggc ggcgcgttcc aggttctgcc     59280
     ctcgcacagg tattcgccgg ggtcgcgcgt ggtgatgccg atctggtagg tgtcgtgcgc     59340
     gtgcctgggc aaggcggtgg gcatgcccgt atgcgcctcc agcaccacgc cgccgcagcg     59400
     ccaggcgtgt atgacgcttt gcccgtcgca caggacgcca ggctcccggg aaacgccagg     59460
     aggaatcggg tttgccgtct tgtccatggc cgctgcctgc ctccgtcgtt ggaattcgtt     59520
     atgagggcag tctaggcaaa ccggcgccga cactccataa agcaaggtga ataagtaata     59580
     tgccgcattg cttatgttat gccgggacgg cggtcgattc tccgcgccaa tgcgggtttt     59640
     catggggcgc gcagcatgcc tggcgcgcgg aggattttcg caagaatgta caagaggccg     59700
     gctgccgtcg cttcctacac tggctgcccg gaacgcacga ggcgttcccg cagaacgaca     59760
     gggagcaggc atgtctggaa atccttcggc gcaccgaccc cggcggcgcg cgctgctggc     59820
     gctggcaggc gccgccatga tcgcaaggcc ggccattgcc cggtcgcgtt ttccggatcg     59880
     atccatccgg ttggtggtgc catggttgcc cgggtcggcg gccgataacg agttgcgtgc     59940
     gctggcccac gtggccggcc gcgatttcgg ccagtcggtc gtcatcgaga acaaggcggg     60000
     cgcaagcggg atcctgggcg cgcagatgat tgcggccgaa aaacgcgccg acggctatct     60060
     gctgacgcaa atgcacacca cggcgtttcg catgacggcg ctgatggaca agccgccgta     60120
     tgacgtgatg gacgactaca gctggatcat ccagctggta ggctattcct atggcaccgt     60180
     cgtgcgggcc gattcgcgct ggaaggactg ggacggattc gtcgcgtatt cgaaggccaa     60240
     tccaggcaag gtgaccctgg gcacggccgg cgtgggcacg acgcagcaca tcaccatgat     60300
     gcaggtggcc aagaagctgg gcgtcgagtg gctgcacgta ccgtttcgcg gcggcggcga     60360
     cgaagcgcag gcgctgctgg gcgggcagat cgacgcggtg gcgtcgtcga cgtactgggc     60420
     cgagctggtc aacgccggca agctgcgcct gctggccacg ttcggcgtgg agcgcgtcaa     60480
     gcggttcccg gacgtgccga cgctgcgcga gctgggcgtg gatatcgctc agatcgcgcc     60540
     ctacggcctg gtcgcgccgc gtggcctgga ccccgacgtc aagcgcgtgc tgcatgacgg     60600
     cttcaggaag gcgctgtatt cgccgcagca tcaggccgcg atcgaacgcc tggacatgcc     60660
     gctggcctac ctcaacagcg aggattacga gcaagcggcc aaggcgctgt tcagggaaga     60720
     ggtcgaggcg atccgcagcc tcggcataaa gaacggttga agggcatcag gcccgtattg     60780
     cgaacatgga gaatgccttg agtaccttgc ccttgacggc gccgtccgcg gaattgccgc     60840
     gcttcggacc gccccatatc cccatccgcg aggactggct ggaccggcag cgcgaggaga     60900
     tcctcgaccc cggcctgccc attgtcgacg cccaccacca tttgtgggac cggcccgggc     60960
     aacgctatat gttcgaggat tttctgcgcg acacgggcag cggccacaac atacgcgcga     61020
     ccgtgtacgt gcaatgccgc tcgatgtacc gcctggacgg gcccgccgca atgcggccgg     61080
     tgggcgaggc cgagttcgtc aatggcgtgg cggcccgcag cgccagcggc atgtacggcc     61140
     ccatgcgcgc ctgcgccgcg atcgtgggct acgcggacct gacactgggc gccgcggtcg     61200
     aggaggtgct gcatgcgctg gtgcgggccg cgcccgatcg cctgcggggc gtacgaaaca     61260
     tgaccgcggc gcatgcctcg ccggcggtgg cgccaggctt cggccgggtg ccggaaggct     61320
     tgttgtcgga tgcacggttt cgcgccggct atgcgcggct cgcgccgctg gggctgtcgt     61380
     acgacgtatg ggctttccac agccagttgg ccgaagtgct ggacctggcg cgtgcgtatc     61440
     cggacacggc cttgatcgtc aatcatgccg gcggcccgct ggggataggc ccgtatgccg     61500
     ggcagcgcga cgcggtcatg cgcgattggg accatcacct gcgcgcgctg gccgattgcc     61560
     ccaacgtggc gctgaaactg ggcgggctgg gcatgcacat cagcggcctg cgttttcacg     61620
     agcaggacat gccgccgtcg tccgaggcgc tggccgaggc ctggcggcca tggatccaca     61680
     ccgcgataga gcggttcggc gcccagcgct gcatgttcga aagcaatttc ccggtggaca     61740
     agggcatggc ggcctatgcc gccgtctgga acgccttcaa gcgcctggcg cggggcgcga     61800
     cgccgcggga gcggcaagcc ctgttcgcgg gtaccgccgc gcgcctctac cgcctgccgg     61860
     cctcggtact ggcctgagcc ctggcacaag gcgggccgcc ggggcctcgc gcggcgaagc     61920
     gcaaagcccc ggggcacagg ctcattccag ccggatatct ccggccacga tcacctcgcg     61980
     ccacttgacg acctcgtcgc gcaccagcgc cgccaattgc tgcggcgtgc cggggccggg     62040
     gtccgcgccc tgttcggcga agcggcgctg caggtcgggg tcggccagcg cgcgattggt     62100
     ggctgcgttg atggccgcga tggcggccgg cggcgtgccg gtgggcgcat acaaggcgaa     62160
     gaaggacgtg acgtcgaagc cgggcagggt ttcggccacg gtgggaacgt cgggcagcga     62220
     gttcacgcgg cggccaccgg tgacggcgag cgcgcgcacg gtcccggcct tgatctgcgt     62280
     catggccgtg ggcaggttgt cgaacatggt cgccaggtgg ccgccgacca ggtcggtcat     62340
     ggcgggcgcg ctgcccttgt aggggacgtg caccatgttc acgccggcga cgttcttgaa     62400
     cagttctccg gccatgtgca gcgacgagcc cgcgcccgcc gatccgaacg tcagctcgcc     62460
     cggcctgctt ttggccagcg ccaccaggtc ggccacgctg tgcgccggca ggtcgttgtt     62520
     gacgatgagc acgttgggcg cgtaggcgac catggccacc ggcgcgaagt cgcgcaggaa     62580
     gtcgaagggc agtttgcgtc cggcggcctg gttgacgggg ttgttgaacg agccgaggta     62640
     ccaggtcagc ccgtccggcc gggcgcgcgc gacgtcggcg gcggcgatgt tgccgttggc     62700
     gccgggcttg ttttccacca cgatccgggc ctcgagcagc ggccccagtt tttcggcgat     62760
     gatgcgggcc accgcatcgg aggtgccgcc tggcgagaag ccgacgagca ggcgcacggt     62820
     cttgccggcc aatgggttgt cggggccggc gccgccgccc tgcgccaggg cgggcatggc     62880
     aacggctgcg gcgacgacga atccggccag ggtcttgggt atcagcatgg gtggtctcca     62940
     tattgtgggg cgggccggct gtcgcggcgc cgcattgcgc gcaggcgcac ggcatacggg     63000
     tgagcggccg tgctccgcag gcgggagtct ggccggggca gggcggggtc gataggatga     63060
     aattgctgac ttgccgggac cgcatgagga ctggccgttc aggtccgcaa gaacgtacaa     63120
     gcggcttgcc cacggcgcgc cgtagactgg ctactcacag aaatccagac aaccgccatg     63180
     cgccgcgcaa gatgccgcgg cgggcgacca cggaccggag gagccgccca tgtatcccat     63240
     caatctgacg cgcctgaaga cagcgcttgc cgcgaccctg gcggttgccg ccctggcggc     63300
     ggccgctccc gccgccgcca cggactggac gcccgatcgc ccgctgcgca tcgtttcgcc     63360
     gtatgcggcg gccggcacca acgacctgct ggcgcgcctg atggcgcaga agctgggcga     63420
     gcggctgggc aagagcatcg tggtggaaaa ccgcgccggc gccaacggca tcatcggcgc     63480
     cgagtacgtg gccaagatgc cgggcgacgg ctacaccatg ctgatgggaa attccgccac     63540
     gcatggaatc aatcccaatc tgtacgccaa gctgtcctat gacgcggaca aggatttcac     63600
     gcccatcggc ctgatcgcct cggtgccgct gctgctggtg gtgggcccca aggtcgaggc     63660
     cgactccctg caggatctga tcgcgctgag caaatccagg ccgggccaga tcagcttcgc     63720
     ctcctcgggc gtggggtctt cgccgcaact ggcgggcgag ctcttcaaga gcatctcggg     63780
     cctggacatc atccacgtac cgtacaaggg cgattcgccc gcgctgaccg acgtgctggg     63840
     cggccaggtg acgatgatgt tcgccaacat cccctcggcg ctgccgatgg tgcgcgccgg     63900
     caagctgaag gcgctggcga tgaccggggc ggcccgtacg tccgccgcgc cggagatccc     63960
     gaccatggcc gaggccggcc tgcccggggt ggaaatcagc gcctggtatg gcctgatggc     64020
     gcccgccggc ctgccatccc cggtgctggc ccgtctgaac accgagttga acgcggtgct     64080
     ccagcagccg gatgtgcaga cccgcatccg cgagctgggc gccgagccgg cccagcccgg     64140
     tccgccggcg caattccagc agttcgtcga tgccgaactg gccaagtacg gcaaggtcat     64200
     caagacggcg ggcatcgctc ccgagtaatg ccaggcggtt cccgcccggc cgcctttttc     64260
     tcccccaacc ggttttcagc ccgctggcgc cttgcgccgc gcgggccggg acagtgcagc     64320
     ctttttttcg caacaacgca tcaatcaaag gaagatcatg agcaagggac ctctgcaagg     64380
     aatacgcgtc ctggatttca cccggttcct ggcgggacct tacgccacca tgctgatggc     64440
     ggacctgggc gccgacgtag tcaagatcga ggagcccggc ggcgaccata cccgcaccag     64500
     cgggccgtat ctggacgcag cgaccaagga ccaggatatc ggcggctttt tcaacagcct     64560
     gaaccgcagc aagcacggta tctgcatcga cctgaagtcg ccgggcggcc gcgacctggt     64620
     gctgcgcatg gtcaaggacg tcgacgtggt ggtggagaac ttccgcggcg gcgtcatgga     64680
     gaaatacggg ctggattatg aaacgctgtc gaggatcaat ccgcgcctgg tctatgcatc     64740
     ggtgcgcggc ttcggcgacc ggcgcaccct gggcacgcac tatccggagc ggccgaccgt     64800
     ggacctgttg gtgcaggccg tctcgggcat catgggcatc accggttcgg ccgacggcca     64860
     ggtctacaag atcggcccgg gcgtgggcga catcttcccc ggcacgatgt gcctggtagg     64920
     aatcctggcc gccctgcaat ggcgcgagcg ttcaggggaa ggccagtacg tcgatacgtc     64980
     gatgtacgac tgcatgcttt cgctgtgcga gcgcatgctg taccagcatt cctataccgg     65040
     cgaaattccc gggcccatgg gcaacgcgca tccgttctcg gcgccgtaca ccatgtaccc     65100
     ggccgccgac ggcaacttcg tggtggcggc acccaacgac aaattctggc ggcgtatcgc     65160
     caccgcgatc ggccagcccg aactgggcgc cgacccgcgt ttcgccacgc gcgccgcgcg     65220
     ccgcgaacac cgcggcgaaa tcgacgacat catgcgggca tggtccagcg tgcgcaagcg     65280
     cgacgacgtc atggccgcct tgctgggcca cgacgtactg gcggcgcccg tgaacaacgc     65340
     ggccgatatc ttcgccgacc cggaggtgcg caagcgccgc atgctggtcg acatcgaccc     65400
     ctacccgcat gccccgcgca aggtgcaggt ggccggcacg cccttgaagt tcaccaagac     65460
     cgaaacccag ccgcagcggc gtgcgccgct ggtgggcgag cacacccacg acgtcctgac     65520
     gcgcatgttc ggcctgagcg ccgcggaggt ggcggccctg gagcgggatg cgatcgtatc     65580
     gcgccgcgaa cccgagtccg ccggagcgtg acatgagcaa ccgcaaaacc aatccgttgt     65640
     acgccttgaa ggaccgctat gcggtggtcg gcgtgggcac cacgccgtat ggcagttttc     65700
     ccgagctgga cgaatacggc ctgggcgcat gggcgttcaa gaacgccatc gatgattgcg     65760
     gcctggacaa gaatctggtc gacggcctgg gcgtctgccg cgtaccgtcg tacacccgca     65820
     tgggcgaggt gctggggctg aatccgcgct ggaccctgac cctgcccgcg catggccgca     65880
     tgtccggcat ttccatcgtc gaggcggtgg cagcgctcaa tgcggggctg accgattacg     65940
     tcgcgctgat ctataccaat atcggacgct ccaggcgtgt caactatggt ggcgacgaaa     66000
     gccccaacat ctggaatccg tggggcttca cctcgccggg cgccggccat gcgctgatgt     66060
     tccaacgcca tgcgcaacag tatggcacca cggggcgcga cctggcggaa gtggcgatgg     66120
     cctttcgcca ccacgcctgc ctgaaccccg acgccgtgat gaagaccccc atcacgatcg     66180
     acgaccacga aaattcgcgg cacatcgccg cgccgctgcg cctgttggat tactgcctga     66240
     tcaacgacgg cgcggtctgc ctgatcctga catccaccga gcgcgcgcgc gacctgaagc     66300
     gtccgccggt caggatttcc ggcatcggcg cgcgcgagac ctacgtcgag tcttcgctgc     66360
     cgaatttttc cagcgacttc tggtacgacg ccttgcagga caccgcggcc gaggtctacg     66420
     ggatggcggg aatagggccc caggatgtgg atgccctgat gtgctacgac aacttcagcc     66480
     ccacggtgct gttcagcctg gagggcatgg gtttctgcgg ccgcggcgag ggtggcgcct     66540
     tcgtgcgcga cggccgcttg aaactgggtg gcggcctgcc caccaatacg gacggcggcc     66600
     atctttccaa ttcgtacatg cagggatggg gcctgaatgc ggaggccgtg cgccaggcgc     66660
     gcggcgacgg cggcgaacgc caggtgcccg gttgccgcgt cgtgcagtac gtggcggcga     66720
     cgccgtgcac ccgttccatc atctacacgg ccgactgacg cgccgccacg aggatacacc     66780
     tatgacgcct ggttttcccc tacccaagcc cgacgtgctg agccggccgt tctgggattt     66840
     tgcgcagcgc ggcgtgctgt cgctgcaacg ctgtcggcat tgcggcgacg tgcattttcc     66900
     cgctgccccc gtatgcccgg cctgtctttc cgaacagcag gaatgggtgc ccgccagcgg     66960
     ccgcggaacc ctgttttcgt ggtgcgagtt ccacaagggc tattgggact cggtggccag     67020
     tctgctgcca taccgcgtcg ccgtgatcaa gctgaacgaa ggcccgctgc tgatcagcaa     67080
     cctggtggat gtggcggact gcgccgcctt gcgggccgac gcgccggtgg aagtggtgtt     67140
     ccgcccggta tcggccgata tcaacctgcc ggtgttccgg ctgagccatg cttgctgaga     67200
     tgaggtttac cgtatgaatg cgagtgccga acccctgctc gaatcgcagg agccgctgtc     67260
     tgcctatacg ccgccggcgt tcgaggtgcc cccgggcgcc tgtgataccc atgcccatat     67320
     cttcgggccc gtttcccgtt atccgctcga tcccaagcgc accttcaacc cgccgcgcgc     67380
     cggcatcgac gattatcggc gcctgctgtc cacgctgggg ctggagcgcg cggtgatcgt     67440
     gcactccggc gcttacggaa ccgatatctc ggtgacgcgc gatgccttgc tggcctccga     67500
     aggaaagtgg cgcggcatcg cgctggtcga tcgcgacgtc acgcgcgacg cgttggccga     67560
     tatgcatgct gcgggctttc gcggcgtgcg cttcaatttc atcttcgggc acaggaacga     67620
     ggaagacgat gtcctggaga tcgcgcggcg catcgcggaa ttcgggtggc atatccagct     67680
     gctggtcgat gcgcgcacct tgccggactt gcttccgttg atccgacgtc tgccggtgat     67740
     ggtcgtgatc gaccacatcg gccgcatgcc gacttccgcc ggtatcggcg accccggctt     67800
     ccaggccctg ctgggcctgc tgcgcgagcg acgttgctgg gtaaagcttt ccggcgccaa     67860
     ccgcatgggc gaccccacgc cgccctatgc cagcgtggtg ccgttcgccc atgcgctggt     67920
     cgatgccggc gcggatcacc tggtctgggg caccgactgg ccccacgtcc gcgagccggg     67980
     cgccatcccc gacgacggcg gcctgctcaa cctgctgcag ctgtgggtgc ccgaccggcg     68040
     cctgcgcaac gccatcctca gcgacaaccc cgcccgcctg tacggctttg cgccgggcgg     68100
     caaggagccc cagccatgac acccaccgca atcgagaaga tcgccgtttt cgtcgccggt     68160
     ttcgacccgg ccggcgccac gcccgccgcc cgccatgtcg ccgcgcgcgc cctgtacgac     68220
     acgatcgcgg tggcgatcgc cggcgccgac gaaccggcgt cgcggttgat gatggattac     68280
     gcccgcggcc agagcgcgcc gggcatggcc actgtctggg ccaccggcga tcgcctgccg     68340
     gtggagctgg cggccctggt gaacggcacc atggggcatg cgctggattt cgacgatgtg     68400
     agttcgccct tgcgcgggca tcccagcgtt gcgatctttc cggcgctgat ggcgctgggc     68460
     gagagccggg gcgtgagcgg caaggcgctg ctcgacgctt atctggcggg cttcgaggtc     68520
     accatcaagc tggcgcgcgc catcgtggac gaccaatatg ccaaggggtg gcattcgacg     68580
     ccgtcgatcg cggcgttcgg cgccaccgcc gcgtgcgccc ggctgttggg gctggacgct     68640
     gcgcgcatcg cgcatgccat gggcatcctg gtctcgcagg tggccggcac gcggcagaac     68700
     ttcggcacca tgtccaagcc gttccaggca gggcaggcca acgtgatggc gctgcgcgcg     68760
     gcgttgctgg ccgagctggg tttcgatgcg tcgatgtccg ccatggacgg cccccatggc     68820
     tatacggtgc tgtatgccga cgggcaggac atccatgcgc agttcgacac cctgggtcaa     68880
     ttgcccctgg aaatcgacgc ggccggcatc gaggtaaaga agtatcccct ctgctatgcc     68940
     acccaccggg ccatccaggg gattctcgac ctgcgcaagc aacagtcgct ggcattcgcc     69000
     gaggtggaac gggtcgaggt gaagaccaac taccgcgcga ccgtgccgct gatctacgac     69060
     cggccgcaaa ccggactgga ggccaagttc agcatgcact acgccgtggc cgccgccttg     69120
     catgacggcg cggtcaacct tgccagcttc gaggatgcag ccgtgcggcg tcccgctatc     69180
     caggccttct tcgagaaagt ggagctgagc cagggcgaac cgcccatgtt cccgcgctgg     69240
     gcggaagttg tggtgcattt gcgcgacggg gtcagccatc gcatacgcgt ggaaggcctg     69300
     cgcggcagcg cgcaatttcc gctcagcaac gcagagctgg tggaaaaggg cgcggactgc     69360
     ctggcacacg gcaaggttgc gttgtccgcc gagcgcctgg cgcgcgcctg cttcgagctg     69420
     gacgcagcgc cgctgcaggc cttgctggag gtcctgcgat ccgcctagcg ggttacgcca     69480
     tgccgggccg tgggtgcgtc ccacggtttt tttcttctga ttcgatcgat atgaccattt     69540
     cgcccctgca gttgctgaac gacccgtcct tgttgcgtac cgacgccctg gtggacggcc     69600
     gctggatagc cgcgagccgg cgcttcgccg tgcacgaccc ggccacgggc cgcaaacttg     69660
     ccgacgtagc caacctcgac gccgcccacg cgcgcgaggc catcgccgcc gcgcaggcgg     69720
     catggccggc ctggcgcgcg cgcacggtca aggagcgcag cgccatcctg cgcaaatggt     69780
     tcgacctgct gctggcgaac caggacgacc tggctcggtt gctgacggcc gagcaaggca     69840
     agccgtttgg cgaggcccgc ggcgagatcg cctatgcggc cagcttcgtc gaatggttcg     69900
     ccgaagaggc caagcgcatc aacggcgaga ccttgccggc cttcgacaac aatcgccgcc     69960
     tgctggtgct gcgcgagtcc atcggcgtgt gcgcggcgat cacgccgtgg aatttcccgc     70020
     tggcaatgat tacgcgcaag gtcgcgccag cgctggccgc cggctgcccg gtcatcgtca     70080
     agcccgccga acacacgccg ctcaccgcgc tggccgccgc ccagctcgcc gtgcgcgccg     70140
     gcgtgccggc cggcgtgctg ggcgtgctgc ccgccgacgg cgccaacagc atcgccatcg     70200
     gcaaggaatt gtgcgccaac gatgcggtcc gccacctcag cttcaccggg tccaccgagg     70260
     tggggcgcat cctgatggcg caaagcgccg ccacggtgaa gaagctgtcg ctggagctgg     70320
     gaggcaacgc gccctttatc gtgttcgacg atgccgacct cgacagcgcc gtcgagggcg     70380
     cgatgcaaag caagtaccgc aatgcgggac agacgtgcgt gtgcgccaac cgcatctatg     70440
     tgcaggatgg cgtctacgac gccttcgtcg agaagctggc ggacgcggtc cgggccttga     70500
     aggtcgggcc gggcttcgac gagggcgtca cgcaggggcc cttgatcgaa ccggaggccg     70560
     tcgacaagat cgaacggcac atcgaggacg ccgtgtccaa gggcggcagg gtggtggcgg     70620
     gaggccggcg gctgggcggg ctgttcttcg agccgacggt gctggtcgac gccacctcgc     70680
     agatgctgtg cgcgcgcgag gaaaccttcg gcccgctcgc gccggtattt cgcttccacg     70740
     ccgacgagga tgccatcgct gctgccaatg ccacggagtt cggcctggcc agctatctgt     70800
     acagccgcga cgtgggccgg atattccggg ccgccgaagc cctggagtcg ggcatggtgg     70860
     gcgtcaatgt cggcatattg gcgaccgagc acgtgccgtt cgggggcgtc aagcaatccg     70920
     gcctggggcg cgaaggcggc cggcacggca tcgacgatta cgtcgagatc aaatacatgt     70980
     gcgtgggcga cattctcaaa tagccgcggg cggcgcctgc aggccttgcg cggcctgcag     71040
     caccaccgag cgcagccatt tgtggccgac gtccttgtgg ctgcgttcgt gccagtaggc     71100
     gccatagcgc atacgcggca gccgcagcgg cacttccagt atctggatgg gctgttgcgc     71160
     ggcgaaggcg cgcgccagca ccaggggcag cacggcgagc aggtcgctgc cggtgatggt     71220
     ataggggatg gtcaggaagt tctgcaccag gaaggggggc gccagctttt tgcccaatag     71280
     ctccaccgct tcgtcgatga cccgccccga catgttgcgt cccatgcccc agggccgcgc     71340
     gtgcggatag cgcaggaagt cggccaggct gagcgtgccg tcgagcgccg gatggtcgcg     71400
     atccgcgatg cagacgatgc ggtcctggaa cagctgcatc gaacgcagcg attgcgccgg     71460
     cttgcgcagc caggcgatgc gcaggtccac ctcaccgctt tccagcaatt cgtaggcccg     71520
     ctcgggatcc ggcgcgcgca cctcgacgcg gatgttcggc gcatgcgcgc gcaagtgacg     71580
     gaagatcggg ggcatcagca gatgctccgc atactcgggc gccgacagca cgaagtggcg     71640
     ctccgaaacg gacggatcga agggctgcgg gcggtgggcg agggcatcgt actcggccag     71700
     caggcggcgc acgcgggcct cgatctcgct ggcgcggtcc gtggggacca tgccggcgcg     71760
     cgaacgcagc agcagcgggt catcgaacaa tatgcgcagg cgcgccagcg cgtggctgac     71820
     cgcaggctgg ctgacgtcca ggcggtcggc ggtacgcgat acgctgcgct cgctcatcag     71880
     caccagcagg gtccgcagca gcttgatgtc gatattgtcc atggcgggga ttgtaggcgc     71940
     ggccgggacc ggtcgcggca atcctttgcg gggcgtctgg cgcatggcgg atgctcaggg     72000
     ctggggcggc agccggtaga cgcggcgggc cgtgccggcg aacagctgcg ccttttcctg     72060
     cgccgagcac tgcgccgcca gccgcttgaa cgcgttccac agcacggcat aggacagcat     72120
     gcccttgtcg acgctgaaat tgctctcgaa catgcagcgg ccggcgccga aaagttcgat     72180
     gcacgcctcg atatacgggc gccaggcatg ggccagctgc cgggagtccg gcggctcggc     72240
     aagcaggtgg aagtccagtc cgctgaagtg catggccagc ccgcccagct tgacgttgac     72300
     attggggcag gcggccagcg cgcgcatcgc cgcgtgccaa tgggcgtaga ccgcgtcgcg     72360
     gcggccggcg taggggccga tgcccagcgg ccccccggcg tggtcgacca cgatgacggt     72420
     ctgcgggaag gcacgcgcca ggtccagcac ttcgtgcaac tgggtgtgaa aagcccaggc     72480
     gtcgtacgac aggcccagcg gcgccagttc ggcaaaaccc tcgcgaaagc gcggcgccat     72540
     cagcaggtgc tcgggcacct tgccggaatt gggctggatg tgcgggctgg cgtgggcggc     72600
     cgtcatgcag cgtatgccgc gcaggcgttg cggcgccgcg ttcaggtgtg cctgcagcac     72660
     cggccggacc gccgcgccca gcgacaggtc ggcataggcg acgatgccgg cacaggcgcg     72720
     caggcggccg tacagcccgc tggcgctttg cgcgccgatg ccattggcga actcggtctc     72780
     gcccacgggc cgcatcgccg ccgggccgtc gcagcggtac atcgaacggc attgcacgta     72840
     tacggtggcg agcacgttgt gcccggtctg caggtcggcg cgcaattcgt cgaacagata     72900
     gcgctggccc gggcggtccc acagatgatg gtgggcgtcg acgatgggca agccgggttc     72960
     cagcacgggt tcgcggcgca ttgccagcca gccggggcgg atggggattt caggcggcgc     73020
     gtagcgaggc ggggcgtcgg ggtcggcgat gtccatgcag gctttgggat ggcggacggt     73080
     cgggccatta ttcgcggcgc atggcgcaga tgcaatcgtt gacccgcatt acgccgcaaa     73140
     gtgagcaaga acgtacaagg tgggcaacgc agggttggcc agaatcgcgg ttaccggcaa     73200
     agcgcgccgc gcgctgccgc atcggtccat aacgaaaaga ggtcctacca tggcattcaa     73260
     acaacagctg cgcggtctgc tgggcagcct ggccggcggc gtgctgctgg ccctgcagcc     73320
     ggcggccgcc gagccgacct acccctcccg gcccatccgg ctgatcgtgc cgttcgcgcc     73380
     cggcggcacc accgatgcgg tagcgcgcgc cgtcgccacc aagctgggac aggcgctgaa     73440
     ccagtccatc gtggtggaga accgggcagg cgccggcggc agcatcggca cggacttcgt     73500
     cgccaaggcg cggcccgatg gctatacgct gctgctggga tcggcgggcc cgctatcggt     73560
     gaacccgacg ctgtatccca atctgcccta cgatcccacg cgcgacttca cgccggtcgg     73620
     catgatctgc acctcggcgc tggtgctggt gacctcctcg gcgtcgggca tcgcgtcgac     73680
     cgcggacttg atacgccagg ccaaggcgaa ccccggctcg ctgaccttct cgaccgccgg     73740
     ggtgggcggc gccagccaca ttgccgccga actgttcgct tccatggccg gcatcaaggc     73800
     cacgcacgtt ccctaccggg gctcgggtcc ggccaccgtg gcggcggtgg cgggcgaaac     73860
     ctcgttcacc ttcaccggac agacggcggc ctggcccatg gtgcaggccg gcaagctgcg     73920
     cgccctgggc gtgggcagcc gcgagcgcag cgccgagcat cccgaggtgc ctaccgtcgc     73980
     ggaaagcggc ccggttcccg gctacgaggc gctggactgg aacgtcatca tggcgccgcc     74040
     tggcacgccc gagagcgtcg tgcgcgcgct gtccgacggc ctggaccgca tcctggacga     74100
     tcccgagctg cgcgcatcct tcgtccagca gggcatcgcg atacgcaagg gcacggccgc     74160
     ggacgtgcag gcgctgatgc ggcacgacat cgccaaatgg gccaaggtca tcgaagaggc     74220
     cggcatcgaa acgcaatagg acggcggcgc gggcaggggc cgcgcagtat catggctggt     74280
     cgccagcttc gcatcgatcc catggcttcc aggaaaccct ccgccgcaag aaaaaccacg     74340
     cccaggcccg cgccgcccag gccgccgcaa ggcgggcgca aggcctcgcg cggccagtcc     74400
     gtgcgccacc tgcttgccgg caaccagctc cggcagagcc tgctgattgc ccagccggcc     74460
     tcggtccggg tggcgctggt cgccggcctg caggccgggc tggcgatttt cgtggcgctg     74520
     gtcagcgcgc atttgtcgcc ctggccgcat ctggtggggt tttccgcgct gggcgggctg     74580
     gcggcgctgt tcgggcgctt cgcgtcggca cagggccgcc agcgtatcgt gatggtctgc     74640
     ggcctgctgc tggtggcggg cgtgctggtg ccgtcgctgg ccacttatgc gggggcgggc     74700
     gcgttgtcca tggtgctgct gctggcgctg tccgccggac tgtatacgtt ggccgtgtgg     74760
     cgctgggggc tgaccggcgg gccgggcgca gtcattttcg tgttcgcggt gggcgcggcc     74820
     ctggcgcccg tggattcggc ggcggcggtc gtggaacgga ccctggccac cgcctggggc     74880
     gcgctggtgg cctggctggc ctgcgccttg accgaccgct tgcggccgca cggcgccgtg     74940
     gcgatggcgg ccgcgccctt gccgccgcta tcgttgcagc tgatggttgc cggacgcatc     75000
     gcggtggggg cgggagccgc ggccctgatc attttctggg ccggctggca gtaccccgcg     75060
     tgggcggcga tcggcgccgc ggcggtgatg cagggcacgc acctgcacct gacgatgaac     75120
     cgctccctgc agcgcatggc cggcaccatc gtcggcgcct gcatcgtgtg ggccatcctg     75180
     gcgcaggacc cgtcgttctg gacgctggtg gcggcggtgg tgctgtgcca ggtcatcacg     75240
     gaagtgacca tcggcttcaa ctatgcgctg ggccaggtca cggtgacgcc gatggcgctg     75300
     ctgatgacct atatggcctc gcccgcgccg gccagcaaca tgccggtgga gcgggtggtc     75360
     gacaccatcg tgggcgcggc gatcggcatc gtcttcgccg tgatcttttc caccgtcgac     75420
     gaccgcgtcc acctggcgcg ccgctaccgc aagctgcgga tctggcgcta gggcaaggct     75480
     gctgcgcctc gtccggccgg gtcgcgcgag cttgccatca gtccttcgtg cgcccgatgg     75540
     ccgcggccag gatggcgatg ccttgccgga tctgttcgac gtccaggctg gcgtagccca     75600
     ggatgaggcc ggcggggcgg tgggcctggc cggcgccggc cggggcatgc agcggcgcca     75660
     gcggatacac gcccacgccc atctcgcgcg ccgtcgccac cagcgccggc tcgtcgcgcg     75720
     cgtccagccc gggcagccac agcaccacgt gcaggccggc cgccgtgccg tcgacccggg     75780
     cgccttgcgg caattcccgc gcgatggcct cgagcagcgc cgtgcggcgg cgttcgttgt     75840
     cgcggcgcat gcggcgcaca tggcgctcgt agacgccgct atcgatcagc gatgccagga     75900
     cttgttggtc cagcgccggc gcgtgccggt cggccagccg cttggcttgc cggaacacct     75960
     cgacgaggtg gcgcggcagc accatgtagc ccagccgcag acgtggcgac agggccttgg     76020
     agacggtgcc gacatagatc acccggccat cggtgtcgat ggattgcaag gcgtcgatgg     76080
     gacgttgtcc gtagcggaat tcgccgtcgt agtcgtcctc gacgatccag gcatcgtggc     76140
     gccgggccca ttgcagcagt tgccggcggc ggccgatggg cagtacgccg ccgagcggga     76200
     actggtgcga tggcgtgacg taggccagcc gcacgcgcgc ggtgtcgggc agctgttcgg     76260
     tgtcgaggcc gtgctcgtcc acgtcgaccg gcagcaggcg cgcgccggtg gccgcgaagc     76320
     agtgtcgcgc catcaggtaa ccggggttct cgaagacgaa gtcgtcgccg gcatccagca     76380
     gcagccgtgc gcacaggtcg atggcctgtt gcgaaccctg cacgatgagg atctgtccgg     76440
     gttcacaggc tatcccgcgc gcgcgccgca ggtagccctg cagcgcgcgg cgcagcgccg     76500
     gctcgccctc gggcggggcg tagctcaggc tgtgcggcgg gcgctgcatg gcctgctgat     76560
     aggcgcgctt ccaggccagg ttgggaaagt cgcgcgaggc cagcgcgccg tagaggaagt     76620
     cgtaacgcac cggcggatgc gacagcggcg ccggcgtgcc gatatttgcc acgcgccggc     76680
     cccaggcgga cagggtgagc gggcggccgg ccggcgggct ggcgggcgtc gcgtcggggt     76740
     cgggcgcggc cagggggctg gcgaggcggg cggcgcggcc aggggcggta tccaggaatc     76800
     cttcggccgc gagctgttcg tagacggcgg tgaccgtggt gcgcgagacg ccgagctcgg     76860
     cggccagggc gcgggtcgat ggcagcggcg cgcgggcggc cagcgtgccg tcggcgatct     76920
     ggccgcgcag caagtcgtag atgcgtcggc ccgccccgtt gggaccgctg gggcggctgg     76980
     cgggcttgcc tgactggccc atttaaatac ctttgaactg gatcttttca ttatgccggt     77040
     ttggcgccac agtgacgcta tctatttctt cggctgcccg ccatgtatct gcccgcccat     77100
     ttcgccgaaa cccggcccga ggaacttgcc cgcatcatcc gcgcgcatcc gcttggcatg     77160
     ctggtcaccc aggacgccca gggactggac gccgaccacc tgccgttcga gttcgatccc     77220
     gacgccgggc cgcatggcac gctgatcgcc cacgtggcgc gcgccaatac gctgtggcag     77280
     cgctgtcccg atgggtcggc ggtgatggtc gtgtttcgcg gggccgaggg ctatatctcg     77340
     cccaactggt atcccagcaa gcacgaggcg catcgacagg tgcccacctg gaactacgag     77400
     gtggtgcatg cgcacggtac gctggcggtg cgcgacgacg agcgcttcgt gcgcggcgtg     77460
     gtcgcacggc tgacgcgccg gcacgaggcg ggcgagtcgc ggccctggaa gatgacggac     77520
     tccacgccgg agtacatcga tagcatgctg cgcaatatcg tgggcatcga agtcgccatc     77580
     acgtcgttgg tcggcaagcg caagctgagc cagaacaagg acgagcgcga tcgcctgggc     77640
     gcggtccagg cgctgcaggc gcgtggccag gacgcgctgg cgcagagcat ggcgcgggcc     77700
     gaatgaagcg ggcccatcgc tgagcccggc actgccatgt ccctgctggc ctttctgctt     77760
     gccgccgcgc tgctggccat cacgcccggg cccggcatcg cctatgtggt cgcccgcacg     77820
     gtggccggcg gccgcgccga aggactggcc tcgtgcctgg gcacggcgct gggcggcctg     77880
     gtgcacgtgc tggcggcggc gctcggcctg tcggtgctga tcgccgagtc ggcgctggcc     77940
     ttcagcttgc tcaagtatgc gggggccgcc tacctggtgt acctgggcct gcgcatgtgg     78000
     ctgagcccgc gcccggcggc ggtgcgcgtc gtggcgccgc agggcgcgcg gcgcgcgctg     78060
     gccgagggcg tgttggtcga ggcgctgaac gtcaagacgg cgttgttctt cctggcgttc     78120
     ctgccgcagt tcgtcgatcc cggcgcgccg ctggcgccgc aactggcgct gctggggggc     78180
     atctgcgtta cgctcaatac cttggtcgat gtgatggcgg tggtcgccgc ccatcgactg     78240
     ctgcgatccg aggcggctcg cgttgcgcgc gctcgcgtgc tgacgcgcgt gtcgggaacc     78300
     acgatggtgg gcctgggcgt ctttctggcg ctggcgcggc gagactagcg gccggcgccg     78360
     ctggcgcgcg acaaggagat gcgatggctg acaagcgtac cgaaggatca ggaaagggcg     78420
     gcgcgaaggc tgccggcaag ggcgggctgg gcgaggtcgt gctgctgtct ggcggcaatc     78480
     cgcagatcgc caagggctac ggcgatgcgc ccgtgcaggc gtacatcgcg gccatgccgg     78540
     gctggaagcg cgcggtcggc gaacgcctgg acgcgatagt cgagcgcacg gtgcccggcg     78600
     tctacaaggc cgtcaaatgg aactcgccct tctacggctt cgagggcgag ggctggtttc     78660
     tcagcttcca ttgcatgacg aagtacataa aggtcgcgtt ctttcgcggc gcttcgctgc     78720
     aacccctgcc gccgggcgcg tccaagcaga aggatgtgcg ctacctggat atctacgaag     78780
     atgcgccatt cgacgaggcc cggttcgccg actgggtggc gcaggcaagc cggttgccgg     78840
     gcgagcggat gtgaaggccc gcggcccgga cgccgcgtag cgatcggcag gtgcctgtcc     78900
     ccgcggggac aggcacctgg agcatggaca ttccaagcaa acccgcatcg ggaaaaccat     78960
     gatggaccgt cccgcggcca cgctcgtacg attcgttaaa tcgatttact aacgtcgtga     79020
     gagaggccat gtccaagcaa gccatgctcg atgccattga ggccgagcgc gaagtgttga     79080
     tcgggttcct gcaggagttc gtgcgggcgg cgtcgcccaa tccgcctggc gacacgcggg     79140
     ccgccgcggc ggtgatccag gggttcctga gcgcgcgcgg cgtgccgaac gagctgcttg     79200
     gcccccagga gagcatgccc aatgtggtca gcgaatgcga gggtgggcgc gccggtccgc     79260
     ggctggtcta taacggccac atggatgtgt tcccggtggg cgatggccat ggctggacgc     79320
     gcgacccgtg gtcgggcgat atcgaggaag gccgcctgca cggccggggc acctgcgaca     79380
     tgaagacggg aaccgccgcc tcggtgatcg cctatgccta cctgtatgcg cggcgtgcgc     79440
     agctggcggg cagcgtggcg ctgaccgcgg tgtccgacga ggagacgggc gggcgctggg     79500
     gtacgcgctg gctgctggaa aacgacacgc gctggcgcgg cgactgcgtg ctcaacggcg     79560
     agccgagcag cctggacacg atccgctttt ccgagaaggg caccttgcgg ttgaagttcg     79620
     aggtgctggc cgccggcgcg cacggcgcct acgtgcatcg cagcgaaagc cccacccgca     79680
     tcgcggccgc gctgatcggc cgcctggccg aagtggaggc gatcgagccg tccctgccgg     79740
     cggcgctgaa ggcgcacctg cagcgcgagg acgtgcgccg cgcgctcgac gtggcgatgg     79800
     gcgagggcgc ggccgacgtg gtcacgcgca ccaccttgaa cgtgggcgtg ctcaacggcg     79860
     ggctgaagat caacatgatc ccggatcgct gcgtgttcga ggtcgatatc cgcctgcccg     79920
     tgggcaccga gcccgacgtg gtgctggccc ggctggaggg catcctggcg gagtttccgc     79980
     aggcctcgat ggaagtgcag caatggcaca gcacgccgcc caacgtctgc gcgcacgatc     80040
     atcccatggt ggacttcatc gccgacaatg cgcaggcgat cgtggggcgc cggccggtgg     80100
     ccgtgccatc gatcgggtcc accgattgcc gctactggcg ccgcagcggc gtgccggcgt     80160
     acgtctacgg cccggcgccg ggccgcatgg cgatgagcaa cgagtcggtc gacctggatg     80220
     agttcatcgc ggtcgccaag gtccatgcgg cggccgggtg ggattacctg aacggcgctg     80280
     cctgagagcg gccacggccg cacacaacac aaggggaatg catgatgagc aagacgggaa     80340
     agatggcggc cgcgctggcc gcgctgtgct tgagcgtggg cctggccggc gccgcgcggg     80400
     cggagtcgac gctgcaggtg gccctgtcca ccagcctgaa cagcctggac cccaacgtca     80460
     cgacgctggg cgaggagtat gtgttcaacg ggctggtgtt cggcgggctg acccgcatcg     80520
     acgccaactc caaggtggtg cccgacctgg cggtaagctg gacgccgtcg gccgatctgc     80580
     gcgaatggac gttcaagctg cggcccgggg tgaagttcca ccatggcaag ccgctgacgg     80640
     ccagcgatgt ggtgttttcg ttccagcgca tcgtcgaccc ggcgaccggc tcgcccggcc     80700
     gcacgcagct ggaggtgatg aagtcggtgg acgcgcccga tgacgccacg gtgcatttca     80760
     ccctgacgca gccgtatgcc gattttcccg gcttgctgac cggccgccag ttgcgcgtgg     80820
     tggcgcagga tcgcatcgac accatcaaga cccagcccag cgggacgggc ccgttccgct     80880
     tcgtgcgcta tacgccgggc gaccagctcg agctggagcg caatcccgat tactacgaca     80940
     aggaccgcat caagatcgac cgggtggtga tgcgcgtcat gcccgaggcg gccgcgcgcg     81000
     tggcggcctt gcgctcgggc agcatcgaca tgatctggaa cctgccgctg gagaccattc     81060
     cggacctgaa gaaggacgcc gcggtagtgg tggactcggt gcccagcgcc agctgggatg     81120
     gcatcgtgct gaacaactcc aagccgccgt tcaatgatgt gcgggtgcgc cgcgcggtgt     81180
     tcctggcgct ggacaagaag gagctggtga acttcgcgct gttcggcgag ggctcgccca     81240
     cccacagccc gatcgcgccg accgatcccg cgttcaacaa ggatatcggc tttgcccccg     81300
     acctggcgca ggccaagcag ttgctggccg aggccggcta tgccaagggt ttcgcggtgg     81360
     acatcttcgt gccggcgggc cggccttcgc gcgaacggct gggcgtggcc gcgcagcagc     81420
     tgctgcggcc gctggggatc aagctgaacg tgcagcgggt gccttacaac cgctattcgg     81480
     ctggcgtggc gggaatcgcg cccatgtatg tggatggctt tttcgccagc ccggtgatcg     81540
     acgcggcgac gtcgccctgg ttctacagca cgggttcgtg gaacgcgcgc atgtggcatt     81600
     tctcgagcaa gcgcgtggac caggcgctgg acgcggcgcg cgccagcacc gaccgcgccg     81660
     agcagatccg ccactaccag gatttccagc gcgcgctcac cgaggaggtg ccgggcgtga     81720
     tcggctacgt gaccaatgtc gccacggcct accgcgccga catcaagaac taccacacca     81780
     atcccttcct ctggctcgac ctgtacgacg tcgagaaaac cggcggggcg cgctgagcca     81840
     tgtgggccta tctcgtcagg cgactggggc acgtggtgtt cgtggtcgcg gccatggcgg     81900
     tgctgatctt cctgatcacg caggccatgc ccggcaacgt ggcctacacc atcgcggggc     81960
     acttcgcctc gcccgaacag gtcgccgcca tcgaggcccg cctgggcctg aacgatccgc     82020
     tgtggacgca gttctggcgc tgggccggcg ccgcgctgca cggcgacatg gggcagtcgc     82080
     tggtgatggg ccggcccgtc ggcccgctga tctccgaggc gctgggccgc tccgcgctgc     82140
     tggcggtggc ggccctggtg ctgacggcgg cgctgggcat tttcctgggc gtggtggcgg     82200
     cggtgcgcca tggccgctgg caggaccggc tgatcctggc gttctcgtgg ctgtcgattt     82260
     cgctgccgca gttcctgatc gccatcgtgc tggtgctgct ggtggccggc acgctggggt     82320
     ggctgcccgc caccgggtat gtggagctgt ccgccggctt cggcgcctgg ctgtcgcacc     82380
     tggtgatgcc ggtatgcacg ctggtgctgg gcctggtggc ccacgtcacc agcctgcagc     82440
     gctccagcat gctggagacc ctgagcgcgc cttatgtgcg cgcggcccgc gccaagggcc     82500
     tgcgcgaacg cacggtgctg taccgccatg ccctgcgcaa cgcgctgatt cccaccgtga     82560
     cggtgctggc gctggacttc ggcatcctga tgggcggcat cgtggtggtg gagacggtgt     82620
     tctcgtatcc cggcctgggc cgcctgctca tcttcgccgt ggagcagaag gacctgcccg     82680
     tgctgcaggc cggcgtgctc gcggtcaccg tcatctatgc cctggccaac ctggcggcgg     82740
     atatcgccta tgccattctc gacccccgga tccgctatgg aaatctcgac acccattgaa     82800
     gccggccgcg cccgcgcgcc gctgcccatg gccctggtcg tgggcaccct gatgctggca     82860
     gccatcgtgc tggtttcgct gggcgcgccc tggctggccc aatacgattt cgacgccatg     82920
     gacgccgccg cgcgcatgct gccgccgtcg ccgcagcact ggctgggcac cgacgaattc     82980
     ggccgcgatg tgttcagccg cgtgctgtat ggcggcacca cgtcgatcct gctgggcgtg     83040
     tcggccaccg ccctcagctt cgtcgtgggc gtgccgctgg gcctgctggc gggctacctg     83100
     cgcggctgga tcgacgacgc ggtgatgcgc acggtggata tcgtcatttc ggtgccgccg     83160
     gtcatgctgg gcctgctcat cctggcgtcc accgagccca gcctgtggaa ggcggcgctg     83220
     gccgtgggga tcatctacac gcccatcatg atccggctgg cgcgcggcat gacgctgtcg     83280
     ctggccaacg aggagttcat caccgcagcc cgcgcgcgcg gcgaggggct ggcctggatc     83340
     ctgctgcgcg agatcctgcc caatgccttg ccgcccctgg tggtggaggc gtcgctgcgc     83400
     gtcagcttcg ccatcctgct gggcgcggtg ttcagcttcc tggggctggg cacgcagccg     83460
     ccgtcctcgg actggggcct gatggtggcc gaggcgcgtc cctacctgga gcgcgcgccc     83520
     tgggtggccc tgtcgcccgg gctggcgatc tgcctgaccg tcatcgccgt caacctgatg     83580
     ggcgaaggcc tgcgcaagcg cctggatgcg cgcggcgagc aaaggaactg agatgcacca     83640
     agacactatc ctgaatatca agggcctgga ggtgcgctac ggccgcaacc aggtgctgca     83700
     tggcgtggat ctcgaattgc cgcgcggcgc gtcgctgggc atcgtgggcg agagcggctc     83760
     gggcaagagc acgattgcct ggacggtgct gggcctgttg ccgcccggcg cggcggtcac     83820
     cgccggcagc gtggccttcg acggcgagga catcacggga gaacgcgccg ccgggctgcg     83880
     cggcgaccgc attgccatgg tgttccagga cccatttacc gcgctcaatc ccagcctgcc     83940
     cgtcggccgc cagatcaccg aggcgctggt cgaacgcggg cgcgccgatg cccgcagcgc     84000
     gcgcgccgaa gccctgcggc tgatggacga ggtgcgcctg ccgcgcgcca gtacgttgct     84060
     ggacgcctat ccgcaccagt tgtccggcgg catgaagcag cgcatcgtga tcgccacggc     84120
     gctggcctgc tcgcccgact tgctgctgct cgacgagccg accaccgcgc tcgacgtcac     84180
     ggtggaagcc cgcatcctgg acctgctgga cgagttgcgg gtgcagcgcg gcctgagcat     84240
     ggtcttcatc agccacaaca tcggtttggt cgagcgcatg tgctcgcgcg tgacggtcat     84300
     gcacggcggg cgcgtgcagg aagccggcgc cgcgcagcag gtgctgtggc atcccgccca     84360
     tgcctacacc cgcaagctgc tggctgcctt gccgctgctg gaaaagcgcg cgccggccgt     84420
     gccggccgtc ggcgcgccga tcgcgcgcgt gcgcgacgtg cgcctgacat tccggcccgc     84480
     ccatccgctg ggcggctggg ccaggctgct gcgcctgccg cgcgccgaag gcgtggcggc     84540
     cctggccggc gtgtcgctgg aactgcggcc gcgcgaagtg gtgggcctgg tgggcgagag     84600
     cgggtcgggc aagtcgaccc tgggccgctg cctggtcggc ctgcaagcgc cggatgcggg     84660
     cacggtcgag ctgtccgacc acgatgtgta ccgcgccagc ccggaggtgg cgcgccggct     84720
     gcggcgccag tcgcagatgg tgttccagaa tcccgactcc tcgctcaacc cgcgccagcg     84780
     cgtgggcgag gtgttgcgcc gcccgctgca attgatgggg ctggatcgcc gccagcagga     84840
     tcgccgcatg gacgagctgc tggatctggt gcgcctgccg gcggcctacg ccgagcgcta     84900
     tccgcaccag ctcagcggcg gggaaaagca gcgcgtgggc attgcccgca cgctggcgct     84960
     ggagccttcg gtgctggtgt gcgacgaagc cacttcggcg ctggacgtgt cggtgcaggc     85020
     gtcgatcctg gagctgctca aggacttgcg cgaccggctg ggcgtggcga tgctgttcat     85080
     ctcgcatgat ctggcggtgg tgtcgcagat atccgatcgg gtggtggtga tgcgccatgg     85140
     cgccatcgtc gagcaggggc gcaccgatca ggtgctcagc gccccggccc acgagtacac     85200
     gcggctgctg ctcgacagcg tgccggcttt cgtggcgcgc cgcgcgcggg aggcggccgt     85260
     ggcctgacag cggcctttgc ggggggcggc gacgggcggg ccttgcccct ataatccgac     85320
     gcatgactga gcacccgggc gcatgacgcc atgacgacca aggctacggg caaccgcaag     85380
     gtagtcaaga tcgtggacgt cgccaaagcg gccaacgtct cgcccgcggt cgtctcgcgc     85440
     attctcagca atgacagcaa gctggtggtg cgcgaggaaa cccgcgcccg cgtgcagcag     85500
     gccatcgagg cgctgggcta cacgcccaac ctgcaggcgc gcggcctgcg cctgtcgcgc     85560
     tccaatacgc tggccatgat cgtgcccgag ctcaacagcc cggtctttcc cgtaatcatc     85620
     cagggcgccc agcgcgccgc ctgggagcgc ggctattcgc tgctggtggg cggcatgggc     85680
     ggcgaggagg aggaccccaa ggtggccggg cggctgttgc gcagcaaccg tatcgacggc     85740
     ctgctggtga ccaccggccg gcacgaagcg cagatgctgc aggagctggc tacgctgaac     85800
     gcgccgttcg tgctggtcaa ccgctacctc gacgatcagc atccctacgt cgaactcgac     85860
     gagcgcggcg cggcggcggc catcacccgc catttcatcg aactggggca tcgccgcatc     85920
     gccttcctgg gcggcctgca gcggcgggtg ggcgaacgcc gcgtggcggg ctacgccgac     85980
     gcgctggccg aggcgggcct gccctgggtg ccgcagctgg tggtcgacgc cggctactac     86040
     aagcccggcg gcgaggacgg actgcgccaa ttgctggcgc tggacgagcc gcccaccgcg     86100
     gtggtggcca ccaacgagat cgtggccgcc ggcgcgatgg cggccgcgca ccggcagggc     86160
     gtgcgcattc cgcgcgacct ctccatcgcc agcttctccg acggcatcgt ggccgaactg     86220
     ctgagccccg cgctgaccgc cgtgcgcttt ccgctggagc gcatgggcta cctggccacc     86280
     gccatgctgg tcgatatcgt cgaggggcgg ggcgcgcccc aggcgggcct gtgcctgccg     86340
     cacgagagcg tggtcgtgcg cgactcgacc gcccggccgc ccggccgcaa ggcgcgcgcc     86400
     gccactcgct aggcgccggg ccgcaggccc ggacagcgtg ccgaaaccgt cacccttgcc     86460
     ctgggcagcc ggcccgattc ctggcatttg catgcctgga cggacacggc tcgaatggca     86520
     cgcatggcgc agccaggggt cggaatcgtc gtaatcgaag ggttgtcagt tgacatcctg     86580
     aacggatcgc ctcaaactgg aaaacaccgc atgacacgtt gcccgcatcc agacaaagac     86640
     gtcgacgccg cgctcaagca tgccgaggcg cacggctggt acatccggcg acggggcggc     86700
     catgcctggg ggcgcatgta ctgcccatgc aacgacagcg aatgccgttg cggcgagttc     86760
     tgcatcacca gcatctggag cacccccagg aacccgggcc accacgcgcg cgccctgcgg     86820
     cgcgtggtgg atgactgcgc caggcatcgc cgggcgcatg cgtgccgcag caaggagtaa     86880
     cccatggaat acctcttcac cctcaaatac cagctggccg acgccgacag cgacctggac     86940
     gccttggtcg agcggctggg ccaggccggt tgcgacgacg ccctggtggg catgggcctg     87000
     cccggccgcc tggcgctcga attcacccgc gaggccgaca gcgccgaggc ggccgtgcgc     87060
     agcgcgctgg ccgacgtgcg ccgcgccatg cccacggcgg cgctgatcga ggccgcgccc     87120
     gacctggtcg gcctgaccga cgtggcgcag atcgtcggcg tgtcgcggca gaacatgcgc     87180
     aagctgatgc tggcgcaccc cgccaccttt ccggcgccca tccacgaggg cagcgcctcg     87240
     ctgtggcacc tggccgacgt gctgggctgg ctgcagaccc gcggcggcta tccgctggcg     87300
     caggccacgc tggatgtggc gcgcatggcg ctgaaggtca atgtggccaa ggaggcgcgg     87360
     cgcctgccgc gctcggccgg cgccggcctc gacgccctgg tgggatgact tgccgcctat     87420
     ggcctggcgg gtgcgcgctt gcggggcgag cgcggcgccg cgcccgttga cgccggccgc     87480
     cggcggctca acgcgccggc cgccgccgcc ttgagcagcc gcttgaaggt cgggcattgc     87540
     gcatggctgg gggcggggca ggcggcggca tgccgcagcc cgcggctcat ggcctgcaac     87600
     tgcttgacgg tggcgtcgat ttcttcggcc ttggccagca atacctgccg gtccacccgc     87660
     ggcgcgcctt gcggcgacag catcgcgcgt atgtcgtcca gcgacaggcc gccggcctgg     87720
     cccagcgcga caagagccag ttgctcgagc accgctggcg catagcggcg gcgcgcgccg     87780
     ggcgggctga ccgacgcgat caatcccacc ttgtcgtagt accgcaatgt cgaggccgga     87840
     acgccggtgc gcctggcgac ttcggcaata tccatgcaag acctccattg acttaaagtt     87900
     gacttcaact tctatcatag gcctcctcga tgaagagggt caacgcacag gaggggatat     87960
     ggcaccgcag gagatgctgg cgcgcgtcgt gctggtcggc atgggcgcca cggccgtgat     88020
     ggacgtgtgg acgatggcgc tcaggcgcct gggcgtgccc gtgctggact atgccctggc     88080
     gggccgctgg gcgggccact ggcgccatgg ccggtttgcg cacgccgata tccggcaggc     88140
     gccggcggtg cgcggcgaag cggcgttggg ttgggggctg cactatgcga ccggcgtgct     88200
     gttcgccggc ctgctggtcg gcgtcgcggg ccaggcatgg ctgcgggcgc cgtcgccggg     88260
     accggccttg gcggtgggcg tggcgaccgt gctgttgccg tggttcgtga tgcagcccgc     88320
     gctgggagcg ggattcgctt cgtcgcgcac gcccacgccg ctcaggaatt gcctgcgcag     88380
     cgtgcttgcg cacgcggtct ttggcctggg gctttatctg gccggcctgg cgctggcctg     88440
     gatagggcgc tgaaccggcg cccgcgcggc gcatgtccgc gcgggcgcgc ggatcatgcc     88500
     ggcgggccgg tccgggttcc gctcgccagc agcccgttgt gcgcgcccag cgcgggcgcg     88560
     ccgctgacga agcgggccgg ggtatcggac aggcgtatcg gactggccag cgtcgcggcc     88620
     gtggcggcac cggcggtttc gggccggcgc accatttcgc gcgccgccac ctgcggatgg     88680
     cggagaatgt cggcgtagct cagcacgggg ccggcgggga tgcccgcctc gcgcaggcgc     88740
     gccagccagt gttcggacgg ctgcgtggcc agggcctgtt cgaccagttc ggccaggacc     88800
     gcgcgatggg ccagccgggc cgtgttgtcg gcgaagcgtg gatcgttctt cagcgcggga     88860
     cggtcgagca ggtcgcaggt tttctcccaa aggccctgcg aggccgcgcc cagcgcaatg     88920
     gcgccgtcct gggtccggaa tatctggtag ggcgcggcgt tgcgcgaggc ctgtcccatg     88980
     cgttcgggat tgtggcccgt ggccaggtaa tcggcgacct ccagcggcgc catggccagc     89040
     gccgagtcca gcaaggcgac gtcgaccaat tgccccgtgc cggtttgctg gcgcgcggca     89100
     agcgcggtaa gcacgccgat ggtggcgaac agggccgtgg aaacgtcgac gatgggaatc     89160
     ggcagccggt gcgcggggcc gtcggtcggg ccgcattgcg cggccaggcc ggacatggcc     89220
     tggatgacca ggtcgaagcc gccttcgcct cgcatggggc cggattggcc gaagcccgag     89280
     atcgagcaat agaccaggcg cgggaactcc gcatgcaggg tcgcgtagtc caggcccagg     89340
     cgcgccatga cgcctggccg gtagttttcg accagcacat cggcgctgcc gatgaggtcg     89400
     cggcattgcg cgcggccggc cggcgtggag aggtcgatcg tgacgctgtg cttgttgcga     89460
     ttgaaaaggt tgaagaaagc gctctgtcca tcgacgaaag gggaagagtg ccgctggtcg     89520
     tcgccgccgc cgggcttttc gatcttgatg acttcggcgc cgaagtccgc cagcatcgcg     89580
     gtgcaatagg gcgccgcgat ccattggccc atgtccagga cgcgcaagcc ttgcagtgct     89640
     cccgtcattg cactgctccc gccggctgca atcgggcgct gccctcgacc gccagggtcg     89700
     agcgctcctt ggcgtgcgcc tcgtagcgga cctggtcgcc atcgcgccag agggagagca     89760
     gcagggtctc gcccggatag aacacgccgc gaaagcgcgc ggacagcgtg gcgatgccat     89820
     cggtgtcata cgccgccagc tcgcgcgcga tggcgtgctg caccaggccc atcaggcata     89880
     cgccgtgcag gaaaggacgc gggtagccgg cctggcgcgc ggcggcgggc caggagtgca     89940
     cagggttgac gatgccgtgc aggtcgaaca gcaacgcctg ctgcggcaag gtcggctgtt     90000
     cggtctggat gtcgggcgcg cgcgccggga cggccggcag gcgcgtcgag tcgtcgggcg     90060
     gtccgccgaa gccgccatcg ccgcggcata tcgtcaccat ggaaagcgtg gcgtagtgcg     90120
     tgccattgtc ggcgtcgtgc agcgtgcgct cggcgtgcag catcgcgccg aactgccggc     90180
     ccttgtcggt gatgcgcgtg acgcgcagct ggctggcgat gcggccggcg gcgggcagcg     90240
     gccggtgcgt cgcgatacgc tgctcgccca gcacgcaccg ggcccagtct atccccgtcc     90300
     agggctggcg ttgccagaag ccggggttgg ccagcaccag ggccatgccg ccggcggtct     90360
     tgggcgcgtc gccatagacg tactgcaact ggcgctcgtc catcgggtcc tggccatagc     90420
     ctgcgctcag ggcatacagg ctgcagtccc gcgcgccgta cgactgcgtc tcgacgggaa     90480
     actcgtgcgc taacaatgct tgcacattca cgaccggctg ctcctcagtt gacggccaga     90540
     ttgaggctct ggacgatggg cttccacttc tggatgtccg catcgatgac ggcctggaac     90600
     tgcgccacgc tgccgccctg cggcgtcatg cccatctcca gcagcttgga ccgtacgtcg     90660
     ttgtcggcca gcacggccgc gacgtcgcgg ttcagctgtt cgacgatggc cgccggcgtg     90720
     ccggccgggg cgaccaggcc gaaccaggcc gaggcctcgt agccgggcaa gccggactcg     90780
     gcgatggtcg gcacgtcggg cagtttcgag aagcgggttt cggagctcac gcccagtgcg     90840
     cgcagtttgc cgccctggac atgcggcagc gccgacgaga ggttgtcgaa catgacttgc     90900
     acatcgccgc cgtacagcgc ctgcagcccg ggcgcggaac ccttgtaggg gatgtgcagc     90960
     atgtcgatgt tcgccatgtg cgccagcagc gcgccggcca ggtgattgga cgagccgttg     91020
     cccgacgacg cataggtcac gccgggctgc gcctgcgcca gcttgatgag gtcctgcagc     91080
     gagtccagct tgctggcggc gttgaccacc agcacgttgg gcacccgggt gacctggatg     91140
     accggctgga agtccttggc cgcgtcatag cctggcgcgg agaagatcag cgggttgatg     91200
     gcgaactgcc cgatcgaggc catcatcagc gtgtagccgt cgggccggct gcgcgccagg     91260
     aaaccggctg cgatgttgcc gcccgcgccg gtcttgttct cgacgacgac ctggcgctcg     91320
     tacttggccg acagcttgct ggcgatgaga cgcgccagca ggtccgtcgt gccgccaggt     91380
     gcgtagggca cgacgagccg gaccggttcg gcggggtagg gggcggcggc ggcgccagcc     91440
     gacagggccg agacggccat gcccaaagcc agggccagtt tgcggcaaaa catgatgctt     91500
     ctccttagct gattgcactt atagtttgaa ggtccggtcc agccggacga tgtcgccccg     91560
     atagacgggc gttcctgcgt agatgatgcg gcccgactca tcgcgcacga cgcgcttcat     91620
     gatgacgacg ggcgcgccca cggcgatatc cagccacttg gccagctcca cgtcggcggc     91680
     atcgacctgg atcatttcga aggcctccag cttgcgctgc ggcaggagct gcggcagcac     91740
     gtgcagcgca atctcatggc gaaagcgctt gggcgccttg cggtacacct cgcggtcgat     91800
     gtagatgtcg gccacggtat agggaatgcc ctgcgcctcg tgcacgcggc gcatgtagaa     91860
     ataggcgtcc gcgggctgtc cgtgctgggc atagtcgggg gggcactcga cccggtcgcg     91920
     ttcggccagg atgcgcacct ggctggcgcc ccacagggcc cgaatgccgc tccagtcctg     91980
     gtccagcgga agctccaggc ctaccggcgc cacggcgtcg tccaggacga aggtgccgac     92040
     gccctggcgg cgctggacca ggccgtcgcg ctcgagcagg gccagggcct ggcgcgcggt     92100
     gacgacggcg gtgttgaact gccgggccaa ttgatcgatg gcgggcagcc ggtcgcccgg     92160
     gcgatagtcg ccggcgcgga tacgcatgcg cagcaggtgc gccaggttga catagcgttt     92220
     gttcgaaccg cttgccagca agtcgtcttt cacggtggcc atgttcagat ttcgcccggt     92280
     gttttccata tcattctgta attctaatat tagaatgact tggcaggcaa gggcgcaggt     92340
     ctgtcgcgtc cgccggtccg gatgccgggt cttgcggcgg ccaagatcgc ccgctatgcg     92400
     ggcgccttgc gcgcctgcct gggtggccgg tgggtcctgg cgctcagttg gccgtgatgc     92460
     cggccgactg gatcagggcg ccccagcgcg cggtttcgcg gttgacgaat tcggtggtgg     92520
     acggaaggtc ctggtaattg atcaccccgc cggtctggcg gattttttcc ttgatggcgg     92580
     gggcggccag ggttttcttc agcgctgcgc tcaaggtggc catggtggcg gccggggtgg     92640
     ccttgggcgc ggcgagcacc gtccacgaag tgacctccag ctcgggatag cccagttcgg     92700
     ccaccgtggg cacatcgggc aggtccggaa tccgcgcatg ggaggtggcc gccagcgcgc     92760
     gcaggcgcgc ggcctggatc tggccggtgg agttggtggc ctggtcgaac atcatgtcca     92820
     cgtggccggc catggtgtcg ttgagggccg gcgcattgcc cttgtacggg acgtgcatca     92880
     gccgggtgcc ggtctcgtgc atgaacaggg cgccgaccag gtgcgtggag gtgccgttgc     92940
     ccgccgacgc gtacgtcagc gcgtcgggcc gggccttggc ctgttctatc agttgcggca     93000
     ggcttttgag cgtggactgc tggcccacca cgatgacatg cggcgtgtcg tagatgcgtc     93060
     ccaccggcgc gagatcgcgt tcgggctgca acggcatgtt gcggtacagg tggctgttga     93120
     cgctcatcac gcccatgctg ccgaacagca gggtgtagcc gtccggcctg gcgcgggcca     93180
     cggcctcggc gccgatattg ccggcggcgc cggtgcggtt ctcgacgatg acggtctgct     93240
     tgagctggct gcccaggccg gtggcgagga tgcgcgcgac gacgtcgctg ccgccgccgg     93300
     ccgagaacgg cacgatgagg gtgatggggc gcgccggata tgcggcgtcg gcttgcgcgt     93360
     gcgcctggcc ggccggcaag catagcgcca gcgccgccag ggcgctgtgc agcgcggtga     93420
     gtcggggttg catggcgtct ccttggagag agtgggtcga acgggtgtct aggccagccg     93480
     cagcagcgcg agcagtgcgg ccgggtcgat ggcgatgccg tgttgcgcgg ccagcctgcg     93540
     cgccgcgtag cgccgctcgc cgggcaagcg ctgctggccg ctgcgcaaca acgcctgcgc     93600
     cagctggtcg atgcgcgccg cgaagccgtg gccggccgag cgcgccgggt cgatgcacag     93660
     gaagaactgg ccggtgcgcg aggtctgggc ggtggggtgg gcgctgcgat cgacttccca     93720
     ggaaaagctg ccgccggtca gcgcggcagc cagtacctcg accatcatgg cgatggccga     93780
     gcccttgtgg ccgccgaacg gcagcagggc gccgccgtcg agcacggccg ccgggtcgcg     93840
     cgtgggttgt ccgtgcctgt ccacgcccgc gtcgggcggc agcgtgtggc catgctgggc     93900
     cgccagttgc acatcgccct tggccatgac gctggaggcc tggtcgaata ccagcgggtc     93960
     cgcgccggcg cgcgggcagg cgaaggccat gggattggtg ccgtacagcg gggtggtgcc     94020
     gccatgcggc gccatgtggc tgatgctgtt gacggcggtc agcgcgatcc actgctggcg     94080
     cgcgtagggc tcgacgtcca gccacagcgc gccgaagtgg tgcgagttgc gcgtcagcag     94140
     catggccagg ccgtgctggc gcacgcgctc ctcgatgagc gggcgcgccg cgcgcagggc     94200
     gcattgggcg aagccgttgc gcgcgtcgac gatgatggtc gcgccgctgg cgtcgatgac     94260
     tgccggctcg gcgtgcccgt cgacccagtc ggtgcccagg gtggccacat agccggccac     94320
     gcgatgcagg ccgtggcttc gggcctcgtc ctgttcggcc agggcgcagg tttgcgccag     94380
     tacggcggcg gtcgcggcgc tggcgccggc gcgctcgaac agccgcgcca gcagcgcggc     94440
     cagctgatcg gcgctcagcc ggcagggcgc gcccgtgtcg gcgcagcgcg ccaggtggcc     94500
     ggccagttcg tcgtgcgatg cggcggggga gatcgtcatg gtcgcagccc tcagagaatg     94560
     ccttcttcgc ggtagggctg gttggcctgc acgcgttcgt agcccagctt cgacaggtcg     94620
     aggctctgga acgcgccgtg caccagcagt tcggcgatgc cgcggccggc ggcgggcgcg     94680
     tgcatcatgc cgtgcccgga gaaacccgcc accgtgtaca gattcttcag gcgcgcgttc     94740
     caggcaccga tcaccgggtt gccgtcgagc tcgttctgtt cgtacaggcc ggaccaggtg     94800
     cggtggcact tggccgcttc gagcggcggg aagcgatgcg ccacggccgg ccagacgacg     94860
     ttctcgaaat agtcgtgatc gacatcgaag ttgaagcccc ggttttcgtc gccgttgacc     94920
     aggccgccgg aaaagccccg gccttcggag cggaacgcca ggcggctgag atccttcacg     94980
     tagggcaggg gttcgatcgg gttgccgcac gtgaagtagt gttcgaagcg gcgcatcggc     95040
     acgaccggca ggtgcatgcc gaacagctcg gcgacctggc ccgaccaggc gccggcggcg     95100
     ttgacgaagg cttcggcgtc cagctgcgcg ccgctttcca gcgtgacgcg gcgcgcgcgg     95160
     gcgggcgtga cgtcggcggc cacgacacgg tccttgagat acaccgcgcc cagttcgacg     95220
     gccttgcgcc gaaagcccca cagcaggccg ttgggatcgc accagccgtc ttgcggcgta     95280
     tgcgcgccag cgcccaggtc gtcgacatgg atggagggaa agcgcgcctt cagttcggcg     95340
     ggggtaagca ggtcgacctg gcagcccatg gcctgctgcc gcgccacgtt gcgctcgagc     95400
     atggcgacgc gctcgggcgg cacgaggaac aggtagccgc cttgcaccca gtcgaccggc     95460
     gcgggccggc cattggcggc catggtgttc tcgaagttct tgatgacgtc caggctgtag     95520
     agcgacatgg cgatgttctc ggggcaggtg aactgcaccc ggcagccgcc cgatgaacgc     95580
     agcgccgagg cgaactcgta gctcggatcc ggctccacga cgcagacccg cgcggccggg     95640
     tcgcgcgcca gcacgtggta ggccacgctg gagccgatga tgcccccgcc gatgatgacg     95700
     atgtcgtact gctggacctg cggctgattc atggcttgca cccgattcca atgttggcga     95760
     gaatgtatcc tttattggat ccaattaaat catggctggc ggggccgcgg tgttgcggga     95820
     aaccctgatg cggccggaca gggagcgcga ggatgaggca ggcattgttt ctgggttacg     95880
     gccggatggg cgcggcgctg ggcgaagcct ggctgcgcgc cggtttgctg gcagggatag     95940
     acgcggtcga tccggggcgc gatggcgccg gcctgcgggc gcgcctggtg cgcggggcgg     96000
     acgaattgcc ggagcaggcc tacgacctgg tggtgctggc ggtgaagccg gccatggcgc     96060
     agcaggcctt gcgcgccgtg ccgccggcgc ggctggcgcg cgcctgcctg gtgtccatca     96120
     tggccggcgt gccggccggc gcattgcggc aggcgctgca gccgccgcgg ccggtggcgc     96180
     gggccatgcc caatacgccg gtcatggcgg ggcaaggctg caccgggctg tacggcggcg     96240
     acgatgtcgc gcccgcgcag cgcgccgcga tcggccgcct gttcgaggcc gtgggcgcgg     96300
     cgttctgggt cgatacggaa gatcagctgc acgccgtgac ggcgttgagc ggcagcggtc     96360
     cggcctacta ccatctgttc agcgaggcgc tggcgcaggc gggcgagcag ctgggcctgc     96420
     cggccgcgct ggcgcgcagc ctggcggccc gcacggcgct gggcgcggcc agcctgcagt     96480
     gcgaggaagg cgccgatttc gccgcgctgc gccgcgaggt gacctcgccc cacggcacca     96540
     cccatgcggc gatcgaagtg ttcgagcagg cgggggcgct gcgcacgctg gtgcgcgatg     96600
     cggtgcggca ggcgcaggcg cgctcgcgcg agctggcgcg gccctaggcg ggcggcgctg     96660
     cctcagatca ggccatgttc cttgcgcagc acgtcctgcg tgtgctcgat gtgcgcttcg     96720
     agcaggtcgc gcgcgcgctt ggccttgccg gcgatgcatg cgtccaggat ggcgcggtgc     96780
     tcgttctggg gcgacttgcg gcccacggca taggactggt gcgcacgcag atggatatcg     96840
     atgccgcgca ccaggttctc gatggtcttg agcaggcgcg ggcggccgct ggggcggtac     96900
     aggcacatat ggaattcgag gttcagctcg ctccattcgc gcgggaattc gctggcgtcg     96960
     tagcgcgcga tgatggtctc ggcttccttg aagacggcgg gcgtcatgtg cggaatggcc     97020
     agcaccagcg cgcgcgattc cagccccacc cggatgtcga gcgtttccag cagttcctgg     97080
     accgagcgcg acgcgaccac cgagccctgg tgcggcgcgt gcgtgaccag tccctcggct     97140
     tccagccgct tgagcgcctc gcgcaccggt atgcggctga cgccgaagcg cttggccagc     97200
     acctcctgct tgagctgcac gccgatgccc agcgagccgt cgaggatcag ggcgcgcaac     97260
     tcgtcggtca cgccatcggc ggtcagcgtc aagggtcctg cattagcgtc ggtcatgcct     97320
     ggtcaacctg gaagagccgc gcggccggat ggccgtcgag gatgggggcc gatcatacac     97380
     accgcgcgcg gcccggcggg cggctgcggg gggtgaaacg gcgtggatat tattttggat     97440
     ccatcatacc acccgcgtcg gcgctgcgtg acccgccgcg cagggtacgg ggtatcatcg     97500
     gggccgccgt cagcgacact agaaggaagc gtgccatgaa ctccgcatct cgcctgaaca     97560
     tctccagtac gtccgacgat tggcgcggcc tggcgttgtc gaatttcccc ctgtcgccgt     97620
     tcgtgctcga tggcgagctg ttcgcctcgg tggaagggtt catccagggg atcaagttcc     97680
     gcgaggacga tccgcgccgc gccactgcgt tcctgtccag cggctgggac gccaagcacc     97740
     tgggcgacac ggcggaccgc agcggggcct attggggcgg cgcgcgcatt cggtacggct     97800
     cggccgaaca ccaccagttg atcgagcggg ccatccgcgc ccgcatcaag caatgcgagg     97860
     gcttgcgccg caccttgcgg gcgaccgagg gcatgaccct ggtgcacgat accggcaagc     97920
     cggaggcccc gcatacctcg ctgcccgcca cggtgttctg ccgcattctc gaaacgctgc     97980
     gccgggaaat cctggcgcgc gcgcggccgt agccgcggcg gctagggctg cgtctcggcg     98040
     ccgccggcca gggccttgta gagcacgacc aggcgggtgc gcaggcgccc gtcgctggcc     98100
     gtgaggtcgc ggcgcgcctg caggtcttcg cgttgcgcgt ccaggacggc caggtagtcg     98160
     gtcaggccgc cgagatagcg cgcctgcgcc catgcgcggg cctgcgcggc gctctcggcc     98220
     ttttcccgca ggcgcgcata ttgcagctgt tcggcgcgat agccgctgag tgcgtcgtcg     98280
     acttcatgcc aggcccgcag cacggtctgc tggtaggcga cggcggcctc ctgctgctgc     98340
     agttcgcgca gcgtgaccac gctgcggcgg cggccgctgt cgaagatggg caggtccagc     98400
     gacggcccga tggaccaggt gcggctgccc cagtcgccga acttgccgct ctcgtacgat     98460
     tcgtagccga accgcgcgcc caggcggatg ctggggtaga ggtcggcctg ggccaggccg     98520
     atgcgggcgg tggcctggtg caggcgcgct tcggcggcgc ggatgtccgg gcggcggcgc     98580
     gccagttcgg acggcagccc cagcgcgtag tcgggcagcg gccgcgccgg gccgtcgcct     98640
     tcgggcgcgg ccagctcgtc gcccagttcg ccgggccgcg cgccgagcag caggcccagg     98700
     cggttgccgg cctgggcctg ctgctccagc cagcgcggca actgggcctg caggccggcc     98760
     agttgcgtgc gctggcgcgc cacgtcgaga tcggcggcca gcccgccgcg cgctcgcgcc     98820
     tggatgagcg acagttgttc ttgcagcgcc gcgatgtcct ggcgcagcag ccgcgcctga     98880
     tgctgcgcgg tgcgcaattc gaagtagttg cgcgccacct cgctgaccag gctgagccgc     98940
     gccgcgtcgt acagcgcggc cgaggccgcc acgtcggcgt cggcggcctc gacggcgcgc     99000
     cgcacgcggc cccacagatc cagttcccag gaggcgtcga agccggcctg gtacagggtg     99060
     taggggtcgc tgagcagttc ggtgacggcc tggcgattgg ccggcgcgat ggcgtcgaga     99120
     atgcggttgg cggcggcgtc ttcgctctgg cgctggcgcg tgacggccgc cgccgcgtcg     99180
     acctgcgggc cgcgctgcgc ggccactgtc cggcgttgcg tgcgcgcctg ggcgtagcgc     99240
     aaggctgcgc tttgcaggtc ggggctggcg gccagcgcgc gcgcctgcag gcggtccagc     99300
     gccgggtcgc cgaagctgcg ccaccattgc gcggccggcg cgccggccgc gccggcgtgg     99360
     cccgccagtt cgggcgggcc gccgtgccac gacgtccagt cggccggggc ggcgggggtg     99420
     ggcgcctggt agtcggggcc gacggcgcag gccgccagcg cgcaggccag cgcgatgcag     99480
     agtgcggaca ggggcaggcg ggcgtgcatg gcgtggggcg ggttcagacg agacggttgc     99540
     gaaacagcca cgcggccagc ggcagcgtga cggcggcgac ggccagcatg ggcaggaagt     99600
     cgatggccac atcgcgtacg ccggcgcctt ccaggtagac gcggcgcacc aggtcgacgg     99660
     cgaagcgcag cgggttggcc caggtcgcgg cctgcagcgc ctcgggcatg ttgcctaccg     99720
     gcgtgatcag gccggacagc aggatcagcg gcatcatcag gacgaaggta tagaccatgg     99780
     cctgctgcat attggccgac agcgccgaga tcgacaggcc gatgcccacg ctggcggtgg     99840
     tgaacagcag cagccccagg taaagcgtgg cgggcgagcc ggccagggga atggcgaacc     99900
     aatagcgcgt caccagcagg atcagggtcg attgcgccag gccgatcagg atggcgggca     99960
     cggccttgcc gaccaggatc tccagcgggt tgagcggggt gaccagcaac tggtcgaagg    100020
     tgccttgctc acgctcgcgc gccaccgaaa gcgcggccag catgagagtc tggatcatgc    100080
     tgagcgtggc gatcagcccg ggcatgatgt tccagcgggt ttccaggttg gggttgaacc    100140
     aggcgcgcgt gctcacgcgc accggcggcg cgcccacgcc cggcagggcg gcgttgtagc    100200
     cggccaccag cgttgcgaga tggccggcgg ccatgccggc ggtggtggag ttgcggccat    100260
     cgagcacgac ctgcatgggc gcgtcctggc cggccgccag gcgccggtcg aagtcggcgg    100320
     ccaggtggat caccagcagc gcctggccgc cgtcgatgac gcgggcgatg tcggccggcg    100380
     cgcgcagggt cgccacgcgc tggaatacgc cggagccgtc gatgcgcgcg gccagctcga    100440
     ccgcgccggc gccgcggctc tggtcgagca gcgcgtaggg cacatggttg aggtcgtagg    100500
     tggcgccata gccgaacagc aggctttgca gcagcacggg ggcgatcagg atgacgcggt    100560
     tggccggatc cttgacgatg gccagcgtct ccttgcggca caggaaggcg atgcggcgca    100620
     gcatggcgga caggcgggcg agcatggcgt gtcagtccag ggatttgcgc gtcaggcggc    100680
     gcgccagggc cagcagcgcc acggcgtaga cggccaggat ggcgcagttg cgggcgatca    100740
     ggggccagtt gtcgccggcc aggaacgcgg tcttcaccag ctccatgaag taggtggcgg    100800
     gcagcagcga gcccacgaag cggattgccg ccggcacgtt gcgcaggtcg aacaaaaagc    100860
     ccgacagcat cagcgccggc aggaagctgc tgagcacggc gacctggctg gccaggaact    100920
     ggttgcgcgt cgtggccgag atcagcaggc cgatgcccag cgccacgacc aggtagagca    100980
     tggcgctgag cagcagcacc gccagcgaac cctgtagcgg cacgtggaac agcaggcgcg    101040
     ccgcggccag gcacagcccc agtcccagca tgccgacgac gaagtagggg atcatcttgg    101100
     ccagcaggat ttcggtgggg cgcacgggcg tgacgaacag cgcctccagg gtgccgcgct    101160
     cccattcgcg cgccaccacc agcgccgtca ggaaggcgcc gaccagggtc atgatgagcg    101220
     cgatcaggcc gggcaccagg taccaggtgc tggtgttggc ggcgttgaac cacagccgct    101280
     cgaccatggt cacgccgggc ggcggcgcgg cgtggccggc gcggtcggcg cgcaggcgcg    101340
     ctgcgtgccc gagcgcgccg tcgacgtagc gcgccagggc ggcggcgctg ttggcgtcgg    101400
     cgccatgcag cagcaactgc acctgcgcgt cgccggcagc cagccggcgc gcgaagtcgg    101460
     cgggcacgcg cacgatgccc tcgacctcgt gccggcgcat cagcgtttcg gcgctatgca    101520
     tatcggccag ccagaccggc gccaggtagt ccgagccggc caggccggcc agcgcgtcgc    101580
     gcgcctgggg cgagcggtct tccagcacga ccgcgatcgg cgcgttgcgc aggtccagcg    101640
     acagcccgta gccgaaaatc aggatcagca ggatgggcag gaccaggcca atggccaggt    101700
     tgctgcggtc gcgcagcaac tggcggaact ccttgcgcac gaggctggcc agccggggcc    101760
     agaaaccgcc ggcgcctgcg cgcgggctca tggccgcgtc tcccggccct ggcgggcgcg    101820
     cgcctgttcg acgatgccga tgaaggccgt gttcatgtcg ccggcattgc ccgcctggcg    101880
     gcgcaccgcg tcgggcgtgc ccagcgccag cagccggccg gcgtcctgga tggcgatgcg    101940
     gtcgcagtat tcggcctcct ccatgaagtg cgtggtgacg atgatggtgg tgccgtccag    102000
     ggccagcgcg gtgatgcggc gccagaacgc gcgccgcgcc agcgggtcga tgccgctggt    102060
     gggttcgtcc aggaacagga tctcgggttc gtgcagcagg ccggtggcca tggccaggcg    102120
     ttgctggtag ccgccgggca gctcgccgct gcgcgcctgg gcatggccgc gcaggccgaa    102180
     ctcgtccagc acggcgtcga tgcgccggcg cagcgccgcg ccgcccagcc cgtagacgcc    102240
     gccgaagaag gcgaggttct cggccaccgt caggttgccg tacagggcga acttctgcga    102300
     tacatagccg atgtggcgcc gcgcccgcgc cggcgcgttg cgcaggttca cgccggccac    102360
     ccgcagctgg ccgctgctgg ccggcagcag gccgcacagc atgcggaacg tggtggtctt    102420
     gccggcgccg ttggggccga gcaggccgaa gatctcgccg cggcgcacgc tgaacgaggt    102480
     gctggccacg gcggtgaacg cgccgaactt gcgcaccagg tcatggactt cgatggcggg    102540
     ctgggccgcg tccggggcgt cgctggcgcg cggcgccggc gggaccgggc gcggcgcggc    102600
     cgtggccgcg ggcgcgtcgg ccgccaggcg cgcgcgcagc agcatctgca cgccgtcttc    102660
     caggcgcgcc ggcgtggcgt gggcctgcgc gccgccgagc agggcgcgca ggcgtgccgg    102720
     gtcggcgtcg gggcgctgga tgtagcgcac cgcgccgccc tcgggcacgg cgtcgatgat    102780
     ctgcgcgctg tcgtcgagca ggcgcgcctg caaggtgcgc gccggcacgc ctgccggcgg    102840
     cgcggcgaga aagcacaggc cctgggccgg ctcgcgcaag gcctgcggcg cgccctgcgc    102900
     gagcagcgtg ccgcggtaca gcacgtggac ttgcgcgcaa tgctgcgctt cgtcgaggta    102960
     ggcggtgctg accagcacgc tgagccgcgt ttgctcgacc agttgctgga cgatctgcca    103020
     cagctcgcgg cgcgacagcg gatccacgcc cacggtcggt tcgtccagca gcagcaggtc    103080
     gggcgagcgc accagggtgc aggccagccc cagcttctgc ttcatgccgc ccgacagctt    103140
     gccggccggc cgctcggtaa agcgcgccag gtcggtcatg gccagcaggc gcgcgtagcg    103200
     ttcgcggcgc tcgcgcgcgg gcacgccgtg caggtcggcg tacaggtcga ggttttcctg    103260
     cacgctgagg tcttcgtaca ggccgaagcg ttgcggcatg tagctgatgc ggtcctgcac    103320
     cgcctggggc gattggacgg catcgatgcc cagcacgcgc agcgtgccgg cgtcgggccg    103380
     catcaggccc gcgatcagcc gcagcaaggt ggtcttgccc gctccgtcgg gcccgaccag    103440
     cgcggtcagc cggccgcgcg cgaccgacag cgtcagcgca tcgagcgcga gcgtctggcc    103500
     aaggcgcttg gccaggtccc gcgcctcgat gacgggcgcc tcgttcatgc gccgggctcc    103560
     gccgcatcgg ccaggtccag ccgcacggtg gccggcatgc ccaggcgcag ccggtcctgc    103620
     gggtcgtcga cgcggatgcg gatttcatac accaggctgg tgcgcagggt ttcggtctgc    103680
     acggtcttgg gcgtgaactc ggccaccgac gagatatagc ccacctggcc gtcgatggcg    103740
     cggtcgggct ggctgtcggt gtagacccgg gcccgcatgc ccggccgcac gcgccccagg    103800
     tcgggttcgg acaggtaggc gcgcacccac ttgggctcgg tcagcgccag cgtatagacg    103860
     gggcgctgcg gcgaggccat gtcgccgggc tcgagcaggc gcgcgcgcac gacggcgtcg    103920
     gtgggcgctt tcagttcggc ctgggccagc cggtgccgca gcagggccag ttcggccagg    103980
     ctggcctgcc actgcgccgc cgcttcggcg atgtcttcgt cgcgcggccc cagcagggcc    104040
     agctgcagcg ccttggcctg ggtttcggcc tgggcgcgcg ctacccgcag gcgcgccgcg    104100
     gcgcggtcga tgtcctgccg gctgacggcg cgtccatcgg tggcgcgggc ggtgccctgc    104160
     agacgttgca ggtcctgctg cgcgagggcg gcgtcggccg tcgccgcgtc ggcgcgcgcc    104220
     cgcgcctggg cgatctcctg ggggcgcgag ccgttgcgca ggcgcagcag ggcttgttcc    104280
     tgcgcgctgg cgcgcgcctg ggcccgttcg gcctcgagtt gcagggtgcg ggtttcctgg    104340
     cgcgccagga cctggccggc gcgcacgcgg tcgccttcct cgacctgcat gtcggcgatg    104400
     cgttcgctgt tgtcgaaggc cagcgccacc tggcggatat cgacattgcc gtacagggtg    104460
     aggatgtcgt ccgggggttg cgcgcgggtc agccaccatg ccgcgccggc tatcgccagc    104520
     gcgatggccg ccgccgctgc aatcaggggt ttcttcatgg tcggcgctcg caccggaggg    104580
     gtcgatgggc cgactataca ttaaattcaa attgaatttg aagtaatttc gggtgacact    104640
     aagccgttct ttcaatgcac cgccacaccg atcaccatga ccagaccgcg ccgttcgctg    104700
     cgggccgacg gggccagcac ccgcgccagg atcctcgagg cagccggcca gctgttcggc    104760
     cagtacggct atgcgggcgt ggccagcaag gccatttgcg cggccgccgg cgccgacctg    104820
     gcggcgatca actaccactt cggcagccgc gacggcctgt accgcgcggt gctggtcgag    104880
     gggcacaagc atttcatcaa tctcgatacc ttgacggcgc tgacgcaaag cgatctgtcg    104940
     ccgcgcgaga aactgtgcgc cttcatcgac ggcatggtgg cggggttgtg ggagcaggac    105000
     tggcacacgc gggtctgcgc gcgcgaggtg ctggcgccgt cggcgcattt cgccgcgctg    105060
     atcgacgaag aggtgctgcc caagttccgg ctggtggcgg gcatcctggg cgacatcacg    105120
     ggctttgcgc cgggcgatcc ggcgctggcg cgttgcgccg tgagcatcgt ggcgccatgc    105180
     atgatgctga tggtggtcga ccgcaatgcg cccagcccgc cgcagcaggt gctggcgcag    105240
     ccggcggccg acctggccga gcatctcaag cgcttcgcgc tggccggcct ggacgcggtc    105300
     agcgccgccg cgccgcgccg ctgacgcctc tgctacattg acgccaccgc ggccccgctc    105360
     cgggcggccg cctggagggg actatggcaa aagaggcgta caccgtcggg cccgtcttgt    105420
     cgtttcgcgg cgtgggaggc gcgcgccagt ggcgcgtgag cgcgctgatc ggcgtcccgc    105480
     gcaccgcgaa ggcgcccgcg ctgcgcgtgg aagggcgggc ctgtgccgcg cccgtggtgc    105540
     tgcaccagac cgcgcgcgaa accttcctgc gctacgacct cagctgcgac atgcaggcgc    105600
     gcgagcgcaa ggtcgagttc ggccccaggg gcggaccggc ctggcatttc accgtgcccg    105660
     cgaagggcgc cgcgccgcgc ctggcctatg tgtcgtgcaa cggcttttcc gaccccagcg    105720
     gcatgcgcaa gctggtgcgc ccggaaaacg ccgtatgggc ggacctgctg tgcaaccacg    105780
     atcgcgactt gcggccggcg gactatctgc tggacaagga acagttgtgg cacgaaacgc    105840
     gtacccatga cgaaggcctg cagcgcttcc acctgctgct gatgggcggc gaccagatct    105900
     atttcgattc gatctgggag gacatcgcgg cgctcaagca gtgggtgggc ctggcgcgcg    105960
     cgcagcagct ggaattcaag gtcagccagg cgctggaaga cgagatcgag gcgtactact    106020
     tcggcctgta cagccgccgc tggctgccgc cgtcgcgcgc gccatgggcg ggcgcgcagc    106080
     ccagcctgga cgccgccgac gccatggccc gcgtgcccac catcatgatg tgggacgacc    106140
     acgacatctt cgacggctgg ggttcgtaca gcccggccat gcagcgctgc gaactgttcc    106200
     agaccctgtt caggcatgcg cggcgcgcct tctgggtctt ccagatgcag cacgcgctgg    106260
     ccgacctgcc gcccctgcag gcgatcgcgc gcgccaatgt gctgccgcag gatccgcagt    106320
     acgagggtat cgcctggagc cgccagctca agcgcgaccg gctggcgctg ccgctgctcg    106380
     acggccagcc cggcttcacc tcggcctatc ggctggggcc gctggcgctg gtggccgccg    106440
     acctgcgcac cgagcgatcg cgcacgcaga tcctgggcac gcaggcgtgg accgcgctgc    106500
     agggctggct gcatgggctc aagggcaacc ggccggcttc ggccacgggc ggctgccggc    106560
     atctgatctt catgtcctcg gtgccggtgg cgcatcccaa gctgtcgctg gccgaaggcc    106620
     tgctcgacac ctttggccag gaccatgtgc tcgacagcaa tgccgacgac ctgaaagatc    106680
     attggtcgca cgacgaccac gagggcgaac gcaagcgcct gctggagacg ctgatgcagg    106740
     tcgccaacga gaagctgctg cgcgtgtcga tcgcctcggg cgacgtgcac gtggcggcgt    106800
     ggggcaatgc ctaccggcgc gacatcccgc ccacgtcgaa ctgggcgcag atccagcagt    106860
     tcacctcgtc ggcggtggtg cacccgtcgc tgctcggcgt ggccgagcgc ctgttcctgt    106920
     tcatgctcaa cggcacggcg gcccaggcgc agcccatcga cgtgaacctg agcgtggaga    106980
     tgatgctgtt tcctggccac aatcgctatg tgatgccggc gcgcaactgg ctggccttcg    107040
     agctcgacgc cggcaaggcc ggcaagctgt gggcgagctg gcgctgcgag accgagacgg    107100
     gcttctccaa ccatctgcag gcggtgcagc ccgcgcaggg ctgatcagat catcggcagg    107160
     ctggccgggc gggggccgcg ctcgaacgcg gcgtccaggt cggcgcagtc ctgttcgctc    107220
     agcgccaggc ggccggcggc ggcgttggcc gccacgtggg ccgggtcggc cgccttggga    107280
     atcgcgaaca cgccgggctg gcgggtgaga aaggccagcg cgatctggcg cggcgtcgcg    107340
     ccgtgggcct gcgcgatgcg cgccagcacg cgcccgccgg cgctggctgg cgccgggaag    107400
     tcgtcgtggc cgaacgggct gtaggccacc acggccacgc catgcgccgc gcaccaaggc    107460
     atgaccgcat gctcgatggc gcgctcgcgc aggtggtaga gcacctggtt gcaggccagc    107520
     ttgccggggc cgacgatgtc cagggtttcc tgcaggtcgt cgacgtcgaa attgctgacc    107580
     ccgtagctgc ggatcttgcc ttcgcgctgc agcgcgtcga atgccgcgaa ggtttcttcc    107640
     agcggatggg cgccgcgcca gtgcagcagg tagcaatcga gatggtcggt gcccaggcgg    107700
     cgcagcgagc gttcgcaggc cgcgcgcgtg ccggcgcgcg aggcgttttc cggtagcacc    107760
     ttggacacca ggaaaacctg gtcgcggcgg cccgcgatgg cctcgcccac caggcgttcg    107820
     gccgcgcccg cgccatacat ctcggcggta tcgatgtggg ccatgcccag gtccagcccg    107880
     ttgcgcaggg catcgaccgc gctggcgcgc gcgctgttgt cgaggttcca ggtgccctgg    107940
     ccgatggccg cgaccatgcg gtcggtggcg ccgaagcgat gctgtttcat ggtgactccc    108000
     cgcgggcaag ccccaagcgt agcaggccgg cgctagccgc gctggcgcgc caggtgccgg    108060
     tacagcgtgc tgcgatggat gccgagttcg tgcgcggccc cggcgatatt gccgccgtgg    108120
     cgggccaggg cctggtcgat ccggtgcagg ctggcgtcgc gcagcgtggc gggcgccgcg    108180
     ggcggggccg ccacgcccgg gcgcggcgcg gcgccgtcgg ccgcgtggac ggcgggcgcg    108240
     gcgatggcgg cgggcaggtg gtggcgatgg atcaggctgc cgggcggatg gaacagcgcc    108300
     agcgtgcgca gcaccgagcg cagctgccgg tagttgcccg gccacgcata ggcggccagc    108360
     gcgtcgaggg cgtcgtcggc cagcgtcagg ccggcgggcg tgtcgtccag cgcgcgcaag    108420
     gcggcgcaga taaaggggcg caggtcgtcg cgctcgcgca gccgcggcaa ggggaccgca    108480
     tagtcgtgca ggcggtaata gaggtcggcg cggaactcgc cggcggcgat catggcgtcc    108540
     aggtcgcggt gggtggcgct gaccaggccg aagttgaccg gcaccgcctt gtcggcgccc    108600
     agcggctgca ccatgcgctc ctgcagggcg cgcagcaggc gggtctgcag ggccagcggc    108660
     atgtcgccga tttcgtccag gaacagcacg ccgccgtcgg cttcgcgcag ccggccgcgc    108720
     gcgcccagcc gccgcgcgcc ggtataggcg cccggctcgt agccgaacag ttcggcctcg    108780
     atcaggcttt cgggcagggc gccgcaattg accgcgacga acggaccgtc gcgccagatg    108840
     ctgcggcggt acaggtgctg tgcgtagact tccttgccgg cgccggtttc gccttgcagc    108900
     agcaccgaca ggccgccgtc gagcgcgcgc cgggcgcgtt cgaagccggc ctgcagcgcc    108960
     ggcgccagcg ccggcagcgt ttcctcgggc gcctgcgccg gcacggcgcg cggcgggcgt    109020
     gggggcgcgg gcagcgagcg cgcatgcccg ccctggcgca gcacggcatg gaagggagcg    109080
     ccttgcggcg tatggacgcg gccgggcgtg cgcgcgacgg cgcgccaatc gaccagccag    109140
     ccgtccagcg gctggtccag cagcgcgggc caggtggcgc ccagcagcgc gacggcggca    109200
     tcgttggcgc cgacgatgcg ttcgtcctcg atcagcagca gcccgcgttc gaccgaatcg    109260
     agcagcgagg cctgcttgtg gaagaccagg tacaggcagc gctcgccggc ctgctcgatg    109320
     acgcggttgg caacctggcg cgcgcacatg ctggccaggc tcagcgcata ggcgtgcatg    109380
     cgcccggcgt cgcccgagat atccagcacg ccgaggatgt cgccgcgcgg cgaacggatc    109440
     ggcgccgcgt ggcaactgag gatctggttg cgccgcagga agtgttcggc gccgtgcacg    109500
     cgcagcgcgg cggcttcgat cagcgccgtg ccgatggcgt tggtgccgcg atggttttcg    109560
     gcccagctga ccccgggccg cagcgccacg tggtcggcgc gctgcaggaa accggtattg    109620
     ccgcttgcct gcaggatcac gccgctggcg tcggccagca gcaccagact ggaggcgctg    109680
     gccaccatgc cggccagggt ctcgatttcg ggctgggcgg cgcgcagcac gcaggcgtgc    109740
     tgctcgaggc gttcctgcag gtcgccgtga cgcagggcga cggggtcgtc gtgcaggtcg    109800
     gcggtggcgc tggcgcagcg ctcccaggag cgcacgatgg gagcggcggc ctgcgtggac    109860
     ggcaggtgct ggccggatgc ggaaagctgg tagccgggca tgcggtgtct ccttgcgtgt    109920
     cgcgcgccgc gacgcgatgt cgccgccggc aacgccggcc tgtcgcaaga tgcgacaggc    109980
     cgctgttttt tatagggaaa ttatgcatga aaagcgcgtg cgcgctggcc gtccagaggt    110040
     aacagctcgt cgccgcgggc tggcacggcg tttgcatgag cctgaacggc gccccatgcg    110100
     cccgccgcgc gacggcaagc aatcgtcacg gcgccacaac gacatcagga gacaaaccat    110160
     ggatctatcc gacctgaaaa aattgggcct ggatgtggcc tacccgttca aggaacagta    110220
     cgagaactac atcggcggcc aatgggtgcc tccggtaggc gcggagtact tcgacaatct    110280
     gtcgcccatt accggccagc cgttttgccg cgtgccgcgc tcgggcgcgg ccgacatcga    110340
     actggcgctg gacgcggcgc atcgcgcgcg cgccgcgtgg gcgcgcacct cgcccgccga    110400
     gcgggccaac atcctgctgc gcatcgccga ccgcatcgag ggacagttgc cgatgctggc    110460
     ggttgccgag tcgatcgaca acggcaagcc gctgcgcgag accaccgcgg ccgacctgcc    110520
     gctggcgatc gaccatttcc gctatttcgc gggctgcatc cgggcgcagg agggcgccat    110580
     ctcggagatc gacgccaaca ccgtggccta ccacttccac gaacccatcg gcgtggtggg    110640
     gcagatcatt ccctggaact tcccgctgct gatggcggcc tggaagctgg cgccggcgct    110700
     ggcggcgggc tgcgtggtgg tgctcaagcc ggccgaacag acgccggcct cgatcctggt    110760
     gctggccgaa ctgatcggcg acctgctgcc gccgggcgtg ctcaacgtgg tcaacggcta    110820
     tggcaaggag gccggccagg cgctggccac cagcaagcgc atcgccaaga tcgccttcac    110880
     cgggtcgacg ccggtgggca agcacatcct gcacgcggcg gccgacaacc tgatccccgc    110940
     cacggtggag ctgggcggca agagccccaa catcttcttc gacgacgtga tggaccacga    111000
     cgacgagttc ctggacaagg cgctcgaggg gctggccatg ttcgcgctca accagggcga    111060
     ggtctgcacc tgcccgtcgc gcatcctgat ccaggagtcg atctacgagc gcttcatcga    111120
     gaaggccatc gcgcgggtgc agtccatcaa gaccggccat ccgctcgatg ccggcaccat    111180
     ggtgggcgcg caggtctcgc aggtgcagat ggacaagatc ctgtcctata tcgatatcgg    111240
     ccgccaggag ggcgcgcaat gcctgaccgg cggcgcgcgc aacgacatgc tgccgggcgg    111300
     gctggaccag ggtttctatg tccagccgac catgctgctg ggcaagaaca gcatgcgcat    111360
     cttccaggag gaaatcttcg ggccggtcgc ggcggtggcc accttcaagg acgaggagga    111420
     ggccatcgcc atggccaacg acacgttcta cggcctgggc gcgggcgtct ggagccgcga    111480
     cggcgcgcgg gcctaccgcg tgggccgcgg catcgaggcc ggccgggtgt ggaccaattg    111540
     ctatcacctg tatccggcgc atgccgcctt cggcggctac aagcagtccg gcatcgggcg    111600
     cgagacgcac aaggcggcgc tgtcgaatta ccagcagacc aagtgcctgc tggtgagcta    111660
     cagcgccaag gccctgggct tcttctaacc cgggtgcctg tccccgcatg gggactggca    111720
     cccgccgact cccggggtgc ctgtccccgc tgggacaggc accaggatcc ccacggggac    111780
     agacaccaga attcccgcag ggactggcac cccaggcgcc gcgctcacgc cggcgcgccg    111840
     ggccagacct ggtggtcgcg cgggctgtcg atgcgatagt cggagtaggg cagcgacaac    111900
     aggccgtggc ccagccggtg cgcggcttgc agcggacggc gcggatcgtg cgccacttcg    111960
     cctctgcggt tgcccgcccc gtgcaccatg ccgacgaact gcgagtgggt gtaacgcgtg    112020
     aactcctgca actgatgcac gatgcccagg gccgcgccag ggtaggtttc ctcggaggac    112080
     acggccagcg ccagccgctt gcccgtcatg cgccgcagta cctcggcgtg gcggggatgg    112140
     ctggccgagt aataggtgaa agagcggtcg aagaaggcct tggcctgggc cgacatgccg    112200
     taccagtaca ccggcgtgca gagcaccacg gcgcgcgcgg gcaggaagtg gtcgaagaag    112260
     agttcgccgt agcggtcgtc ggggcgccgc gcatcggcct ctttctcgtc ggtcaagaag    112320
     cccgcgatgt agtcgtcgag aaacagcagc gtggcggcgg cgccggactg gcgcgcgccc    112380
     tcggccacgg cctgggcgag cagggcgctg ttgccgtcgc ggcgcggact gccgaccagc    112440
     accagcacgg ggttggggac ttgagatgaa tccattttca ttcctcgcta agcgtttggg    112500
     tggggtgagc gttggcgcat ggaaaattta cggcttgatt gcctggcttg gcgagtgacg    112560
     atgcctgcat taagatgaat tgaattcatc tctgtcgtga ccccgcatgt ttcatgatct    112620
     accgctgggc gcgctgcgcg ccttcgaggc cgcggcgcgc ctgctcagct tcaagggcgc    112680
     cgccgccgag ctgcatgtca cgcccaccgc cgtgtcgcac cagatccgcg cgctcgagca    112740
     gcggctgggc tttgcgctgt tcgagcgcct gccgcgcggg gtgctgctca ctcccaaggg    112800
     cgggcgcctg ttccagcggg tgcatggcat gctgctggat ctggcgcaga cgctggacgc    112860
     gctgcgtccg cggccgagca cgggcggcct gacggtgtcg accacgcatt cgtttgccgc    112920
     gctgtggctg gtgccgcggc tggggcgctt ctaccaggcg catcccggct acgaggtgcg    112980
     gctggacgcg accagccgcc tggtggatct gctgcaggac gccagcgtgg acgtggcgat    113040
     ccgctatggc ggcggcgacc gctcgggccg ccaccgcggc ctgcaggccg cggccgtgct    113100
     gcccgagcgc ttcgccgtct acggcgcgcc cgccgcggtg gccagcgcgg cgcggcggcg    113160
     gcccgcgctg atctcggtgc aatggcgcga ttccaccgtg tacgagaccg gctggcggca    113220
     atggtgcgag gcggccggcg tgagctggct ggcgcgcgcc gcgccgcgca gctatgaaga    113280
     ggaaaactac gccctgcagg ccgccatcgc cggccagggg ctggtgctgg ccagctcggc    113340
     catggtgtcc gacagcgagg cacgcggcct gctggcgtgc tttcgtcccg acatcagcgt    113400
     gcccgggctg cgctataccg cgctgtcggc gccgggccgc cagcggcacc caccggtgcg    113460
     cgccttcctg gactggctgg ccggcgagtt cgagaccgcg gcggcgcgcg ggcgcccggg    113520
     gctggcccca tgagcgcgcc ggccgatccg cgcctggcgc aattgcgccg catgcagcgt    113580
     tgggcgctgg cgctgctggc ggccatgatc gccggcttcg tcgccagcca cctgatgggc    113640
     ggacagggcg cctgggcctg ggtacgggcg ttctgcgagg ccgccacggt cggcgcgctg    113700
     gccgactggt ttgccgtggt ggcgctgttt cgccgcccgc tggggctgcc gattccccat    113760
     accgccatca tcccggccaa caaggcgcgt atcggcgaca accttgcggt gttcgtgcgc    113820
     gatcatttcc tcgatcccgc gacgctgctg gaaaagctgc gcgtgttcga tccggccgcg    113880
     cgcctgggcc attggctggc cgacccgcgc cagacccgca gcctgggcca gggcgcgcgc    113940
     caggtggcgc tgcaggcgct ggacctgctc gatgagcagg ctgtcagccg cgccatccag    114000
     ggcttcgccg tggcgcagtt gcgccgctgg gacgcggcgc gcacggccgg cgaagtgctg    114060
     gcgctcctga cccgcgacgg ccgccaccag gaattgctgg acgccgcgct gcgccggctg    114120
     ggcgactacc tcggcgaaga ggatatccgc cagcgcgcct gcgcgctgct ggtgaagttc    114180
     gcccgcaagg aatggccgcg catcatcgcc gcggtggatg tcatcggctc ggtggagggc    114240
     attgccgaca acctggccga tcgcatggcg cgcgccctgg tcgacgaact gcgcgatgtg    114300
     ctgtctcgcc cggatcatcc cgtgcggcgc aactacgagg cgtgggtggc cgactatatt    114360
     gcgcggctgc gcgacgaccc cgagctggcc ggccaggtcg aggccctgaa gcagcgcctg    114420
     atcgacgacc cgcgcgtaca ggagtacgcg ctggggctat ggcgcgacat ccatgcggta    114480
     ttgcggcgcg acctgcaggc cgaggattcg gcgctggcgc gtcacctgga ggatgccctg    114540
     caggcgctgg gccaacggct gtcgcgcgac cccgagctgc gccgggcggt caacgagcat    114600
     gtgctggaca gcgcgcgcaa gctgaccgac agcctgcgca gcggcgtgac cgagcatatc    114660
     tcgcgtaccg tcaagaactg ggacgagcgc cacctggtgc gcgaactcga actgagcgtg    114720
     ggccgtgacc tgcagtacat ccgcttcaac gggacgctgg tgggcgggtt gatcggcctg    114780
     gccctgcatg ccggcgtgct gctggtgcag cgggccggcg gctgagccgg cgcgacgcgg    114840
     gcgcgctcag gcggcggccg cgtaagccgg ccggcgctcc tggtaggcct ggcggatatg    114900
     gcgcgccatt tcctcgacgg cctgcgagcg ctcgccgggc gcgatgtaca gattgatggc    114960
     gtagtcgggc agggccggca ggccgctggc cgcgtcgagc acttgcaggt cggcgggggc    115020
     caccgacaac aggctggccg tgaccgccag gtccaggcgc acggtggtca acgtggcgtc    115080
     ggcattgccg ttctcgaata cgctgcgcca gggaatgcgt ccgccgtcca gcgcgtcggc    115140
     cagcaccggc cggaaggcgc aggcatcgct gaccagtgac accggcaacg ggttcttgcg    115200
     ccacgcctgg ccgcccgggg cggccagcca caccacgcgg tcgacggcca ggcgctcgcc    115260
     gcccgccgcc gcgccgatgg gctcctcggc cagcgtcaag tccagcttgc ggcgccgcac    115320
     ctgctccagc agttcgggcg aggtcgccga gatcagtgaa atgtccacgt cgggatagcg    115380
     cagcgaatag gcgcgcagca ggcccggcaa gtgcgtgccg atcaggtcgt gcggcacccc    115440
     cagccgcacc gcgccgacgc agccggcgcc ggtcatgtgc tgcatcagtt cgtcgttgat    115500
     gcgcaccatc tcgcgcgcgc ggcccagcag gcgcgcgccg tcgccggtca gcgccgcgcc    115560
     gctgcggcgc cgttccagca aggtgcggcc gaacagggcc tccagccgct gcaattgctg    115620
     gctgaccgcg ccctgggtca ggtgcagcag ggcggcggcg gcggtcaggc tgccggtatc    115680
     gtggacggcc aggaaggcgc gcagcagcgc ggtgtcgata ttgcggctca tgatttatta    115740
     ggattcgtaa tactggggat tataagaatt cgatatccta aattgatgcg tgtggctatc    115800
     gtacctctca tcgctttgtg gagatagcca tgcaaaccac gacatccctg attgcctcgg    115860
     tgcggcgcat cgccgccttt tccgacggcg cgcgcggcgg caacccggcc ggcgtccatg    115920
     tggccgaggt gctgcccgac gccatgacca tgcagcagat ggccgccgag atcggctatt    115980
     ccgaaaccgt gttcgccgcg ccggcctatg gcggctggcg ggtacgctat ttcgcgccgg    116040
     aagcggaagt gccattctgc ggccacgcca cgatcgcgct gggcgccgtg ctggccgagc    116100
     aggagggcga cggcgtgttc gccctgacga ccaaccatgc caacataacg gtcgaagggc    116160
     gccgccaggg cggcctctac agcgccgcgc tgcaatcgcc gcgcacgcgc agcgcaccct    116220
     tggaggcggc cgtgcgcgac gaggcgctgg ccctgttcgg ctacacgccc gccgacctcg    116280
     acagccggct gccgccagcc tacgccgagg ccggcgccgc ccacctgatc ctgccgctga    116340
     acagccgcga gcgcctggcg gcgatgcgct acgacctggc cgccggccgc gctttcatga    116400
     agcgcacggg cgtggtgacg atcgcctggg tccacgccga gtcggccacg ctgctgcacg    116460
     cgcgcaatgc gtttgcggcc ggcggcgtgt acgaggatcc ggcaaccggg gcggccgccg    116520
     ccgcgctggc cggacatctg cgcgacagcg gctggctgcg cgccggggcc atcgagatcc    116580
     tgcagggctt cgacatgggc gtgccggcgc ggctaagggc cgagtacggc cccgagccgg    116640
     gcagttcggt gcgggtggcc ggcacggcgc gtgcgctggc gcgccagccc gccctcatag    116700
     attgaccagc gtcttgaacc cgccgtaggc catgcgcttg aaatcgaaca cgccctcgac    116760
     gcactgttcc ttcaggcgcg ggtcggccat gaccgccgca ttgatgcggt cgcgctcggc    116820
     ccggttcggg tagacgatcc aggcgaacac cacggtttcg ccctcgcgcg ccgcggccga    116880
     ggtcttgaac gacaccatgc cttcgatgtc caggtcgtcg cccgtgcatt cgcaataggc    116940
     cagcgcgcca tgctctttcc agatcgcgcc ggccttggtg gccatctgcc ggtaggtgtc    117000
     cagcttgtcg ttgggcaccg acagcaggaa accgtctacg tactgatcca tggcattgct    117060
     cctgggtggc aggggccccg cggccccctg gttggaattg gcactgtagc gggaaagcag    117120
     ggggttgccg acgggggatt gcgacattgt tgcgggtgga tcgcgacagg ctggccgcag    117180
     tatgctgggc gctatgaaac gtctcgccct gctggtgccc gaacgggcca acatcgcatc    117240
     gctcgagaac gcccgccagg gcttcctggc ggccaacggc ttcttgcgcg agcgcggctg    117300
     cgcgccgcgc ttcgacgtgc gcctggtggc ggccacgccg caggtgcggc tggatcacgg    117360
     ccgcatcacc gtgcaggccg acaccgtgct ggaggcggtg ggcgaggtcg acctgtgcgt    117420
     cgtgccgccc atccagggcg atccgcagcc ggcgctgcag gaaaacggcg cattgatcga    117480
     ctggctggcc ggctactaca agaacggcgg cgaggtcgcc agcctgtgcg tgggcgccgc    117540
     gctgctggcc gccggcggcg tgctcgacgg acagcgcgcg gtggtgcact gggcggcgca    117600
     gagcgacttc ggccgcctgt ttccggcggt gcgctgggtc agcgaccggg tcgtgctgga    117660
     ggccaacggc atctacacca gcggcggcgc gttctcggcc gcgcacctgg tgctgcacct    117720
     ggtcgacaag tacaccgatc gcgagacggc gatctggtgc gccaagctgt tccagctgga    117780
     ctggagccgc cagagccaat tgccgttcgt ggtgttcgtg gggcagaaaa cgcatggcga    117840
     tggggtggtg cggcaagtgc aggagcacat cgaggccaac tacaccgagc gcctgaccgt    117900
     cgagcagttg gcgcagcgcg tggcgctggg gcggcgcacg ctggagcggc gctttcgcca    117960
     tgccaccggc aacagcatcg tcgagtacgt gcagcgcatc cgcatcgagg cggccaagaa    118020
     gcagctcgaa agctcgcgca aatcggtcgc cgaagtgatg tacgaggttg gctacaacga    118080
     caccaaggcc tttcgcgaca tcttcaacaa gtactgcggc atgtcgccgc tgatgtacaa    118140
     ggaaagatac ctatgacaca ggagcctgtc ccggcgggga caggctcctg ctgaatccta    118200
     tgccggggtg gctgtcccgg cggggacagg ctcctgctga atcctgtatg ccggggtgcc    118260
     tgtccccgtc gggacaggca cccttgccgc aggtttcgct gcccatgcgg ggacggcctc    118320
     ccggagggtc acttatggta cggcttgccc ttgcgggcgg tgccggccat gtgttcgagc    118380
     tcgcgctcgc tcatcgagtc gtacatgtcg cgcgaggcgc ccttgaggtc gctcaccctg    118440
     gattcgccgc gcttggccgc gagcgccgcg ccggcggcca tttgctgggc tttggatttg    118500
     gctggcatga tgtacctcct tccagaaatg tcgatacggg aacggtgatt tcagcgtagc    118560
     aactccgagc aaggggagct gctacgaggg gtagcagcgt gcaagatgca atgtcccgcg    118620
     tttccgggtc gtttcctcag gagttcccgc atgcagattt cccgccattt tccgcgcctg    118680
     gtccgccgcg ccgctctggc gctatgcctg gccggcgccg cccaggtcca tgcccaggag    118740
     gccgccgtgc aacgcaagag cgactatccc tttgccgcca ccgtggcgcg cctgcaggat    118800
     gccttgcgcg ccaagggaat gacgatcttc gcggtcatcg accaccaggc cgccgcgaag    118860
     caggcggggc tggacatgcc gccgacccag gtggtggtgt acggcaatcc caaggccggc    118920
     acgccgctca tgctggccgc gcccgatttc gcgctggagc tgcccttgaa agtgctggtg    118980
     cgcgagaccg cgtcgggcga ggtgctggtg gtctaccatc cggccggcac gcgcgagggc    119040
     atgctgggcc tgcccgccgg gatggcgcag caactggccg gcgccgagcg catcgtcgac    119100
     gccgcggtgc ggcgcgcgcc ggccgactga gccgggcgcg ttacgccggg cgcggcagcg    119160
     cgcccacgaa tccggccagc gcgcgcgtca ccagctcggg ctggtccttg tgcggcgagt    119220
     ggccgcagtc ctggatttcc agcaggcggg tctgcggcgc caggcggcgg atgccgcgga    119280
     tctgctccag cgtgccgtat tcgtcgtcca cgccctgcat ggccagcacc gggcaggtga    119340
     tggccggcag gtaggcctcg atgttccatt gccggaaggc cgggtccagc caggtgtcgg    119400
     tccacgatgc gaaggtcgaa tcgacatcgt cgtggtagcg ggccaggcgg tcgcgcagcg    119460
     tggtttcgcg gtaggcgcgc agcgccaccg cgatgttggc gacggtaatg tcctcgacgt    119520
     agatatgcgg cgcggctacc gcgattccgg ccacggcgtc cgggcacaag gcggcataga    119580
     gcagcgcgat gctggcgccg tcgctgtggc cgaacaggac cggcttgtcg cgccgcgcat    119640
     cgatgcccag cgccgcgaac agcgcgggca gagcttgcgc ggcctgctgg tgcaggtagt    119700
     cgatgggccg gctctcatcc agcggacgga cggtcgagcg gccgtagccg tagcgcgaat    119760
     agaccagccc gcggcatccg gccgcatcgc agacgcgccg cggccagtcg cgccacatgg    119820
     ccagcgaccc cagcccttcg tgcaggaata ccagcagggg cgcatcgcgc cgctcaggcg    119880
     cgagcagcgc atactcgatg cgcatgggac ggtcggcgta atgcacgtcg gcgtattgcg    119940
     cgggcacggc ggcggaagag cgggcgggcg gcgtcatggc agggttttcc ggtgctgagg    120000
     cttgcgctcc attgtgccag tgccgccgcg gttacaaaaa atataaccat ttggttgaat    120060
     aagacggcgg tcttctctaa tataaccaaa tggttgaata tcaagctccc gccctggacc    120120
     gcgtctttca cgccctgtcc gaccccacgc gccgcgcgat gctgcgccgc ctggccgacg    120180
     gggaacacaa tatccgcgcg ctggccgcgc cgttcgccat gtcgttcacg gctgcctcca    120240
     agcacctgaa ggtgctggaa agcgccgggc tggtcagccg ccgcgtgcag gggcgctcgc    120300
     acctgtgccg catcgatgcc gcgccgctgg ccgccatcga cgagtggctg aagttctacg    120360
     agcgcttctg gcataccagg ctggacatgc tggagacctt gctgcgcgcc gacgcggcat    120420
     cgtccgttcc ctcccacccc gaccaggacc cgactccatg acctccccat cttctgcctc    120480
     ccccgatggc cacggcgcgc gcctggacgc gcaaagcatt cgcttcgagc ggctgctgcc    120540
     cgggcccatc gaacgcgtct gggcctggct ggccgacgcc gacaagcgcg cgcgctggct    120600
     ggccggcggc gaattgccgc ggcagcccgg gcagaccttc gagctgcatt tcaatcacgc    120660
     cgcgctgacg gccgagaccg cgccggcgcg ctacgcgcaa tacgaccggc ccatcgtcgc    120720
     gcgccacacg ctgctgcgtt gcgagccgcc gcgcgtgctg gcgctgacgt ggggcggcgg    120780
     cgccggcgag gcgccgtccg aggtgttgtt cgagctgagc gaggccggcg agcaggtgcg    120840
     cctggtgctg acccacaccc ggctggccga ccgcgccgcg atgctggatg tggcgggcgg    120900
     ctggcatgcg cacctggcgg tgctggccgg caagctggcc ggacaggcgc cgccgccgtt    120960
     ctggaccacg ctggcgcagg ccgagcagga ctacgagcag cgcctgtagc ggccggcgcg    121020
     ccgttcaggc cgtggccggg gcggctggcg cgcggcagga cagcaccgcg tcctcgaagc    121080
     ggtcgaatac attgtcggcg ccggccaggc ccaccaggcc ggcccgatgc agcttggcct    121140
     tgacccgcgg gttggcgccg ctgaggatga cccgcacgcc gcggcgctgc aggtcggtga    121200
     tcacctcttc gagcgcctgc aggccggtga tgtcgatgaa cggcacccag cgcaggcgga    121260
     tgatgagcgt gcgcggatcg gtgtgcgtgg ccgccagggc gcgctcgaag ttctcggcgg    121320
     cgccgaagaa cagcggccct tcgaccgcgt agaccagcac gtcgtccggc agcggcccgt    121380
     agccgcggtg gcccagctcg tcgcccagct cggccgggct ctgcgcctgc acttgcacgc    121440
     tggacgccat gcgccgcagg aagtgcagga tggcgatcac cacgccgatg ttgaccgcca    121500
     ccaccaggtc ggcgaacacg gtcagcacga aggtgaccag caggatggcg acgtcggcgc    121560
     gcggcgcgcg cttgatcatc ctgacgaagt gaggcgcgtc gctcatgttc caggccacca    121620
     cgaacaggat ggcggccagc gcggccagcg gcacgttttc ggccagcggc gccagcagca    121680
     gcaccatcag cagcagggtg atgcaatgca cgaccccggc cagcgggctg gtgccgccgt    121740
     tgcggatgtt ggtggccgtg cgcgcgatgg cgccggtggc ggcaaaaccg ccgaacagcg    121800
     gcgcgacgat attggccagg ccctggccga ccagttcctg gttggaatcg tggcgggtgc    121860
     cggccatgcc gtcggccacc acggccgaca gcagggattc gatggcgccc agcatggcaa    121920
     tggcgaaagc cgggccgatc aattcgatga cgcgcgacac ggtgatctcg ggccactgcc    121980
     agctgggcag gccctgcgga atgccgccga aagcgctgcc tatggtggcc acgccgtcca    122040
     ggcccagtac ggcctgcagc gtggtggcca ccacgagcgc caccagcggg ccgggcacgc    122100
     ggcgcaggta gggcaagcga ttgttggcca gcagcagcgc cagcgacagc gcggccagcg    122160
     cggtggtggc caggtgcagc tgcggcaggc tgtgcacgag ctgccacagt ttttcatgga    122220
     agtgcgtgcc ggccggggag ggcaggccga agaagtcctt ccactggcct acccagatga    122280
     tgacgccgat cccggcggtg aagcccacga tgaccggcgc ggggatgtac ttgatgatgg    122340
     cccccagccg ggccgcgccc agcgccagca ggatgcagcc ggccatcagg gtggccagct    122400
     gcaggcccgc cacgccatgc tgggcggtga tgccggccag gatgacgatg aaggcgccgg    122460
     tggggccggc aatctgtacg cggctgccgc cgcacagcga gaccagcagg cccgccacga    122520
     tggcggtata caggccttgt tcgggcttgg cgccgctggc gatggcaaag gccatggcca    122580
     gcggcagcgc cacgaccccc acgatcaggc cggagacaat attgggcagc caatgggcgc    122640
     gtcgcagcag gccggcgcgc ttggcttcga gcagggcgat cacacgaagg tccaggcagg    122700
     caacagaatg cggcatagta gcctttcgcg cgcgcttggg ccatgatccg gcgcaaatgg    122760
     ccgctcaact gagcagggcg gccaccagat cgcggttggg cgcgggcgcg ccgtcgaagt    122820
     ccagcgcggt ctgcagatgc agcaggtgtt cgtccatcag ggcgcaggcg cgctcggcgt    122880
     cgccctcgcg cgcggccgcc aggaaggcgt agtgttcctg cgacgagcaa ctggcgtcgt    122940
     gggcgctctg gtacatcacc gtgatgacgg cggtgcgcgc cagcagttcg tgcagcatgg    123000
     cggtgagcac cgagttgccg acgatctcgg ccagctgcag gtgaaagccg gccagcagct    123060
     gattgcgccg ctgcacgtcg ccctcgtgga tggcttcgcg ttcctggtgc agatgctgtt    123120
     cgagccgttc gtagtcctgc ggtgcggcgc aggcgacgaa ctcgcgcgcc agcgcggcct    123180
     ccaggatgcg ccgcacggca tagacctcgc gcgcttcgtg ggcgtccggc ttgctgacga    123240
     aggcgccctt gtcgggcacg atctggatca gcttgtcctt ggacagcatc agcaaggccg    123300
     cccggatctt ggtgcggctg accttgtaca cgctggccag cgcttcctcg cgcaggcgcg    123360
     tgcccggcgg caggcggtgc gacacgatgg ccgtggcgat cgcctgggag atgccctcgg    123420
     cgctgaggtc ggtggagctg cgcatcgtcg ttgctcctca catgcgcggc gcgcgaggcg    123480
     tttgcgcatc aggaatgggc ctggacaccc ggggcccggg ggctcgcgct cggcgagcgg    123540
     cccgcgccgc caggaaagcc gccatcgccc ggccccccgc ccggcatggg ccgggcgggg    123600
     ggccgaagga cgaaggatgt tgctattaaa cgtgatagcc caaaatttgt gtacaaattt    123660
     gatcgtgcgc cggcccggag tgtggcgcgc ccgctaattc cacaggtagc cgtggctggc    123720
     atcgaaagcg gcgtagccgt cggcgcagcg gtacagccgg tagcggccgg ccgcaccttc    123780
     ctggtgcaag gaagccggcc agcccggcaa ggccagggcc ggcggcggca gccggccgct    123840
     ggccggcgcg cagccgggcg gctcgatgcg ggcgccgtcg ggcagcacga agcgggccgc    123900
     gcggcggttg gtgtcgaggt cgtgcgcctc ggcgatggcg ccggtgcgcg cgggcagcca    123960
     tgccggcagc cagccgcgct gtatcgcgcc ggccgcgcgc gcctcgtcga ggtcgcggta    124020
     ttgcgtttgc acggcatcgg agcaggcggc aagcagcagg ggcaggatca ggggcagggc    124080
     gtacgcccgg gcaggcagcg aggtcggcat ggcaggcagc ggggaagtgg cgtgacgggc    124140
     acgagtgtgc aacaggcccg caccgccatc cagcggccat tctcaatggt tgtcggtgga    124200
     aatatccctg cctgcgcggc gcgccgatac cgcggctcaa tcggcgcgat tgaaaagcat    124260
     gccttgggac cggccgcggg ggtctggcaa tatacccata ccttcgtcac gggccatcgc    124320
     catgaatcaa ccctcgtcgc ttgccgccga cctgcgcggc gcctggcacg cgcaggcgca    124380
     gtcgcatcct ctgatcaccc tcggattggc cgcctcggcc gccggcgtgg tcttgctgct    124440
     ggtggcgggc atcgtcaacg cgctgaccgg cgagaaccgc gtccacgtgg gctacgcggt    124500
     gctgggcggc gcggcgggct tcgccgccac ggcgctgggc gcgctgatgg ccctggggct    124560
     gcgcgcgatc tcggcccgca cgcaggacgc gatgctgggt tttgccgccg gcatgatgct    124620
     ggcggccagc gcgttctcgc tgatcctgcc cggcctggac gcggccggga ccatcgtggg    124680
     cccggggccg gccgccgcgg cggtagtggc gctgggcctg gggctgggcg tgctgctgat    124740
     gctgggcctg gactacttca cgccgcacga gcacgaacgc accggccacc aggggcccga    124800
     ggcggcgcgc gtcaatcgcg tctggctgtt cgtgctgacc atcatcctgc acaacctgcc    124860
     cgagggcatg gccatcggcg tcagcttcgc caccggcgac ctgcgcatcg gcctgccgct    124920
     gacctccgcc attgccatcc aggacgtccc cgaagggctg gcggtcgcgc tggcgctgcg    124980
     cgcggtcggc ctgcccatcg ggcgcgccgt gctggtggcg gtggcgtcgg ggctgatgga    125040
     gccgctgggc gcgctggtgg gcgtgggcat ttccagcggc tttgcgctgg cgtatccgat    125100
     cagcatgggc ctggccgccg gggcgatgat cttcgtggtc tcgcacgaag tgattcccga    125160
     gacgcatcgc aacgggcatg agaccaccgc cacggtgggc ctgatggccg gtttcgcgct    125220
     gatgatgttc ctggataccg cgctgggctg aagccgcggg gcgtcagccg cgcccggcca    125280
     ggcaggccga cagggcgcgc tggtacgaat cgaccgagac gccggtggtc caggccgagg    125340
     gcgtggccgg atcgtagccg ctctgattca tggcttcgcg ccggcaggcc gcctcgccgg    125400
     ccggctggcg ggtggcggtg cgtgcgatgc cggcgccttg cggggccacc gggtagccgg    125460
     ccaccgtgcc atcatcgtag gcgggctggc catggccggc cggcgcgtaa ccggcgtctt    125520
     cgtaggccgt gggcgggtcg tagctgggcg ggtcgtacac cgtgctgtcg taggggctgg    125580
     ccgcgtaacc gccgggggtg gtgtaggtga tgccgccggc gctgtactgc gcggctggcg    125640
     cgtagctggg ctgcgaactg acggccaggt aggtgccggc cgccaccagc gccagcgcgc    125700
     cggcgatcca ccagccatcg gatgaactgc cgtgcgagtg gccgtagccg ccgtagtacc    125760
     catggtggcc gtggtggccg ccgccggcca ccgcctggcc gcaggccgcc gccatcatca    125820
     gcgcgacgcc ggccaactgt aaacgtctgg acttcatgtc ttgctcccga accgcccggt    125880
     gggcgcgcaa cggcgcgcgc aggaacggca ttgatactgt aacggctggc gcgcgggcgg    125940
     tgcgcacgaa agtggtgtcc agacgttagg ccggtttcag ccggtcacag cagcgatacg    126000
     ccggcttcgg ggccgccgcc ggcggtatcg ggctcggact gcggttcggg ggcgcgcacg    126060
     gccggccgtt cgccgatctg ctggcgccac atggcgtaat acaggccctt gccggccagc    126120
     agttcggcgt ggctgccttg ctccaccacg cggcctttct ccaggacgaa gatggtgtcg    126180
     gcgtgcatga tggtggacag ccggtgggcg atcaggatgg tgatctggcc ggcgcgccgg    126240
     gacacgtcgc gtatcgtctg ggtgatctgc tcttcggtca gcgagtccag cgccgaggtg    126300
     gcttcgtcga agatcagcag ccggggctgg cgcaccagcg cgcgggcgat ggacaggcgc    126360
     tgccgttccc cgcccgacag tttgacgccg ccttcgccga tggtcgtgtc cagtccggcg    126420
     ggcgagcgcg ccagcacgtt ggcgcaggac gcctggcgca tggcggcgac gatttcctcg    126480
     tcggtgacat cgggcttgac cagctgcatg ttctcgcgca gcgtgccgga gaaaagatgg    126540
     gtttcctgcg tgacgaagcc gatctggcgc cgggtcggat tgaagcgcag gtcgcgcgtc    126600
     gagacgtcgt tgtaatagac ctcgccgtgg tcgggcgcat acaggcccac cagcagcttg    126660
     accagggtgg atttgcccga gcccgacggc cccacgaagg ccacggtgtc gcccaggcgc    126720
     gcctcgaacg acacgccgtc cagcgcgttc tcggtggcgc cctggtggcg gaaccgcacc    126780
     tcgccgaagc gcacgcgctg gatcggtccg ctgtcctgcg ccgattcggg attgcgttcg    126840
     accggccggg ccatcagggc ggcgtagtgg ttcagcgagg cgtcggcctc gcggtacgcg    126900
     aggatgaggt tgcccagttc ctgcaagggc gcgaagatcg cgaccgagat gaactgcatg    126960
     gcgatcagtt ccccggtgct cagcacgtcg cgcaagatca gccacaggag ggcgaacagc    127020
     accgacagct tgagcacgct gagtatcatg ccctgcagga acgacagcag gcggatgcgt    127080
     ttgaccttct gcatttcgag cgcgaagatc tgctgggtct gcgcctgcag gcggcggatc    127140
     tcggggtagg tcaggcccag gctcttgatc agttcgatgt tgcgcagcga ctcggtgatg    127200
     aagcccgagt tgcggttggt ttcgcgcatg atggagcgtt gctggctgcg gatctggcgg    127260
     ctgagcagcc cggtcagccc gcccagcagc agcacgccga cgaagaacac cggtaccagc    127320
     agccagtggc gcgtgaccga gtaccagcac aggaaggcca cgccgacgcc ggcggcgaac    127380
     gccgtgttga tgaaggcatt gatgaagcgt tcgctgtcgc tgcgcacttt ctgcagcagc    127440
     gacagcgttt cgccgctgcg cagctcctcg aattcctgga agcgcagccg catgacctgg    127500
     cgcaggccat cattgaagat ctgcgtgccc agtttctgca ccaccaggcg cgtgacgtat    127560
     tcctgcaatg ccttggccag ccgcgacagt atcgccacgg ccagcgccag cgccagcagg    127620
     cccagcacgc cggcgagcaa ctggtcgccg gtcttgccgg cgcggccgat ggcgtattcg    127680
     tcgatgatgc ggccgaagat gatggggtcg atcagcgcca gcacctggct ggcggcggcc    127740
     agcagcaagg ccagcagcgc caggccgcca tggggccgca ggtaggtcca gagcatgcgc    127800
     attgtcgggg tctcgcgggc gaaagcgggc ccccagtatc ccggcaagcg gggcgcggcg    127860
     caacggcggg cgcgcggcgg cgcggctagc ggcgcgccgc cgcgatctcg cgccgcatgg    127920
     cgcagcggcg cgccgccggc aggcccaggc tggcctcgcg cgccaggatg gcctgcaggc    127980
     gcacgttgag gccgtccgct tgcagcgtgg cgaaacccag gcgcgcgtag aagggctggt    128040
     tccagggcag gtcgcggaag gtggtcagcg tgatggcggg caggccggcc gccgccgcgg    128100
     catcgatggc ggcccgcacc agccgcccgc cgatgccgcg gccctgcatt tcgcgccgca    128160
     ccgccagctc ccagacatgc agcgcatcgg cggtgcgctc cgcgaccagg aagcccgcca    128220
     atccggcgcc ggggcattcg gccacccagc tggtgccggc cgcgatccag gcccggtggt    128280
     cctgctcgct catgacttcg tcggcggcga tccaggccag ccccggggcg tccaggaagc    128340
     gctgcccggc gctgcgttcg atggccggca gcagggcggc gtcgggcgcc tgggcgcggc    128400
     gcacggcgac ggagggcgtg gcgggggcgg atggcatggg gcgcagtgta aacccggcta    128460
     tcatggcggt tttccagatc cggattgcgc catgcgcctg ttgcttgcca tcttcctgcc    128520
     gttcacggtg ttcttcacca tcggccgccc catcgccggc atcatctgcc tgctgctgca    128580
     aatcaccctg atcggctgga ttccggccgc gctgtgggcg gtctacgcat tgagccagtt    128640
     ccataccgac cgcaagatcc gcgacgccgt gggcggccgc ggctagcgcc gccaggcgcc    128700
     ggcgctatgc cgcgcggccg tcgtactgat gcacggcgac cgcgtccagg tccacgtcgt    128760
     ccaggcagcg gatattgatc gccgccatcg cccggccttg ctggtcgacg ccttcgccat    128820
     gggtgtggat gccgcacgtg ggacagaagc ggtgcttgat caggtggcgg ttgaaggtat    128880
     aggtggcgat ctgttcgtcg ggcgtggcca gccgcaggtg gtcgcgcggc acgaaccaca    128940
     gcagcgcgcc cttgcgccgg catatcgagc aattgcagga catggcgcct gtcagttcgc    129000
     cttccacgtc gaatcggatg gtgccgcaat ggcaactgcc gtgatagtgc atggtgcggg    129060
     gctcctgtgc gggtaaggga tcaatgcgcg tcggcggccg gggcgctcgc gccgggctgc    129120
     gggcggcgca gcagcacgcc ggccagcagc gcggccaggg cggcgaacac ggcgcccacc    129180
     gcgaaggcag cgtgatagcc gccgttgagc gccgtcagca cgtcggcgcc gccggcgcgc    129240
     aggctggcgc tgcggcccgc cgccaggctg gccagcaccg ccaggcccag ggcgccgccc    129300
     atcatgaacg aagtgttgac cacgccggat gccaggcccg cttcgctggg gtccacatcg    129360
     ctcatggcgg ccagcagcac ggggttgaac gcgatgcccg cgcccaggcc cagcagcagc    129420
     atgcccggca gcacgtcgac ggcgaacgag cccgcgaccg gcgcgcgcgc gaacagcgcc    129480
     agccccagcg ccgccaccag caggccgcac accagcggcg cgcggatgcc gaagcgcatc    129540
     accagcctgg ccgacagccc cagcgagaac gccgccatga tgatattggc cggcaggaag    129600
     cccagcccca cctgcatggc cgtgtagccc agcaccagct gcatgtagag cgccgagatg    129660
     aagaaccagg cgaacatggc cgcggcccac agcacgccga cgatgttggc ggtggcgacg    129720
     ttgcgcagcg cgaacagcga cagcggcatc aacggcgccg gcacgcgcgc ctcgatgcgc    129780
     aggaacagcg ccagcagcgc gaccgccagc gccagcagcc cgagcgattg gggcgaggtc    129840
     cagccggcct cgttgccgtt gaccaccgcg tagacggcca gcatcagcga ggcggtgatg    129900
     gctgccgcgc cggccaggtc cagccgtgga tggccggtcg ggccctggct ggccggcagc    129960
     agcggcaggc acagcgcgta gaccagcgcc ccgatgggca ggttgaccag gaagatccag    130020
     tgccagctca gcgagctggt cagcaggccg cccagcaaca cgccgatgct gccgccgccg    130080
     gcgcagacga aaccgtagac gcccatggcg cgggcgcgct cggccggctc ggtgaacagc    130140
     gtcatgatca gcgacagggc cacggccgag acgaccgcgc cgcccaggcc ctgcaccgcg    130200
     cgcgcggcca ccagcatggc ctgcccctgg gccatcccgc aggccagcga ggccagcgtg    130260
     aacagcgtca ggccggcgag gaacatgcgg cgctggccca gcaggtcgcc cagccgtccg    130320
     cccagcagca ggaagccgcc gaaggtcagc atataggcgt tgaccaccca caccagcgac    130380
     gcttcggtaa agcccaggtc ggccttgatg gacggcaggg cgacgttgac gatggtcgtg    130440
     tccagcacga tcatcagcac gcccaggcac agcaccatga gggccagcca gcgcttgcgt    130500
     tcgtcgagag tgtggggcat ggatgcgatt cctggaggtc agctgttcat ctggccgccg    130560
     ctgatcatcc acgccgtgcc gtggcggtcg accagcacgc cgaagatttc ggcccagaag    130620
     gttttctgca gcggcatggt gacctggccg ccctcggcca gcgcgttgaa gatgcgctgc    130680
     gcgtcggaga cggtcgggta gacgagcgac agcgaaaagc ctttcttgcc ttcgtacggg    130740
     cattggctgt tgctgtcgga ggccatcagc agctggtcat cgaggcgcag gcgcgcgtgc    130800
     atgatcagat cgcggtcctg cggctcgcag ggcatctcgg gcgggctttc gccgtaggtg    130860
     atcaaggcgt ccagcttgcc gcccaggatg cgctcgtaca ggcgcatggc ctcggcgcaa    130920
     tcgccgtcga acatgagata cgcggaaatt tgcggcatgg tgtcatcctc cggaaggtgg    130980
     ccacgtctcg tggggcgggc cttttgaagt gctaatttaa tacaggttag tcctaaattg    131040
     ctagtaattt caggacggca agcggcgccg cggcgcacgt ggcggggcga tcgtgtcatc    131100
     ataggcccat ggccgagatt ccattatttc cattgagcaa cgccttgttt cctgcgggcg    131160
     tgctgcgcct gcgggtgttc gagatccgtt atctcgacat ggtcaggcgc tgcatcgccg    131220
     acggctccga gttcggcgtc gtggtgctgg agcagggcac cgaagtgcgc cgccccgatg    131280
     gccgcgaggt gctggcgcgc gccggcacca tggcgcgcat cgaccattgg gaagcgccca    131340
     tgccggcgct gctggaactg gcctgcaccg gtaccgggcg attccggctg cacgcttgta    131400
     cccagggcaa gtacggcctg tggaccggcc aggccgagcc ggtgcccgac gatgcgccgc    131460
     tggaagtgcc gccggaactg gcgcgcagcg cctcggcgct ggggcgcctg atcgcccgcc    131520
     tgcagcgcga gggcgtgccg cctcacatca tgcccatggc cgcgccgttc cggctcgacg    131580
     actgcggctg ggtggccgac cgctgggccg agatgctgtc gctgccgccg gccgacaagg    131640
     cgcgtctgct attgttgccg ccgctggaca ggctgcgcga gatcgacgcg gtgctggccg    131700
     ccgacgggca cgcctgagcc aggcccaaca tgacgggaac catgaccatc cggatcgacg    131760
     aagaactgcg ggcctacatc gacccgctga cgcctgacga atacgcggcg ctggagcaaa    131820
     gcctgctggc cgagggctgc cgcgacgcgc tggtgctgtg gggcgacctg ctggtcgacg    131880
     gccacaaccg ccacgccatt tgcagcaagc acggtatcgc tttcaatacg gtgcagaaca    131940
     cgcgcctgca gtccatggac gatgtacggc tatggatgat agacaaccac ctggggcggc    132000
     gcagtgtgtc ggacttccag cgcggggtgc tggccctgcg caagaaggag atcctggaaa    132060
     gccggcgcca ggccggcgaa ggggacgccg cgccggccgg cggcgacggg cctgcgccgc    132120
     tgacgcgcca gacgctggcg cgccaggcgc gcctgagcag cgcgaccctg ggccagatcg    132180
     agaaaatccg ccagcaggcc gcgcccgaac tggtgcgcgc ggtgcaaagc ggcgagattt    132240
     ccatcaatgc cgccgcggcg gtggcgacct tgccggcgcc gcagcaggcg gccgcggccg    132300
     cgggcgggcg cggcgagctg cgcgccgccg cgcgccaggt gcgcgaggcg cgcctgccgg    132360
     tacgccgggc gcccgaagcc gaaccggcgc ccgcggccga gccgcgcgtg gtggacgact    132420
     atcccgccga ggtggcgcgg ctggaccgcc tggtggcgca actggccgaa gagcgcgacg    132480
     ccctgaagaa gaaagtggtt cagctgaccg tggcgctggc cgaggcgcgc gccaagccgg    132540
     gcgactgagc gtcggccggg gccgtgccgc gcaagcgcgc cgcgtcgcgc agcggcggcg    132600
     cgccgtacag gcggctgtat tcgcggctga attgcgacgc gctttcgtag ccgacccggt    132660
     gggcggccgc gccggcgtcc agggtttcgg ccaccatcag ccggcgcgcc tcgtgcaggc    132720
     gcagctgctt ctggtattgc agcgggctga gcgcggtgac ggccttgaaa tggtgatgca    132780
     gcgacgacac gctcatgttg acggtcgtgg ccaggtgttc cacgcgcagc ggctgcgcgt    132840
     agtgccggcg cagccagtcg atggcgcgcg cgatctgcag cgccgtgccc tcggcgcgcg    132900
     cgatgtggcg cagccgcccg cccatcggac cggacagcag gcggtagtgg atttcgcgct    132960
     cgatcaacgg ggccagcacc gggatgtcgg ccggcgtgtc gagcaggcgc gccaggcgca    133020
     gcacggcgtc gagcaagggc tcggtcaggc gcgcgagcgt caggccgcgg cgcagcggct    133080
     ggccggccgg cggggcgccc agctcgctga tcaggccggc gatgcggtgc ggatccaggt    133140
     cgagcgcaaa gcacaggtag ggcgtgcccg gggtggccag cgtgacgcgc gaggccaccg    133200
     gcaggtcgaa cgaggtcagc aggtagtgcg aggtgtcgta ttcgtagacg tcgtcgccca    133260
     gctgcacgcg cttggcgccc tgcgccagca gcgccagcga cggccggtag aagctgacgt    133320
     tcagttcggt cgggctggac gaacggtaga agttcaggcc cggcagggcg gtcgcggtgc    133380
     tgccgtcggc cggcgtatgc cgttcgatca ggctggccag ttcgtcgtgg cgcggcggcg    133440
     ggctggcgga tggggagtcg ggcagggcgc tcatcggtgg ggggcgggct ggactggcat    133500
     gcctatagcg tagcgcacag gcccgcctgg atcacgccgg cgccgccggg ctggcgggcc    133560
     ttgccggcgg ccacgctggc ggcgggcggc agcggcgcgc cgttcttgcc ggcgacgatc    133620
     tcggccatga tggacagggc gatctccggc ggcgtgcggc tgccgatgta gatgccggcc    133680
     gggccgcgca ggcgcgccag ttgcgccggc gtcagcccga aatgttcgcg caggcgcgcc    133740
     acgcgccgcg catggttggc gcgcgagccc agcgcgccga cgtagaaggc cggcgtctgc    133800
     agggcgtcga tcagcgccag gtcgtccagc ttggggtcat gggtcagcgc gatgacggcg    133860
     gtgcgcgcgt cgggccgcgc ggcgatcacc atgtcgtcgg gcatcgccgt ggtcagcgcc    133920
     acgccctcga cctgccatcc ggcgcggtac tcctggcgcg gatcgctgac cgtgacgtcg    133980
     aagtccagcg cgatcgccat ttcgcacagg tagcgcgaca gctggccggc gccgacgacc    134040
     agcagccggt ggcgcggccc gagcacgctg gcaaagcccg cgccgtccag gcgcggctcg    134100
     gcgtcggcgg cggcaggctc cagcgtgacc gcgccgtcgg ccaggcgcac gctgcgccgc    134160
     acggtctggt gcgcgcgcag tcgggccagc aggtccgcga gccggctgtg cgcgcccagc    134220
     ggctcgagca ccagctgcag cgtgcccccg cagggcagcc cgaagcggcg cgcctgctcg    134280
     ccgtccacgc cgtaggtggc cagcgccggg cgggcgccgg ggcacagcgc ggcgatgccg    134340
     cgctggcgga tctggtcgat caggtcgtcc tcgatgcagc cgcccgacac cgagccggcc    134400
     accgcgccat cggcgcggat ggccatcatg gcaccgggcg ggcgcggcga tgagccccag    134460
     gtgcgcgcca cggtcagcag cacggcggcc tggccggcgt ccagccagga ctgggcggtc    134520
     tgcagcacgt acaggtcggc ggcttgcatg gcgatgctcc tcatgccttg acggtggtgc    134580
     ccagcggcag cgtgcgcagg cgctggccgg tggcctgggc gatggcgttg gccagggccg    134640
     gcgccagcgg cggcacgccc ggctcgccca cgccggtggg cggctgcgtg gacggcgcga    134700
     tatgcacttc gacggccggc atttcggcca ggcgcagcac cgggtagtcg tggaagttgc    134760
     tctgctcgac cgcgccgtcc ttcagcgtga tggcgccgtg cagggcggtg gacagggcaa    134820
     agccgatgcc gccttccatc tgcgcgcgca ccacgtccgg attgacggcc aggccgcaat    134880
     gcacggcgca tacgacccgg tccaccttga gcgcgccgtc ggcggcaatg gtcacttcga    134940
     ccacctgcgc caccaccgag cgaaacgatt catgcaccgc cacgccgcgg ccgcggcgcg    135000
     tgcctggcgc gccggccgcc agcggttcgc gccagccggc gcgggcggcc gccagttgca    135060
     gcacttcgcg gtggcgcggg tgcgcggcca gcagggccag gcgataggcc accgggtcct    135120
     ggccggccgc cacggcggcc tcgtcgatca gggtttcggc ggagaacgcc gtatgcgtgt    135180
     gccccaccga gcggtaccac aggaccggca cgggcacatc ggtgggcgta tgcagctcca    135240
     cctgcaggtt gggcaccgcg taggcgaggt cggacaggcc ctcgaccgag accgggtcga    135300
     cgccgtcgcg cacccagtcc gccagcggcg tgcccagcag gatcgattgg ccggccatgc    135360
     gcacgtgcac cgcctgcagc gcgccgtcgg cgccgagcgc cagccgcgcg cggtgcaggt    135420
     tgagcggccg gtagtagccg gcgcgcatgt cgtcctcgcg catccacacc agcttgaccg    135480
     gcgcgttcag gccctgggcg cgcgcggtgc gcgcgatggc gaccgcctcc agcaggtagt    135540
     cggcatgcga gctggcgcgg cggccgaagc tgccgccggc gtacagctgg gtcaaggtga    135600
     tgcgctcggc cggcatgccg agatactgcg cgatggcgcg ctggtcggcc gtctggaact    135660
     gctcgccgtt ccagatctcg cagcgttcgt cgtccagccg caccaggcag ttcagcggct    135720
     ccatggccgc atgcgcaaga tacggatacg tgtattcggc ctcgatgacc ttggccgcgc    135780
     ccgcgaaggc ggcgtcgatg tcgcccttgc gcgccgccat gctgccgggc cggccgacgg    135840
     cctcgcggta ccgggccagg atgtcggcgc tgccctggcg gtaggccggg ccctcgtccc    135900
     actcgatccg cagcgcatcg cgcccggccc gcgcggccca ggtattggtg gccagcacgg    135960
     ccacgccggc gtggcgcagc gcagcgccgc cgaagcggac cacggcgcgc acgccgggca    136020
     ccgcccgggc ggcggcgtca tcgacgcgcg ccaccgccgc gcccaggcgc ggcgcatgcg    136080
     ccaccaccgc caccagcatg ccgggcagct tcatgtcctg cgtgtagagg gcgctgccgt    136140
     cgctcttggc ggcgctgtcg acgcgcggca ggcgatgctt gccgatcagc cggaagcggg    136200
     ccgggtcctt gagcggcacg tcctcgggca cgggcgagcg cgcggcggcc tcggccagct    136260
     cgccgaagcc ggcgcggcgt cccgaggccg ggtggctgag cacgccctcg gccacctcga    136320
     tcgtgtcggc cggcacttgc cagcgctgcg cggcggcttg caccagcatg gcgcgcgcgg    136380
     tggcgccggc gcgccgcatg ggttcccacg agtcgaacat ggcggtgctg ccgccggtgc    136440
     cctgcaggcc gcccagcgcc tggttgccgt agcgcgcgct gtcggccggg gcaccctcga    136500
     cgcgcacctg gcgccaatcg gcgtcgagct cctcggccag cagcgtggcc aggccggtat    136560
     aggccccctg gcccatctcc aggtgcttgg ccaggacggt gatccggccg tcggcgccga    136620
     tgcgcacgaa ggcgttggcg gcgaaaccgt cgcccgcctg cgggccggcg gccatggcgc    136680
     ggcgggccag cggcggcagc gacaggccca gcagcaggcc gccggcgcct tgcacgaaac    136740
     ggcgccggct caggttctgg atggcgatgc gcatgatgct tgctccctca ggccagggcc    136800
     gcggcggcgg cgtggatggc ggcgcggatg cgcacgtacg tggcgcaacg gcagatattg    136860
     ccgttcatgg cgtcgtcgat gtcgcggtcg gtgggggcgg gattggcgcg cagcagggcg    136920
     gcggcggaca tgatctggcc cgactggcag tagccgcact gggccacatc cagttcgcgc    136980
     caggcctgct gcacggcctg gccggcgcgg tcggcggcca cgccttcgat ggtgacgatg    137040
     cggcggccgg cgaccgcctg cacgggcgtg atacaggcgc ggatgggctg gccgtcggcg    137100
     tgcacggtgc aggcgccgca tagcgccatg ccgcaaccgt acttggtgcc ggtcaggtcg    137160
     gccacatcgc gcagggccca cagcagcggc atttcgccgg gggcgtccag tacggtgtcc    137220
     ttgccattga tattgagcgt cggcattggg ggtttccttc cgatgagcgg gggcgcgccc    137280
     tggcggcgcg cacgacccgc aaagaatagg aaaccgaggc ccgtggcggc aatgccgatt    137340
     gctgcaggat tcttgcctga tcctgcgaga gtgcggcccc ggcggcgccg gggccagcgg    137400
     gtatcagccg cagcgcaggg cgctgatgct gccgttgccc tccaggatga tgttcaggcg    137460
     gcgcgcgttg tattccatgg tcatgacctg gccgggcttg agcaggcgca tcgaccccga    137520
     gttcgagcgc cgcagcgcgt cgttgccgac cgagtccgaa tatttctgcc ccaccaggtt    137580
     ctgcaccggc tgggcgtcgc agtccgggcc gctgggcgtc gttgccgacc cgggcgcggc    137640
     gctggaggaa gtctggctgg aggccggcgg gctggagtcc gtccgggtgc cggaggcgca    137700
     ggcggtcagg ccggccagca gtgcaatggg gatcaacttc cagatcatgg gcaactcctt    137760
     aaaactggga acagacggaa tgtccatgat agttgaggcc gggcacggtt ggggcgcgcg    137820
     ccgcgcgcgg gcgccgggcc ggctggacgg cgcggcgccg acgcgggatg atgcgcgctt    137880
     tggggcgcag ccggagaagg cgcagtggac aaattccagg aggtaagcct gttcctggcc    137940
     gtggccgagg cgcgcagctt cgccgccgcg ggccggcggc tgggcctgtc ggcctcgacc    138000
     gtgacgcgcg cggtggcggc gctggaggcg cgcctgggca tcctgctgct ggtgcgcacc    138060
     acgcgccacg tacgcctgac cgacgccggc gaacagttcg cgcacgattg ccgcgcggtg    138120
     ctggacagcc tggcgcaggc cgaggaggcg gccgccggcg ggcgggtcca gccgcgcggc    138180
     gaactgtcgg tgacggcgcc gacgctgttc ggcgaactgc acgtgatgcc ggccatcgtc    138240
     gattacctgc gccagcaccg gcgggtgcgg ctgcgcgcct tgctggtcga tcgcgtggtg    138300
     cggttgctcg acgaaggcgt ggatgtggcg gtgcgcatcg gccgcctgcc cgactccagc    138360
     ctgaccgcca tccatgtggg cgacgtgcgc cgcatcgtgt gcgcggcgcc ggatttcctg    138420
     gcgcgcgccg gcgtgccgtc gcatccggac atgctgccgc gctattgcac ggtcagcgtg    138480
     gtgatggaag ggcaaatgga ccgctggcgc tttgtctgcg acggccatgc ccgcgacctg    138540
     gacgtgcagg cgcaacttac cgtgacgtcg tcgcaggccg cggtgcgcgc cgctgtgcag    138600
     ggctggggcc tggcgcaggt ggtgtcctac caggccgccg gtgcgctgcg cgagggcgcg    138660
     ctgcaggtgg ttctgcgcga attcgagccg ccgcccctgc cggtgcatgt ggtgtatccg    138720
     gaagggcgca agggcgccgc caaggtgcgc agcttcgtgg aattctgcgt ggagcgcctg    138780
     cgcgccgaac tggccgagct gccggcctga cggcgctgcc gtaccagcgg gcacggcatt    138840
     gcggcggctg caacactgtt ttgcgccggc gccgcgcggg ccgcgcggcg ggcatcatgg    138900
     aggttgttcg atacgacatt cccggtgcct tgatgagcga ttcgctggtt ttccataccg    138960
     atctccctgg cctggccgac ggcccctggc atggcggcga gctggccatg caggagcgcg    139020
     ccggcgcgcg cgaacgcatg gcgcaattgg ggccgcgcgt catccgcgac tacatgccgc    139080
     agcagcatcg cgatttcttt gcccagctgc cgttcatgct gctggccacg gtcgatgcgc    139140
     aaggcgatcc ctgggccagc gtgctggagg ggccgccggg tttcgcgcac agccccgacg    139200
     agcgcacctt gcgcctggat gcctggcccg ccggcgacga ccccgcgcgc gccggcctgg    139260
     cgcatggcgc cggcgtgggc atgttgggca tcgagctgtc cacgcggcgg cgcaatcgcg    139320
     tcaacggcca tgtcgccgcg ctggacggac aggggttctg cgtggcggtg acgcagtcgt    139380
     tcggcaactg cccgcaatac atacagaccc gccatgcgcg tcaggccgcg cccgcgccgc    139440
     agccggcgcg ctggctggcg ggcctggacg cggccgcgcg cacgctggtc gggcaggctg    139500
     atacgctgtt cgtggccagc tacgcgcgcc aggccggccc gcacgcggtg gacgtgtcgc    139560
     atcggggcgg gccgcccggc ttcgtgcacc tgcgcggcga tacgctgacg atgccggatt    139620
     tctccggcaa tcgcttcttc aataccctgg gcaatctgct ggccaatccg cgcgccggcc    139680
     tggtgttcgt ggatttcgcg cgcggcgact tgctgcagct gtgcgggcgc gccgaagtgc    139740
     tggccgaggc ctgggcgccc gcggcgtatc cgggcgccca gcgcctgtgg cgcgtccacg    139800
     tggagcgggc ggtgcgccgg cccgcggcgc tggggctgcg ggccgggttc ggcgagtatg    139860
     ccgcgcagct ggcggccgtg gggcaatggg ccggcgagcc gccggcctga ggcaggctca    139920
     gccttcgcgg cgctggcgca cggcctgggc cagctcggcc agcaccggct cggtctgggc    139980
     ccagctcagg caggcgtcgg tgatggacac gccgcgcttg agcggcacgc cgggcttgag    140040
     atcctggcgg ccttcctcga ggttgctttc gatcatgatg ccgatgatgc ggcggtcgcc    140100
     gccggccagc tgccgggcca ggtcgcgcgc cacgtcgacc tggcgcgcgt gcgacttgtt    140160
     cgaattggcg tgcgagcagt cgaccatgac ctgctcgcgc aggccggcct tggccagcgc    140220
     cgcacagcag gcgtcgatgg cggccgcgtc gtagttgggg ccttgcttgc cgccgcgcag    140280
     gatgacgtgg gtgtcgtcgt tgccgcgcgt ctcgaagatg gcggcggtgc ccatcttggt    140340
     catgcccatg aaggcatgcg gggcgctggc ggccacgatg gcgtcagccg ccacctggat    140400
     gccgccgtcg gtgccgttct tgaaacccag cgggcagctc aggcccgagg ccagttgccg    140460
     gtggctgggg ctttcggtgg tgcgcgcgcc gatcgcgccc caggcgatca ggtcggcgat    140520
     gtattgcggg ctgagcaggt ccaggaattc ggtggcgatg ggcagtccca gggcgccgat    140580
     ttccagcagc aggtggcgcg cgcggcgcag gccttcgttg atgcggaaac tgccgtccag    140640
     gcgcggatcg ttgatgtagc ccttccagcc cacggtggtg cgcggcttct cgaagtacac    140700
     gcgcatgacg atgagcaggt cgtcggccag cgtgtcggcc gcctccttga gctggcgcgc    140760
     gtactccatg gcctgttcgt ggtcgtggat ggagcagggg ccgaccacca ccaccagccg    140820
     gtcgtcgcgg ccgtgcagca cgtcggcgat gcgcgcgcgg ctgtcctcga ccagcgcctg    140880
     tagcggcgcc gataccggca gttcgtcctg cagcagggcg ggcgaaatca ggggacgcac    140940
     ggcgccgatg cgcacgtcgt cgatgcgggt ggtgtcttgc gtcgcgtcgg cctggccggc    141000
     ctcgcgatcg tgcagcgggt catcgatacg ggtcaaggca atttctccgg tgcgccccgg    141060
     cggcgcaaca ggcaattatc gcactttgcc gcgcggcgcc agggggccgg gccggcagcg    141120
     acagccgggc ggcgccgcgg cgccacggtt ggggggctca gcggcgggcg tccagggcca    141180
     tgcgcaccgc caggccggcc agcaccgaac ccatcagcca gcgctgcgcc accatccaca    141240
     tgggccggcg cgccaggaat accgcgatgg cgccagccat gacggtgaac agcgcgttga    141300
     cgcagatgct gatgccgacc tgggtgaagc ccagggccag cgactgggtc aggacgctgc    141360
     cttgctgcgg gtcgatgaac tgcggcagca gcgacaggta cagcacggcg atcttgggat    141420
     tgagcagggc ggtgaacagc cccatggcga acaggcggcg cggcgggctg ggcgccaggg    141480
     cgcgcacctg gaatggcgac tgcccgcccg ggcgcagcgc ctgccaggcc atgtacatca    141540
     ggtagatggc gccggccacg cacagcgctt cgtaggccag cggcaccgcc atcagcagcg    141600
     ccgtgatgcc cagcacggcg cacagcacgt agaacaccag cccgagcgcc acgccggcca    141660
     gcgaaaccag cccggcgcgg tagccctgcg acagcgagcg cgacaccagg tacatcatgt    141720
     tggggccggg cgtgagcgtc atgcccaggc agatcagggc gaaggcaagc agttgggtcg    141780
     gttcgggcat ggcggcacgc aaggtggacg cgcggatggc gcgcggttat cactctagcg    141840
     cagaactgtt gcgtaacagg gggaattttt ggtgcctgtc ccggcgggga caggcacacg    141900
     cacgggcaga cgccatgaaa tcttgcaggt gcctgtcccc gcagtgggga ctggcaagca    141960
     attggcgggt gccagtcccc cagtggggac aggcacccgg gggttaggtt gccgttctca    142020
     tcgtgacgaa ttcctcggcg gcggtggggt ggatgccgat ggtgtcgtcg aagacctgct    142080
     tggtggcgcc ggccttgagg gccacggcca gcccctggac gatttcgccg gcgtccgggc    142140
     ctaccatgtg gcagcccagc actttctggc tgtcggcgtc gaccaccagc ttcatcaggg    142200
     tcttttcctg gctctgggtc agggtcagtt tcatgggccg gaagcggctt tcgtagcggg    142260
     tgacccgaaa tccgcgttcg agggcctgct cggtggtcag gccgaccgtg ccgatgttgg    142320
     gcaggctgaa gacggcggtg gggatgaggt cgtagtcgac cttgcggtac tcctgcgggc    142380
     ggaacaggcg gcgcgccacg gccatgcctt cggccagcgc cacgggggtg agcggcacgc    142440
     ggccgatcac gtcgccgatg gcgaggatgg acggctcgct ggtgcggtat tcgtcgtcca    142500
     cctcgatgta gccggactcg gccagccgca cgccggtgtt ctccaggccc aggtcgtcga    142560
     gcatggcgcg ccggccggtg gcgtagaaga cgcaatcggt ttcgagcacc gagccgtcgg    142620
     acagcgtgac cgccagcacg ccatcggcgc gcttgtcgat gcgttcgacg tcggtattga    142680
     agcgcaggtc caggcctttc ttgaccagtt cgtcgcgcag gtgctcgcgc acgctgccgt    142740
     cgaagccgcg caggaacagt tcgcgccggt agacctgcac ggtctgcgcg cccaggccat    142800
     tgaaaatgga ggcgaattcc accgcgatgt agccgccgcc caccaccagc acccggcgcg    142860
     gcagctcggg caggaagaag gcgtcgttgg acgtgatggc gtgttccttg cccgggatgt    142920
     cgggcacgaa cggccagccg ccggtggcca ccaggatgtg ttgcgcgctg tggcgctgcc    142980
     cgttgatttc gacggtgtgc gggtcgacga tgcgggcgtg gccttcgtgc agcgcgacgc    143040
     cgctgttgac cagcaggttg cggtagatgc cgttcaggcg ttcgatttcg cggttcttgt    143100
     tggcgatcag cgtgggccag tcgaactccg ggcggcccgg gttccagccg aagccggccg    143160
     cctgctcgaa gtcttcgtgg aaatgcgcgc cgtagaccag cagcttcttg ggcacgcagc    143220
     ccacgttgac gcaggtgccg cccaggtagc ggctttccgc caccgccacg cgggccccgt    143280
     agccggccgc gaagcgcgcc gcgcgcacgc cgccggagcc ggcgccgatg acgtacaaat    143340
     cgaaatcaaa tgccatgtct gtcggtcctt ccgcggccgt ccgaggcggc cgcgcgtgta    143400
     aacatctgga agccgtatta aacaaccaac cgggccgctc tgcttggcgg gcgcgccgaa    143460
     tcggatataa cagcagtcag cgcggctgga tggccggccg ccatgcacga cgcacgcgtc    143520
     acggaacgag atgcagaacg aagacagttt tttcggctcg ctgggcgcca tgctgggcgc    143580
     ggtgatacgc gccatcgtcg atggcctgcg ctatgtgttc ggcgggctgg ggcgggcgct    143640
     gggcgatttc ttcggtggcc tggcctcggc gctgggcatg agcccgtcgg tgttcaattt    143700
     tgccttgctg gtgctgggcc tgctcctgct gtggaccgcg gtgcgcgcct tcatggggcg    143760
     cgccatcgtg gccgggatct tctggctggt gctggcgatg ctgctgctgg gcggcctgat    143820
     cggctagcgc ggccagggca gggacggcgc catgctttac cgcttcctgg ccgatctggt    143880
     gctggcgctg catgcgctgt tcgtggcctt cgccgtgctg ggcgggctgc tggcgctgcg    143940
     ctggccgcgg ctggcctggc tgcatgtgcc ggcggccctg tggggggcgg gcatcatgct    144000
     ggccggcgcc gtctgcccgt tgaccccgct ggaaaaccat tggcgcgcgc aggccggcca    144060
     gcagggctac gaggacggtt tcatcgccca ttatctgctg gcggcgatct atccagaggg    144120
     gctgagccgg acggcgcaga ccgtgctggg cgcgctggcg ctggccggca atgcgctcgt    144180
     ctatgcggcg ctgtggcgcc ggcggcggcg cggcggaatc ggccgatgag ttatgctgga    144240
     ctgttttgca actcaggcga gtcccattca tgattgatct gtatttctgg gccacgccca    144300
     atggtttgaa aataaaactc ttcctggaag aggccggcct gccctatacc gagcacccga    144360
     tcaacatcgg caagggcgag cagttccagc gcgaattcct cgcgatcgcg cccaacaacc    144420
     gcattcccgc catcgtcgac caggcgccgg ctggcggcgg cgcgccgatc tcgttgttcg    144480
     agtccggcgc catcctgctg tacctggccg agaagatcgg ccgcttcatc cccgccgacg    144540
     tgcgcggccg cgccgaagtc ctgcagtggc tgttctggca gatgggcggg ctggggccca    144600
     tggccggcca gaatgggcat ttcaacgtct atgcccccga gaaggtgccg tacgccatcg    144660
     aacgctacac ggccgaaacc gcgcgcctgt acgacgtgat ggaccggcgc ctggccgagc    144720
     gcgagttcct ggcgggcgag tactcgatcg ccgatatcgc ctgctatccc tgggtcgtgc    144780
     cgcacgaggc gcacggccag aagatggccc atttcccgca cctgagccgc tggttcgagg    144840
     cgatcgccgc gcggcccgcc acggcgcgcg cctataagga ggccggcgac agctaccggc    144900
     ccaaggcgcc catgtcggac gaggaacggg ccgtactgtt cggccagccg ggcgcgccgc    144960
     gctaggcggc gcgggctagg cctggatcag ccgggccagc cgctcgatca gcggttcgaa    145020
     cagctcggcc gaggtgttgc cgtagcccag caccagtccg gtgtcctccg gccgcggcgc    145080
     gatggcgaag ccggacagcg cctgcggcgc catgcccagg cgcagcgcct gggcggcgat    145140
     ggcgcggtcg tccagcgccg cgggcagccg cagcgtcagg tgcaggccgc agtggccgcc    145200
     cagcacttcg tgcggcacgc gcaggtggcg cgccagggcg gcgcgcaggg cctgctggcg    145260
     ctcgcggtag agccgccgca tgcggttgag gtggcgggtg aactggccgc tttcgatgaa    145320
     ggaggccagg gcccattgtt cgtggcgatg gccgccgcgc agcatctcgg ccagcgcctc    145380
     ggcggcctcg tcggccaggc ccgtgggcag caccacgaag cccagccgca aggacgggaa    145440
     catggtcttg ctgtaggtgc ccacgtacag cacgggcgca tcgggcacca ggccctgcat    145500
     ggccgcgatg ggctcgccct ggtggcggaa ttcgctgtcg tagtcgtctt cgatgatcca    145560
     ggcgccggcg cggcgcgcct gctcgatcag cgccagccgg cgcgtgacgg gcagcacggc    145620
     gccggtcggg tactggtgcg acggcgtgac atagatcagg cgcggcggcg cgtcgcgcca    145680
     ggcctgcggc ggcgccagca ggccagcggc gtccacccgc accggcacca cccgcatgtc    145740
     gccgcagcgc agcgccgtct tggcgccgcg gtagccgggg tcttcgaccc atgcggtgtc    145800
     gccggcgttg cccagcagcc gcacgcacag cgccagccct tcctgggcgc cttcggtgat    145860
     gacgatctgg cgcgcctcgc agcgcacgcc gcgcgcggcc gccaggtagg cggcgatggc    145920
     ctggcgcagg cgcggttcgc cggcgggttc gccgtagccc agcaaggccg cgggcgcctc    145980
     gcgcagggcg cgttccagcg cgttgcgcca ggcgctggcg ggaaaatggt tgagggccgg    146040
     cgtgccgggc cgcagcggca ggtaggtgtc ggtgcgcggc gcgctggcct tcagcgcggc    146100
     caggcgccgc gcggtcgggc cggcgctgga cgccgcggac gcgcgcgccg gcatgcccgc    146160
     gcgggccagc cccgctaccc gcgtgccctg gcggtcggcc cgcacatagc cttcggcggc    146220
     caggtgttcg taggccagca gcacggtgtt gcgcgaaatg cccagctgct gcgccagcgc    146280
     gcgggaagcg ggcaggcggc tgcccggcgc caggcggcca tccaggatgg cgttcttgaa    146340
     gcgttgcagc aactggcgct gcaggggcag gcgcgcgccg gccggcggcg cttgctggag    146400
     gatcgcggca aaatccatgg ctctatcaaa aaggcggttc gtggcacttt ttatcatgcc    146460
     acgaatcgcc tatcttgatg ccatggcggg cgcgccgtgg tggcgcgccg cccacccgca    146520
     aaggaagccg tccatgtcag cccgcgtcaa cgaattcggt caacccatcg gccaggccat    146580
     gccgcaatgg caggcgcggc cgcgtccccc gcgcgatccc gccgagggcc gctattgccg    146640
     gctcgaaccg ctcgacgccg cgcgccacgg cgacgatctg tacgcggcct ttgcggtgcc    146700
     cgacgcggcc agcggctgga cctatctgtc ggctggcccg ttcgccgacc gcgccggcta    146760
     cgatgaatac ctgcgcaagg cggccgacag cgccgatccc ctgcaccacg cggtgatcga    146820
     cctggccagc gggcgcgcga tcggcacgct gtcgctgatg cgcatcgatc cggccaacgg    146880
     cgtgatcgaa gtggggcatg tgaacttcgc gccggcgctg cggcgctcgc cggcttcgac    146940
     cgaggcgcag tacctgctga tgcggcgcgc cttcgacgaa ctgggctacc gccgctacga    147000
     atggaagtgc gacagcctga acgcgccctc gcgcgcggcc gcgctgcgcc tgggtttcct    147060
     gttcgagggc attttccgcc aggcgctggt ctacaagggg cgtacgcgcg acaccgcgtg    147120
     gttctccatc atagacagcg aatggccggc gctgcgggcg gcgttcgagc ggtggctggc    147180
     gccggagaac ttcgatgcgg cgggccgcca gcgcaagcgg ctggatgcct gccgccagcc    147240
     gtaatcggtg cctgtccccg ccgggacagg caccccgtca tacgccatga aatcaggcgc    147300
     cagtccccat gccgggacag gcaccggcat tcctgcgggg gcagccttat gtccggcgcc    147360
     gcagcttctc gcgcagcagc tcggcgccgc tgaccagcgt gatgccggcc agcaccagca    147420
     ccgcgccgat gacgaagccc gagtccagcg gctcgtcgag gatcagcacg ccgaaggtga    147480
     cgccgaacag cggcgtcatg aacgacagca ccgccaggcg ggtggcgaga tagcggcgta    147540
     gcagccagaa ccaggccagg tagctcgaca gcgccacgac caccgactgg aagcccaggc    147600
     tggccagggc cgcgccggac cagacgggcg cggcgccgcc gctggcgaaa tgaaaggcgg    147660
     gcagggccag tccggccatc agcatctggt agaacagagt cttggccggc gccgcctcgg    147720
     acagcgagga tttgcggatc gccaccgtgg tggcgcccca ggccgcgccg gccagcacgc    147780
     cgagcaggtc gcccagcagc atgccgggca cggccgcgtg gcccttgccc aggaaggcgg    147840
     tggcgatgcc gccgaaggcc accgccacgc ccagccactg cagcggcttg aggcgttcgt    147900
     cgggcagcag caggtgcagc ccgagcgccg tgaagatggg cgcggtgtag aggaataccg    147960
     ccatgtgcga ggcggtggtg tactccagac ccacgccgac cagcaggaat tccagcgcga    148020
     acagcgcgcc caccgccagg ccgggcccca gcgtgccgtc gcgcaacgcg cccaggccct    148080
     cgtggcgcag caccacccag atcagcacca ccgcggcgaa ggccgagcgc aggccgatct    148140
     gcagggtggg ggagacatcg gcggccacca gcttgatggc gatctgctgg aagccccagc    148200
     agatgcacag cgccagcatg acgtaagtgg cgaaaccgtc cagcggacgg cgcagcggcg    148260
     cggcggcggc catggtcatg gcagttcggc cgggtagctg tccagcgcca ggctgatctg    148320
     ctggcgcagg tcccagtcgg ccagttgcgc gctgaccggc ccgtagtagg cgccgtcgcg    148380
     cgtgacgaac agcgccggca ggtggaagac ttcatagcgc tgcaccagcc cgccgttctc    148440
     gccggcgtcg atccagcaca ggcggtcgac cggcaggtcg aactcgggca ggcgctggcg    148500
     cgccacgccg caggtggcgc aggtgcggct gtggaagaca agcagcgaca ggcccggcgc    148560
     atccagcagg tagcggtcgg cggtgccgtc ggtcagttcg atctggtcca tggggaaact    148620
     cgggggcggg ccggctatgc taccgcatcg ccggcccgcc ggccgcagct agcgcgacag    148680
     gcggcgatcg agttccagca cggtttcgta cagcacgcgc gtgccgtcga gcagctgcga    148740
     cggctccagc cactcctcgg gacagtggct gcggccgttc aggcagggca cgaagatcat    148800
     gccgatcggg ccggtgggcg ccatgtagac ggcgtcgtgg ccggcgccgc tgggcaggcg    148860
     catcgaggca tagcccaggc gggtggcggc gtcttcgacg gcatccatca ccagcggcgc    148920
     gcaatcggtg gggtgggcgc ggctgaccgg cgccattgcg gccgacaggc gcagcgcggc    148980
     cagcgcgtcc gccacttccg ccatgatggc ctcgggaaac gcgtccagca cggcgtcgct    149040
     gtcgctgcgc acttccagca tcagttcgac catgccgggc acggcgttgg gcgcgttggg    149100
     cgtcatggca atgcggccga tggtggccac cacgtagtgc ggcttgccgc tctgcgtgct    149160
     ggcgcggcgg tgcgccgcgt cgatgacgcg cgccgcgccc accagcgcgt cgcggcggat    149220
     atccatgggc gtggtgccgg cgtggtcggg ctggccgtgc acggtgatga gcacgcgccg    149280
     gataccgacg atgttggtga ccacgccgat cggcaggccg cggctttcga gcacgggccc    149340
     ctgttcgatg tgcagctcga cgaaggcggc ggtctggccg gggccgcgca gcggggcgcc    149400
     cagcgcgtcc gggtcgccgc cgatgcggcg cagcccctcg gccagcgtct cgccatcggc    149460
     gttgcgcgcg gccagcatgt cgggcgtcaa ctggccgctc agcgcgcggc tgcccacgca    149520
     ggagatgccg tagtcgctcg gctcttcgga caggaagtcg atgacttcga acgggtgctc    149580
     cagcgtcacg ccctgctcgt gcagggtgtg cgccacttcg atgccggcca gcacgccgat    149640
     gatgccgtcg aagcggccgc cggccatcac ggtgtcgcaa tgcgagccgg tggcgatggg    149700
     gcggcgggcg gcgtcgcggc cggggcgcgt gcccaccagg ttgccgccgg catccaggcg    149760
     caccgccagg ccggccgcct cgaattcggc gcgcagccat tggcgcgatt gctcgaacag    149820
     cggcgagaag gcgcgtcgcg tccagggcac gtccggcaag gtcatgcgcg acagggtttc    149880
     gacgcgcgac cagaggcgct cggcgttcag gggaggaaat gtcgtggtca tgggaatgtc    149940
     ctgaaaagag agaagggcgg ctaggcgcgc cgcagcagcc ccacgcggtc gcggcgcagc    150000
     cagcgctgca tcatgagcac ggccaccagc gccaggccga tggccagccc gctccagacg    150060
     cccacgccgc gccagccggc ccagaacgcc agcgccgcgc cgctgggcag gcccacgccc    150120
     caatagccga gcgccgcgta cagcatgggc acgcgggtgt cgtgcaggcc gcgcagcatg    150180
     ccggcgccca gcacctgcgc gccgtcgacg atctggaaga gggcggcgac cgccaggtag    150240
     gcggtggcca gccgcaggac ctgggcattg gcggggtcgc cgatgtccag gaaggccgac    150300
     accagcaggc cgggcgccag cagcatcagc gccgcggcga tcgccatgct gccgatgccc    150360
     agcgagaagg cgcaccagcc ggcgcgcgcg acctggtcgg gctggcgcgc gccgtacgcg    150420
     tgtcccacgc gcaccgtggc cgcctgggca atgccgtagg gaatcatgaa cgtgacgctg    150480
     gcgatctgga tggcgatcgc gtgggcggcc agctccggtt cgcccagcca gcccatcagg    150540
     aaggccgcgg cgttgaagat ggtgacttcg aacgcggtgg ccgcgccgat cggcaggccg    150600
     agtttccaga actcggccag gcgctgccag tccggttgcc agacgtcgcc gaacagatgg    150660
     tagcggcgga agcggcggtc caggcagacc acgccgacca tgcccaggaa caggcccagc    150720
     gtggccagcg cgctggccag gccggcgccc accaggccca gcgccggcgc gcccaggttg    150780
     ccgaacacca gcacccagtt gccgaagacg ttcagcacga tcgcggccag cgcgatcagg    150840
     aaggccgagc gcgggcgctg cagcgccgcc acgaacgagc gcagcaccag gaatcccagg    150900
     aagggcggca tggcccacat cagcgcgcgc aggtaggcgc cggcctgcgc ggccagctcg    150960
     gggggctggt cgatggccag caggatggct tcgccgtgcc acagcagcag gcagcccggc    151020
     accgaataga tcaccgcggt ccacaggccc tggcgcaccg tgcggcgcac gtcgcgcacg    151080
     gcgttgccgc gccggcccag cgcatgcgcg accatcggcg cggtggccgc gaccaggccc    151140
     aggccgaaga attcgatggc ggtgaacagg ttggcgccca gggcgctggc agccagcgcc    151200
     tgtgatccga gccgtccgat gaagatcaca tcggtaacag tcatggccat ttgtgccaga    151260
     ttggtcagca ccagcggcag gccgagcgcc agcgtggcgg cgagctcgcg cttccaggcg    151320
     gcgcgggctg tcgatcgggg catgcgccct cccattgatt ttgaatcggg atattacctt    151380
     ttttcctagg gtaaacccgg gtttgtcccc ggctcatgca actggccgag ttggtggggc    151440
     cggaggtcgc aagtatgatg aggcccattc caatgctgct ggcccggcca tgccccggcc    151500
     agcgttgtta caccgcagga gaccctaccg atgaacaagc catccgaagt caaacccgtc    151560
     gcgctcaacg tgcccgacta tgtcaagcac agcgggttga tcgcgtgggt ggaacggatc    151620
     gctgccctga ccaagccgga ccgcgtggtg tggtgcgacg gctcgcagga ggagtacgac    151680
     cgcctgtgcg aacagatggt ccagggcggc acgatgcgcc gcctcaatcc ggccaagcgc    151740
     gccaactcgt acctggcgtg ttccgatccc tcggacgtgg cgcgcgtgga agaccgcacc    151800
     ttcatctgtt ccgagcgcga ggaagacgcc ggccccacca acaactgggc cgccccgcag    151860
     gccatgcgcg agacgctcgg cggcctgttc gacggcgcca tgcgcggccg caccatgtat    151920
     gtggtgccgt tctcgatggg gccgctgggc tcgcccatcg cccacatcgg cgtggagctg    151980
     agcgacagcc cctatgtggt ggtgaacatg cgcatcatga cgcgcatggg ccgcaaggtc    152040
     tttgacgtgc tgggcagcga cggcgccttc gtgccgtgcg tgcacagcgt gggcatgccg    152100
     ctggccgaag ggcagcagga cgtggcgtgg ccgtgcaacc ccaccaagta catcgtgcac    152160
     taccccgaga cgcgcgagat ctggagcttc ggttcgggct acggcggcaa cgcgctgctg    152220
     ggcaagaagt gcttcgcgct gcgcatcgcc tcgaccatgg gccgcgacga gggctggctg    152280
     gccgagcaca tgctgatcct gggcgtgacc tcgcccaagg gccgcaaata ccacgtggcc    152340
     gcggcgttcc cgtcggcctg cggcaagacc aatttcgcga tgctgatccc gccgcacggc    152400
     atggacggct ggaaggtcac caccatcggc gacgatatcg cctggatcaa gcccggcccg    152460
     gacggccggc tgcatgccat caatcccgag gcgggttact tcggcgtggc gccgggcacc    152520
     agcgagaaga ccaatttcaa tgccatggcc acgctcaagg ccaacgtgat cttcaccaac    152580
     gtggcgctga ccgacgacgg cgacgtgtgg tgggaaggca tgaccgacac gccgccggcg    152640
     cacctgatcg actggcaggg ccaggactgg acgccggcca tcgccgccga gaccggccgc    152700
     aaggccgcgc acccgaacgc ccgcttcacg gcgccggccg cgcagtgccc gtccatcgac    152760
     cccgaatggg aaaaccccaa gggcgtggcg atcgacgcct tcatcttcgg cgggcgccgc    152820
     tcgaccaccg tgccgctggt caccgaggcg cgcaactggg tcgagggcgt ctacatggcc    152880
     gccaccatgg gctcggaaac caccgccgcc gcggctggcc agcaaggcgt ggtgcggcgc    152940
     gaccccttcg ccatgctgcc gttctgcggc tacaacatga gcgactactt cgaccactgg    153000
     ctcaagctgg gccgccgtct cgaagagacc ggcgccacgc tgccgcgcat ctactgcgtc    153060
     aactggttcc gcaagggacc ggacggcaag ttcgtgtggc cgggattcgg cgagaacatg    153120
     cgcgtgctgc gctggatgct gggccgcctg gatgggcagg ccggcggggt cgaccaggtg    153180
     ttcggcatct cgccggccta cggcgatatc gactggaccg ggctggaatt cagccccgac    153240
     aagttcgagc aggtcatctc ggtggacctg ccggcatggc gcgccgagct ggcgctgcac    153300
     gatgagctgt tcacccagct ggccgcgcgc ctgcccgagg atctgccgtt gacgcgtacc    153360
     gccatcgagc ggcgcatggc ggcctgaggc cggagcggcg cggcgtttcg ccgccgcgcc    153420
     ggcgccgctt tgcggcacaa tcgcgccatg accttgactt ccgacgacct gcgccagatc    153480
     gcggcgctga cgctggccca ttacgacgac aacgctgtct cgttcgaggt cggcacgcgc    153540
     gaccacgacg taagccagaa catcgcggcc ctgctgcgcc atatacaggg cgatccgccg    153600
     tatgccatcc tggacttcgg ctgcggcccg ggccgcgacc tcaagacgtt cgcggcgctg    153660
     gggcacgcgg ccgtcggcct ggacggcgcg gcgcacttcg tggccatggc gcatcaggcc    153720
     accggctgcg aagtgtggca gcaggatttc ctgcggctgg cgctgccggc cgggcgtttc    153780
     gacggcatct tcgccaacgc gtcgctgttt cacgtgccga cgcaggaatt gccgcgcgtg    153840
     ctgggcgagc tgcgcgacac gctcaagccg ggcggcgtgc tgttctgctc caacccgcgc    153900
     ggcggcaacg aagagggctg gtcgcgcggc cgctatgggg tgtggcatga ctgggagtcg    153960
     tggcgcgcgc tgctggaagc ggcgggcttc caggccctgg agcactatta ccggcccgcc    154020
     gggctgccgc gcgagcagca gcaatggctg gccagcgtat ggcgcaggta gcggggttcg    154080
     cggccctggc gcgcgccgac gcgcgcgtgc tggtgctggg cagcatgccg ggcgtggctt    154140
     cgctgcgggc gcagcagtac tacgggcatc cgcgcaatgc attctggccg atcgccgccg    154200
     agctgttcgg cctggacgcc gcgcagccct atgcccaccg cgtgcaggcc ctgcagcggg    154260
     ccggcgtggc cctgtgggac gtgttgcagg cctgcgagcg cccgggcagc ctggacgccg    154320
     ccatcgtcgc cgatagcgtg cgcccgaacg atttccaggc cttcttcgcc gcgcatccgg    154380
     gcatcgcctg cgtgggcttg aacggcgcgg ccgccgcgac gctgtatcgc cgccacgtgc    154440
     tgccgcgcct gcacggcctg gcgcatctgc gctacgtggc gctgccgtcg accagcccgg    154500
     cccatgcagc gatggatttc gccgccaagc tgcgggcctg gcgcgcgatc gcgccggcgt    154560
     catccgaccc ttcggcgtgt ctgtccccgt aggggggagc ggcgtctgcg gccagggtgc    154620
     ctgtccccct gcggggacag gcaccctgcg gagacaggca cctgcaagat ttcacggcgt    154680
     ctgcccgtgc gtgtgcctgt ccccgctggg acaggcaccg ctggctatgc caggcgtccg    154740
     tagatctcgc gcgcctgcgc ggcggtggcg atgggccggc ccagcacgcg gccagcctgc    154800
     gcggcctggg ccaccagggc ggcgttgccc ggcgcggtcg cgccgtcgct cagcttgagg    154860
     ttgttctcga agcccacccg catatggccg ccgaacgcgg ccgcggtggc cacgcaggcg    154920
     ttctcttcgc ggccgaaggc gcacacggcc cagggcagcg atccgtcgta gacctcgaga    154980
     aagggcagca ggtcgcgcgg cgaggacacc tggccggccg agtagcggcc cagcacgaac    155040
     agcaccgacc aggctccttc aggcgccagg ccgcgcgcgc gcagcgcctg ccacctggcc    155100
     acgtcggcgg cgtcgtacag gatgatctgc gccatgatgc gttcggctgc gacccaggcc    155160
     aggaagtcgg ccagctcgcg ttccggcatc tcgggcacgg cgatctcgcg caggcccatc    155220
     gaaacggctt cggggcgcag ttcgcgcacc atggccatct gctcggcggc gcggtagacg    155280
     ccggccgctt cgctggtgac ctgcaccagc agttcttcgc ccacggcctg gcgcaccgcc    155340
     gccagcgcct cgcggtaggc cgccacgtcc agcgaatggc ggccttcggg cgtgcgcaca    155400
     tgcatgtgca tcatggccgc gccggcgtcc aggcaggcgc gcgcctcggc cgccagcgcc    155460
     gccgccgtca gcggcacggc ggggtggtcg gcggcggtct tgtaggcgcc attgggcgcc    155520
     accgtgacga tcaggggcga gtcggccagc gcggcctgcg cgcccgcggc gaacagcgac    155580
     tggctcatgg ctggatctcc ggcagctcgg cgccgagcag gtccagcccg gcgcgcagca    155640
     ggcggtcgta gcgggcgcgc tcggcggcga tggtctcggg cgtccatgca tagaagcccg    155700
     tgccggcctt catgccgtgg cggccgtcgg cggcgcgctc ggtcaggcag cgcgccggcg    155760
     tatcggcgtt gcagaacgtc gggtacatgg tcgcgccggc ggccgcgtgc acgtcgatgc    155820
     cggcatggtc gcgctgcatg accgggccgg cggccaggaa gcggaagccg aaaccgaaac    155880
     gcaccgccgc gtccacgtcc tcgggcgagg cgatgccgcg gtcgatgaga tcgaaggctt    155940
     cgcgcgacag ggcgtgctgc aggcggttgg ccagaaagcc cggcaggtcc tgcgcgaccc    156000
     tgaccggcac catgccgcag cggcgcatga aggcgatcag gacgtcggcg caggccgggt    156060
     cgctggcctc gcacagcacc acctcgacca gcggcaccag gtgcgccggc atgaagaagt    156120
     gcaggcccag catgcgctcg cgcgtgggca ggccggcgcc gatggcgctg atcgggaagc    156180
     tggagctgtt gctggccagg atggcgtggg ccggcgcgcg gcgcgccagc tcggcgaaca    156240
     gcgcctgctt gatgtccagg cgctcgggaa cgcattcgat caccaggccg accgagtccc    156300
     attcgaccgc gtccaggccg ggcacgaccg cgatgtgcgc ggcgccctcg gcgcggccgg    156360
     cctgcgccag gttgtcggcg gcgcggcgcg gcagcgcggc ggcgcgcgcg gcgtcgggtt    156420
     ccaccaccgt ggtgcggcac agcgcgcgcg ccagcaccac cgccacgtcg gcgcccatgg    156480
     tgccgccgcc gatgacgacc gcatggctgg cgccgggacg gcccagcgcg gaatcgggag    156540
     agctcatgtt gttccttctc gcaggagtgt tcgcaatgcc agccagtgta gggaaacggc    156600
     tttgattgat gaatcagatt ttttggatag aatgatcgat aaattagatc agtgaggcgc    156660
     cgtgaagatc aatctgtcca tgcgcgatat cgagaccgtc ctggtattgg gccgcacgct    156720
     caatttccgg caggcggcgg cgcagctgca cctgtcgcaa tcggcactgt cgacccaggt    156780
     gctgcgcatt gaggaggcgc tgggcgtgcg cctgttcgac cgcaccacgc gcaccgtgcg    156840
     gctgacggcc gccggcgagg tgttcatgca gcaggccgcc tcgctgcagg tggcgtttcg    156900
     cgaggccatc gacgcggtca gcggcatcgc cagcgccgag cacggccagg tggcggtggc    156960
     ggcgctgccg tcgctggccg cgcgcctgct gccgcgcgtg ctgatggcgt accggcaggc    157020
     ccatcccggg gtggcgctga aagtgcacga cacgctgtcg ggcccggcgt tcgacctggt    157080
     gcgcgccggc gaggtcgact tcgcgctgac cgcggccgat ccgcagcagg cggacctgca    157140
     ctatgtgccc atgatgtccg acagcttcat cctgctgatc ccgcaggacc acgcgctggc    157200
     gcgcggcaag gggccgctgc gctgggccga tacgctggcc gcgccgcacg tgtcgatggt    157260
     gcatccgagc agcgtgcgcc agtacgcgga gtgggccttc ctgcagaacc gcatccgttt    157320
     ccagcccgcc ttcgaggccg agcacctggc caccatcgtc gccatggtgg agtgcggctt    157380
     cggcgtggcg gccctgccgg agatcgccgc cgccgcggtg gcgcacagcg gcatcgtcga    157440
     gcgcccgctg accgggccgg tggccgagcg ctccatcggc ctggtgacct cgcgcaaccg    157500
     taccttgtcg ccggcggcgg ccgcgctggt ggcgcagctg cgcgagcacc tggccgcctc    157560
     ggcgtacaag cccgcgccgg cggcccctag cgcacgtacg acggcagcaa gagcgagatc    157620
     gagggaaaca gcaccaggat cgccaggcgc accacgtcgc tgaccacgaa cggcatgacg    157680
     ccgcggaaga tcgtgggcgt ggacacgccg ggcagcagtc cgcgcagcac gaacacattc    157740
     atgccgaagg gcggcgtgat gaagctgatc tcggtgacca ccaccacgat gacgccgaac    157800
     cagatcaggt cgaagcccag gctctgcacc agcgggtaga acaccggcac cgtcagcagg    157860
     atcatggaca tgctctccag cacgcagccc agcacgatgt agatgacgca gatggccagg    157920
     atcaccgtca gcgggctgag ctggtggcgg gcgaccacgt ccagcaagtc ctgcggcagc    157980
     gaggtgaagt tgatgaaatt ggccagcatc agcgcgccta tcatcaccac gaagatcatg    158040
     ccggtggtct tggccgattc gaccaccacg tccaggaagc ggcgccacgt catggcgcgc    158100
     cggctgcagg cgaacaggaa gctgaggaag gcgccgacgc cggcggcctc ggccggcgtg    158160
     aacaggccgc cgtagatgcc gcccagcagc atgccgatca gcgccagcac catccagacc    158220
     tgccgcagcg cgtgcagggt atgcggccag gtgctgcgcg ggccgcgcgg ccccgcggcc    158280
     ggatcgcggc gcaccaccca ggccaccgcc gccatgtagc acaggatcgc cagcacgccg    158340
     ggcagcacgc cggcggcgaa catcttgccg atgctctgtt cggtcagcag gcaatacacc    158400
     accatgatga tggagggggg aatcagcacg cccagcgtgc cgccggcggc gatcgaaccg    158460
     gccgccagct tctcgctgta gcccatgcgg cgcatttccg gataggcgac cttggccatc    158520
     gtcgcggccg tcgccaggct ggagccgcag atggcgccga aaccgccgca ggcggcgatg    158580
     gtggacatcg ccaggccgcc gcgccggtgg cccagcagcg cgtgggcggc ggcgtacagt    158640
     tcgcgcgaca tgcgcgattc ggtgacgaag ttgcccatca ggatgaacag cggcagcacc    158700
     gacagcaggt actggaagcc gctttcgtag atcaccgagc cggccatggc gtaggcgggc    158760
     ggccagccgc gcagcaggcc caggccgacg aagccgacca gcgccatggc gaaggccacg    158820
     ggcacgcgca tgaaaaccag cgccagcatg gcgcccaggg cggacaggga ttcaatcatc    158880
     ttgggtcggt tccggctgcg tagcggcagg cccgaccagg gccgccagcc ggtaggcggc    158940
     gtccagggcc agcagtaccg ccatggcgta tacgaagggt gccaggggaa tgttgagcat    159000
     gggcgtcatg tcgccgtagt cggcggtgct ttgcgccttg cgcagcgcca cccaggccag    159060
     gcaggcgctg accgtcagcg ccagcaggcc ggccacgcag tcctgcgcgc gcagggtcgc    159120
     gggcgagaac aggtggctga agctgtcgac cgtgatgtgg ccgcgcgcgc gggtcaccag    159180
     cgggatgctg gcgaagatca ccgccaccat cagcagctcg accatctcga cggtgcccat    159240
     gatgggacgg ttgagcaggt agcgtccggt ggcgtcggcc accgtcagca ggctcatgcc    159300
     gcacaggctg atgaccacga tggcgcgcag cagggccgtg acggcccggt ccaggatccg    159360
     catggcgcgc gctcagcgtt gctggtccag ctgcttgatc tcggcgcgga acgacgccag    159420
     cgcggcgggc ccgtcgatgc ccttggcctt ggccgcgtcc agccatgcct gctcgaaccc    159480
     cttggtgcgt tcgcgcacgg cctcgatcag cgcgtcgtcg gccttgacca gttcgatctc    159540
     gccgccttcg agcaccttgc gcgcggccgc gtcgtgcgtg tcccaggcgc gtccggccag    159600
     ctcggccagg tggcggcccg acaggcgcac cagcgtgtcc tggtcctgct tggacaggcg    159660
     cgcgaaggcg tcgcggttga tgatgaccgc gtgcgtgtcc gaatacaggc cgccggggaa    159720
     ttcggtggcg tgcctgatga tgctgtccag cttgaacgac accagcgatt cggccgggaa    159780
     gaacacgccg tcggccacgc cggtgctgag cagttcgtac gactcgggcg ccggcttggc    159840
     gatgggactg gcgcccaccg ccttggccac gtcggccgcc atgccgccgc cgacgcggat    159900
     cttcaggccc tggaagtcgc cgatctgctt gaccggcttg ctggtggtga aggcgatgcc    159960
     cgggccgtgc gcgtagatgc ccagcaggcg cacgcccttg tgctcgtcgg ccttgagcag    160020
     gtatttctcg taggtgtccc aggccgcgat ggagcgcgag gtcgcggtgt cgccggagaa    160080
     cggcagcacg gcgaacttgg tcagctggaa gcgcccgggg taataggcgt gcgagacgaa    160140
     ggtcacgtcg accaggccat cgcgcacggc gtcgaagtgg ccggccgggt tggtgaccgc    160200
     cttgggcagc aggcgcagcg tcacgcggcc atcggtggcc ttgcggattt cctcgcccca    160260
     gggcatgagg aagtccgcca cgaccgcatg ggtgggcggc agccagctcg acagggtgag    160320
     ctcgaccggc ttttgcgcga tggcgggggc cgtgcccgca aggccaaggg cgaacagggc    160380
     ggcggcgagg gtcttgtgca tcatgtctcc ttgttttatg ggatggcccg ctcggcggcg    160440
     ggccgttggt gcgacaggat caaggcggcg ggccgacggc ccgctccagc agcgccggca    160500
     ggctgccgtc gtggcgaaag cccgccgcct gcgcggcatc gcattgcagg ggcggctggt    160560
     tgccgaactg cgcctcgata tccgggcgcg gcgcgtaact taccaacggc gtggccgcgc    160620
     cctggctgcg cgcatcgaag gcctgcacga tgtcgcgcac cgacacgcgt agcgccggca    160680
     gcgtccagcc ggtgcgcccg ccgggcggcg gcgcctgggc ggtcagctcg gcggcgcgca    160740
     gcaggttgtc cacgcagcac ggcagcgaca tcagccacag cgtggcctgc gggccgaccg    160800
     gcatttcgca aggctggccc gccgccagcg cgcgcagcag cgtgctggag aaggccgacc    160860
     aggcgccgtt gggcgccggc gggcggggcg ccacgccggg caggcgcacg gcgcgcccgc    160920
     gcacgaagcc gcgccgggtg tagtcggcca acaggatttc gactgcctgc ttctgcgcgc    160980
     catagctcag cgccggcgcc agcggcgtgt cgtccgtgac gagcgcgggc agcggcgcgc    161040
     cgtagacggc gatgctgctg gtgaacacca gtccgggcga gcggccctgg cggcgcagct    161100
     gctccagcaa tcgcagcgat ccttccaggt tgacgcgcag gcccagctcg aactccagct    161160
     cggcgcgtcc gctggcgacg caggccagat ggaacaccag gtccggcggc ggatcggtga    161220
     tggccgccag cgtggcgggg tcggcgaagt cgccggccac ctggcgcacg cgcgggtcgg    161280
     ccggcgcggc gtcgaaggcc aggtcgcaca gcgtcagctg ttcgagcgcg ccatggccgg    161340
     gcacgccggg cagggcgcac aggcgctcgg ccagggcgcg gccgatatag ccgttggcgc    161400
     cggtgatcag gacgcgcatg ccgcacctcc gctgccgcag gcggcgtcgt aggcgccgcg    161460
     ccaggccttc aggccggcgc tggccaggcc gcgcggcgtg tactcgcagc ccacccagcc    161520
     gccatagccg ctttgcgcca gcaggcgtag ggtggcggcc accggcgggc tggccggatc    161580
     gggttcgtgg cgcccgtcgg ggccggcgaa ctgcacgtgg cgcaccagcg gcagcacgcg    161640
     gcgcagctcg gcgtgcgggt ccagcccttc gcgcaggttg tgatagatgt cgaactgcag    161700
     gccgacgttc ggatggtcga ccgcgcggat gatgtcggcg gcctgctcgg gcaggtaata    161760
     gaaatagccc ggcatgtcgg cgcggttgag cggctccagg gtcagcgtga cgccggcctg    161820
     ggcggcgcgc ggcgcggctc gctgcaggtt gccgatcagc gtggcgcggc attcgtccat    161880
     gccggcgggc gccggcggca tgcccgccat ggcgtgcacg atgcggcagc cggtggcgcg    161940
     gcacagcgcc agcgcctggt ccagcgcggc cccgaaatcg gcttcgcgcc cgggcacgca    162000
     ggccaggcct ttttcgccgg ccgcgcccag cggcgtgttg accagcgcca gggccaggcc    162060
     gtgctcgcgc agctgcgccg ccaattgcgc gggcggctgg tcgtacggaa acaggatctc    162120
     cactcccgcg aagccgtctt cgcgcgcggc ggccatgcgc gcggccagcg gcaggccggg    162180
     gtacagcagt gtcaggttgg cggccagttt catgcgggct ccctggcggg cgcggcgggc    162240
     cgttcgggcc acgccacgcg cacgatgtcg gacaggtcgc cggggcccag gccgcgcgcg    162300
     gcggcggtgc ggtagctgtc gagcacgcct tgcagcccgc gcagttgcgt gccgctggcg    162360
     gcggccaggg cggccacgtt ctccaggtct ttcagcatgg tctgcagggc gcccagcggc    162420
     tggtcgacgg gcgcggtcat gcgcggcacg aagatgcgca gcaagaccga atcggcccag    162480
     ccgccggcca gggcggtatc gagggcggcg gcgtcgatgc cgttgcggcg ggccagggcc    162540
     acggcctcgg cgatggcgtt gaccgtggtg gccacgatgg tctggttgca cagcttgccg    162600
     atctggccgg cgcccgtatc gcccagccgc gtcacgcggc cggcgtaggc gcgcagccag    162660
     ggttgcgcgg cctcgatcgc cgcggccggc ccgcccgcca ggatggacag cgtgccggcc    162720
     tgcgcgccgg ccacgccgcc cgagaccggc gcgtcgatcc atacgcggcc gctggcggcc    162780
     agcaggcgcg cggccagcgc gcgggtggcg tccggctcga tgctggagtg gtccaccagc    162840
     aggccgccgg ccacgtcggc cacgccgtgc ggcccgaaca ccgtggcctg caccgcggcc    162900
     aggtcggtca ggcacagcaa caccgcctgc gcgcccgccg ccgcttcggc cggcgtggcg    162960
     cagaccaccg cgccgtcggc cgccagcgcc tgcgccttgg ccgcgctgcg gttccatacg    163020
     cgcacccgat ggccggccgc cagcagccgc cgtatcatcg gcgcgcccat caggccggcg    163080
     ccgcagaaag ccagggtggc gctcattcgg cctccggcgt ttcgtaaggc caatcgacct    163140
     ggccggagtg ggtgaccgcg cccaggcagg ccgggcgcac cagcgcggcg tatttctcca    163200
     gcgcgccggc caggcgcgcc tgcggcggcg cctggtaggc ggcgcggcgc cgcgccagct    163260
     cttcgtcgga cagcgccacg tccagcgtat cggcctcggc gtcgatgtgg atcatgtcgc    163320
     catcgcgcag cagcgcgatg gggccgccgg cggccgcttc cggcccggcg tagccgatgc    163380
     acaggccgcg cgtggcgccc gagaagcggc cgtcggtcag cagcgccact ttctcgccca    163440
     tgccctgtcc atacagggcg gccgtgacgc tgagcatctc gcgcatgccc ggcccgcccc    163500
     gggggccttc gttgcggatg accaggactt cgcccggctg gtaggcgtgc gtggacaccg    163560
     cgcgcatgca ggcttcctcg ttctcgaaca cgcgcgccgg cccggagaat ttcagcgact    163620
     tcaggccggc gatcttcagc agcgcgccat cggggctgag attgcccttg agcacggcga    163680
     cgccgccggt ggggtgcagg gcctggccgc aggcgcgcac caccttgccg tcgggcgcgg    163740
     gcgtgtcggc cagggcctcg gccagggtgc ggccgtcgag cgtcagcacg ctgccgtcga    163800
     tatggccgcc gtccagcagc gccttgagca ccaccggcac gccgccggcc tcgtgcaggt    163860
     cgcgcgccag atagcggccg ccgggttgca ggtcggcgat cagcggcgtg cgcttgaaca    163920
     cccgggccac gtcgtccagc gtgaaggcga tgccggcctc gtgcgcgatg gccggaatgt    163980
     gcagggccgc gttggtcgag ccgccggtgg ccgccaccgc ggcgcaggcg ttctccaggc    164040
     tggcgcgcgt caccagctgg cgcggcagcg ggccgcccgc ggccagggcg cgcatcacgt    164100
     gctcgccggc gcgctgcgcg atggccagcc gttcgctgta gaccgcgggc atcatcgccg    164160
     aacccagcgg cgacaggccc agcgcctcgc ccaccatggc catggtgttg gcggtgaact    164220
     ggcccgggca cgagcccgcc gagggcgtac aggtgcgctc catcgccttg agctcggccg    164280
     ccggcatggt gccgtgctgt acccggccga cggcttcgat ggtgtcgagg atggtgacct    164340
     ggccgctggc cgcatggccg ggcagggtgg cgccgccgta caggaacacc gccggcacgt    164400
     tcagccgcac gatggccatc atcatggccg gcagcgtctt gtcgcagccg gcgaacgcca    164460
     ccagtgcgtc ataggcgtgg ccgcgcacca ccagctcgac gctgtcggcg atggtctcgc    164520
     gcgacagcag gctcatgcgc atgcccgcat ggttcatcga ggtgccgtcg gagatcgaga    164580
     tggtcgagaa gctgaccggc acgccgccgc cggcggccac gcccaggcgg gcgcggtcgg    164640
     cctgcggccc cagcgccatg gagcagggcg tgttctcgcc ttgcgtgctc acgatgccga    164700
     ccatggattt ctccagggcg gcgtcgtcga agccggtggc gcgcaggaag gcgcgatgcg    164760
     gggtgcgcgt caggccttgg gtaaccatgc gggaacggtg cttatgcagg gacatgaatc    164820
     ggttccatgg aaaaggcgaa gaagggcggc gccggctagg gcatggcggg ctgcagcgcc    164880
     tgcagcctgt cgaaggccca gctgatgtcc tgcgccatga ccgcgcgcgc gctttcggcg    164940
     tcgcgccgcg cgatggcgtc gacgatggcg gcgtgcagct cggccgaggg gcgctcgtcg    165000
     gaatgcatca gctcgcgcgt ggcgcgcagg tagggcccgg actgcagcca caggctttcg    165060
     atggtggcca gcatcgagtc cgagcgcgcg gcgcggtaaa tggtgaagtg aaagcgctgg    165120
     ttgttctcca gcccggcctg gaccgacgcc gtatcgctga gcgacctgcc gatctggtcg    165180
     gccagcgcgc gcagctcggc cagttccggc gcggtgatgt gctcgaccgc ccaggcggtg    165240
     acatggccct cgatcagcac gcgggcgcgg cggatgtcct ccaggctggc gcgcgagatc    165300
     accggcacgc gcaccgagcg gctcttcatc ggttcgagcg cgcgctgcgt gaccagccgg    165360
     cgcagcgcct cgcgcaccgg catggcgctg gtgccgaacg catcggccag ttcctggatg    165420
     ccgagcaccg cgccggcggc gtagtcgccg cgcatcaggt ggtcgcgcag gcggcggtag    165480
     atggcttcgt tgacggaggt atggacgagc ggatcggggt gggtgagcgc aggcatttga    165540
     tctttgatca aagatttttc gctacgctac cgggccggga ggcaaggccg ccataggggt    165600
     ttgcccggtc aatgggtgtc aggccgaggg gcgcggcgtt cgcgtcactt cgactggagc    165660
     tttgcccggt cgcgatggcg gcggtcgcgc cgcttccctc ggccgccggg attcgcgtcg    165720
     cagcggggcg ttcacttcac cttgaccaca tcgtccggct tccacgtctg atcgtagaaa    165780
     gcgtcctcgg ctccatacaa tcgcaacgtg accaggaaat tgcgattcgg aatggtcttg    165840
     atgaaggcgg catccgctac gtcggcaggc ttttgggggc caaaccagat ttctgtcgag    165900
     ccgtcctttt gcttcggaat gtcgtaatag ccattcgtcg aaggcatcag ctggtcggtc    165960
     tcgggcatgg ttccgtcggt gacgttgtaa gccgtgaccg cccagaacag cgccgccggg    166020
     gcatcgggtg gcatgcgcag cttgtaggtg gccgacccgt tcaggaattc tccgttggca    166080
     tcacgcgcgg tgaaagggta tttggacccg gcgcccgtag tgcgcatcac catggccggc    166140
     gcggatgaat aggcgatctg gaagaatgtg gcgcgctggt tcacatccag gtagctgtcc    166200
     tgcatccatt ccgcggtggc gcctgcccag gcgcgttccc actgccgatc cttgtaatac    166260
     aggtgccgtt tgtcctcgcg tcccagttgc cgcatcgcca ggatcatctt cggcgccgtt    166320
     tccaccgccc tcttcagcaa ctcctgctcc ctggcagtgg gcttgaacgg ctgccctttg    166380
     acgatgccga tcgaggccag gacgccacgc agctcgggat cgatggccga gacgggttcg    166440
     tagtcgacga attccttgag tttggtccag tattcctgat cgacggggta catcatgttg    166500
     atgtgcttac ctgatccgtc gggaaactcc atgggtttaa tgtccttttc ttcggcccac    166560
     agaggatata cgcgcgtggt ttccgcggcc ttgacggcgg gtgccgggtc cggcttgccc    166620
     ttgccctggc ccatgatggt gcggaagaac agaaatacgt tataggtagg cgactttacg    166680
     acgaagtagc tgctgggtac gtggccatca tagtccggcg gtaatatcag atacaggccg    166740
     cctcgtgcgc ggtctggacc aatggcgccg acgtcggtga gggtgcgctg gaaaaaatcg    166800
     gtgaacatgc cgatgacgtt ggccggcgcc ttgaccacca gaggtccggt cttcttcaga    166860
     tccaggtagc tcatcgaata gatcacgtcg gcattgggcg tgggcaccat ggtgcgggcg    166920
     tccatgcgct ccttccagac tggaagcacg ttgtagcccg cgccaaacac cttctccgac    166980
     ccgtcgcgca tgccgatcac gttcaatgcc ggcagcatgg tcatgtaggc gtggatggcc    167040
     cgctgatagt agagctcgtc gcgcagcgtt tcggcctctt tggggtccag ccagttgcca    167100
     ttgttcagct gttgaaccag tggcgacgcc ggagtcgggg gttgtcccca tgcgggcgtg    167160
     gccagcggga gcgcgaccag cagtacgccg gttgtcagag cgagcttggg cggcaggtgc    167220
     atgaacggct ccagatagtg gcgcgttcgt cgcgcctgtg attgacgggc atcgacaggc    167280
     gcgaacgcct cgactgtgaa tgcagtcatt ctattttctt gacggccggc ggcttccaag    167340
     tgccgtccag gattgcctgt tctccccagt aggcacggat gtagagcgaa ataggttccc    167400
     tgggcgacgg cagccagttg gcttccttgt ccttgccggg agaggtcggt cccacatgga    167460
     tcgtcagcga tccatccggt ccgcgcacca gattcttgtt cttggttccc agcgagtacc    167520
     ggttcaggtc gttagggctg aacaaatggt gcttgttgta gagggtgagc gaccagaatc    167580
     ccttgacggg cggaagttgg cccgaggcga aggtgatttc ataccgcttg ccgccgtcca    167640
     ggactgcccc ggtggagtcg aagtcggtgt agaagtactg ggtttcgttg ggtcggttgt    167700
     cgaacatatt cgacttggcc gtgcccgtgc gattgaagta gtccaatccg gtctgagcat    167760
     tgttgaccga ccggttccag ttgttgccgg ccggcttgcc gttgtgcttc cattggaaga    167820
     aaggcgcgat cacctgctct tccgtttcct tggcaacttc gaccaaggcg ttcttgatgg    167880
     ccggatcctt tgccgcggcg tccatcatgg agcggaattg cacgtacatg gcttcctctc    167940
     caggcaaggg cggcaccatg tccagtacct gcccgaactg attgaagaac tcttcgggaa    168000
     ccacccaacg cgtttccccg gcgttggcgc tgtcggcgcc ggggttggga atgtcggcgg    168060
     tggactgcca gtcgagggac ttcatcttgc cgtcgaaatc cttcagtgga taaaagacca    168120
     cctggttgat ttttttctgg atggcctgtc gatcctcgtc cgtgtcgtcc atgaagatgc    168180
     gcgggatggc gttggccagg gccgtcgggc tgcggatgat cgcctgcacg cccgcgggtt    168240
     tctggccctt ccagttgggt ccgaccagca ggtagaaacc gggtttgctg cgataaggct    168300
     tgcccagctc gccgaactgg ttggtgcggt ggtcatagag cgcgtacacc cagaagcggt    168360
     cgccgaagtc gggcacttgc gcgatcacgg gctccgtgtc gagcgaaaag aaacccagtc    168420
     cgtagacgac gtcctggttc gggcaggtga cgaaggtttc ggcgggcagg atgtagtcat    168480
     gcagcatgcc gacctggccg cgtggcgccg cgggcaggat gccgcccagc aggcccggat    168540
     gtggcgcctt ggtgatccgc gcgttgcgat tgagcatatt caccatcggc cagccccata    168600
     cgtaggccag gcgcccgatg gtcctggcgt actccggatg catcacgatg tcggggggcg    168660
     gcgtgttgga agacggttgt cttgccgggg cggagtaggc gggcagggcc gggaacaaca    168720
     acgcggcgaa ggccaggatt gcgaggcagc gcttcatccc agtgctcctt gattgtttgc    168780
     atacgttgaa catccaacct ggccagggca aaccgccgtc ccggcttaca tggatctgaa    168840
     cattgcgcgg agcggtgaaa accgcacttc atggatgcgc aggccaccgc tggaaacggc    168900
     cggtccgggc ggcatgggcg gccggcagcg cgtacgatat tgttagcggc gacaggggct    168960
     gaagtccatg ctaattttgg caataattcg tctgccaccc atgagggatc catgcagctg    169020
     cgccgcttcg attcgttcgg agaattcgag agtgccgtcg tggacgtcga cctgaaggtg    169080
     cgcctgctgg ggcccaggga cggacgatgg aaactggggc atatcgatgt tgacggcatt    169140
     accgttcagc gcggtgtgga ggcggttccc aacctgtgcg aggcgtcggg atggcccgcg    169200
     catctgatgc tcttgctgtc cgcggggcgg cctgtcccga cctggttgaa cggacttccg    169260
     ttcgccgaag gcacggtagg cgtgctggcg ccggggcgag ggttcgtgtt ccgcgcggcg    169320
     ggtcccaacg aatggatgac gattgcgttg ccgtcggcgt catcgttgtt cgaggcggac    169380
     aacgaaacag gccgggtatt gcgcagctgg tgtcaatcaa cgcgcattct tgacgccgcg    169440
     ccctttgcga ttgggcaact gcgaaaggcg gcgttggtgg cggcggacgc gcggacaccg    169500
     cgcgccgccg gacgcgtcct gatcgagcaa gccgtcgtcg ccctggcgca gtcgtcgcgc    169560
     cagccgcact cggccatcct gggccgcccc gggatctcgc cgcatgcaat atgcgatgcc    169620
     gccttggccc tgttgaaaat gatggatgcg aggcggctgg cggacttgcc gatcagttcc    169680
     aggtcgcaga gaaaattctt caagcaatgt tttggtctgg ggccggcgca gtacctgcat    169740
     ttgatacggc tccatggaat ccacgaggcc ttgcaggacg tgcgcggcag cctggtttcc    169800
     atcgccgaga cattcgagcg gcatggctat ccctattccg cctatgccct cgctcgctat    169860
     caggccatct ttggcgagct cccgtcagcg acaagaaagg ggccgaaggc tgtcaggtaa    169920
     aggcgtttca agaaattggc tggcatggtg tgccgtgttc agacgccagc gcgcagtccg    169980
     gcggcggcca gataggcgtc gcgcgaaggc agcagatggt tgcggcacag ggccaccagg    170040
     gcggcgcggt cgccctggcg cagcgcctgg atcatggccc agtgttcctg gcgcgcgcgc    170100
     tcgcggtagc cggccgcggc caggctgccg aagcggatcg ggtgggtgcg gcgcgcgtat    170160
     tcctcgatgg cctgttgcag caccgggttg tcgagcaggc cgaacaattc gcggtggaac    170220
     cgctggttgc tgcggaacac gcgccgcgcg ttgcctgcgg ccaccgcggc gtcgtgctcg    170280
     cgctgcacgg ccaccagcgc ggccaggcgc gcctcgtcca cgggtagcgc gatgcgctcg    170340
     gccgcgcgcg tctccagcag ttcgcgcagg tcgtacaggt ccatgacttc gcgcgccgtg    170400
     aaggcgcgca cctcggcgcc cacgttgcgc ttgcgctcga ccgcgccgcg ctgctccagc    170460
     tgcgccagca cctggcgcac cgcgtgccgc ttcagcccga agcgcgccat cagctcgtcc    170520
     tcggtcaggc gctggcgcgg aaacagccgg ccgaagacga tgtcttcttc cagctgttcc    170580
     accgccaggt ccaggtccag ggcgtcggcg ggcggcgggt cggcgggcag ggcggtcagg    170640
     gtcatggcgg ctcagcgagg cggcacggtt tgcttgctgg cgggtgcgcg caggaagtcg    170700
     aagtctaccc cctggtcggc ctgcgtgacc gtgtcgagga acagcttgcg gtagccccgc    170760
     tcggcctgcg gccgttcgat cggctgggcg gccgcgcgct gcgccagctc ggcctcgctg    170820
     accagcaggc tgatctcgcg ctggcgcacc gacaggcgga tgcggtcgcc attgcgcacg    170880
     tgggccagcg gtccgccgat ggcggcctcg ggcgtgacgt gcagcacgat ggtgccggcg    170940
     gcggtgccgc tcatgcggcc gtcggatacg cgcaccatgt ccttgacgcc ggcgcgcgcc    171000
     agcttgcgcg gaatcggcat gtagcccgcc tcgggcatgc cgggcgcgcc ggtggggccg    171060
     atgcgcttga gcaccaggat gtcgtcggcc gtgacatcga gcgcgtcgtc gtcgatgcgg    171120
     cgcgccatgt cttcggcgtc ctcgaacacc acggcgcggc cttcgtgctc catcagccgg    171180
     gcgtcggcgg ccgactgctt gatgatggcg ccgcccggcg ccaggttgcc gcgcagcacc    171240
     gccagcccgc ccaccgggta gatcggggcg tccaaggcgc ggatcacctc ctgcgcgaac    171300
     ggcgcgggcg cggcgtcgag ctcttcgccc agcgtgcggc ccgagacggt gagggcgtcc    171360
     aggtgcagca gcgggcgcag ttcgcgcagc agcgccggca tgccgccggc cttgtggaag    171420
     tcttccatgt agtgctggcc cgagggcttg agatccacca gtaccggtgt ctcgcggctc    171480
     atgcggtcca ggccggccag gtcgatgtcg atgcccaggc ggccggcgat ggccgtcagg    171540
     tgcacgatgc cattggtcga gccgccgatg gccagcagca cgcgcaacgc gttctcgatg    171600
     gccttgccgg tcaggatgcg ctcgggcgtc aggcgcgccg cggccatggc cacggcggtg    171660
     gcgccggtgc gttcggccac gcggatgcgg tcggccgtga ccgcgggcgc cgaggcgccg    171720
     ccgctgatca tcatgcccag cgcctcggtc aggcacgcca tggtgctggc cgtgcccatc    171780
     accgagcagg tgcccacgct ggccaccagc tggttgttga cgtcggtgat ctcggcggtg    171840
     tcgatttcgt cggcgcggta gcggccccag tagcggcggc aatcggtaca ggcgccgacc    171900
     cgttcgccgc ggtgcgagcc ggtcagcatc gagccggtca ccagctggat ggccggcacg    171960
     ccggccgagg ccgcgcccat cagctgcgcg ggcaccgtct tgtcgcagcc gccgatcagc    172020
     accaccgcgt ccatgggctg ggcgcggatc atctcttcgg tgtccatcga catcaggttg    172080
     cgcaggtaca tgctggtggg ctgcgagaag ctctcgtgca ccgagatggt gggaaagtcc    172140
     accggcagcc cgccggccag catcacgccg cgcttgaccg cctcgaccag ttgcggggcg    172200
     ttgccgtggc aggggttgta gctgctgccg gtgttgacga tgccgatgac cgggcgcgcc    172260
     agcgcgtcgt cggtatagcc cgcgcccttg atgaaggcct tgcgcaggaa cagcgaaaag    172320
     ccggtgtcgc cgtagttggt caggcccttg gacaggccgc cgggcggctt gccgccttgg    172380
     tcgcgctggg tcatggaaca cctcgataat attattgata atcgtggcgg ctatcatagc    172440
     cagcgcgcaa tccaggccgc aagcgaattc caggattttc tttattgatc tgttttgtag    172500
     atcattcaat agaaaaatac gtattcatca atcaagaaat ggcgcctaca ctgcggccaa    172560
     agcgagcggg gcgcctgcac ccgctccgtc cagatccacc acccggcaca caggaggaga    172620
     acatccatgt ccgaccgtca atccgcgcgc ctgccgcgcc gcgccgccct ctgttccatg    172680
     ctggcgctgt gcgccggttt cgcgctgcag cccgtcgccg cgcagagcgc ctaccccgac    172740
     cgtccgatcc gcatgatcgt gccgtacccc ccgggcggcg ccacggacgt gatcggccgc    172800
     gtgctggcca aggaaatgag cggtgcgctg ggccagtcgg tggtggtcga gaaccgcgcc    172860
     ggcgcggccg gcaacatcgg cgccgacgtg gtggccaagg ccacgccgga tggctacacc    172920
     atcctgatgg gcgccatgac cagccacgcc atcaacgccg tgctctacca gggccgcgtg    172980
     tcgtacgaca tcgagaagag tttcgcgccc gtggccatcg tgggcacggt gccgctggtg    173040
     ttcgtggtca atcccgccgt gccggccgat tcgctgcaaa gcctgatcgc gctggccaag    173100
     tccaagcccg gctacctgac catggcgtcg gccggcaacg gttcgccgca gcacctggcc    173160
     ggcgaaatgt tcaagcgcgt ggcgggcgtg gacctgctgc acgtgccgta caagggcagc    173220
     ggcccggcca tgaccgacct gatgggcggc caggtgctca gcatgatcga gaccgtgccg    173280
     gcggcgcagg gcaacgtcaa gggcggcaag ctgcgcgcgc tggcggtggc ctcggcgcag    173340
     cgcgtcgaat cgctgcccga cgtgccgacc acggccgagg ccggcctgcc caatttccag    173400
     gtcagttcga tgttcggcat cgccgcgccg gccggcacgc cggccccggt ggtcgagcgc    173460
     ctgaacgccg tgctcaagga agcgctggcc aagcccgagg tgcagaccgc cttgctgaac    173520
     cagggcgcca tctcgacctg gaccacgcct gccgacgccg ccgcgcgcat cagcgccgag    173580
     cgccagcagt gggccaccgt gatcgccgaa gccggcgtga aggccgagta agcccggcag    173640
     cgggtcaggc ggcgtccagc cgctgcctgc cccgcaccag gtcggcgcct ttctcgccga    173700
     tcaggatggc cgcggcattg gtgttggccg ataccatcgc cggcatcacc gacgcatcga    173760
     tcagccgcag ccggtccacc ccgcgcaccc gcagctcggg gtccaccacc gaggccgggt    173820
     cgccgcccat gcggcacgaa ccgctggcgt ggaagaccgt gccgccgcgc gtgcgcgcga    173880
     actgttccag gtcggcatcg ccgcggatgg ctgcgcccgg catgtattcc tcgccgctca    173940
     ggtgctggcg aaacgccggc tggtggtaga tctcgcgcag cagtttcaac cccgccacca    174000
     gcaccttgat atcgtgcggg tcggtcaggt agttggcgac gatgcgcggc gcctcgaacg    174060
     ggtcggcgct gcgcagcgcc accgtgccgc gcgacagcgg ccggcactgc gtggccgacg    174120
     ccgaaaagcc cgagaagcca tgcagcgcgt cgccgggctt gtccaccgac aacggcatca    174180
     cattgaacag cacgtcggcg cgcccgtcgc gcgcgtgctc gctgcacacc atgccgccca    174240
     cctggccggc gcctacggtc agcggaccat cctggcgcag cagccagcgc gcgcccatgc    174300
     ccagcatctt caggggcttg cgcacgtcgt cgttgagcga gagcggatgc ttcagtttga    174360
     cgatgacgcg cgcctggtag tggtcctgca gattgcggcc gacttccggc gcatccacct    174420
     gcacggcgac gccgtggcgg cgcagcagtt cggccgggcc cacgcccgac agctgcagca    174480
     gctgcggcga ttgcagcgcg ccggcggcca gcagcacctc ggcgtcggcc tgcgtccgca    174540
     ccggctggcc gcgccggcgt tcgtccaccc attccacgcc gcggcagacg ccgccgtcga    174600
     tcagcaggcg cgtgacgcgc acgccggtca gcacggtcag gttgggccgg ccgcgcaccg    174660
     gatgcaggaa cgcggtggca gcgctgcagc gccagcgtcc cttgagggtg agctggtaat    174720
     tgcccaggcc gctgtcgcgc gcgccgttga aatcgggatt ggggtcgaag ccggcctgca    174780
     gtccggcctc gacccagtcg cggcacagcg ggtggtcgtt gcgcaggtcc gagacgcaca    174840
     gctcgccggc gccgccgtgg tattcgctcg cgccgccgct gtagcgctcg gacttgcgga    174900
     agtagggcag cacgtcgcga tagccccagc cctgcgcgcc ggcgcgcgcc cagtcgtcgt    174960
     aatccgcgtg ctggccgcgg atgtagatca gcccgttgat cgaactggag ccgcccagta    175020
     cgcggccgcg cggccagacg atggggcgct cgcccgtctc ggcctggggc tcgaccggaa    175080
     actgccacga gaagcgcgga tcgtagatcg agcggaagta ccccaccggc agccgcagcc    175140
     agaagttgcg gtcctcgccg ccggcctcca gcagcagtac gcggcaggcc gggtcggcgg    175200
     tgaggcggtt ggccagcacg cagccggccg agccggcgcc gacgatgatg tagtcatacg    175260
     aagcgcagag ggcgggcggc atcggatccc gggcgcgctc aggcgcgcac ggcctccagg    175320
     tagggtttgg gatcgaaata gcgctcggcc ggcaccggct gggcgatgtt ggcgctttgc    175380
     acgaagaagt cggtgacctg ctgcagccac ctggtcaccg tgccgtcggc atagcgctgg    175440
     cgccattcgg ccgcggtgaa atacttcgac gccttgaact gctctttcag gtccggcagc    175500
     gggacttgct ggtagtggtt cttctgcaag gccaccagcg cctcgtcggt atgcgacagc    175560
     aggtagtcgt tggtctcggc ccaggcctgg atcagggcat tgatgatctt ggggttcttg    175620
     tcgtagtagt cgttgcgcgc cgcccagccg cccacgatgg ccgcctcggg gtagaaggtc    175680
     gaggcgtcga gcagcttgcg cgcgccgggc agcttctggc ggatggtcac gtcgaacggc    175740
     acccacagcg ccaccgccgg caccgcgccc gaaatgaacg aggtgacggc ctcggccatg    175800
     cgctggttga cgatctgcac gtccttgccg gcctgcaggc cgacgctgcg cagggcgcgg    175860
     tccaggaaca cgtgcgcggt ggtgccggtg gtggtcgaga tcttcttgcc cttgaggtcg    175920
     gccagggtct tgatgcccgc gtcgtcgcgc acccacagct gggcggtggc gtattcgata    175980
     ttgttgacca ggaatacctt gccttgtccg cgcgccggga agttcgacac caccgcgccg    176040
     gtcgagagca tgtccaggct gccgcctatc atggcctgga acagttccag gccggtggtg    176100
     aactggatca gttccaggtc cagcccgtgc ttggcgaacg cgccggtctg ctgcccggtc    176160
     cagatctggc cgtcgacggc cggcgtatgc agatagccga cgcgcacctt gtcgcgggcg    176220
     cgcgccaggg aggggatgcc gatgccggcc atggcggccg ccagggcgcc ggtcttgagc    176280
     aaggttctgc gctgcgggtt catcatggtg tggctcctcg agtgggcttc aatcggacag    176340
     gcgcacggtc tggcgcgcct gcttggcata ctcttccatg accagcgcgc ggatgtgcga    176400
     gcgcagctcg ccaaagcgcg ggtcctcgtg caggttctcg gcccgggggt agccgaacgg    176460
     cacgtcgatg atggtgcgga tgcgcgccgg ccgcgcggtg accaccacga tgcgcgacga    176520
     caggtagatg gcttcctcga ccgaatgcgt gatcagcatg acggtcttgc cctcggtcat    176580
     ctgcacctgc agcagcaggt cctgcatggc cgagcgggtt tgcgcgtcga gcgcgccgaa    176640
     cggctcgtcc atcagcagga actgcggctt gaccgcatag gcgcgcgcca gcgccaggcg    176700
     ctggcgcatg ccgccggaca ggtgcttggg atagtggtgg gcgaagtcgc ccaggcccat    176760
     cagggtcatg tagcgctggc agatctgcgc ccgttcgccg gccgccacgc ggttgctgcg    176820
     caggttcagg ccgaaggcga tgttctcgcg caccgtcagc cacgggaaca cgccgtattc    176880
     ctggaagatc acgccacggt cgggcccggg cccgccgacc ggctggccgt cgagcagcac    176940
     gcggccggcg gtgggctgca cgaagccgcc caccagtccc atcatggtgg tcttgccgca    177000
     gcccgagggg ccgatcaccg agacgaactc gccctggcgg atttcgtaat tgatgccgtc    177060
     gagcacgcgc atcggaccgt cggcggtcgg gtagtccacg cagacatcct cgaagcggat    177120
     gcgcacgtcg gaggcgggag tcgcgctcat gcagggtctc cgtggtcggt caggcgatgc    177180
     ggtcctgcca ggccaccagc cggcgcgcgg ccgcgcgcag ggcgaggtcc atggccaggg    177240
     cgatgaagcc gatgcagatg atgccgacat agatgatgtc gagctggaag aacgaggagg    177300
     cgtcctggat cagcgcgccc agcccctgtt gcgccgcgat cagttccgag gccaccagcg    177360
     tggcccaggc cacgcccagc gccacgcgca gcgcggtcag catgtgcggg atggtcagcg    177420
     gcacgatgac cttgcggaag atctcgccgt cggtcgcgcc cagcgtcttg gccacgcgca    177480
     cgaagatcgg gttgatctgc gagatgccct cgtacatgac gatgacgccg gcgaagaacg    177540
     aggcgtagaa caggatggcg atcttggccg tctcgccgat gccgaaatac acgatgacca    177600
     gcgggatcag cgcgatgggg ggcagggcgc ggaagaagtt gatgaccgga tcgatgaagc    177660
     tgcgcacgcc gcggtaccag cccagcacga agcccaccgg caccgccagc agggtgccca    177720
     ggcagacgcc cacgaacacg cgctgggtgg acatgaggat gtcgtgcggc aggcgcgcct    177780
     gcatcagggc cacgaaccgc gtccagactt cgccggggct gggcaccagg gccgggctga    177840
     ccagcccgct ggcgcgtatg ccgtaccaga gcagcacgat caacaaccac ggggccagga    177900
     ccagcagcgc acgcatgagc gcggatcgac gcttcacgtt tcctccttgg ggattggcag    177960
     gcagcggctt gctcttattg tgatcagatc gtaccataga ccatacgtta agcaaataaa    178020
     gaattccgct gagcttatgg ccatcaattt ccacgacagt cccatcccgc gctacctgca    178080
     attggccgac ctgatgcgcc agcgcattgc ccggggccag tggggccagg ggcaccgcct    178140
     gccgtcgctg gaggaactgg tggcggagtt cggcgtggcg cgcgtgacgg tgcgccaggc    178200
     catcgacgtg ctcacgcgcg aggggctggt gtcgccgcag caggggcgcg gcaccttcgt    178260
     caccggcctg ccgcccaacg accgctggct gcaggtgcag accacgctgg ccgagctggc    178320
     caaggtctac cgcgacacca agcccaagat cgtcaacatc gacgaaacca tcaccaatcc    178380
     gccgctgacc gcgcaggatg gcgtggcggc cgagcgctat gtctacatgc gccgcgtgca    178440
     cgagcgcgaa gggcggccgt attgcgtcat caatatctac ctggacgaac agatcttccg    178500
     ccgcgatccg gtgcgctacc gcaacgaaac cgtcatcccg ctgctggtgt ccgacccggc    178560
     cctgcgcatc gcccgcgcgc accaggtgct gaccatcggc accgccgaca tggaagtcgc    178620
     cggccatctg caggtgccgg tcaatacgcc gatcgccgaa gtgcggcggc tgttcctcga    178680
     cgaggccggc aaggtggtgt acctgagcga agtctcgtat cgcggcgatt tcatccacct    178740
     ggaaatgaac ctgatcccct gaggacgcca tgacacgcga tgccgcttcg atcacgcccg    178800
     cgcgggtgcg cgcgcatgtg ttccgctatc cggtcagcac gccggtcaag acctcgttcg    178860
     gcaccatgca cgaccggccg gcggtattgg tcgaggtcga ggacagcgat ggcgcggtgg    178920
     gctggggcga ggtctggtgc aacttcccgg cctgcggcgc cgaacaccgc gcccgcctgg    178980
     tcgagaccgt gctggcgccg ctgctgaccg cgcgcgcgtt cgccgatccg gcgcaggcct    179040
     tcgcccatct cgaggcgcgc accgcggtgc tggccatcca gaccggcgag cccggcccgc    179100
     tggcccaggc catcgcgggc ctggacatcg cgctgtgcga cctggccgcg cggcgcgccg    179160
     gccagccgct gtgggcctgg ctgggcggca gcggcgatcg catcggcgtg tacgccagcg    179220
     gcatcaaccc cgaaaatccc gaggacgtcg tggcgcgcaa ggcggccgaa ggctaccgcg    179280
     ccttcaagct gaaggtgggc ttcgacgatg cgcgcgacgt ccgcaatgcc ctgcatgtgc    179340
     gcgaactgct gggcgcggcc acgccgctga tggccgacgc caaccagggc tgggacctgc    179400
     cgcgcgcgcg ccagatggcg cagcgcctgg ggccggcgca gctggactgg ctggaagagc    179460
     cgctgcgcgc cgaccgtccg gccgccgagt gggccgagct ggcccaggcc gcgcccatgc    179520
     cgctggccgg cggcgagaac atcgccggcg tggcggcgtt cgagacggcg ctggccgcgc    179580
     gcagcctgcg cgtgatgcag cccgacctgg ccaagtgggg cggtttcagc ggctgcctgc    179640
     cggtggcgcg cgccgtggtc gccgccggcc tgcgctattg tccgcattac ctgggcgccg    179700
     gcatcggcct gcaggcgtcg gcgcatctgc tggcggccgt gccgggcctg gccagtcccg    179760
     gcctgctcga agtcgacgcc aacgacaacc ccttgcgcag cctgctcagt ccggcgctgg    179820
     cgaccctgca cgaaggccgc atcacgctgg gcggcgcgcc cgggctgggc gttacgcccg    179880
     acctggcggc cttgcgcgcc gcctgcgccg ctcgctgaag gcgcccggcc tcgctagcgt    179940
     cgcgccggcg cggcagcggg gaacgcctcc tcatacagct tgccgagcca gtccacgaat    180000
     acccgcacgc ggggggacag gtggcggtgc gagggataca gcgcggacac cggcaagtcc    180060
     gggctcggcc aatcgctcag cacttcgacc agccgtcccg cgcgcagatc gtcctcgacg    180120
     tgaaagcgcg gcaactgaat caagccacag ccgcgcagcg cacagacgac atagttctcc    180180
     gcgtcgctga ccgatatcca gccattgagc gcgaacgccc ggatctcgcc gccgatgcgc    180240
     agttccagcg gatagtccac ggccgcgctg gcggcgaaga atttcacgac ccgatgcgcc    180300
     gcaagttcgt ccgggtggcg cggcgcgccg aaggcggcga gatattcggg gctggcgcaa    180360
     atgacttgcg gcatgacggc cagccgcctt gccaccaggg acgagtcgcg cggattgccc    180420
     gcgcggatca cgcaatcgat gccttccctg accagatcga ccagcctgtc gccgccgctg    180480
     accgcgaggt cgatgccggg atagcgcgcg cggaaatcat cgattcgagg caggacgatt    180540
     ttggtggcgt gcgtgctgtg catgtctacg cgcagcaggc cgcgcggatt ggaagcgacg    180600
     cgctgcagcg aagactgcgc atcgtccagt tcgctgagca catggacgca ccgctcgtag    180660
     aacgcctgcc cgtcgggcgt cgcgcgcacg tggcgcgtgg tgcggtccag cagccgcgcg    180720
     cccaggcggg cctccagttg cttgatcgca tgcgtggcgg tggcgcgggg aatgtccagc    180780
     gcggccgcgg cgcggctgaa gctgcccagc tcgacgatgc gggtgaacag ttgcagggag    180840
     tcgaagcgat ccataggcct gattgttgtc catgcttgaa tttagattcc aatccgcatg    180900
     catttattca tcaattttaa acgtggacaa tgggcgccat gtcctgcctt tcgacctgga    180960
     gcacctcaat gaacatggat atatccaagg ccgccatcgt cacgggcggc tcgcgcggca    181020
     taggcagggc cattgccgcg cggctggccg ccgatggctt tgcggtcgtc gtcaactacg    181080
     ccggcaatgg cgccaaggcc cacgaaaccg tggccgccat cgaatcggcc ggcggcaagg    181140
     ccatcgccat ccagggcgat gtcggcaagc cgcaagacgt ggcgaacctg ttcgcccagg    181200
     ccagggcagc cttcggccgc atcgacgtgg tcgtcaacag cgccggcgtg atgccgatgg    181260
     ccagcatcga tgtcgccaat ctcgacgcct tcgaccaggt catcgccacg aacctgcgcg    181320
     gcgctttcct ggtgctggcc caggcggcgg ccaacctcgg cgacgatggg cgcatcatcg    181380
     cgctgtcgac cagcgtgatc gccaagtcgt tgcccggcta tgggccctac atcgccagca    181440
     aggccggcgt cgagggcctg gtgcatgtgc tcgccaacga attgcgcggc cgcaacatca    181500
     cggtcaacgc gatcgcgccc ggcccggtcg gcaccgacct gttcttcaac ggcaagagcg    181560
     aggaagccgt cgccagcatc gccaggcagg cgccgatgga gcgcatcggc atgccggacg    181620
     aaatcgccgc cgccgtttcc ttcctggccg gcccggacgg ccgttgggtc aacgcgcagg    181680
     tgctgcgcgt caatggcggc ttcgcctgat ccaggcggat cgaaaggggg cgccgcatgc    181740
     ggcgagggcg cgggacccaa ggcgttggcc tgtcccgcgc ccgcccatgc aaaacccgcc    181800
     ccgaggggcg ggtgtgcggg ggcgctgggc gccggcctgc ttacttgccg gcttgcaggc    181860
     gcttttccat gcgcgccgcg cggtccggcg aggacgggtg cgagctgaac atgctgctct    181920
     cgccgccgtc gagctcggcc agcttctgga aggccgtcac caggcccttg cggttcatct    181980
     tcttctcggt gagcaggtcg aacgagaagt cgtctgcggc ggtttcctgc gactgcgaga    182040
     actgcgcgtt gatgaatttc tcggtcatct cgcccagttg cgaagcgctc agcgaagcca    182100
     ccacgctgtt gccggcggcg ccggcggcct ggcgcgcggc gctgaccgcg taggcggtct    182160
     gcatggcctt cttggtgtgg cccagcgcga cgtggcccat ttcatggccg atcacgccgc    182220
     gcagctcgtc gtcgttcatc aggtccatca ggccggtgta gacgcgcacg caaccgttgc    182280
     ccatggccca ggcgttgacg tcctcggtca tgtagacctt gtagttgacc ttctgcccgt    182340
     tgagcgtcat gttgccgaag ccgcgcatca gcttggtcag gcgcacgctg tacttgttgc    182400
     cggccggggc gatcttcgat tcctggtcgc tttgcttgca ggcggcgtcc gacagctgga    182460
     tgatgtcggc gtcggaaaga ttggccgcct tggccatgtc ggagcccgcc gaaagcaggc    182520
     tgttggtgtc catgctcttc atgctggcgc agccggccag cagcaggctg gcggccaggg    182580
     cgccgccgag cagtttcgtc ttgctcttca tcatgcattc ctctttcttc gaagccgagt    182640
     ttgggcggga gcgcgttcgt ccggcaggtg cgcgcgccgt cccgaggcgg cgcgcttcct    182700
     ggctcgcggc ccaggccgga tcgaaagttc gcgggctaga ctgtaattac cagtgacgga    182760
     tgggcgggtg ttattgattt tcaaactgca acagaatgcc agtgcaatga cgcggtaatg    182820
     tcggcgcggg cgccgcctgg ccgcataatc gacgcttgcg ccgcgccgcg gccggcgcct    182880
     tgcggagcac accatgcaag ccaacctgac tgtcatcacc ctgggcgtgg acgacctgga    182940
     gcgcgccctg cgcttctacc gcgacggact ggggctgccg accgccggca tcgtgggccg    183000
     ggagttcgag cacggcgcgg tcgtgttcat cgacctgcag gccggcctga agctggcgct    183060
     gtggccgcgc cgcagcctgg cgcacgatac cggcctgccg ctggcgccgc ccagcgccac    183120
     ggaactgagc ctgggccaca acgtgaccag ccgcgccgag gtcgacgcgg tgatggcgca    183180
     ggccgcccag gccggcgccg ccatcgtcaa gccggccggc gacaccttct ggggcggcta    183240
     cgccggctac ttccaggacc cggacgggca cctctgggaa gtggtccata acccgcagct    183300
     tgcgccggcg ggctgagcgg aggccgtccc ggggcggcgc ggcgaatcgg gcataatgcg    183360
     accggccgca tatttccagc ggttataagg ggcccgcgcg ccaggcgcgg gccccgtccc    183420
     attccatcga agccgccatg ccgtcccgtt ccgcgcagtc ctcctccaac gttctgcggc    183480
     ttgccgcggc acaggcgctg gccggcgcca acacgaccgt ggtgtacgcc accgccgcca    183540
     tcatcggcga ggcgctcgcg ccgtccaaat cgctggcgac gctgccgatt tcggtattcg    183600
     tggtgggcat ggccgccagc acgctgccgg ccggcgccgt ggcgcaacgc cacggccggc    183660
     gcgcggcgtt catgctgggc acgctgtgcg gcgtgctgct cggcctgctg gccgcgctgg    183720
     gcatctacct ggaatcgttc gcgctgttct gcgccgccat ggccttcggc ggcgcctatg    183780
     ccgccgtggt gctgacgttc cgctttgccg ccgccgagtg cgtcgaaccg caccgcaagg    183840
     cccgggccct gtcgaccgtg ctggccggcg gcgtgctggc cggcgtgctc ggcccgcaac    183900
     tggtgtccta caccatggac gcctggagcg gccatgtttt cgccggcacg tacctggcgg    183960
     cttcggcggt ggcggtgctt gccgccgtgg tgctgggcgg cgtcgacctg ccgcggccgg    184020
     cgcgcgccgc cgccgcgggc ggacggcccc tgcgggtcat cgcgcgccag ccgcgcttca    184080
     tcgcggcggt ggtgtgcggc gtggtgacct acatgctgat gaatttcctc atgacgtcgg    184140
     cgcccctggc gatgcgcatg catggcctgt cgcagcacgc ctccaacctg ggcgtgcaat    184200
     ggcacgtcat cgcgatgtac gcgcccagct tcgtggccgg cgggctgatc acccgccacg    184260
     gcgcggtgcc ggtggtcgcg gccggcctgc tgctgaccgc ggccgcggcc gtggtcggcc    184320
     tggcgggcat ggacgcatgg catttctggg tgtcgctgac gctgctgggc gtgggctgga    184380
     atttcggctt cgccggcgcg tcggccatgg tgctggaatg ccatctgccg caagagcgca    184440
     cgcgggtgca ggccgccaac gatttcatca tcttcggcac catggtggtg ggctcgttcg    184500
     tctcgggcga tctgctgatg cgctacggct gggaagtcgt gtgctggctg gcgctgccgc    184560
     cgctggccgt ggccgcgttc gcgctgcgct ggttcaagcc gctgccggcc ggcgccgcgg    184620
     gcagcgccta gcagggatca caccgcctgg cgcaggcagg cgatgaaatg ggccgtatgg    184680
     gtgccatgca cgccgtcggc ccgccacagc atgccgatgg ggccgccgct gcccagcgtc    184740
     agcggcagga tgcgcagcac gccctggcgc tggaagtgct cggccagccg gcgcgacatg    184800
     ggcgcgatca tgtccgagcg gtcgagcagg gcgacgttgg tctgcaccga ggtcgactcc    184860
     accgcatggc gcggcagggg ctggccggcc acggcgagtt ccatttccag ccgcatgcgc    184920
     agcggcgtgc cctgttgcgg cgagatccac ggataggcct gcgcgtcctc ccagctgatg    184980
     cgccggcggc cggccagcgg atgcgcgcgg cccgccacca ggcagaccgg ttcgtcgtac    185040
     agcgtctcgc agcggacatc ctcgggcatg gcaacctctt ccaggcgccc gacgacgata    185100
     tcgaaatccc cgttgcgcag gcccggcagc agcagatcga tcgaggcttc gatcacgctg    185160
     accagcacgt ccggataggc ggcgcgaaag cgccggatgc tttcgggcag cacgaccggc    185220
     cccaccaccg gcgagaaacc caccgacaga tggcccgcga aaccgcttgc gatgtggtct    185280
     accgcggtac gggcgcgttc gagccggccg atgatggcgc gcgcgtgcgc ctgcagttcg    185340
     cgcgcgcagg ccgtcggcgt cacgccgcgc ggctcgcgca cgaacaggcg ctggccgatg    185400
     tcggcctcga ggtccttgag ccatttcgac agcgcgggct ggctgatgcc gtattcgttg    185460
     gccacttcgg tcaggttgcc ggtttcgcac aggcgtatca gcaggcgcag gtggcggggc    185520
     cgcagccggt cgatccagtt cgtgagcatg ggcgtcggat atgacataac taatgggtta    185580
     tggaattcta atatcttttc atttttcatt tatgtttagg gcacgcacaa tcgggcctcg    185640
     tcgtgtactt atgtccggct tgcgccgcac ctgccatgtc ccagcccaat ttcctgctgt    185700
     tcattaccga ccagcaccgc gccgatcacc ttggtgccta cggcaattcg cagatccgca    185760
     cgccggcgct cgacgccctg gcgcggcgcg gctggctggc cgagcgcttc tacgtcgcct    185820
     cgcccatctg catgcccaac cgcgccaccc tgatgaccgg ccggatgcct tcggcgcacg    185880
     gggcgcgcca caatgggatt ccgctgtcgc agcgcgccac caccttcgtc gagcgcctgc    185940
     gccaggccgg ctatggcacg gcgctggtgg gcaagtcgca cctgcagaac atgacgggca    186000
     acggtccggt ctggccgcgc ccgcaggatc cgcccgccga gggtgaggcc tgggcgcccg    186060
     agccgggcga ctacgaccag gagtgggggc ccttgtggcg cgaggatccg gcccatgacc    186120
     tggccacgcc gttctatggt ttttcgcagg tggacctggc ggtcgaccat ggcgaccggg    186180
     tctgggggca ttactggcgc tggctgcagc gcgagcatcc ggaggtcgcg gcgcaggccg    186240
     ggcccgacca tgcgctgccc gcgcccggct tcgaactggt gcgggcaggg caggcctggc    186300
     gcacgcgcgt gcccgaatcc tgttcgacca cggcctacct gggccgccgc accatgcagg    186360
     ccctggacgg ctacgcgcag cgcggacagc cgttcttcat ccagtgctcg tttcccgatc    186420
     cgcaccatcc gttcacgccg ccgggcaagt actgggacat gtaccggccc gaggacgtcg    186480
     aactgcccgc gtccttccat gccagcgcgg ccgccggcag gcagcccccg ccgcacgtgc    186540
     agtggatgta cgcgcagcgc gacagcggcc gcgccgtcaa gcacacgccg gcgatgttcg    186600
     cctgcaccga gcgcgaggcg cgcgaggcga tcgcgctgaa ctacggctcg atctcgcaca    186660
     tcgaccacac ggtgggcgaa gtgctggcgc atctgcagcg gctgggcctg gcggacaaca    186720
     ccgtggtgat cttcaccagc gaccacggcg actacctggg cgaccaccag ttgctgtgga    186780
     aagggccggt ccactaccag agcgtcatcc gcaccccgtt catctgggcc gatccggccg    186840
     gcgcgcaagg cgcgcgcagc gacgcgctgt gctcgaccac cgacatcgcg cccaccatcc    186900
     tggcgcgcgc cggcctgctg ccctacaacg gcatccaggg cgccgatctc ggcgcgctga    186960
     tgcgcggcga gcaggccgcg ccgcgcgagg ccgtgctgat cgaggaagaa ggccagcgcg    187020
     tcatgttcgg tttcgacaag cgggtgcgca tgcgcaccct gcagaccggc cgttaccgca    187080
     tgagcgtcta tcacggcgtg tcctggggcg agctgtacga cctgcgcgag gatccgctgg    187140
     aattgcgcaa cctgtgggac gagccgggca gcgccgcgct acggcaggac ctgctgttcc    187200
     agctcgcgca gaacctgatc gggcatggcg agaccagccc ccatccgacc gcgctggcct    187260
     gaccgccagg caagcgcgcc aacagaattc gaggagacaa gacatgcgta ttttccaagc    187320
     cctgcgccac gcggccctgg ccgccgccct gagcctgggc gcggcggcgg ccgccaccgc    187380
     cgcctatccc gacaagccgg tgcggctggt cgtcaacttc acgccggccg gtccgctgga    187440
     cctgctggcc cgcctggtgg ccgagcgcgc cagccgcgag ctgggacaga ccgtcatcgt    187500
     cgagaatcgc gccggcgccg gcggcaatat cggcgccgac gtggtggcca agtccgcgcc    187560
     cgacggctat acgctgctga tcaccaccga tacgctggcc accgtcaatc cgttcgtcta    187620
     tgcaagcatg ccggccgatc cgttcaagga cctgcagccg gtggcgctga ccggcacgtt    187680
     caaccaggtg ctggtggtcc agcccagcct gggcgtgcgc aacctggccg actacatggc    187740
     ctatctcagg cagcacggcg gcacctacgc ctcggccggc aacgccacgc ccggccacct    187800
     gaccttcgaa agcctgcgcc aggcgctcga cctcgacgtc acgcacgtgc cttaccgcgg    187860
     caccgcgccg gcggtcaacg atctgctcgg cggccaggtc gaggcgggct ttctggtggt    187920
     gccgggcgtg ctgcagcata tccaggcggg caagctggtg ccgctggccg tctcgggcgc    187980
     gcagcgcgac gccgcgctgc ccgacgtgcc gacgatcgcc gagtccggcc tggcgcaggt    188040
     gcgcgacttc gacaccagct tcggctatct gctgatggcg cccgcgggcg tgccggacga    188100
     ggcggtccag gcctggcaac gggtactggc caggatctac gccagcccgg aattcctcga    188160
     gcggctcgcg gccctggata tcgcgccgac cttcggcgac gcgcagcagg cggcgcagtg    188220
     gatgcgcacg cgcgcggcgc gctgggaaaa ggtggtggcg gcggcgggca tcaagccgta    188280
     acgccccgcc tgcccggggc ttcactccgt ggcaggcacc ttgcgcgcgc gcatcagccg    188340
     gccccatgcg cgcgcaaagc cgctggccgc gccggccagc acggcaaagc ccagcgcggc    188400
     cgacagccag ccgatgcgcg cgaaaccggg aaacgcgccg tacagccagc ccaggccttg    188460
     cgacagcgcg accatggcga ccgtgccgac gatccagccg gcaatcagcc agcgcgcccg    188520
     gcgctggcgg accggcgcga aactgaggtg gtacacgatg cgcgcgcagt aatacgcggc    188580
     cacggccgcc agcgccgtca ggaaaaccga cgcgtcggcg atggcgccgc tgaattcggc    188640
     cgattgccag ctctcgccga tcagcagcca ctggcggcgc ggcgccggat agggaatcca    188700
     ggtcgccacg cccagcgcgc ccgccagccg cgccaggccg gcgtagcaca gccagccggt    188760
     ggccgccgcc gccaggccgg ccagccagaa gcgcaggcgt tcatggcgca tcatcggcgg    188820
     tttctcgcgg gcgggcggta cgaatggcgg ggggcaggcg ggttcaagag cggcatgggc    188880
     ggcatgggcg gcggggtcgg cgttgcgcaa ccgtatcggc gcgaacggcg gaaatcaacc    188940
     gcggggctga gtccggcctc attccatccg ccatctggat gagaaaaact atatcgtaga    189000
     gcgatatgaa ttaatgcttt tggattaggc cggcacgaga atcacgcgcg aaaggcccgc    189060
     aaaatcgtac tgcggaccaa ttatttcatc gtaatatcag cgcgttgcag cgatgctttc    189120
     agtttgaaag cagaccgtaa gctaatcgta aacccggggt tttcaagcaa aagcatcgtg    189180
     ctacgatcta ttccgttttc ctgatggcgg cgttccggtc gcaatccgtt acaccactct    189240
     gtgccccgtt cggccggtat cgtgaccatg tgccgcgacg ggggcagcag caaaagaaag    189300
     gaaaggggcg aaatggaact gctgcaaaat ctggcgcttg gcttttcggt agcgttcacg    189360
     ccggaaaacc tgttgtacgc gctgctgggc tgcgtgctgg gcaccctggt cggcgtgctg    189420
     cccggcctgg ggccggtgcc caccatcgcc atgctgctgc ccatcaccta tgtgctgccg    189480
     ccggtggccg gcctgatcat gctggccggc atctactacg gcacgcagta cggggggtcg    189540
     accacggcca tcctggtcaa cctgcccggc gagacatcgg cggtggtgac cgtgctcgat    189600
     ggccaccaga tggcgcgcaa cggccgcgcc ggcgcggcgc tggcgctggc ggccatcggt    189660
     tcgttcttcg ccggcactgt cgccaccatg ctgatcgccg ccttcgcgcc gccgctggcc    189720
     gaagtcgcct tcaagttcgg cccggccgaa tatttctcgc tcatggtgct gggcctgatc    189780
     ggcgccgtgg tgctggcgtc gggctccatc ctcaaggcgg tggccatgat catcctcggc    189840
     ctgctgctgg gcatggtcgg caccgacgtg aactccggcg tggcccgcta cgacttcggc    189900
     atccccgagc tgcaggacgg catcgacttc gccatcgtcg ccatgggcgt gttcggcttc    189960
     gccgaaatcc tcaccaacct ggaacagaag gaaaaccgcg tcgacatcac cgacaaggtc    190020
     ggttcgctgt atccgaacaa gcaggaaatg cgcgaagccg cgccggccat cgtgcgcggc    190080
     accgcgctgg ggtcgtgcct gggcatcctg ccgggcggcg gctcggtgct gtcggccttc    190140
     gcctcgtact cgctggaaaa gaagctgtcg cgcaatcccg agcgcttcgg caagggccat    190200
     ccggccggcc tggccggccc cgaatcggcc aacaacgccg gcgcgcagac ctcgttcatc    190260
     ccgctgctga ccctgggcat cccgggcaac gccgtgatgg cgctgatggt cggcgcgatg    190320
     accatccaca acatccagcc gggtccgcag gtcatgacca gccaccccga gctgttctgg    190380
     ggcctgatcg cctcgatgtg gatcggcaac ctgatgctgg tggtgctgaa cctgccgctg    190440
     gtcggcctgt gggtcaagct gctcaaggtc ccgtaccgca tcctgtaccc ggccatcctg    190500
     gtgttctgca ccatcggcgt gtactcgctg aactacaacg tcttcgacgt gttcgtcacc    190560
     gccatcttcg gcgtggtggg ctatgtatgg tccaagctga aatgcgaggg cgcgccgctg    190620
     ctgctgggcc tggtgctcgg ccccatgatg gaagagaact tccggcgcgc gctgctgctg    190680
     tcgcgcggcg acttcctgac cttcgtcgag cggccgctgt cggcctcgct gctgggtgcg    190740
     gcggccctgc tggtgatcat cgtggcgctg ccgtcgatcc gcaagaagcg cgacgagacc    190800
     ttcgtcgaag aagaatgatc gcagcgtgaa gttgagtgat tgcgggtgtt ggcgacggca    190860
     cccgtttttt ttggggtggc catgtttcgc atggggcctg gcgccccgcg acggcttact    190920
     tgcgccgata cgccggcgaa tcgaaatagc tcagcagcgt acgcagcagc ggtccgaccg    190980
     agcgcagttc ctcgacgtgc gcggccgaca gcgtatccag cgtgtgctcg gccagcgggg    191040
     tcagggccac cagcacgcgg cggcggtcgg cgttgctggg aatgcgccgc accatatcca    191100
     tgcgcgcgag ccggtcgacc agttcgccgg cgctgtgatg gcggatcagc agccggtcgg    191160
     ccagttcgcc tacgctcagc gtgtcgtccg atgccttgat ggccagcagg gcctggtgtt    191220
     gctgcgcggt caggccgctt tcggtggccg cggcttcgct gaaggccatg aagcggcgca    191280
     gcgcgtagcg caggtccgcc agggcggcaa aatcggcttt atccagcttg cggccgcgtg    191340
     gcggcgcggg gctgggggaa gaggtctgga cgtctgacat ggcaaggccg gcctatgatc    191400
     tgtacatttt cgaccgcgcg ccaaccgggc gggcgcgtac gcaagaatca ttctagaaga    191460
     aatggggcag gggcgttgtc agcctgccgt caagcggcgg cgtgccaggg atcgacggcg    191520
     gcgagcccgg ccgcctcgaa cctggccgga tggcgcgtgg cgatggccag gccgtgcgcg    191580
     gtggcgatgg cggcgatgca gccatcgatt gcgcacagcg catggcccgc cgccgcggcc    191640
     cgcatcatga cggcggcgta ggcatcggcc gcggccgtgt cgaagggcag gacatggccc    191700
     atgaacagcg gcaggatgcg ccgctcgaat tcgtggcgca gggcctcggc ccgcttgccg    191760
     cgcggcaggc gggccagccc gagctggatt tcggccgcgc cgggcgcggc caggtacagg    191820
     gtttcgacgt gctggccatc cagccatgcc gcgacggccg ggtcgggggc cggccgcagc    191880
     ggctcgagca gcacgtcggt gtcgagcagg atcattcgaa gctggccggg cgggcgggcg    191940
     ccggattgcg ctcgatggtc aggtccatgc cgcgcgcgcc ccggccgatg tggctgagca    192000
     gggtgcccag cttgacgcgg ccatcgggca gcacggcgtt ttccaggatg gcgcggatct    192060
     cggcctcggt gctgcgccca tgcgtggccg cgcgtacgcg caaggcgcga tgcacttcct    192120
     cgggaacatt tcttaccgta atcgaagaca cgacagcacc tccatttttt gcatgcaatg    192180
     atttcatttt agcaaaatgc aatcatttcg gcaatggcgc ggcttcagcg ctgggcgtcc    192240
     agccactggc gcgccgaagc gcccatccgc tgccggaagg ccttggacag cgccggcacg    192300
     ccggcaaagc ccagctcggg cgcgatgcgc ttcatggggt ggccggcgcg cagcatggac    192360
     gccgccaggc tcagccgcca atcggccagg taggccgcgg gcgtgacccc cgtcgccgtc    192420
     ttgaacgccg cggcaaaggc gctgcgcgac atgcccgcga tatccgccat ccgcgtcaac    192480
     ggccaggcct ggcctggcgc gccgtgcaac gccgccaggg ccttggccag gcgcgggtcc    192540
     gacaggccca tgatcagtcc gttgctcacg ccgacctggg ccgggtggtc gagcatccag    192600
     cgcagcagct ggatcagcac gacctcgaac aggcggtcgg ccaggacgcg cgaaccgcaa    192660
     cgcacctgat cggcctcggc gaacagcagg tccagcgcgg gccgcaggcc ggccaccgcg    192720
     tccagcggca cgcagacgac cggcggcagc gagcgcacca gcggatgacg gtcgccgcct    192780
     tcgaaatcca gcgtggcgca ggtcaagtcg ggcccctcgg cgggcgggtt gatgaactcg    192840
     tgatgcaagg gacgcgggta gaacagcaga gtgggctcgg ccagccgcag gcgcggcagc    192900
     gcggtttcgc ccgggcggtg gcgcacttcc atatcgccgc ggcgcaatac gtgcaggaag    192960
     gcgcgcccgg gctgcgcctc gaagcggtgg tggccgcaca gcgtgccggc gtggaacagg    193020
     gcggtgcgca cgcggaagcg ttccagcagg gccgacagcc tgtccacggg cgccggcgcg    193080
     gccgaggttt tagacgattt ggaaactttc atggacgaaa ctcgattttt tgtccagata    193140
     ttctacgtac gatgggctgg tccgtcacgg cggaccttat ccctaccgtt tccaggagca    193200
     agccatgtca cgtgttcccc tgatcgatcc ctcccaggcc ggcgccgagc gccaggcgat    193260
     cctggcgcag atccaaggcg cgttcggcgc cacgccgaat atgttcaagg ccgtggccaa    193320
     ctccgccgcg gcgctcaaga gcatgtggga ggcattcggc gcgctgggcg gcggcgtcat    193380
     tgccgcgcgg ctcggcgagc agatcgccgt ggcggtggcc aaccgcaacc gctgcgaata    193440
     ctgcctggcc gcgcacaccg cgctgggccg caaggccggc gccagcgccg gggacatggc    193500
     ggccgcgcag gacggccgtt cggccgatcc ccgcacggcg gcggcgctgc gcttcgcgct    193560
     gcagctggtc gaggcgcgcg ggcaggtcgg cgaggccgag gtgcaggccg tgcgggccgc    193620
     cggtttcagc gacgaggaaa tcgtcgagat ccttgcccac gtggcgctca acctgttcac    193680
     caactatgtc aacgtcgcgt ttgccgtccc ggtagacttt cccaaggtcg cgctgcgcca    193740
     ggcagcctga gcgtcgcgcc ggcccgccgc gccgcgccgc gggccgcgtc cattccccag    193800
     gagccgccat gtcccgccac gaagccctcg ccaccgttac cgcgccgccc ttgcaggtgg    193860
     acgcatggct caataccccg cacccgctgg agctggcccg gctgcgcggg caggtggtgg    193920
     tgctgcacgc cttccagatg ctgtgcccgg gctgtcttgc gcatggcctg ccgcaggccg    193980
     agcgcctgca ccgcctgttt cgcgacgacg gcgtggtggt gatcggcctg catacggtct    194040
     tcgagcatca tgcggtcatg gggcccgagg cgctgcgggt tttcaatcac gagtaccgct    194100
     ggagctttcc gatcgggatc gaccgccccg atcccgaggg cgacatgccg atgaccatgc    194160
     gcgcctacag cctgggcggt acgcccagcc tggtgctgct ggaccgccgc gggcggatcc    194220
     gcctgcacca cctgggccgg ctcgacgacc tggccctggg cgcggcgatc ggccggctgc    194280
     tggccgagga cgccgagtcc gcgggcgcgc cgccggcgtg acgtccgggc gcgccatgcg    194340
     gtagcctatg cgggaggccc ggccgcgcgc cggccgggcg ttcgcgacag gaggcgatgg    194400
     catgaccggc aagacggcat tcaggatcgg cgaccacgtg gcctggaact ccgaggccgg    194460
     ccaggtgtcg ggcaccatca tcgccatcca cacgcgggac ttcgattaca aggggcacac    194520
     gcatcgcgcc tcgcccgacc atccgcagta cgaaatcaag agcgacaaga ccgatcacat    194580
     cgccgcgcac cgcggcgagg tgctgcggcg cgtgcgcgca aagggcgggg catgaggccg    194640
     ccgtttcata ccataggcca ttccaaccgc agtctcgagg ccttcgtcgc cttgctggag    194700
     gcggccggca tcgagctcgt ggtcgatatc cggaccgtac cgcgctcgcg cgccaacccg    194760
     cagttcaacc aggacgcgct gcccggctcg ctggacgggc gcggcatcgc ctacgaacac    194820
     ctggccgcgc tgggcgggct gcggcccaga tcgcgcacgg tgccgcgcga ggtcaacggc    194880
     tactgggaca acgacagctt ccacaactac gcggactacg cgctttcgca ggccttccat    194940
     gcgggcctgg agcatctcgt tgcgcgcggg cgcgcacagc gcagcgccgt catgtgttcg    195000
     gaggccgtgt ggtggcgttg ccaccgccgc atcgtggccg accatttgct ggcccggggg    195060
     gagaccgtgt tccatatcat ggaagcgggc cgcatcgatc cggccagcct gacgccgggc    195120
     gcgctcgtgc gcccggacgg catggtggtc tatcctggcg cggacgccgc tgtgcgcccg    195180
     cccatgccgt gatgtggcta caaggcgcgg cgccgactag aatgagtgcc agcccgaccg    195240
     cagaccttgc caaccgccta tagagaccca tgcctcagaa caatccggaa ccacaggccg    195300
     tcgtcagtcc gatcacacgc agcgccattt tcctcgtcgc cactgtcggc gccgacaacg    195360
     aagccgccga caaggtccgc gccctgtgcg gcaagctggc cgacctggcg cgcgccgtcg    195420
     gcaagcgggt gccggccggc aatctttcct gtgtatgcgg tttcagcgcc gcgggctggg    195480
     accgcctgtt cggccagccg cggccggccg agctgcaccc ctttcgcgaa ttcagcgccg    195540
     gcgagcgccg cgctccggcc accccgggcg acctgctgct gcacatccgc gccgagcaga    195600
     tggacctctg tttcgagctg gccacccatg tgatggcgca gctgggcgac gccgtcaccg    195660
     tggtcgacga agtgcacggc tttcgctatt tcgacctgcg cagcctggtc ggcttcgtcg    195720
     acggcaccga aaaccccacc gggcgcgaag cgctggattt caccctggtg gacgacgccg    195780
     atccggattt cgccggcggc agctacgtcc tggtgcagaa atatctgcac gacatggacg    195840
     gctggaacgc gctgtccgtc gagacccagg agcgcatcat cgggcgcacc aagctgtcgg    195900
     acatcgaact ggacgaggcc gtcaagccca gcaactcgca cagcgccctg accacgctcg    195960
     aagaaaacgg ccaggaaatc aagatcctgc gcgacaacat gccgtttggc cggcccggct    196020
     ccggcgagtt cggcacctat ttcatcggct atgcccgctc gcccgcgccc atcgagcaaa    196080
     tgctcgagaa catggtcgtg ggacgcccgc cgggcaacta tgaccgcctg ctcgacttca    196140
     gccgcgcggt gaccggcggc ctgttcttcg cgccttcggc cgacctgctc gaagcgctgg    196200
     ccgaacgcga cccgcaagac accgacggca gccggcctga ccccgcgccg gccgcgcgcg    196260
     cgccgcatga cggctcgctg aacattggct ccctgaaagg aaacccccag caatgaacaa    196320
     cctgtatcgc gacctggctc ccatttccgc cgccgcctgg gcgcaaatcg aagaagaggt    196380
     ggcgcgcacc ttcaagcgtt cggtcgccgg ccggcgcgtg gtcgatgtca aggatcctgg    196440
     cggcttcggc ctggcggccg tgggcaccgg ccacctgcgc ggcatcgccg cgccgcagaa    196500
     gggcgtcgac gccaagctgc gcgaagtcaa ggctctggtc gagctgaccg tgcccttcga    196560
     gctgcagcgc gacgaaatcg acgccgtcga gcgcggcgcc aacgatgccg actggcagcc    196620
     cgccaaggac gccgccaccg aactggcgta tgccgaggac cgcgccattt tcgacggcta    196680
     caaggccgcc ggcatcgtcg gcatccgcga gggttcgtcc aacagccggc tcgaactgcc    196740
     cacggacgcc gccgactacc cggcggccgt cggccgcgcc ctcgagcagc tgcgcctggc    196800
     cggcgtggac gggccgtact cggtattgct gggcgccgac gcctacaccg ccctgagcga    196860
     gggcagcgac gacggctacc ccaccatcga ccacatcaag cgcatcgtca gcggcgacat    196920
     catctgggcg ccggccctga acggcggctg cgtgctctcc acgcgcggcg gcgacttcga    196980
     actgcacctc ggacaggacc tgtcgatcgg ctaccagagc cacaccgaca aggtcgtgcg    197040
     cctgtacctg cgcgaaaccc tgaccttcct catgctcacg agcgaggcgt cggtcccggt    197100
     ggcgcccaag ggatagggcg gacgcggcgg gtccggccga tggccaggcc cgccgcgctt    197160
     tccccccggc ctacatgtgg ctgggcagcc acaaggccag ttgcggaaac agcaccagga    197220
     tcagcacggc cagcgcttcc accagcacga acggcagggc gcccatggtg atgtcgcgca    197280
     gcgagatctc cggcgccacg cccttgatga catacaggtt caggccgatg ggcggcgtga    197340
     tcaccgccat ctcgcacatg atgatcatga ccacgccgaa ccagatcgga tccaggccca    197400
     gcgacgtgat caccggaagc acgatcgggg tcgtgatcag gatgatcgag acgatgtcca    197460
     ggaacatccc gacgatcagc aggaagacca ggatcagcag caggatcacc caatccggct    197520
     gggccagcgc ggcgacccag gcgatcagca tctgcggcgc ctgcaggcgc atcaggacat    197580
     ggccgaacaa cagcgcggcc gccacgatca gcaggatcat gctgctggtg acgatggtgg    197640
     agcggacgat ctcgcgcagc ttcgcgcggt ccagttcgcg gtagccgagc gccaccagca    197700
     gcgcgccggc cgcgcccagg cccgaagcct cggtcggcgt ggcgatgccc agatagatcg    197760
     tgcccagcac ggcgacgatc agcacaatgg cggcccatac atcgcgcagc gcctgccagc    197820
     gctcccgcca cgagaccttc tgcgcttcgt ccggcgccac cgagggcttg atgcggctca    197880
     atccgtacag ataaagcatc atcaggacgc tgagcagcag gccgggcacg atggcggcgc    197940
     tgaacagctt gccgatcgac tggctggcga tctcgccata cagcacgaag cccacgctgg    198000
     gcggaatcag caaggccagc gaacccgccg cggctaccga tccgccggcc aggccagggt    198060
     catagcggcg cttgagcatc tccggaatgg cgacgcggcc tatggtggcc gcgccggcca    198120
     cgctgacgcc gctcatggcg ccgaagatgg ccgaggcccc cacgctggca atcgccaggc    198180
     tgcaacgcac gcggctcagc caggtgtaga acaaggtata gaggcgcgcg ccgatgctgg    198240
     tgcgggccag cgtctcgccc atcaggatga acagcggaat gcagatcagc gagtagctgg    198300
     cgatgccgcg atgcagcacc gacggcacga cgttcagcgc cgaggcgccg cccaccagat    198360
     agatgccgag aatgctgggc acgcccagcg cggcgaaaat cgggatgccc aataccagca    198420
     gcaggccgaa cagcccgagt atcacggtca gaatgagtac ggcgtccacg ggtcatgcct    198480
     ccgggctggg tggcgcaatg gcggcgttgc cgtcgggatg gttcagcttg cacgcggcgg    198540
     cgatcgccaa gagcagcgcg ccgaccgcga tcagtccgta ggcgatccac atgggaaagg    198600
     ccagcaggga cgtcgagcgg taattgcgcg ccagtgccgt ggcggcgatc tggacgccgg    198660
     catgcagcag gaagccgcag aacaccagca ccaccagctc gcgaaacacg ttcagcagcc    198720
     gcttgccgcg tccgcgcacg cggatgctga gcatttccat gctgacgtgg cgctcgagca    198780
     gatgggtcca gcccaccgaa agccaggtca ccagcagcaa caggtaaatg ctgatctcca    198840
     cggcgtggac gctgggctgc tggagcacgt accgcgcgat gaccgagtaa acggtcagca    198900
     gcatcatcag cagcaaggct gcctgcgcga tgaaaacggc ggcccggttg gttccgtggc    198960
     cgatccgtgt cagccgatca agaagcgatt tcatgggggg gatccagatc gataggcggt    199020
     catgtcgaaa gggcctcagt tcgcccgggt cttttccagc agctccaggt ggcggctggc    199080
     cgcgggctcc tgcgcgaccc actcctggac cgcgggctgg gtcgcggcgc gcatatcctg    199140
     caaggcggcg ggttcgatcg tgtacacgga tacgccattc ttctcgaact tcgccacgcc    199200
     ctgttcgatg taggcataca cctggcggaa ttgctcctcg tcacgcacct gcgcgccgcg    199260
     gcggatgatg tcctggatat ccggcggcag cgaatcgaac ttcgccttgt tcatcgacag    199320
     cagcgaggtg tcgatggcca gcgtcgccag cgacaggtgc ttgaccacct cgtgcaggct    199380
     gcgtcccagc ccggtgatca gcgggcgcgg cgtgccgtcc accaccccgc ggtccaacgc    199440
     caggtacagc tcggacgacg gcatgctggt gggcgagccg cccagcagct ggatcgcgcg    199500
     cgcgtcggcg gcgccggtcg tggcccacac cttgcccttg aaatcggcgg ccgtgcggac    199560
     cggcgcgcgg cgcgaataga tctggtaggg atcgataggc gccaggccga gcacttcgat    199620
     gccatgcttg tcgcgcattt cgccgcgtat gctcacatcg agcaggccgg ccttggcggc    199680
     gcgctccagg tgcgccgtat cctggaacac gaacggcatg gtgaacagat tcagcaccgg    199740
     catggcgccg ctggcgtagg tcgagaccac ggtggtgata tcgatgtcgc cgcgcgacag    199800
     cgccggcaat tcctcgtagc cgtcgaacag ctgggcggag tggaaggcct tgatcttcac    199860
     gcggccctgg ctttccttct ccacatacgc gatgaaggtc tccagcggct tccacatgta    199920
     ctcataggaa ggcggggcat aggtcgacag cgtcagttcg atcggcttgt ccgccgcgcc    199980
     ggcgttggcc gacagcgcca gcagcacggc cggcagcaat ttggcgatcc aggtcttgtt    200040
     catgattgat gtactccgca gtggcgctca ggccgtcggg ttgagaagca ggggcaggag    200100
     cgcgtcggtc ggcaggactt ccgcgtactt gctcttgagg tcgatcaggt tgctgaggtg    200160
     ctgggccgcg gagcggtccg tgacggcgtc ctgcgccacg aaaggcggaa agccgtgctg    200220
     catggcgtcg accgcgctgg cgcgcacgca gccgctggtg gtgcagccgg cgatcagcac    200280
     ggcgtcgcag cccgcgtgcg cgagcatggc ggccagcggc gtaccgaaaa acgccgaggc    200340
     ctgcgtcttg tgcagcagca cgtcggtcgc cgcgtcgtaa tccagtcgct cgtcgagtgc    200400
     gcagcccgcc gagccgcgta ccaggtcctt cagcggcggg cacttgcgat gaaaacagcc    200460
     gccgtcgcca tggttgccgt cgtagcccac caccgtgaac accaccggac cgcgtccgcg    200520
     catcgcctgg atcaggcgat tggcctgcgc gatggcgggc gcgcaatcgc tggccagcgg    200580
     actgacgtcc gggtcggtga aagcccgctg gaaatcgatc accaccaggg ccgggcgtcg    200640
     cccgaacggg tgtgaaccga tgaaaccgcc tcgggcattg tcgaggtcta gcatgaacgc    200700
     tcctgatgga aagtatgtgg gcgtgccgcg ccgcgggacc ggacccgccg cgcggacaga    200760
     aagggatggc ggaaaacgcc tagccgtggg cctggaccgg ccaggccttg ctcgggaagg    200820
     gcgtcaggcg cgaggcgcgc gcgttggaga gggcaggaag cgggcgcgcg caggcgtgcg    200880
     cgcgcctggc cgggaggcgt ctggacagca tggctggcgg catggccgcc acggctggtg    200940
     accgatatcc cattgcatcc cccgcgttct ggtcatgttc atgcaagctg actgcatggc    201000
     agcttgtaag gcacacgtgt gcattgatgt tttgcggaag tctaggccgg gatgaacggg    201060
     cgcggaattg gggttttcct tagcaagatt gcatcaatag tatttactta tagggctatt    201120
     gagtgcgatg atggtttgcc ggcgtgccgt tgtccggctt ggccgcctgt gccatgtcgg    201180
     atttgcttta gtggaaaaca gccttgaaaa tgtacacgta tgcacttgtg tgcatgcgtc    201240
     atcgacggcc gcgcggcggc ggcctggttc agggttgggc gccgcgttcg tgccagagcc    201300
     gtttgagccg ttccaggtcc cgcacccaga tttccccgta acccagtccg accaggccct    201360
     ggttcgccaa ttgcctgagt tcgcggttga ccgcatggcg cgacacgccc agcagggtgg    201420
     ccagggcgtc ctgggtctgc gccacggcga tgccgcgttc gtcgtcgccg ggccgcccgg    201480
     ccgtcagggc gcccagcagg cgcggcagcc gttgcggcag gctgcgcagc gccagttcgt    201540
     cgatgatggc atgggcggtg cgtatgcggc tgcacagcag cttgacgaag tagcgataca    201600
     gtccggggtc gccgtccagt atgtccagga aggccgcgcg cggcagcagc aggatgtcgg    201660
     tctgctggta ggcccggctg tcgcgcagca tcccgccgcc gtccagtacc gccgcgacgc    201720
     cccacaggcc gtcgaattcc agcatcgaca gcgcgaactc gtggccgtcg tcggaaaacg    201780
     agctggtgtg gatggcgccc ttgaggatga tcaccacgcc gggggcgggc gtgccgcgtc    201840
     cggccagcag ttcgccatgg tccagccggc gccattgggc gatggcggcg aacgcggcca    201900
     gcgtcggttc ggccatgtgc ccgaagcagg tattggcgcg cagttgcgcc aggatcgccg    201960
     gcgggtccca ggcggggagg gcggtcggat tggctgcctg gctcattgct tgactgtgat    202020
     ggcgccgccg caggggcgcg ggaatgtaat gtagatcata ttcgtggccc ggggcgcctc    202080
     ctagaatcat ggcgcatcag acatcagacc ctagtcgcga ggatatacat gaagatcaag    202140
     agcatgctgc ttgccgtgct ggcggtatcg atggccgggg tatcggccgc cgcgctgtcc    202200
     cagggctttc ccgaacgggc gctgcgcgtc gtggtgccct atccgccggg cggcaccacc    202260
     gatgtgctgg tgcgcctgct gcaaaagccg gtggccgacg ccgcggggca atcggtggtg    202320
     gtcgacaacc ggccgggcgg cgcgtcggtc atcggcacct cgcacgtggc gcaagcggcc    202380
     ccggatggct acaccgtgct gggcggcgac ctgtcgatgc tggtcaaccc ttcgctgatg    202440
     aaagacctgc cgtatgacac cttgcgggat ttccgcggcg tcacgatgct ggcgcgcgcg    202500
     ccgctggtgc tgctggtgca cccgtcggtg ccggccaaca ccctcgacga gctgatcgcg    202560
     ctggccaagg ccaagccggg tacgctgaac ttcgcctcgg gcggctacgg cacctcgacc    202620
     cacatggcgg gcgagatgtt ccgccgcgcc gcgggcatcg atgtcgtgca tgtgccgtac    202680
     cagggcgtgg cgccggccat gtcggcgctg ctgggcgggc aggtgcagat gtatttcggc    202740
     ggcaccacga cgggcctgcc gcatatccag tcgggcaagc tgcgcgcgct ggcggtgacg    202800
     ggcgaggcgc ccagtccgct gctgcccgag gtgccgacct tcgtgtcgcg cggcatccag    202860
     ggcgtgaacg ccgatacgta ctggggcgtc tacgccccgg ccaggacgcc cgatgcggtc    202920
     atcgagaagc tgaatgccta ttacaccggc gccttgcgcg accccgccgt gcaacagcgc    202980
     acccgcgacc tgggcctgac cctgatcggc aacagcgccg ccgagcatac ggcgcagatg    203040
     aagacgatga ttggcgattg gggcgccttc gtcaaggaag cggacatccg actggagtaa    203100
     gccatggccg ccaaacaatc cctggtttgc ctgaccttcg atttcgacgc gatctcggtg    203160
     tggctggcgc gcggcatgga cagtccgacg ccggtgtcgc gcggcgagtt ctgcgccgtg    203220
     gcggccgacc gcgtgctgga cttgctcgaa cggctgggcc tgccgtcgac ctggttcatc    203280
     cccggccata ccttggccag ctatccggag cattgccggc gcgtgcacga ggccggccat    203340
     gaaatcggcc accacggctg gacgcacgtc gcgcccaacc tgatgacgcg cgaggaagag    203400
     ctcgacggcc tggtgcgcgc gaacgaggcg atccgcgcgc tgacggggcg ggccgcgcgc    203460
     ggctaccgct cgccatcgtg ggacctcagt ccgcacaccc tggcgctgct gctcgagcac    203520
     ggcttcgact acgacagcag catgatgggg cacgactatc tgccgtatcc ggtgcgccag    203580
     ggagacagtt ttcccctgga cgaacccgcg gtgttcggcg cgcccacccg cctcatcgag    203640
     gtgcctgtca gctggtcgct ggacgactat ccgcacttcg agttcgtgcg cgccgggcag    203700
     agcgtcatcc ccggcctgat gaatgccaac agcgtgatgg acaactggat cgaggacttc    203760
     ctgtacctga aggagaactt cgactggggc gtcatcacct acaccttcca tcctttcgtg    203820
     atcggccgcg gccaccgcat gcgcatgctc gagcgcctgc tgcggcgcct gatcgacgag    203880
     ggcgcgacgt tcgtgcgcat ggaggaagcg gtggacgcgt accggcaacg gcaggcgctg    203940
     gccgccggcg ccgcatgacc aacgagggaa aggacgatga tgcagcacta ctatgagcgc    204000
     gacggcgtgc gcttgagcta ttacctggac gactataccg acccctggac gcaggcaccc    204060
     accttgctgc tgctgcacgg cgccatggcc aatgcccagc gcttctactc ctgggtgccc    204120
     ggcctgagcc gcgattaccg cgtggtgcgc gccgacctgc gcgggcatgg gctgtccgac    204180
     gtgccgccgg cggacaagcc cttggacctg caggtgctga ccgaggacat cctggccttg    204240
     ctcgatcacc tgggctgcga gcgcgtgcac ctggccggca attcggccgg cggctacgtg    204300
     ggccagcatc tggccatgca gcacccgcaa cgcatcgaga ccctggcgct gttcggttcg    204360
     gcgccaggcc tgcgcaacag ccaggcttcg acctggctcg aacgagtggc cgaaaagggc    204420
     ttgcggcaat tcctggccga caccatcgac gatcgcttcc ctccggagct ggtcggcacg    204480
     ccgcgctgcg agcagttcct cgatgcgctg tccgatcacg acatggccta tatcggcagg    204540
     ttcgtcggct acatggcgca acaggagtgg ggcgatcaat tgcaccgcat cacctgcccg    204600
     acgctggtgg tgattccggg ggccggccgc atcggcgcca tggacgccta ccagcccatg    204660
     cgcgaccacc tcaagcgggc cgagatcctg gtctacgaag gcgagcggca cagcatctgc    204720
     gagtacctgc cgcaacgctg cgtggcggac ctgcgcagct tcctggcccg ccacggcgga    204780
     ccggcctggc cttgacccat cgcgctcgtc gaccttggcg tctgtcatga acatcgaaca    204840
     atacgtgcag caggacggcc tggcgctgtc cgcgcaattg cgggccggcg ccaccgaccc    204900
     gcaggccctg atgcaatgcg cgatcacgct ggcccggcag cgcgccgagc ccctgaacgc    204960
     cctgtgctat cccgactacg acgcggcgct ggcgcgcgcg gcggcctggc ggccgacggg    205020
     cgtgttcggc ggcctgccgt tcctgttgaa ggactccggc ctggcctgcg accgcctgcc    205080
     ctcgagcatc gggctggcgc tgtgcaagga catgcgtttt gccggcaacg ccacgctggt    205140
     ggaacgcttc gacgccgccg gcctgttgcc ctttgcccgc accaccgtgc cggcgctgtg    205200
     catggcgccc accaccgagg cgctcgtcaa cggcgggccc gcccgcaacc cctgggcgcc    205260
     gcagcgttcg gccggcggct ccagcggcgg cgccgccatc gcggtcgcca ccggcgtggt    205320
     gcccctggcc cacggcagcg acggcggcgg gtcgatccgc attccggcgt cttgctgcgg    205380
     cgtcttcggc ctgaagccca gccgcggcct ggtgcccctg gggccggcgc gcggcgaggc    205440
     atggggcggc atggcgggcg atggcgtgct gagccgcagc gtgcgcgaca ccgccgccgc    205500
     gctcgatgcg atcgccggca tggagcgcgg cgctccctat gcggcgccgg cgtcgccggc    205560
     aggcggctac ctggccgccc tggcccggcc tttcgagcgg ccattgcgca tcggcgtgtg    205620
     gcagcatgcc tgggacggca tcgaggtcga tccggcgtgc tcggcggcgc tggcgcaggc    205680
     cgaggccctg tgccggcaac tgggccacgc caccgaagcc atcgccgcgc cgcccatcga    205740
     ctaccaggcc ttcgtgcggg cgcatatcgg cattctgtgc acgcatatcg cgctggccgt    205800
     cgacgcccgc ctggccgtcc tgcggcgcgg cctgcgcgac gacgacctgg agccggccat    205860
     cctggacggc tatcggcgcg cgcgcggcat ttccgccacc gactacgccg gcatgatcca    205920
     ggcgctgcac gcggtgggcc gcgccatggc ggcctgcatg cagggctacg acctgctgct    205980
     gtcgcccacc ctgacgcgcc cgccggtgcc gctgggcgaa atcagcatgg cggacgactt    206040
     cgtatcgttt cgccagaagg cggcccgcta cacgaccttc ctggccgtca tcaacgcctc    206100
     ggggcagccg gcggccagcg tgcccctgca tatcgacggg caggggctgc ccatcggcgt    206160
     gcagctgatc ggcgccctgg gccgcgacga cctggtgctg cgcctggccg cgcagctcga    206220
     gcgcgccgcg ccgtgggcgg gacggttccc gcctgcggca ggcgcagggg cctgaacatg    206280
     gcaggccgca ccgattgcgc gccggcggcc ggcaggctgg cggggcgggt cgccctgatc    206340
     accggcgcgg ccggcggcat aggcagcgcc gccgcgctgc gcttcgcggc cgaaggcgcc    206400
     gcgctggcgc tgctggatcg gcgccccgac gccatcgagc aactggccgg ccggatctgc    206460
     ggccagggcg ggcaggcgat aggcgtggcc gccgacgtga ccgacgacga cagcgtgcgc    206520
     caggccgtac ggcgggcagt cgagcatttc ggcaggatcg atacgctgtt caactgcgcc    206580
     ggcggatcgg tggcgggcga tacggcggtg gacaaggtgg agctggcgct gtggaaccgc    206640
     accctgcgcc tggacctgga cggcaccatg ctgtgctgcc gccacgccgt gccggcgatt    206700
     gtgcgcgccg gcggcggcgc ggtcgtcaac atgtcgtccg gggccggcct gcgcggcagc    206760
     ttcggcgggc atgcctacac ggccgccaag ggcgcggtga ttgccctgac ccgcgcgctg    206820
     gccgccgaat acgcgccgca tggagtgcgg gtcaacgcca tctgcgcggg ccgcatccgc    206880
     accgaacgca tactgcgcaa cctggacgcc ggcgcaccgg cgcaagccgg cgcggcgcaa    206940
     cgctatccat gccgcgaggg cgacccgatc gacatcgccc acatcgcgct gttcctggcc    207000
     agccacgagt cgcgcatgat caccggcgag gccatcgccg ccaatggcgg gtactcggcg    207060
     ttctgaggca ggccgggcaa ggcgcctgtc ccggcgtgga caggcgcggc cgggcatgag    207120
     gccagtccgt ggattgtccc gcggaaacaa aaaagccctg gaccacgtgg cgcgtgtggc    207180
     gttaagcata agtttgccgg ggaataaggg ataataactt tgccggtcgg ttcggttgtt    207240
     ccctgaggat ggaactcctg accggcgaag gcgtaaagca taatttttcc catcgacacg    207300
     gaatcaagta aaacgttgcc gaaaagtcgg caatgaaaat tgcctatgaa ttcctgtgta    207360
     ttttgtgtgc acagactatc tgatgattcg acataaaatg tttcgaattc ccctgcggta    207420
     ctgaagctga cggggggtgg aagccgattg gggaataagg aggggctatg gcaaagaatg    207480
     accgcatcct gttggatggg attgtcgatg acaggatcgc gacccggacg ccatccgaaa    207540
     agagagatga ggcgtttgag tacttggcat tcgagcagct tctcaaagac tacgatttgt    207600
     cgcatgacga attgcttcat ggagcggtag atggtgaacg tgacgggggg atagacggtt    207660
     tttttatcct tgtgaacggt caccttcttg atgatccaga atcattcgtc tggcctcgtt    207720
     cgagcgcgga acttcgtctt atcttggtca cctgcaagca ccatgaaacc ttcaagcaag    207780
     caacacttga cagtctcgtt gctacgctga cggagttact ggattttgca atcgacgata    207840
     aagatctgaa gggcgcatat tcagatcggt tgcttcgcgt gcgcagcaac ctaaagttcg    207900
     cataccgcaa actttcccca aggttgaata gcttttcggt aagtgcctat tacgcgtccc    207960
     gtggtgatac gcaagaactc ggcgctgagg tggcggctcg cggtgagcag attgcattgc    208020
     tgattcgcga gagcttcggt gcttgccaag ctgagttcgc ttttgtcggt gcaaccgaac    208080
     tcgtcgagct gcatcggaaa atccgaaatt acacgcttga gctgccgttt gtagaggcac    208140
     tgacgaaggg tgtgcgctat gtgctgctgg cgaggctcac tgactacttc aacttcgtta    208200
     ctgacggcgg aaggctcaga cggtatctgt tcgactccaa tgttcgggac ttcatgggaa    208260
     tgaatcgagt caatgaagat attcagaata cgttgagagg ggcagagtct cctgatttct    208320
     ggtggcttaa caacggggtc acgatgctgg caagttcagc ggcgatcaca ggcaagtcaa    208380
     ttcagatcag tgacatccag atcgttaatg ggttgcagac aacagaatcg atttttaggt    208440
     actttcaggg gcgtgattta gcgaaagatc agcgttgtgt tcttgtcaag gtgatcatca    208500
     cgaatgatga ggcagtgcgg gacgccatta ttcgcgccac caataatcaa actgatgttg    208560
     agcttgcatc tttgcatgca actgacaaaa tccagcgcga cgtggaggat attttcctgc    208620
     ggcatgggct cttttacgag cgtcgaaaga attattacgc caatcaagga agatcgcctg    208680
     ctgagctggt tactcccttg tacgctgccg caggatacct tgctctcgcg ttgaaggagc    208740
     ctcataaggc atcaaagttg cgatccagat ttatgagggt gcccgcgtcg tacgaacaga    208800
     tatttgacga atccgcgccg ctagatgttt ggccaaagat cgtccagacg ctcaagagag    208860
     ttgatgaggc gctcgaagcg ctgcggccgc ggggtaaggg tacggagcgg tttctgaaag    208920
     ggtggcgtta cgtcattgcg ttgattttgg tcgcccagca tttcggaaaa ttctcatact    208980
     ccaagcgtga gctcaccacg tttgatgttt ccacggtcac attcgactct gtcaagggag    209040
     tctgggcgga gttgtatgcg cctgacaatg gagtgcgaat ggtaggctgg acgtcattgc    209100
     gcgatgtggt tgctgcctgc cagattgtgt cgaagtcgcg aggaattcga gatgttgagg    209160
     ctatctcccg ggggagtcag ggagttcata tgaggtcgca ggatttgagt gcccagttca    209220
     tcgagtctgt aaggcaggcc ttgccagcac agccttggaa gccgggggtg catattgagg    209280
     tatcacggaa gttgaagtgc gatatccccg cgtaccgtgc ggcggttgaa cagcttatcg    209340
     aagacgggat attccttcgg caaaaggacg gtgtgctgta cgatgaggaa gggagtgtgg    209400
     tttcgttcga ccctgagcgg gtcgatcccg aaacgctaca gttgcgaccc gccgatgagt    209460
     gaatcaccag ccctttgaga gattttaggt gccgatgata ggtttgtcct ggtattggag    209520
     gctgcagatt cagtacatct gaacgtgctc gccggacatt gcgtactgca cacgttgata    209580
     gcggggaaac accgtgcggt atcgaggggc cgggacttgc tctgttcccg ccagatatgg    209640
     aaacacgtac atcaccaggt ctgggttggg aagccgatgg aattgccgat agattgaatc    209700
     gaccagggtt tcgtagacat ctccaagccg taaattacgg taatcaagga cctggttatg    209760
     aactgacctg cccctagact tggtacggta ccgaaataga gtccagggtt aaaaaccgtt    209820
     gttgctgatg agcctgggcg aactgctcgg gcgttaaata tccaagcgcg ctatgcggcc    209880
     gctcggtgtt gtactcgacg cgccagtctt cgatcaagga tttggcctgg cgcaatgata    209940
     ggaaccagtg ctcgttcaag cattcatcgc ggaattttcc attctttcga tgtaagcgtt    210000
     ttccacgggc ttgcctggcc tgatgaatga cagcttcacg ccggcctgat aggcccaggc    210060
     gtccaaggcc ctgccggaaa attccgggcc gttgtccacg gtgatagaac gaggcaaccc    210120
     acgcagttcc gcaagccgtt gcagcacctg tgacactcgc aatcccggta gtgatgtatc    210180
     gacctcgatg gccagacatt cacgcgtgta atcatcgacg atattcaagc agcgaaacct    210240
     gcggccatag gccaggccgt cggccacgaa gtccatcgac cagccctggt tcggcgccgt    210300
     cgcagcggga cgaactaccc gttctgcggg cgcgatgcgt ttgcggcgac gcttacgaac    210360
     gctcaagcct gcctggctat aaagccgcca gacgcgcttg tgattcgtct gccagccttc    210420
     acgacgcagc agaacatgga tgcgccgata gccgtagcgc cgtttgagcg ctgccatctc    210480
     cttcatgcgc tcggtcaatg ccacatcgct cgtacgctta ctttcataag cgaacagcga    210540
     ccgagatatg cctaacagcc cgcaggcccg ggtgataccc atgccgcgct cagccatcaa    210600
     cgtcctgacc gcttcgcgct tggcctgcgg gctcgctact ttcggctcag aaggtcctga    210660
     agcgcagctt tgtccagcat cgattcggcc aatagcttct tgagcttgtt gttctcttgc    210720
     tccagctcct tcagtcgctg ggcctccgag acggccatac ccccgaactt gaccttccaa    210780
     ttgtagtacg tggcctcaga gatcccgtac ttgcggcaca actccgccac cttggctccc    210840
     acctcggctt ccttcagcac gccgacgatt tgttcttccg taaatcgctt cttcattgcc    210900
     gttcctttgt gaacggactc tacatcgatt tcgtactact cacgggggca ggtcactcca    210960
     ttttggcacc cgtctgtctg tcaccactgc gctgggacag ggccgaagcg gcgaggcttt    211020
     tggcaatttg agatgaagta ttattttgta gtatttcgga tgctagccgg ccgattctcc    211080
     aggacgtctg cttcgtgttc ttggacatcg ctattccttt cacatcaaga cttggataga    211140
     ggccgaaact gcaccacatt gttgccctga ccggggtggt cagtggatgg tttctgagca    211200
     gttttcagac gtgcaaactc cagtacaacg ctggcctttt cttggaagta gccttcgggc    211260
     agtccggcga gagcctcgac gtcaacagcc gccagtccaa tatgtctagg gatggcttcc    211320
     agtggcatga ctttttcttc gaccagtaag tcaatagtgc ggcgtaggag gcgaggtttc    211380
     tctggcttgc gatcattgtc accaggctcc gattttgcac cccatcgggc agagcgacgc    211440
     ttgaaaagca tcagagcgcc atcttcattc actaaatgaa gggccttcag acgcatgata    211500
     atcgctgctg ccgatacgcc ccatcgacgc ttcaagagca gcaaatcatc tagtgttggc    211560
     ggcacgcgta cttccgtggc gaaggtttca gcaggaagca gaaaagcccc cgcaaaacgg    211620
     tgtgcctgct gttctagcag tttgtggcgg gtgcgttcgg tcggacgctt gatgtagcga    211680
     tgcagcacga gatgtccaat ctcatgggct aggtcaaagc ggctacgata cccgttgtct    211740
     ttgtctgccg acagaaggat gagcggacgg cccaaaacct cactccaagc agagagtcct    211800
     tcaatttgcg caatacctgt ttcttctcgg actaggatga tcccagcgcc ttcaacagcg    211860
     agtgctaagt cttgaattgc cgagcgacca agacgccaca tatcacggca ttcgcaggct    211920
     gccttttcga tatcctcggc ggtgatctct tctgggtcgg tataggtacg aatgggtaag    211980
     ttgacatcgg gatagtcaac atattccatc agggctgctg ccacgtcctg agtccattcg    212040
     aggcgggcct caagcatcgc ccttgccgcc acgtgtgctg aggcattgct gcggaaaaga    212100
     ggcaacgaca tcttcgtcgc aggactgcgg gtgaaccact ccggagtcac attgaccacg    212160
     gtagcgaggc gctcaagcgc gtcgcgctca ggggcttgag cgcctgagcg ccacttactg    212220
     atggtcgcag gtgagacttc caccattgaa gccaattgaa cttgcgttag acgacgggca    212280
     gcaagaatct ggctaagccg ttcctgctga aatccttgta caccacccct gctcatgatc    212340
     ccgttccgtc tttgtcttgc tgtttgccaa tattcttttt cagcttcggt ttggccaaat    212400
     cgttctgcgc tgtcgtcgat ttctggtcgt atctcttaag gaatgctgtt attggttctc    212460
     ggaagagcca gccgtacatg tttcgatctg gaaccgcgag gtcgatcgat ataggggttt    212520
     ccggctgagt gtgaagcgat ccggcgaagc cggcgacaat aaaaacaacg ccatcagatg    212580
     gcggtacata ttcagaaaaa aatcctggtt gtaccagggg ttctatggct gcgtttgcca    212640
     gtgacatctg tttgcgggtc tcgctgcgtc gcgcactgtt ccaggttccg tatttggtgt    212700
     tgaagcgcgc tagggtgaag atccctgctc ggcccgtaac gatcctattg ccacggagcg    212760
     gtgatggaga agctccgcca acagtgagtg tccgatgaaa cgactcgttc atatgaaagt    212820
     ggcgcagatg accaactacg ctgggcaagt gcccgtcatc catcccacgc gctgcggcat    212880
     aggcgcgctg agcaccaact aacatggctt cttctagggc catcacaagc ccacgtggaa    212940
     tattcctcac gagcaaatct tggattgttt cttgggtcgg ttgggacatc agtggctccg    213000
     ctagcggatt tcgttgactg ggattttacc accaaaaaat ttcgtttaac agtgatggcg    213060
     gtggaaagtg ctgcgagtaa gccaaggatg tgaaaaatgg cgttagtgat tcttgctggg    213120
     gtggtaatac tggccacttc tcggatggtg ggcgccgtgg gaggcggtaa tttttgttag    213180
     attgatacgt cgcttcggac gaggcttgag ggacggtttg gcccaaattt gtcccattca    213240
     ggggtcattt ttttcggtat ttgagcgcat aagctgttct cccattagct accgaaaatc    213300
     agcgggcaga ccttgtgtca tggcgacgac gccaccagcc gctaacccaa taaaatcaag    213360
     cctgtagaaa caaaaaagcc ctggaccacg tggcgtgtcc aaggcttttc cgtctggtgt    213420
     ttggtggagc ggaggaggat cgaactcccg accttcgcat tgcgaacgcg acgctctccc    213480
     agctgagcta ccgccccaat gaagtccgca actatacacg gattccggcc gttttggtag    213540
     cggccggcgg aaaattttcg ccggcttgac gggccgccag gctttcaggg ccgggcaggg    213600
     acgaagggcc ggccgcgcgg gcgggtgcgc atgccgggcg ccaggcgcgt ccagggcagg    213660
     tcggcggggt cggcctgcat ggggccgggc gccttggcga tcagcacggc gtgggcgatg    213720
     ggttcgaagt cggcgcgaaa gtgcaccgag ctcttgacga ccaggatggc gaggtcttcg    213780
     gggtcgatgc cgcccaggcg gatgaggttg cggtccaggg tctgggattt gttgctgctg    213840
     acgatgacgc gcacgccgcg gtggcgcagg cagacggtgg agccgaggtc ggccgccatg    213900
     ccgtgcatca tggggccgtc gtagcgggtc ttgccgtcgg actggtgttc gacgatgaat    213960
     tcggcttcgc agggggcgtc gccggcgacg ccggactggc cgcccaggcg cagccgtacg    214020
     cgcttgccca cgccggcggc cagggcctgg gcgacggcct gggggtcgca catgaggccg    214080
     atggcggcgt tgtcggcgtc cgcgtcgatg agggcgcgca gcatgccggt ggtgttggcg    214140
     tcgccgccgg cgccggggtt gtcctgcgtg tcggcgatga ccacggggcg gcgggcgcct    214200
     tgcgccagct gccgggcctg gcggatggct tcgtccgggg cgaggaagtc gggcgcccac    214260
     tgggcttcga gcccggcgat gcggtcggcc agggtctgca cggcgcgctc gacggcgtcg    214320
     cggtcggggc cgtgggccca gacgaccggg ctgcactcgg ggaagtcggc ggccggaaag    214380
     cccagggcgc aggacaggct ggcgatgccc ggttcgctgc gctcgagctc ggccagcagg    214440
     gcatacacgc cccgggcggg ttcgagctgg gtgcacatgc cgttgatggg aatgaggaac    214500
     ggcaggcgcc gcgcggcgcc atgccagtgc ttgccggcct gcgcgcgcgc ttgcagcagg    214560
     gcggcggcgc gcgcgccggt gtcggccatg tcgacgtgcg gataggtgcg ataggccacc    214620
     agcgcgctgg catgcgccag catggcgcga gtcacgttgg cgtgcaggtc caggctggcg    214680
     acgatgggcg tggcggggcc gacggcgtcg cgcaggcggc gcaggagttc gccttcgccg    214740
     tcgtcgtggt gttcggtggc catggcgccg tgcaggtcca ggtagacggc gtcgtagcgg    214800
     ccggcgcggg cggccgcctc gatctcgccg gcgatgcgct cgaaggcgtc gcgcgtgacg    214860
     tgcgccgagg ggctggcgcc ggcccagatg acggggtgca cgctgtggcc gtccgccagg    214920
     gccgcgttca ggaagccgcc ggcggggatg ttgacggcgc gcagcgccag caggtcgtcg    214980
     ccgcgcacca gggcgggaaa gccttcgccg cgcaggaagt tgtcatagcc ggccttggaa    215040
     ggcgcgaagg tgttggtttc gtgttggaaa ccggcaacca ggatatgcat gcttgcctcc    215100
     cgggcgtggg gcgccgccgc ggcgccgggc gtcagccgaa cgccagggtg gcgatgaccg    215160
     gcgcgtggtc ggacggctgt tcgttggcgc gcggcgcctt gtcgatgacg caggccacgc    215220
     agtgcggctt gagcgcgtca gacagcagca catggtcgat gcgcaggccg gcgttgcggc    215280
     ggaacgcgaa ctggcggtag tcccaccagc tgaaggattt ctcgggctgc tcgaacaggc    215340
     ggaaggagtc ggtcaggccc aggtccagca gcgcgcggaa ggccgcgcgt tcgggctcgg    215400
     agaccagcac ctggccttcc catttctcgg ggttgtgcac gtcggcgtcg gccggcgcga    215460
     cgttgtagtc gcccaggatg gccaggcgcg gataggtgcg catttcttcc tcgagccagt    215520
     cgcgcaggcc gtcgaaccag gccagcttgt agacgtactt gtcgctgtcg accgactggc    215580
     cgttggggca ataggcgcag atcacgcgca cgtcgccggc cgggctgggc agggtcacgg    215640
     ccaggatgcg ctgctgcggg tcttcgtagc gcgggttgtt gcgcaccagc gcgaagccgg    215700
     gctcgcgcga gatgatggcc acgccgttat aggtcttctg gccggcccag gcggcgtggt    215760
     agccggcctc ggtaaaggcg tcgagcggga atttgtcgtc ggtcagcttg agttcctgga    215820
     tgcacagcgc atcgaccgga ttggcggcca gccagtccag cacctgcggc aggcgcacat    215880
     tcagggagtt gacgttccaa gtcgcgagtt tcacgggttc tcactgcaaa agttcggcca    215940
     acggcggatt ttcgcagatt tgggccaggc gggcaggaaa cgctcagcgc aacgcgtcga    216000
     tgtagtacat ccccttggcc agcaacacga tcgccacgac gtggcagaac acgctcaggt    216060
     gcagccgccg cgaacgccgg ccgcgcaatt ggccgcgccg gcgccagcgc atggcggcgg    216120
     cgaaatggcc caggacgctg agcgccagca cgatcttcag gctgagcagc aggccgaagc    216180
     tgctggccag cggctgctcg agcgcgccgc ggtgctgcca ggccatgccg atgccggcgc    216240
     cgaacagcgc cagcagcacc cacggcatga tggcgcgggc gcggttgccg atgccgcgct    216300
     cgaccgcgtt catggcttcg cgcggcactt gccgccgcac gctttcgagg atgaggactt    216360
     cgaagaagac ggtgccgatg aagacgaagg cggccagcag gtgcagggcc agcaggatgg    216420
     ggtaggtcat gggcgggacc gcacgggcgt ggcggcggcg gttggtgcgc gcaggcgcgg    216480
     gcgcaccagc aggggcgcga aacgccacag gtacaggacg aacgccagca cccaggcggc    216540
     ggtggcgccg tgcagcgcgg ccagggtgtg cgggccgggc cagagggcgg ccaggcgcag    216600
     cgcggccgcg ccgatgacca ggaggtagca ggcgagcatg aggcggtcgg tgcgcagcgg    216660
     ccggcccagg tggcccaggg cggtgcgggt gatcatgccg atgatgagca ggccgaagcc    216720
     ggccatgccg atgacgtgcg caggccacgc ggcgcgcgcg atgccgcccg ccgcgcttgc    216780
     cgccgccacc agcaggccgg cggccaggcc caggtagccg gcgtacagga tccacagcag    216840
     gggcacgccg cgcgtggccc aggggcgcca ggacagccat tgcgccagcg cgatcaggcc    216900
     ggccgcggcc agcgccacgg cggtcagcgc gccggcctgc gccagcgtcg ccgccacggc    216960
     gaccaggccg gcggccagtt gccattggcc gctgcgcgta tgcatgggga tctgcaggcc    217020
     ggcgatggcg cgcatggcga aaaagggaat gatgcggcgc gcgatcagca aggcgatcac    217080
     ggccatgcac agcaggcccg cgttgaagcg ctgcagcagc aaggggtagt cgccggcgcg    217140
     ggcggccagc agatacaggg cgtcggccgc gcccagcccc agcaccagca agggcacgcc    217200
     gtcgttgcgc cggctggcgc cgcgccggta gatggcccgg cccagcgcgg ccgcggccca    217260
     ggcgaagaac agcagctcgc aggccacgcc ggtccagaag gcggccatgc ccggcagcag    217320
     gaaggcggcg cgggccgcca gccacagcgc ggccagcgcg gccagcggcg cgccgcgcag    217380
     cgggttgacg ccggtccagg tggccgcggc ggtcagcagg aagcccaccg cgatggcgcc    217440
     gatgaagccc cacagcattt catgcgcatg ccagatgacg cccgccatgg cgccgcccag    217500
     ccactgcggc gcgccgatcc acagcgccac cgacagcgcg ccccaggccg cgcccaccag    217560
     gtagagcgga cgaaagccca gttccaggaa ggcgcgccat tgcggcgcgg cgcgtgcggc    217620
     ggcgggctcg tcgatttgca gcagttcagc catgggcgag gtccgtgggg gcctggtcgg    217680
     ggctgcggtg cagctgatag ccgtaccaca ggctttgcgc gatgcggccg gccatcaggc    217740
     aggcctgttc ggccatggcc tggttgggct gcgccgcggc ggtggcgcga aacagccgca    217800
     gccagcgctc gaacaggccc gcgtgcaggc cgggcagggc cacgtgcctg ggcatgggcg    217860
     tgccgcgaaa gcgtccggtg ccgcgcagta tcgacgacca gaagtcgacc agcttggcga    217920
     ggtggacgtc ccagtcgtcg acatgggtgt tgaagatcgg ccccaactcg gcgtcgcgcc    217980
     gcacttcggc gtagaactgg tgcaccagtt gcgtgatgtc ttcttcggta cagagatcgg    218040
     gcgcgcccac gaggcctctc ctgcggctta taagatgtat ctataataca tcttatggct    218100
     taggcatggg gaaggaaggg ctcgggcctt gacgcagcgc aagcgcggcg ctttctcttt    218160
     tacactgggc cgacgggcat gcgcccgcgt attccgcagc ccagccgcca tgatcacgcc    218220
     gccagaccat cccccccgca tcgccatcca gtattgcacg cagtgccagt ggctgctgcg    218280
     cgcggcctgg atggcgcagg agctgctttc gaccttcggc gccgacctgg gcgaggtggc    218340
     cctggtgccc ggcaccggcg gggtgttccg catccactac aacggcgcgc cgctgtggga    218400
     ccgcgaggtc gacggcggct ttcccgaggc caaggtgctc aagcagcggg tgcgcgacca    218460
     tctcgatccg ggccgtccgc tcggccatat cgacggccgt cccaagccct aggcgggcgc    218520
     gctccattcc tcgggcaggc cctgggtcag ggtcgagacg aacgcggcgg tgcgcgcatc    218580
     gcgcgactgc gcgaagactt cgcgcggcgt acccgcctcg accaccgcgc cgccctccag    218640
     gaacaccacc tgctgggcga tgctggcggc cagccgcagg tcgtgggtgg ccatcagcat    218700
     ggtcatgcct tcgccggcca gccggcgcag cacgtccacc acttcgatgg ccagcgacgg    218760
     gtccagcgcc gaggtcggct cgtcgcacag caagacgcgc ggcgacggcg ccagcgcgcg    218820
     ggcgatggcc acgcgctgct gctggccgcc cgacagcgtg accggccagg cgtcggcctt    218880
     ggcggtcatg ccgactttct ccagcagctc catggcgcgc gctcgggcgc gcggcttgtc    218940
     ccagcgctgc accgtgacca ggccttccat gacgttgtcg atcacgctct ggtggggaaa    219000
     cagctggaag ttctggaaca ccatcccggt ctggcggcgg atgcgctgca cggcgtcgcg    219060
     cgccgggcgc cgaccgtcga acgccagtgt ttccggcccc agccgcagca cgccggcctc    219120
     gggaatctcc agcaggttca cgcagcgcag cagcgtgctc ttgccgctgc ccgaagggcc    219180
     gatcagggcc gtgacgctgc cctcgggaat gacgacgtcc acgccgtgca atacccggtt    219240
     gccgccgaag ctcttgtcta tgccttgcag ccctatcatc gatgttgctc cgcgaagacg    219300
     gcgtgctggc cgaagcgttt ttccaggcgc acctgcagcg aggacagggc cgaactgaac    219360
     accaggtaga tcagcgccgc ctcggtatag agaatgagcg gctcgtaggt caccgccgcg    219420
     atgcgctggg cggcctggaa gatttcgggc acggtcagca ccgccgccag cgaggtgtcc    219480
     ttgaccagcg cgatgaacga attggccagc ggcggcaccg ccacccgcgc ggcctgcggc    219540
     agcacggtgc ggcgcatggc ctggccgcgc gtcatgctca gcgaataggc cgcttcccat    219600
     tggcccctgg ggatggattc gatggcgccg cgaatcactt ccgagttgta ggcgccgacg    219660
     ttcagcgtga agccgatcag ggcggccggc agcgggtcga gcacgatgcc gacgctgggc    219720
     aggccataga agatcacgaa caactgcacc agcagcggcg tgccgcggat cagccagacg    219780
     tagaagcgca tcagcgccac gatgggccag gggccgaaca gccgcagcag cgccaccacg    219840
     aaggccagcg ccaggcccgc ggcgaacgac agcagcgtca gcggcacggt gaacatcaac    219900
     cccgcatgca gcaggggcca gaacgaatcg agcatgagct gtagccaggc cggcacgatg    219960
     ggggctcctg tgcgttgcgg gcggggaagg gcggcgccgc cgggcggggc cggcggcggg    220020
     ctttactggg cggccgacag gtcggcgccg aagtactgct cggagatctt ccggtaggtg    220080
     ccgtcggcct tcagctcggc cagcgccttg ttgatggcgg cctgcagctc ggggttgttc    220140
     ttgcggatca gcacgcccga ttcgctgaac tccttgctct tgtcgtaggc ggccaccttg    220200
     accttggcgt tgggcttttg cttcttgaag tcgagaaacg acaggttgtc gttgaccgtg    220260
     gcctcgacgc ggcccgacat gagcaggtcg atggcttcgt tgaacccctg caccggcacc    220320
     acttcggcgc catagctctg cgccagcttg ccgaagttgc tggtcagggt attggccgac    220380
     ttgcggccct tcaggtcggc gaacgacttg atggcctggt tgtcctcgcg cacgatcagc    220440
     gcggcctgcg acgagatgta ggggtccgag aaatcgtact tggccttgcg cgcatcggtg    220500
     atgccgacct ggttgatgac ggcgtcgtag cgcttgacgt ccaggccggc gatcagcccg    220560
     tcccacttgc cttcgacgaa ctcggctttc acgcccagct tctgggcgat ggcgcggccg    220620
     atctccacgt cgaagccggt cagcttgttg ctggcgtcgt gatagctgaa cggggcgtag    220680
     gtcccctcgg tgccgatctt gatgacgccg gccgccttga tggcggccag gtcgtcggcc    220740
     tgggcggccg tgccgaccat ggccagcggc accaggccgg caagcagcag tttgcgcaag    220800
     gagaagttca tggcgcgtgc tccacaggaa gaggtggacg gggcgcagcg ccccgcggaa    220860
     ctgagcactc tagcaacgcg cctatttttc cacaaagaat aagaaatcgt gaaaacataa    220920
     gaaaaagcaa tatacccggg agcctgtccc cggacgggga ctggctcccg ctgacttcca    220980
     cctgccggcg ccccaggtgc cagtccccgc tgggacaggc accccatgct tctacttgcc    221040
     ggcgccccag gtgcccgtcc ccctgcgggg acaggcaccc cgtcatcagg acgcctggtg    221100
     cctgcccgcg cgcagcagcc gcaagccgtt ggcgaccacc agcaggctgg cgccgacgtc    221160
     ggcgaacacc gccatccaca gcgtggcctg gccggccatc gccagcacca ggaacaccgc    221220
     cttgatgccc agcgccagga cgatgttctg ggtcaggatg cggtgggtgg cgcgcgacag    221280
     gcgcacgaac gtgccgatct tgcgcaggtc gtcgtccatc agcgccacgt cggcggtttc    221340
     gatggcggtg ccggtgccgg ccgcgcccat ggcgaagccg atgtcggcgc gcgccagcgc    221400
     cggcgcgtcg ttgatgccgt cgcccaccat gcccacgcgc agggccggat ccagcttggc    221460
     ctcgacggcg tccagcttgt cctgcggcag caggtcgccg cgcgcctcgt cgatgccggc    221520
     ctgggcggcc accgcctggg cggcgcgggt gttgtcgccg gtcagcatga gggtgcgcac    221580
     gcccagccgg tgcaggtcgg ccacggcggc ggcgctgctg gccttgagcg tgtcggccac    221640
     cgcggccagc agcaggacgc gctgcccgtc ggccagggcg atggcggtct tgccggccgc    221700
     ttcataggcg tcgatgcggg cctcgatatc gggcgtgctg acgtccagct cgcgcatcag    221760
     gcggcggttg cccagctgga agcgctcgcc gccgatctcg ccctgcacgc cgcggccggg    221820
     cagggcggcg aaaccgttca cctcgtccag cggcgcgtcc agggcgtggt cggcctgggc    221880
     cagcgcgcgc gacacggggt ggtccgagcg cgccgccagg ctgaccgcgg cgcgcagcgc    221940
     cgggcgcccg cccgcgctgg cgtcgtgcag cagttccagg tcggtctgca ccggcttgcc    222000
     ctgggtcagc gtgccagtct tgtccagcgc cagccagcgc agcttgcgtc cttcctccag    222060
     gtagacgccg cccttgatca ggatgccgcg ccgcgcggcg gcggtcaggc cgctgaccac    222120
     gctgaccggg gtggaaatca ccagcgcgca ggggcaggcg atgatcagca gcgccagcgc    222180
     gcggtacacg gagtcgagcc aggcgtggcc cagcagcagc ggcggcgcca gcgcgaccag    222240
     caccgccagc ccgaccacgg ccggcgtgta gatgcgcgag aagcggtcga tgaagcgctg    222300
     ggtcggggcg cgcgcgccct gggcctgttc gaccgcgtgg atgatgcggt ccagcgtggt    222360
     attgccggcc gccgccgtga cgcggtagtc gaacgacccg gaggcattga cggtgccggc    222420
     gtagacgtcg tcgtccgggc ctttttccac cggcaggctt tcgccggtga tgggcgactg    222480
     gtcgatcgcg gactggcctt cgctgatggt gccgtcggcg gcgatgcgct cgcccgggcg    222540
     cacccgcacc aggtcgcccg ggcgcagtcg cgccgccggc acctcggccc acgagccgtc    222600
     cggctggcgc gcggtggcgg tctgcggcgc caggtccagc aggccgcgca ccgcatggcg    222660
     ggcgcggtcc agggcgcggg cctcgatcag ctcggccacg ttgaacagga acatcaccat    222720
     ggccgcttcc ggccattggc cgatgagcat cgcgccggtc acggcgatgc tcatcagggc    222780
     attgatgttg aggttgccgt tgcgcaccgc gatccagccc ttgcggtagg tcgacagccc    222840
     gcaggccagg atggccgcca gcgccagggc ggcggcgaca tagaccggct ggccggtgaa    222900
     gtgggcgagc tcggacagcg ccgccagcac cccgccggcg gccagcaggc gccagccgcg    222960
     cgaaggcgcg gccgcgccgg ccggggtcgc cggggcgtcg ccggccaggg gctcgggcgt    223020
     catgcccagc gagcggatcg ccgcgtcgat gcgatcgagc gcgccgtcgg catgcagcac    223080
     ggtcagtacg cgctgcatca ggttgaagtc gagctcgtgc acctcgggca ggctggccag    223140
     cttcttgcgg atcagcgttt cctcggtggg gcagtccatc tgcccgatgc gcacccgcgt    223200
     gacctgctgg ccgggaccgg gctgccaggc cggggcggcc gcgggcgcgg ccggctggcc    223260
     gtgcccatgg ccgcagcagg ccgggatgcc atggtcgtgg gcatggtcgt gcccggcatg    223320
     gtcatggcct gcgtggtcgt ggcctgcgtg gtcgtggccg tgggcgtccg tgcgttggcc    223380
     agatggcgta tcgagggcaa ggtcgcgggt cgtggagggc atctggtacg tcctttctgg    223440
     atgttggacg catttcacac cctggagtta ctatagggtc aagcacccgg atcaaggagc    223500
     ccccatgaaa atcggcgaac tggcccgcac ggcgggcacc acggtggaaa ccgtgcgcta    223560
     ttacgagaag gaagggctgt tgcccgcgcc cgagcgcggc ctgaacaact accgcagcta    223620
     cggcgaggcc catgtcgagc ggctgcgcct gatccgcaat tgccgcgcgc tggacatgac    223680
     gcaggacgag atccgcaccg tcctggccct ggcggacaac cacgaggccg gctgcgctcc    223740
     gatcaaccag gtgttcgacg agcacatcgc ccacgtggac gcccgcatcg ccgagctgac    223800
     ccagctgaag gcccagctgg gcgagctgcg ccagcgctgc gcctcggccc gcccagacgc    223860
     cgaggactgc ggcatcctgc acggcctgag cgagatgcag gtcgaagagc gtcccgagcg    223920
     ccacacccac ctcggctagc gcggcgatgc ccttggcgcg cggccgggaa taggccggcc    223980
     ggccccctgc gctgggctat gatgagaata tgttttcttc tcgtcgagat tttccgcgcc    224040
     tatgaccgta tctcccttgc acgcgctgac gtcgcgccgt tcgatgaagt tcctgcgcgc    224100
     gcccgcgccc aagcaggacg aactggagca aatcctgcag gccgccatga gcgcgcccga    224160
     ccatggcgcg ctgcgcccgt ggcggttcgt gctgatccgg ggcgaggcca tcggccggct    224220
     ggccgacctg gcgatcgagg cggtcaagcg cagcggcgac aagcgcatga cgcccgagaa    224280
     agagaagtcg gtgcgcgaat gggccgccgg cgtgccgctg ttcatcgccg tggcgcagaa    224340
     gatttcgcat gacaacaccc gcattcccga gcaggaacag ctgctggcca ccggcgcggc    224400
     ggtcatgaac atcctcaacg ccgcgcacat gctggggtac ggcgcgttct ggagcacggg    224460
     cctgggcact tacgtcgagg acgtgcagga cgcgctgggc ctggacgcga tggactaccg    224520
     cttcctgggc ttcgtggccc tgggcacgcc gggctgcgcg gtgccgccgg cgcagcgccc    224580
     ggatttccgc gagttcgtgt ccgaatggca gggcgtcacc gcctgagcgc gtctgcgcgc    224640
     gcggcatgta aaaacccggc gcacaggccg ggtttttaca tggagcgggg ccgtgtcagg    224700
     cgccggcggt ctcggccagc acgcgctggg cttcctcgcg cacgcgctcg ggggcggtgc    224760
     cgccgatgtg cttgcgggcg gccaccgagc cttccagcgt cagcacctgg tggatgtcct    224820
     cgccgatgct gggatggtag gcctgcaggt cggccagcga caggtcggcc aggtcgcagc    224880
     cgcgctgctc gcagtcgcgc accgcgtggg cgacgatttc gtgcgcgtcg cgaaacggca    224940
     ggccgcgctt gaccaggtag tcggccaggt cggtggcggt ggcaaagccc tgcagggcgg    225000
     cggcgcgcat gttgtcggcc ttgaccttga tgccgccggc catgtcggcg aagatggtca    225060
     gggtgtcgcg cagcgtgtcg gccgtgtcga acaggccttc cttgtcttcc tggttgtcct    225120
     tgttgtaggc cagcggctgg cccttcatca gggtcagcag cgccaccagg tggccgttga    225180
     cgcggccggt cttgccgcgc gccagttcgg ggacgtcggg gtttttcttc tgcggcatga    225240
     tcgagctgcc ggtgcagaag cggtcggcca ggtcgatgaa gcccacgcgc gggctcatcc    225300
     acagcaccag ttcctcggaa agacgcgaga tgtgcgtcat gatcagggcg ccggcggcgc    225360
     agaattcgat gccgaagtcg cggtcggaga cggcgtcgag cgagttgcgg cagacgccgt    225420
     cgaagcccag cgtgcgggcc acgcgctcgc ggtcgatggg atagctggtg ccggccagcg    225480
     cggccgcgcc cagcggcagg cggttgacgc ggcggcggca gtcggccagg cgctcggcgt    225540
     cgcggccgaa catctcggca taggccagca ggtggtggcc gaacgtgacg ggctgggcca    225600
     cctgcaggtg ggtgaagccc ggcatgatgg tggcggcgtt ctccagcgcg accgtggcta    225660
     gcgcgtgtcg cagctggcgc agcaggtcga ccagggtgtc gatttcgtcg cgcagccaca    225720
     ggcggatgtc ggtggcgacc tggtcgttgc gcgagcggcc ggtgtgcagg cgcttgccgg    225780
     cgtcgcccac gagctccacc aggcgcttct cgatgttcag gtgcacgtcc tccaggtcca    225840
     gcagccactg gaacgagccg gcgtcgatct ccgagaggat ctgctgcatg ccgcgctgga    225900
     tgtcggccag gtcctgggcc gagatgatgc cttgcgcggc cagcatgtcg gcgtgcgcca    225960
     gcgagccgcg gatgtcgtgg cgcgccatgc gcttgtcgaa atcgaccgag gccgtgtagc    226020
     gtttgacgag gtcggaaacg ggttccgaga aacgggcgga ccacgcctgc gccttgttgg    226080
     cgaactggtc ctggctggag tgggaagtat ttgccatgat gcgggcaatt atatagggcc    226140
     ggcgcgcgcc gcggcggcgc cacggaacgg cgcgccggcc gacttgtcgg ataatctgca    226200
     ccatggcgct ttcaggagga tgcagtgctg ccgaaggaat tggagaacgt ggtcgccacg    226260
     ctggacaact atgtgccgga cacggcatgg ggccagacgc tggtcggcat cggcgtgctg    226320
     gtgctgacgg cgctgttcgt ccaatgggtg gtggcgcgcg tcgtgctgta tttcgcccac    226380
     cggctgctgg tgctgagcgg ccgcgaggac tgggaccgcg ccctgagccg ccgccgcgcc    226440
     taccagaact tctggtacgc ggtgccgttc gcggtggtct ccatgggcat agaactggtg    226500
     ccgcatgccg agcgcgcggt caccgtcgtg ggccggctgt cgcacgccgg ggcctggatc    226560
     tgcgtgttcg tggccttcag cggcgtgctc agcgcctggc aggataccta ttcggccacc    226620
     acgcgggcgc agacgcgctc gatcaagggc tatatccaga tcggcaagct gatcctgtgc    226680
     gcggtggggg cggtgctggt gctctccatc ctgctggacc gctcgccgct gtggatgatc    226740
     tccggcctgg gcgcgctgtc ggcggtgctg ctgctggtgt tcaaggacac gctgctgtcg    226800
     ctggtggcca gcacccagct cacgtccaac gacatgctgc gcatcggcga ctggatcgag    226860
     atgccgcagg ccaacgccga cggcttcgtc aaggacatcg cgctgcatac cgtcaaggtg    226920
     cagaactggg acaacacggt gaccaccgtg cccacctaca agctgttttc cgaaagctac    226980
     cgcaactacc gccacatgtt cgagtcgggc gggcggcgca tcaagcgcac cttgcggctg    227040
     gacgcggcca gcgtgcgctt catgaacgag gaagagggcg gacggctcaa gcgcttcgtg    227100
     ctgctgcgcg actacctgca ggccaaggag gacgcgctgc tggaggccaa ccgccaactg    227160
     ggcgaactgg ccgaggtgcc ggccaaccgc cgccgcctga ccaacatcgg caccttccgc    227220
     ggctatgcgc tggcctacct gcgccagcac cccgaggtgc gccaggacat ggccatgatg    227280
     gtgcgcatga tggagccgca gcccaacggc atcccgatcg agatctattg cttcacggcc    227340
     atcaccgcct gggtcgagta cgagcgcatc cagggcgaca tcttcgacca tctgctggcc    227400
     atcctgcccg agctggggct gcggctgttc caggagccct ccggctcgga cctgggcaac    227460
     ctggccggcg gcatgcgcga ggcggccctg cacgagttcc ggcgcgagca ggtggccgcg    227520
     ggcgaggcgc cgctggcgct gcgcggcgac ggcgccgcgc ccgtgcgata atttttcttt    227580
     ccctttttcc cattctggaa ccgtcgttca tgagccttgc ccgggttgga atcgcgcaaa    227640
     tcaacgcctg cgtcggcgat ctcgccggca acgcggcccg ggtgctgcaa gcggcgcggc    227700
     aggcggccgg gcagggcgcc gacgtgctgg tcacccccga gctggtcctg accggctatc    227760
     cgccggaaga cctgctgctg cgtccccggt tcatccagga gcagcaggcc gtgttcgagc    227820
     ggctttgcca ggacctggcc ggcctggccg gcctgcatgt ggtgatcggc catgtgctgg    227880
     cgcgccagga ccgcctgtac aacgccgcca cggtggtgtg cgaagggcgc gtgctgggca    227940
     gctactgcaa gcgcgaactg cccaattatt cggtcttcga cgagcagcgc tatttctccg    228000
     cccatggcga agccttcggc tttaccgtca agggcgtgcg cttcggcctg aacatctgcg    228060
     aggacatctg gttcgagcgc gcgccgcgcg cggcggcggc cgacggggcg caggtgctgc    228120
     tggtgcccaa cgcgtcgccc tacaacaccg gcaagcagga agagcgcctg tcggtggcgc    228180
     ggcgcagcgt gcaggacacc ggttgcgccc tgatctacgc caacctggtc ggcggccagg    228240
     acgaactggt gttcgacggc gcgtcgttcg cgctggacgc gcaaggccgc atgagcgccc    228300
     gcctgccgga tttcaccgaa ggcgtgaatg tgctcgaggt cgatgcgcgc ggcacggtgc    228360
     gcccggtgac cgaacaggcc gccgtgcagc cctacggcct cgaagagcag gtctggaacg    228420
     cgctggtgct gggcgtgcgc gactacctgg gcaagaacgg ctttcccggc gccatcatcg    228480
     gcctgtcggg cggcatcgat tcggccgtgg tgctggcggt ggcggtcgac gccgtgggcg    228540
     cggacaacgt gcgcgcggtc atgatgccct cgcgctatac cgccgacatc tccctgaccg    228600
     acgccgccga catggcccgg cgcctgggcg tgcaatacga cgtgatcgcc atcggcgagg    228660
     tggtcgaccg cttcgaggcg gcgctggcgc cgcagttcgc cggcctgccg gtcgacgcca    228720
     ccgaggagaa catccaggcg cgcgcgcgcg gcaccttgct gatggcgctg tccaacaaga    228780
     ccggccggct ggtgctgacc accggcaaca aatccgaaat gaccaccggc tattgcacgc    228840
     tgtatggcga catggcgggg ggcttcgccg tcatcaagga cgtgcccaag accctggtct    228900
     accgcctggc gaactggcgc aaccggcgcc agcccatcat tcccgagcgc atcatcaccc    228960
     gcccgccgtc ggccgagctg cggcccgacc agaccgacca ggacagcctg ccgccctacg    229020
     acatcctcga cggcatcatc gagcgctaca tggaacacaa cgcctcggcg gccgatatcg    229080
     tggccgccgg ctttccgcgc gaggcggtcg ggcaggtcgt gcggctgatc cgcatcaacg    229140
     aatacaagcg gcgccaggcc ccgcccgggc cccgcatcac gccgcgcgcg ttcggccgtg    229200
     attggcggta tcctgtgacc aacggattcc gcgagacggt ttgaggccgg cgggcatccc    229260
     attcagaaaa agccaggaca gcacaacgtg aaacaagtaa ccgccatcat caaacccttc    229320
     aagctggacg aagtccgcga agcgctggcc gaggtcggcg tcagcggcct gaccgtcacc    229380
     gaggtcaagg ggttcggccg ccagaagggc cataccgagc tgtatcgcgg cgccgagtat    229440
     gtggtggatt tcctgcccaa gatccgcgtc gaggtcgtgc tggccgacga catggtcgat    229500
     ccggccatcg aggccatcgt caaggccgcg cgcaccggca agatcggcga cggcaagatc    229560
     ttcgtgaccc cggtcgaaca ggccatccgc atccgcaccg gcgagagcga cgaagaggcg    229620
     ctgtaggcgt tcgcgccagg cgccgggccg ctaggccttg ccgccgctgc gcgcggcaat    229680
     gcgcgcgcgg ttgagcgcca gggcctcctc ggtcggggtc cagtcgttcc agaacggcgc    229740
     gggaatatcc ggaaagtcct cgcgcgtgac gccggcgaat gccggccgat agccgcggcg    229800
     ccgcatttcc tcgaccagcg cgcggtgccg cctggccaga tagcccaggc gggtgtagaa    229860
     gaacagcaga tggcccttgc ccagcgtgta ggcggccggc tgcaccagcg cgccgcgcgc    229920
     ggcggccttg tgcgccagcg cgaaaacccg cggcagttcg cggtattcgg cgaccaggtg    229980
     cgggccgctc agttcttcga cggggacaca attgatgcgg gtcaaggcgg ggctcctgtg    230040
     ggggcgcggc ggcggccatg acggccatcc ggccacgcat tagatcagaa aggcagcgga    230100
     gcgacggcag atggacaaga tacgcctgga caaatggcta tgggcggcgc gcttctacaa    230160
     gacgcgcagc ctggcggtgc aggaaatcgg caagggcagg gtgcaggtca acggccagcc    230220
     ggccaagccg gcgcgcgagg tggcgccggg cgacgtggtg tgcatccgca aggaagatcc    230280
     gcccatccat gtgcgggtct gcgcggtcag cggcgtgcgc ggcccggcgc cggtggcgca    230340
     gcagctgtac gaggaaacgc cggaaagcgc ggcggcgcgc gagcgggccg ccgagatgcg    230400
     gcggctggcg cccgagcccg ccatggatat cgtcgccggc cgtccgacca agcgcgaccg    230460
     ccgcctgatc gacaagtggc gcgacgctta ggacatcggc agggcggggc cgggcgcctc    230520
     gcgcagtgca gcggaattgt catcgcggat cgctaggatg cggggggtca tacccacgcc    230580
     accacgcgat ccggagggaa tactggcatg cacgaaccga cgatgagcaa gcgccgcctg    230640
     gtgctgaaga tgctgggcgg cgcgcccatg ctgccgctgg gcgccgtggg cgcggccacg    230700
     ctgctggccg gctgcagggc cggcgccgac ggcgcacagg ccgccgcgcg cggcgccggg    230760
     ccgcggggcg atttcgcggc ggccgccttc acgtccatgg ccgcgccgtc gctggacgcg    230820
     ccggaaaaaa tggccgtcac caccgtcgag tcgaccctgg aggtccgctt cagcgacggc    230880
     ggcaggcaga cgttccagct ggggtacgaa ccgttcttca tgaccggcga cagcgtgccc    230940
     gatggccagg gcgcgaccct ggtcgcgggc ggctatctcg atatccaggg ccgacccatc    231000
     atggacagct cggtgcccgg caaggcgcgc cagttctttt ccgactgccc cgacggcatg    231060
     tccctgctgg ccctgccgtc ggcccgggtg ccgggcgtca agggcaatac ggtgttcgcc    231120
     gtggtgcagt tcgagtacgc ctcgcacaac cagaagggcg agtccatgta cggcctgctg    231180
     ccgtcgccca tcgcggtgct gaccctggcg caggatccgg ccaccggcag gctggcgctg    231240
     gtcaagtaca gcccggtcga taccgccccg gcccacggcc tgtggatcac ctgcggcgcg    231300
     agcctgtcgc cgtggaacac ccatctggcc agcgaggaat acgagccgga cgcgaccacc    231360
     gcgcgcgcct cggcgcagtt ccagggcttc agccgcaacc tgtacggcga tgcggccaag    231420
     gccaatccgt atcactatgg gcacctgccc gaagtggtgg tccacccgga cggcaccggc    231480
     accatcagga agcactattg cctgggccgc atctcgcacg agctgatcca ggtcatgccc    231540
     gaccagcgca cctgtctgat gggcgacgac gccaccaacg gcgggctgtt catgttcgtg    231600
     gccgaccgca aggccgatct gtcggccggc accctctacg tcgccaagtg gcgccagacc    231660
     tcgggcgagg gcccgggggc cggcacgctg ggctggatca acctgggcca tgcccgcagc    231720
     gccgacatcg aggcgctggc cgataccctg acggcggccg acatcatgga cgtgcgcacc    231780
     gcggatccgg gcgacccggc cttcaaggcg atacgcgtca acggcaaggc caactgggtc    231840
     aggctggcgc cgggccgcga gcaggccgcg gccttcctgg aaacgcaccg ctacgcggcc    231900
     ctggcgggcg gcacgatggc gttttccaag atggaaggca ccaccgtcaa tgcgcgcgac    231960
     cgcatcgcct acagcgccat gtcgcgcatc gagacctcga tggtggacgg cacctcgccc    232020
     gacctgcgcg tgcagggccc cgagccgggc gcggtgtacg cgctgaacct gcgcggcggc    232080
     cagcgcgata gcgccggcac ggcgatcgac agcgagtggg tgccggtgga catggcggcg    232140
     gtgccggccc tggtcggcga gaaactggcc gcgcccgacg ccctgggcaa ccgccaccac    232200
     gccgaccgca tctccaatcc cgacaacatc aagttttcgg agaagctgcg cacgctgttc    232260
     atcggcgagg acagcaacgg ccacgtcaac aacttcctgt gggcctacaa cgtcgacagc    232320
     ggggcactct cgcgcatcct gtcgtgcccg gccggcggcg agtccaccgg cctgcaggcg    232380
     gtcgacgaga tcaacggctg gacctacatc accagcaact tccagcacgc cgccgactgg    232440
     ggcggcgtcc acgccgtcgt gcgcgccacg ctggacccgc tggtcaaggc cagctaccgc    232500
     gacggcttcg gcgcctcggt ggggtatatc acgataaagc cgtaactccc ggtgcctgtc    232560
     cccgacagtg tgcctgtccc ggcggggaca ggcacactgt ccgcggtgtc gcttcccggc    232620
     ggggacaggc accctggccg caggtgtcgc tctcccgcgg ggacaggcac cttgcgcccc    232680
     cgcacctgcc gcggtcagcc tggcgcccag cgggccaggt ccaacgccag cgcgccggcc    232740
     tgcaatcgcc cggcgatctc gtccgcgatc tcggcggccg gccggcccgc cgtgacgacg    232800
     cggtggccgg ccaggctgcc ggccgcgcgg aacgcatcgt gcatggtccg caccatcgac    232860
     gcctgtccgg gcccgctgcg ctgctcgacg cgcgccaggg cttcgtccag accgatatcc    232920
     agcaaggcgt aggcggccgg gcagcgcgcc gcctgcaatt gcgcggcgat gaggggcagg    232980
     aaccacggtc cgaagatgcc gtccaggtag acgcgatagc cgtcggcggc gaacgacgcc    233040
     gcgctgcggc ataccgcgcg gatgaccgcg gcgttctggg catcggcctg ggggcggtag    233100
     ggcgggatgg ggtgggccgg aaagccatag aacaggtcgg acggcaggtg caggccctgc    233160
     gggtcggcct gcgccagcag gccgcacgcg gtggtcttgc ccgaaccggg cggccccgag    233220
     acgatgacga tgggaagcat ggatggattc ctggagacgg tgtgcacggt gatagtacgc    233280
     gcgggcgggg ccgctcgggt ctgtcgcggt tctcagcggc cgaacagcgc gccgcactgg    233340
     gcgcagatct cggcggtgac ggccagccgc gcgtggtcgc gccgctcgat catgccgatg    233400
     gcgcgcaccg ccgggcccag ttcggcgggc aggggcagca cgcgcaactg cgggctggct    233460
     tgccagttgg cgccgttgag cagcggcagc agggtcacgc ccacctcctg gcgcaccagt    233520
     tccaccaggg tttcgatggc gttgagttcg aggaactcgt tcaggccgcc gcccagccgg    233580
     cgcacgatgc ggtcgatctg gcgcccggtg cgctgggtgc ggtcaaagcg caggaacgga    233640
     ttggcggcca gcacttcgcg cgcgtcggcg ccgggcgcgt gggggtgcgc cagcacgacc    233700
     agcggctctt cgtacagggg cgtccagcgc gtgctggcca tcttgcggcc ggcctcgacc    233760
     accagggccg cgtccagctc gccggcctcg accttgccgg ccagttcgct ggccttgccg    233820
     gagaacacgc gcacgtccag cgccggatga tcgcgcttca actgcgaaac caccttggac    233880
     agggtgccca tgcacgacac gatggcgccc accgagaccg agccggccag ctcgcccggc    233940
     acgttgcgtg gcgccttcag gtggtcgtat aaatcaagca gccgcttgat ctccggcacc    234000
     agttcgcgcc ccgccgcatt caggatggcg agccgcccgc cgcggtcgaa cagctcgcgg    234060
     cccagttcgg cttccagcgc gcgcatctgg aagctgaccg cggcctgcgt cagcgccacc    234120
     tgctcggccg cttccgagaa cgtgccgtgc tgcgccaccg ccagaaaggt acgcaggaac    234180
     cgtatgctac tcataaaaat attttgaatg acggaacaaa aaatcaaatt gatttaatta    234240
     gatcacgaga gtaacgtcat cgggttcaac ttgtgcccgc gctatcgata gagatcatca    234300
     gatgaaagcc ttcaattggg tcaatccgta cccgtccacc cgcattcccg tcttcgcccg    234360
     caatgtcgtg tccacctcgc acccgctggc ggcgcaggcc ggcctgcgca tgctgctcaa    234420
     gggcggcaac gcggtcgatg cggccatcgc ggcggcggcg accatcgtgc tggtcgagcc    234480
     ggtgtcctgt ggattgggcg gcgactgctt cgccatcgtc tgggatggcc ggcaattgca    234540
     cggcctgaac tcgtcgggcg tggcgccggc ggcgtggaat gtggagtatt tcaagcgcaa    234600
     gtacggcacc ggcccggacg ggctggccgt gcagcccaag cgcggctggg acgccgtgac    234660
     cgtgcccggc gtggtggcgg gctgggccgc gctgcacgag aagctgggca agctgccgtt    234720
     cgagcagctg ttcgaacccg ccatcgagat cgccgagcgc ggctatacgg tgccgccggt    234780
     ggtggcgcac aaatgggccg ccgcggccgc cgagctgagc gagcagcccg gctacgccca    234840
     ggcgttcatg cccgaggggc gcgcgccgcg ggtgggcgag catttccgct tccccgacgc    234900
     cgcgtacgcg ctgcgccgca tcgccgcctc gggcggacgc gacttctacg agggcgagct    234960
     ggccgagcgc atcgccgcgt tcagcaagga gtgcggcggc gccatgacgc tggacgatct    235020
     gcgcaattac cgccccgagt gggtcaagcc gatttcccgc tcctaccgcg gctacgagtt    235080
     gcacgagatc ccgcccaacg ggcagggcat cgccgcgctg atcgcgctgg gcatctgcga    235140
     gcgcttcgac ctggccgaca tgccggtcga ttcggtgcag tcgcagcatc tgcagatcga    235200
     ggccatgaag ctggcgttct ccgacctgta ccgctatgtc gccgatccgc gcagcatgga    235260
     agtcacgccg cagcagatgc tcgacgacgc gtacctggac agccgggcca ggctgatcga    235320
     cccggaccgc gccacgcatt tcgaggcggg gcgaccgcat gccggcggca ccatctacct    235380
     gacggccgcc gacgagaacg gcatgatgat ttcgttcatc cagtccaact acatgggctt    235440
     cggttcgggc gtggtcgtgc cgggcaccgg catcagcctg cagaaccgcg gcgtgggctt    235500
     ctcgatgaac ccggcctcgg ccaacgtggt ggaaggcggc aagcggccgt tccacaccat    235560
     catcccgggc ttcctgacgc gcggcggcaa gccggtcatg agctttggcg tgatgggcgg    235620
     cgacatgcag ccgcagggcc atctgcagac cgtcatccgc atgctggact accaccagca    235680
     gccgcaggcc gcctgctgcg cgccgcgctg gaaggtcaac cgcgatttca cgctggatat    235740
     cgagtccacc atgaaccgcg cgacggtcga ggggctgaag aacctgggcc accgcctcaa    235800
     ggcggtggac gacccgtaca tggacttcgg cgccggccag ttcatctggc gcatggcgga    235860
     aagcgacaac gatctcggct acgtggcggc cagcgacagc cggcgcgacg ggcaggccgt    235920
     aggcttctga cgcgcctgcg ggcgcacgac caccaagggg aaatccacaa catgaccaag    235980
     accaagagcc tgagcatgat gatgggcgcg gccgtgctgg ccggcgcggg cggcgccgcc    236040
     ctggcgcagg acctgcgcat cggcctgcag gaagacccgg acgtgctcga tccgcaccgc    236100
     gcccgcacct atgtgggccg catcgtcttc acctcgttgt gcgacaagct ggtcgacatc    236160
     gacgagaagc tgcagttcgt gccgcagctg gcgcagtcgt ggagtttcag cgaggacaac    236220
     aagacgctga cattcaagct gcgcaccgat gtccagttcc acgatggcag caagttcgac    236280
     gccgccgcgg cgcgcgccaa tctggagcgc gccatgacgc tgcaggacag catgcgcaag    236340
     ggcgaactgg cctcggtcga gaaaatcgag gcgcccgatc ccgccaccct ggtgctgacg    236400
     ctcaaacgcc ccgacgccac cttgctggct cagttgtccg accgcgccgg catgatgctc    236460
     tcgcccaagg ccttcgaggg cgacgcggcc gcggtgggcc gcaagccggt ctgctcgggc    236520
     ccctacaagt tcgtcgaacg ggtgcagaac gaccgcatcg tgctgcagaa gttcgaccag    236580
     tactacggcg ccaaggatta ccacttcgac aagctggtat tcctgcccat tccggacacc    236640
     acggtgcgcc tgtccaatct gcgcgccggc gggctggaca tcctggagcg catgaacccc    236700
     tcggacgcgc cgcaggtcaa gaacgacgcc agcgtgcagt tcatgccggt gtcggggctg    236760
     ggttaccagg aggtcttctt caatacgggc aacggcaagc gcgccgagac caatccgttc    236820
     aaggacaagc gggtgcgcca ggcgctggcc ttgtcgatcg accgcgccat catcaacgaa    236880
     gtggtcggcg gcggcatctt cgacccggcc agccagccgt tcccgccggc cagcccctat    236940
     cacagcgaca agttcccggt gcccaagcgc gatgtcgagc gcgcccgcgc gctgctcaag    237000
     caagccggcc tgcagaaggt caaggccgag ttcgccttcg gcaacaacac cacgacgtcg    237060
     gccatcgccg aaatgatcca ggccatggcg gccgaggccg gcttcgagct gagcctgcgg    237120
     cccaccgaat acgccgccat gctcaacgag gcgcaggccg gcaacttcga gatgatcatg    237180
     cgcggctggt cgggccgggt cgatccggac ggcaacatct accagttcgt gacctgcaag    237240
     ggcgcgctga acgacggccg ctattgcaat gccgaggtcg acaagctgct ggccgaggcg    237300
     cgcaccgtgc ccgaccaggc caagcgcaag gtgatctacg accaggccca ggcgctgctg    237360
     caggccgaca cgcacgatat ttacctgtac taccagccgt ggccgttcgt gctgggcaag    237420
     aacgtacgcg gcttcaagcc gtacccggac ggcatggtgc gcctgaaggg cgtgacgctg    237480
     gccaagtagc gacggtgggg gcggcgggcc gccgcggcgg cggccggctg ccgcgatcgg    237540
     cgcggcgcgc gggcgccgcc gcgcccgttt ttcggtggcg accatgttca aactgatcct    237600
     gcgacgcgtc gtcgtggcga tcccgacgct gatcctggtg tcgatgatcg tcttcatgct    237660
     gcagaaaatc ctgcccggcg atccggtgct cacgctggcc ggcgaggagc gcgatcccgc    237720
     ggtgctggac tacctgcgcg agaaataccg cctcaacgac ccgctgccgg tgcagtacgg    237780
     cgcctgggtg gcccaggtgc tgcagggcga cctgggcaag tccatgcgca ccgacgtgcc    237840
     ggtgctgacc ctgatcgcgc aaaagctgcc ggtgaccctg cagctggccg tgatggcgat    237900
     ggcgttcgcg ctgctggtgg gcattcccct gggcatcgtc gccgccgtgc gcaagggcac    237960
     ggcggtcgag atgggcgcca acatggccgc gctctcgggc atgtccattc ccaatttctg    238020
     gctgggcatc atcctcatca tggtggtctc ggtgcagtgg aagctgctgc cggcctccgg    238080
     ctatgtctcg ccggccgagg acttctggct ttccatcaag accatgctga tgccggccct    238140
     ggtgctgtcc acggcgatcg ccgcctacct gatgcggcac acgcgttcgg ccatgctgga    238200
     ggcgctgtcg gccgattacg tgcgcaccgc gcgcgccaag ggcgttgcgc cgcgcaaggt    238260
     ggtgctgcgc cacgcgctgc gcaacgcgct gatgcccatc gtgacgctgg tgacgctgct    238320
     gttcggcgaa ctgctggccg gtgcggtgct gaccgagcag gtgttcacca ttccgggttt    238380
     cggcaagctg atcgtcgacg cggtcttcaa ccgcgactac gccgtggtcc agggcgtggt    238440
     gctgtgcgtg gcggtcggct tcatcgtcat gaacctgctg gccgacatcc tgtacatcct    238500
     cgtcaacccc cgcctgaggc acgcatgagc gcacccatcg caagcgcggg catggccgcg    238560
     ccgcgccgcg ccaaccgctc ctggggcaag ttccgccgca accggattgc gatgctgggc    238620
     gcgctcatcg tgctggcgtt cgtcgtgctg gcgctgctgg cgccctgggt ggccagccac    238680
     gacccgttcc agaccagctt catgaccatc cgcaaggcgc cctcggcggc gttctggatg    238740
     ggcaccgatg aactgggccg ggacatcttc agccgcatgg tgtacggcgc gcgcgcctcg    238800
     ctgatggcgg gcatggtgtc ggtgctgatc gccctggcgg tgggggtgcc gttcggactg    238860
     gccgccggct atttcggcgg ctggaccgac agcgtcatct cgcgcgccac cgaggcgctg    238920
     ctggccattc cgttcctgat cctggcgatc gcgctggccg ccttcctggg gcccagcctg    238980
     accaacgcca tgatcgccat cggcgtatcg gccgcgccca agttcatccg gctcacgcgc    239040
     ggccaggtgc tggccgtcaa gaacgaggac tacgtgcaga gcgcgcgcgc cctgggcgcc    239100
     tcggacctgc gcatcatcgg ccgccacgtc tttcccaatg tcatgccgcc gctgatcgtg    239160
     caggccacca tcaccatcgc caccgccatc atcgccgagg ccagcctgtc gttcctgggg    239220
     ctgggcctgc agccgcccaa tccatcctgg gggtcgatgc tcaacacggc caagaacttc    239280
     atgacccagg cgccctggat gtccatcttc cccggctcgg cgatcttcct ggtggtgctg    239340
     ggcttcaacc tgttgggcga cggcctgcgc gacgcgctgg atccgcgcca ggagaagtag    239400
     gcatggacgc caatcgtgtg gtgcaggtcg acggcctgag cgtgcgcttc aacaccccgg    239460
     ggcgggtggt ccaggccgtc aacgatgtgt ccttccacgt cgaccgcggc gagacgctgg    239520
     ccatcgtcgg cgaatcgggt tcgggcaagt cggtgacctc gctggcgctg atgcggctgg    239580
     tcgagtacgg cggggggcgg ctcagcgcga ccgacatgcg cttgcgccgg cgcggcggcg    239640
     acgtgctgga cctggcgcgc gccgacgagc gcaccctgca acgggtgcgc ggcgccgatg    239700
     tggcgatgat ttttcaggag ccgatgactt cgctcaaccc cagtttcacc gccggcaacc    239760
     agatcgccga ggcgctgcaa ctgcaccagg ggctggacgc ggccggcgcg cgcgccgagg    239820
     cgctgcgcat gctggagcgg gtgcgcattc cggaagcccg cgccatcctg gaccgctatc    239880
     cgcaccagct ctcgggcggc atgcgccagc gcgtgatgat cgccatggcg ctgtcgtgca    239940
     agccgcagct gctgatcgcc gacgaaccca ccaccgcgct ggatgtcacc atccaggcgc    240000
     agatcctgca gctgatacgc cagctccagg aggaaatgga catgggcgtc atcttcatca    240060
     cccacgatat gggcgtggtg gcggaggtgg ccgatcgcgt gctggtgatg taccgcggcg    240120
     acaaggtcga ggagggcggg tgcgacggcg tgttcgccgc gccgcgccat gcctatacgc    240180
     gcgcgctgct gtcggcggtg ccgcggctgg gcgccatgca gggcaccgac cagccggcgc    240240
     cgtttccgct gttgcaggtc gaccagcagg ccctggcgcc ggctccgcag gccggcgcgg    240300
     ccgaggtgga caccgtgcgc cgcgacggcg gtccggtgct gaaagtgcgc gggctggtga    240360
     cgcggttcga catcgccggc ggcattttcg ggcggatcga caagcgcgtg cacgcggtcg    240420
     agcaggtcag cttcgagctg ttccccggcg agacgctggc gctggtgggc gagtccggtt    240480
     gcggcaagac caccacgggc cgctcgctgc tgcagctggt caaaagccag ggcggcagca    240540
     tcgagttcga cggccgcgac atcggggtgc tgcgcggcgc ggccatgcag tcgctgcggc    240600
     gccatatcca gttcatcttc caggacccgt tcgcctcgct caacccgcgc atgacggtgg    240660
     gcgactccat catggagccc ttgctggtcc acaggacggc cagcgggcgc gccgcgcgcg    240720
     agcgggtgcg ctggctgatg gacaagtgcg ggctgctgcc cgaaatgacc gaccgctacc    240780
     cgcacgagtt ctcgggcggg cagcgccagc gcatctgcat cgcgcgcgcg ctggcgctca    240840
     accccaaggt ggtgatcgcc gacgaatcgg tctcggcgct ggatgtctcg atccaggcgc    240900
     agatcgtcaa cctgctgctg gacctgcagc gcgagctggg ggtgtcgtac ctgttcatct    240960
     cgcacgacat ggcggtggtc gagcgcgtca gccaccgcgt ggccgtcatg tacctgggcc    241020
     agatcgtgga gatcggcccg cgccgcgcca tcttcgaaaa cccgcagcat ccctataccc    241080
     gcaagctgat ggcggcggtg ccgatcgccg atccgcgccg gcgccaccgc gagcgttcgc    241140
     tactggtcga cgagattccc agcccggtgc gcaaggtggg cgacgagccg gtggtcgcgc    241200
     cgctggtgcg ggtgggcgaa ggccactacg tggcgcgcca tcccgtgggc gtgtacgcct    241260
     gagctcagcg ccgctccagc gccagcttca ggccgaaggc gatgaagacg ccagcgctca    241320
     ggcggtcgag cccgcgcgcc accgaggggc gcgccagcca gcgcgacaac ggccgggtgg    241380
     ccgccaccag ggcggcgaac cacagcaggc ccagcgcggc gtgcagcgcg gccagcagca    241440
     ggctgaatgc cagcacgtcc accccggccg ggatgaattg cggcaggaac gtgacgtaga    241500
     agacgccgac cttggggttg agcatgttgg tcaggcagcc gcgccagaac cattgcaagg    241560
     cgccgccgcc ggccggcgcg gccggcagca tgccgggggc cgcgtcgccg gcgcgccggc    241620
     gcaggctgcg ggccagcagg cgcgcgccca gccagcacag gtagatcgcc ccggcgatgc    241680
     gcagcgcgtc gtaggccagc gaggacgccg ccagcagcgc gcccaggccg agcgcggcgg    241740
     ctacgcccca ggccaggcag ccggcgcata cgcccaggcc ggccagcagc gcgcggcgcg    241800
     gcccgtcgat cgccgcggtg cgcagcacca gggcggtgtc caggccgggg gtgatggtga    241860
     gcagggtggc ggccacggtg aaggccagca gggcggcaag aggcgtcatg gcgagggacg    241920
     gagcaggtgc ggcacgcaat cgcgcgggca gttatcattg ccggtctttg gcaacccagc    241980
     aactggatca ggcactcttc atggccctgc gcgcaaccat ttacaaggcg gacctgcatg    242040
     tcgccgatac cgaccgccac tattatgcca gccatggcct gaccatcgcg cgtcatccgt    242100
     ccgagaccga cgagcgcatg atggtgcggg tgctggccta tgcgctgcac gccgacgaac    242160
     agctcgcctt caccaagggg ttgagcgata ccgacgagcc ggacctctgg cgcaaggacc    242220
     tgaccggcga tatcgaactg tgggtcgagg tcggccagcc cgacgagcgg cgcatcctca    242280
     aggcctgcgg gcgcgccgcc gaggtcgtgg tgtattgcta cggcggccat gcctcgcagg    242340
     tctggtggga cggcgtgcgc ggcaagctgg agcgcgcgcg caacctgcgc gtggtctgcc    242400
     tgcccgcggc gcagaccgag gcgctggcgc agctggcgcg ccgcaccatg caggtgcatg    242460
     tcaatatctc cgacggcgcg gccttcgtca gcaccgatga gggccaggtc caggtcgagc    242520
     cgcaatcctg gcgctgaggg ggtaaagggt gcctgtcccc gcggggacag gcacctctgc    242580
     cgcagcgggg acaggcaccc ttgccgcagc ggggacaggc acccctgccg cagcggtgac    242640
     aggcgcccgg ggcagccacg gcgcgccgga tcagccgcgc gccttgcgtt cttgccaggc    242700
     cagcagcagc aggacggcgg cggcggcggg aaagaccgtc agattgacga tggaccagcc    242760
     gccatgggcc agcagctggc cggacgagaa cgaagcggcg gccacgcagc cgaataccag    242820
     caggtcgttg agcgcctgga cgcgcaggcg ttcgtgcggc tcgcaacagt cggccagcat    242880
     ggcggtggcg ccgatgaagc cgaggttcca gcccacgccc agcaggacca gcacggccca    242940
     gaaatgcggc acgctcaggc cggtcagcga gacgccggcc gcggccagca tcagcgccag    243000
     gcccagcgcg gtgaccggca gcttgccgaa acgctcgatc agccggccgg tgacgaagct    243060
     gggggcatac atggccagca catgccattg gatgcccagg gccgcggcgg cgacgctgtg    243120
     gccgcagtcg accatggcca gcggcgcggc ggtcatgacc aggctcatca agccgaacga    243180
     caccacgccg gccgcggccg cgatgatgaa gcgcggcgtg cgcgcgatgc gcgccagggg    243240
     ccggccggcc tgcgccgcgg ccaggccgac cggcaccgcg cgcagccggc tgacgacgcc    243300
     cagcgccagc agcgccagcg cggcctgcga gacgaagctg ccggcaaagg gcgcggcggg    243360
     ccacaggttg cgggtccaga tggcggcatt ggtgcccagc accgccgcca ccaggccggc    243420
     gctcatgatg gccgaaatgg cgcgcggccg gtgctcgggg cgcacgccgt cggtgacggc    243480
     gtggcggtag ctctgcacgt aggcgccgta caggccggcc agcgccgtgc cggtacagaa    243540
     cagcgcgaac cggccgctcc agatgcccca ggcggccagc aggccgccca gcaggcccag    243600
     cagggcgccc aactggtagc cgccgcgccg gccgcggcgg cgcatcatgg cggccgcggg    243660
     caggatgccg gcggccaggc cgaggttgta caggctgacc ggcagcgtcg ccagccccgg    243720
     gtcgccggcc agcatctggc ccaccagccc gcccatcgag atgacgatgg ccgggctggc    243780
     tccgcccagc gcctgcgcac agctgagcag gcgcgtgttg cggcggatat tcggcgattc    243840
     ggcggtcgtg gtcatgggca cctggcgcga acagggcgcg gcaggccgcc gcgcaaccct    243900
     gattctgcgt caaaaccgcc cgcggcgtca gcgcggcgcg acaggcgcgc gcgccagcga    243960
     ccagaaggcg ggcaggaagc actcggccac cagcagcggc tggccggcgc gccagaaggc    244020
     ggagcggcgc gcccacagcg ccggctccgg gccgccggcc ggcgcgcgcg cgatggcggt    244080
     ggcatggaag ggcacgccgg cggccagccg gcggcatacg aagaccgaac gatggatgcc    244140
     gggatcgtgg tacagcatgt cggccagcgg gcgcgtcagc aggcgccgca tgccctgcca    244200
     gacgccatgc gaggcgcgca gcggcgtgag gctgcgcgcc acgacgctgt ccacgccgtc    244260
     gatcgacatc agcacttcgc gcacccagac cgggctttgc gcggcgatgc gcatgccgtc    244320
     ggcctcgtcg cggggcgcgc cggtcgggta ctctgccagc acgcgcaggc gtacgtggcc    244380
     cagctggcgc aggccggcgg tgagcgcgcc gggacggaac agccaatact tgcgcaaggg    244440
     atccagcgtc gagggcgcgg cgggcagcca gccgcgcgca aggggaatgg gggtggtcat    244500
     ggctgtgtat tatgccaagc cggcgcggcg cccgtgaggc aggctctaca atacgcgcca    244560
     tggaaaaagt acgcatctcc aagctgatgt ccgagcgcgg gctctgttcg cgccgcgagg    244620
     ccgacagcta tatcgaacgg ggctgggtgc gcgtcgacgg cgtggtggtg tccgagctgg    244680
     gcgcgcgcgc ctttcccgat caggccatca cgctggagcg cgccgcggcc gcgcgccaga    244740
     ccgcgcgtgt caccatcttg ctgcacaagc ccgtgggcta tgtatcggga caggccgaga    244800
     aaggctacac cccggcggtg gcgctgatcg acgcgcgctc gcgctatgcg ggcgaccgcg    244860
     cgcccctgcg cttcgagcgc ggccagctgc agggcctggc cgtggccggg cggctcgaca    244920
     tcgactcgca gggcttgctg gtcctcacgc aggatggccg tatcgccaag aagctgatcg    244980
     gcgaagactc cgaggtcgac aaggaatacc tggtgcgggt gcagggccgc ctgtccgagg    245040
     cggggctggc gctgctcaac cacggcctgt cgctggacgg caagccattg cgccccgccc    245100
     aggtgcgctg gcagaacgcc gaccagctgc ggttcgtgct gcgcgagggc aagaaacgcc    245160
     agattcgccg catgtgcgag ctggtggggc tgcgggtggt gggcttgaaa cgggtgcgca    245220
     tcggccgggt gtcgctgggc gacctgccgg tgggccaatg gcgctatctg cgcgccgacg    245280
     aacgcttctg agcgacgtaa ccgtttcagt cgatttccaa gcggccgccg ccggcccggc    245340
     gattaacgca aatttaaaaa cgccgggtta ttctggcctg ccagtgtctt gttgctcaga    245400
     cgctccatca ggaattccac gaagatgcgg gtcttggccg gcagcatgcg ggtgtccgtg    245460
     accgcgtaga ccgggaacgg cccggccagc caatcgggca ggatgcgctt gagacggccc    245520
     gattcgatgt cctcgcgcac attgcccatg ggcgccagga tcgcgatgcc ggcgcccagc    245580
     gtggccaggt tgcgcaccat cgacacgctg ttgaccgaaa agcggttgcc cggggtgatc    245640
     tcgacgtggc gctcgccgct gttcaggggc cagcgcgtga cgcggcccgt gccggcgcgg    245700
     aactgaatgc attcgtggcg gggcaggtca tcggggtgtt gcggttcgcc gtggcgcgcc    245760
     aggtaatcgg gcgacgcata caggtgggcc ggcagcacgc ccagcaggcg ggcgatgtgg    245820
     gtggagtcgg gcagatcgcc gatttcgatc gacacatcgc aggtctggaa aacccgctcg    245880
     gcgtgctcgg ggctggccag gtccaggtag aaggtgacct cggggtagcg gcgcgagaac    245940
     tccgtgaacg cctcggacag gaagtcggtg ccgaagtcgg ccggcatgtt cacgcgcagc    246000
     ggaccggacg gcgtctcgac caggttctgc agctcttcat gggcgatgcg ggcttcggcc    246060
     acgatgcgct ggcagcgctc gaagtaaagc tgcccggctt cggtcagctc gacccggcgc    246120
     gtggtacggc tgagcagcct caggccgacc gaacgctcca gttcggccac ctggcgcgac    246180
     agggtggatt tgggaatggc caggttctcg gcggcgcggc tgaagctgag cgtcctggcc    246240
     acttcgacga agagttccat gccttgcaaa cggttcatgg cggatggtga gagggcggaa    246300
     tatgaaattg tcccatattt ggaatgatgt tttcgaaaac aagttgtttg tttccaccgc    246360
     gggataacgc aaaatgctcg ttttgcagcg cagcaccaag ccggccggca aacccgcatg    246420
     gcggaggcgg tgtgtttcct tttatgcgtt gtggcgcgca acgggtgcgc acaggcatcc    246480
     cggcgcttgg tttgaatgga aaggcaagct atgaagaata actatctggt cgggcgcggc    246540
     atcgccgcgc tttccttggc ggcattgacc ctgacgctgg ccgcatgcgg caaggaacag    246600
     caggcggcgc agcaaggcgg gcaaccgcag gtcggggtgg tcaccctgaa aacccagtcg    246660
     gtggcgctgt ccagcgaatt gcctggccgc accgccgcct accgcatcgc cgaagtgcgt    246720
     ccgcaggtca gcggcatcgt ccagaagcgc ctgttcaccg aaggcggcga agtcgccgcc    246780
     ggccagcagc tctaccagat cgatccggcg ctgtaccagg ccgaggtcga cagccggcgg    246840
     gccgcgctgg cgcgcgtcca ggcgcagctg aagaccgcca ccttgctggt gcagcgctac    246900
     aagccgctgg tcgatacgcg ggcggtcagc cggcaggcct acgatgacgc ggtcgccgcg    246960
     cgcgaccagg cctcggccga cgtcctggcg gccaaggctg cgctggacac cgcgcgcatc    247020
     aacctggtct ataccaaggt gctggcgccg atcggcggca tcatcggccg ctccaacgtc    247080
     accgaaggcg cgctggtgac ggccaaccag agcgcggcgg tcgcggcggt ccagcagatc    247140
     gaccccatct acgtcgacgt gacgcagtcc agcgtgcagc tgctgcgcct gaaaagcgcc    247200
     ctggacagcg gtttgctgca gcgcgaggct ggcgagcagt cggcgcgcgt gacgctgacg    247260
     ctggaagacg gcacgcagta cgaccaggac ggcaagctgc aattctcgga ggtcaccgtc    247320
     gacccgggca ccggctcggt gctgctgcgc gccgtgttcc ccaatccgca gcgcaagctg    247380
     ctgccgggga tgttcgtgcg cgcccggctg gccgagggcg tggcgtccga gggcctgctg    247440
     gtgccgcagc gcggcgtcac gcgcaaccag cgcggcctgc ccaccgcgct ggtggtcaac    247500
     gccgagaaca aggtcgaact gcgcacgctc aagaccgacc gcgccatcgg cgaccaatgg    247560
     ctggtgagca gcggcctggc cgccggcgac cgcgtgatcg tcgaaggcct gcaatccgtg    247620
     cgtccaggcg ccgaggtcaa ggcggccgaa tggagtccgc ccgcatccaa ggccgccgcg    247680
     caaccggccg ccgcgaagta agggagttcc cgcatggcaa agtttttcat cgacaggccg    247740
     gtgttcgcct gggtgatcgc gattgtgctg atgatggccg gcgcgctctc catcctgagc    247800
     ctgccggtcg cgcaatatcc gaacatcgcg ccgcccgcca tcagcatcaa cgtgacctat    247860
     cctggcgcct cggcccagac cgtgcaggac acggtggtgc aggtcatcga gcagcagatg    247920
     aacggcatcg acaacctgca gtacatctcg tcggaaagca attccgacgg cagcatgtcg    247980
     atcacgctca cgttctcgca gggcaccaac ccggatacgg cgcaggtgca ggtgcagaac    248040
     aagctggcgg tggcccagcc gctgctgccg ctggaagtgc agcagcaggg catccgcgtc    248100
     accaaggcca ccaagaactt cctgatcgtc gccggcttcg tgtccaccga cggcaccatg    248160
     gacaagtccg acctggccga ctacgtggcc tcgtacatcc aggacccgat cagccgcacg    248220
     cccggcgtgg gcgacttcca gctgttcggc gcgccatacg ccatgcgcat atggatcagc    248280
     cccgagaaac tggtcaattt cggcctgacc gcctccgacg tcaccaccgc gatccgcgag    248340
     cagaacgtgc aggtctcgtc cgggcagctg ggcggccagc cggcggtgcg cggccagcag    248400
     ctcaacgcca cggtgatcgg accgtcgcgg ctgcagaccc cggaagcctt cggccgcatc    248460
     ctgctcaagg tcaatagcga cggctcgcag gtgcgcctga aggacgtggc cagcatcgag    248520
     ctgggcgcgc agacgtacgc catcgacagc tattacaacg gcaagcccgc ctcgggcctg    248580
     gccatcaagc tggccagcgg cgccaacgcg ctcgataccg cccaggcggt gcgcgagacc    248640
     atcaacggcc tcaagccgta cttcccgccg ggcatggacg tggtgtatcc gtacgacacc    248700
     acgccgttcg tcagcctgtc gatcgagggc gtggtcaaga cgctgttcga agcggtgctg    248760
     ctggtcttcc tggtgatgta cctgttcctg cagaacgtgc gcgccacgct catccccacg    248820
     ctggccgtgc cggtggtgct gctgggcacg ttcggggtgc tggcggcgtt cggctattcg    248880
     atcaacacgc tgaccatgtt cggcatggtg ctggccatcg gcctgctggt cgacgacgcc    248940
     atcgtggtgg tcgagaacgt cgagcgcgtg atggccgagg aggggctgtc gcccaggcag    249000
     gccacccgca agtcgatgag ccagatcacc ggcgcgctga tcggtatcgc catggtgctg    249060
     gcggcggtgt tcgtgcccat ggcgttcttc ggcggttcca ccggggtgat ctatcgccag    249120
     ttctccatca ccattgtttc gtccatggtg ctgtcggtgg tggtggccat tgtcttcacg    249180
     ccggcgctgt gcgccaccat gctcaaaccc atcccgaagg gccaccatgg ctccaagaag    249240
     ggctttttcg gctggttcaa ccgcaccttc gagcgttcca gccaggccta tgccaacaac    249300
     gtggctcgca gcatggggcg caccaagcgc ctgttgctga tctacgtggt gatcctgctg    249360
     ggcatggctt ggatgttcat gcgcattccc accgcgttcc tgccggacga agaccagggc    249420
     atcctgttcg cccaggtgca ggcgccggcc ggcgccacca gcgagcgcac ccaggccacc    249480
     atcgacgcgg cggtcaagta cctgctggaa gacgagaagg agtcggtggc ctcggtgttc    249540
     gcggtcaacg gctttagctt cggcggccgc gggcagaacg ccgccatcct gttcatcaag    249600
     ctgcgcgact ggaacgaacg caagggcgcc gagcaccgcg ccgccgcggt ggccgcgcgc    249660
     gccaatgcca agttccgcgc cgagttgcgc gacgcgcagg cggccgtgtt cgcgccgccc    249720
     gcggtgatgg agctgggcaa cgccaccggc ttcgacttcc agctgcagga ccgcgccggc    249780
     gtcggccacg agaagctgct ggcggcgcgc aaccagctgc tgcaagaggc cggcacaagt    249840
     cccatgctgg tggccgtgcg ccccaacggc atcgaggacg cgccgcagta ccagctggac    249900
     atcgaccgcg agaaggcgcg cgcgctcggc gtgtcgatca ccgagatcaa caacacgctg    249960
     gccaccgcct ggggctcgtc ctacgtcaat gatttcatcg accgcggccg ggtcaagaag    250020
     gtgttcgtgc agggcgaggc atcgtcgcgc atgctgccgc aggacctgga caaatggtac    250080
     gtgcgcaaca acgcgggcga catggtgccg ttctcggcct tctcgtcggc gcaatggacc    250140
     ttcgggccgc agaagctgaa ccgctacaac ggcgtgccgt cgtacaacat ccagggccag    250200
     gccgcgccgg gctacagctc gggcgacgcc atggccgaga tggagcggct ggccgacaag    250260
     ctgccgctgg gcatcggcta cgactggacc ggcctgtcgt tcgaggagcg cctgtcgggc    250320
     gcgcaggcgc cggcgctgta cgcgatctcg ctgatcgtgg tgttcctgtg cctggccgcg    250380
     ctctatgaaa gctggagcat tcccaccgcg gtgatgctgg tggtgccgct gggcgtggtg    250440
     ggggccttgc tggccaccct gacgcggggc ctgtccaacg atgtgtactt ccaggtgggg    250500
     ctgctgacca ccatcgggct ggccgccaag aacgccatcc tgatcgtgga gttcgccaag    250560
     gagcactacg aggagggcgc cagcctgacc gaggcggcgg tgcacgccgc gcgccagcgt    250620
     ctgcgcccca tcctgatgac gtcgctggcg ttcatcctgg gcgtggtgcc gctggccatc    250680
     tccacgggcg ccggctcggg cagccagaac gccatcggca cgggcgtgat cggcggcatg    250740
     ctcaccggca ccttcctggc gatcttcttc gtgcccctgt tctttgtcct taccctgcgc    250800
     ctgttcaagg tcaagcgcgc ctcggagaac cgcgaggacg acgacccgca tggcggcgcc    250860
     cagccggcca cgcacggagg acagccgcaa tgaaacctgc cgtcatgaga accttgttgt    250920
     cccttgccgt ggccacggcc ctggccggct gctcgctggc gcccacctac gagcgcccgc    250980
     aggcgccggt cgacgcggcc tatccgtccg gcccggccta cggcgcgccg ggccaggccg    251040
     ccgcgggcgc gccggccgcc gccgacgtgg gctggcgcga cttcttcggc gacccgctgc    251100
     tgcaggaact gctggcgctg tcgctggcca acaaccgcga cctgcgggtc gccgcgctca    251160
     acgtggaggc ggcgcgcgcg cagtaccgca tccagcgcgc cgatctcgcg cccagcgtgg    251220
     gcgtgggcgg caccggctcg gtgcagcgca ccccggccga cctcaacccg agcggacagg    251280
     ccggcatcag ccgcagctat caggtcggcg ccagcctgtc gacctgggag ctggacctgt    251340
     tcgggcgcat ccgcagcctc agcgagcagg cgctgcagct ctatctggcc caggacgaaa    251400
     cgcgcctggc cacccagctg acgctggtgg ccgagaccgc caacgcctac ctgaccctgc    251460
     gcgccgacca ggaactgctg gcgctgacgc gccagacgct ggcggcccag caggagtcgt    251520
     acaagctgac ccgccagagc tacgacctgg gcgtggcgac cgaactggac ctgagccagg    251580
     ccgagatttc gctgcgcacc gccgagcgca atctgtcgca gtacacgcgc atggcggcgc    251640
     aggaccgcaa cgcgctggtg ctgctggtgg gccagccgct gccggccggg atcggcgcgc    251700
     agctggacca ggccgtggcg ctgcccgatg gcgtggtcct ggccgacctg ccggcgggcc    251760
     tgccgtcgga tctgctcgcg cgccggccgg atatccgcgc ggcggagcac cagctgcaag    251820
     ccgccaacgc cagcatcggc gcggcgcgcg cggcgttctt cccgcgcatc agcctgaccg    251880
     gctcggccgg cacggccagc gccagcctgg gcggcctgtt cgatgccggg tcgggcgcct    251940
     ggagtttcgc gccgcagatc agcgtgccga tcttcgcggg cggggcgctg cgcgccagcc    252000
     tggacctggc caagatccag aaggatatcg gcatcgcgcg ctacgagcag gccatccaga    252060
     gcgggttccg cgaggtctcc gacgcgctgg ccggccgcgg cacattgcag gagcagatcc    252120
     ggtcgcagga actgctggtg caggccaacc agcgcgccta cgacctgtcg cagcagcgtt    252180
     accagcaggg catcgacaac tatctcagcg tgctggattc gcagcgttcg ctgtatacgg    252240
     cgcagcagac gctggtcgag acgcggctgg cgcgcctgtc caacctgatc cagctctaca    252300
     aggcgctggg cggcggctgg tccgagcgca cggtggcggc ggcgcaggcc agctgatcgc    252360
     gcgcggccgt ccaaaacaga caggccggca agatgccggc ctgtctgttt gcccagtggc    252420
     gggggtcagg cgcgcttctt ggcgaccagg cccacgacga acaacacgat gatcgcgccg    252480
     acgaccgaac cgatccagcc cgcgggttcg cccggtgcgt accagcccag ttgctggccc    252540
     aggaaaccgg cgaccaccga tccgatgatg cccaggatcg tcgtcatgat gtagcccatg    252600
     ttctggtctc ccggcatgat ggcccgggcg atcagtccga cgacaaaccc gacgatgatc    252660
     atgatgatga tgctcatacg cgcgctcctt cgtggtggcg aaatggtgcg gccatgatac    252720
     ccatggccgt gcgcccgacg ctgtaacaac acgtacgacc gcaggggatt gccgcgcggt    252780
     ggggcgcaaa agcaacaacc gcgccctggg gcgcggtccg gatcattggg tctgcgcgat    252840
     gagctggcgc aggtccttga ccatggtgtc gatggtgtcc gtgtcggagg ccagcaggcg    252900
     cgccttgccc tggttgtcga agatatagac gccgcggctg tgggtgacgt cgtagatatc    252960
     ggcgtcgtcg cccggcttgg gcttctcgat ctggtaggcc acccgatagc gccgcgccag    253020
     gtcggcgatc tgcttttcgt tgccggtcac gccgatcgcg ttgttgttga acgcattgac    253080
     ataggcctgc aggatgtccg gggtatcgcg atgcgggtcg acgctgacga acaggatgcg    253140
     cacgtccctg gcctgctcgc ccagttgctg cagcaccgcc gtcagttgcg ccatggtggt    253200
     ggggcagacg tcggggcagc tggcgtagcc gaagaacagc aataccgtct tgcccttgag    253260
     gtcgtcgctg ctgacggtct tgccgtgcgc gcccggcagg ctgaacttca ggtcgggcag    253320
     atggcccttg acgttgtaca gcgaccaatc cgccgaacgt tcgctgcacg ccgccagcag    253380
     catcaacatc gccaggagca ggccgcgcca cgcgcggccg gaaagaggtg agtacatggt    253440
     agatacagcc aggcgccgat gcggcgcgcg catgagtggg aaggacctgg ggattctacc    253500
     gcgtcggggc gggaggggcg cggggggagg ggggcagagg tgcctgtccg cgtggggaca    253560
     ggcacctgag gcgtcaggcg tcagaagtca gcaggtgcca gtccccgcgg ggacaggcac    253620
     ctgagaggtc aggcttgcat gccgctgtgc cgcagcaggg cgtcgatgcg gggttcgcgg    253680
     ccgcggaagg cgcggaagga gtcggcggcg gggcgggcgc cgccgacggc gaggatttcc    253740
     ttgcgaaagc gcgcgccggt ggcgccgtcc agcgtggtgg cggccggctc gccctggcgg    253800
     gcggcttcct cgaaggcttc gtacgcgtcg gccgacagca cctcggccca cttgtagctg    253860
     tagtacccgg cgccataacc gccggcaaac aggtgcgaga agctgtgggg caggcgatgc    253920
     cacgcgggcg ggaacagcac tgcgacttcc tggcgcacct gctgcagcag cgccagcacg    253980
     tcggcgatgg gcgcgccttg cgggcggtcg tgcagcatca tgtcgaacag cgcgaactcg    254040
     atctggcgca cggtctgcat gccgctctgg aagttgcgcg ccgccaccag acggtcgtag    254100
     agatcgcgcg gcagcggctg gccggtttcg acatgggccg acagcttctg caccacgctc    254160
     cattcccagc agaagttctc catgaactgc gacggcagtt cgatggcgtc ccattcgacg    254220
     ctggcgaacg ccgccgcgcc gggctcgtcc acttcggaca gcagggcgtg cagcgcgtgg    254280
     ccggtttcgt ggaacagcgt gatgacgtca tcgtgcgtga gcagcgcggc cttgtcgcca    254340
     ttggggcgcg agaagttgca ggtcaggtag gcgaccggcg tctgcagatc gccttgcacg    254400
     cggcgtctgc tgcgctcgct gtcgacccag gcgccgcttt gcttgccggc gcgcgcgtac    254460
     aggtcgaggt aaagatgacc cagcgtcgcg ccggccgggc tttcgacccg cacgccgcgc    254520
     acgtcggcat gccaggacga caccggcact tcgcgcaggc gcacgtcgaa cagcgtctcg    254580
     atgacctcga acaggcccgc cagcacgcgc ggctcggtga agtactgctt gatctcgtct    254640
     tccgaatagg catagcgcga ctcgcgcagc cgctcggcgg cgaagggcac atcccagggc    254700
     tgcagctcgg ccaggcccag ctcgccggtg gcgaaggcct gcaattcggc caggtcgcgt    254760
     tcggcgtacg gtttggcgcg gcgcgccagg tcgcgcagga agtccacgac ttcggtggcg    254820
     tcgcgcgcca tgcgggtctg caggcgcagg gcggcgaagg tggggtactg cagcagcccg    254880
     gcttcgtcgg cgcgcagctg cagcagttct tcgatcagcg gcgagttgtc gtaggcggcg    254940
     tcgccatgtt cggacgcgac ggtgccgtac gcgcggtaca gggtttcgcg cagggcgcgg    255000
     tcgcgcgcgt actgcatgac gggcaggtag cagggcattt tcagcgtcag cttccagccg    255060
     gtggcgccat cgtcctcggc cgccttgcgc gccgcggcca gcacgtcggc cgggatgccg    255120
     tccaggcgcg cctggtcgtc gaccagcagc gaccacgcgt cgatggcgtc gagcacgttc    255180
     tcggagaact tctgcgatgc ctgggcctcg cggtcggaga tctcggcgta gcgttcgcgc    255240
     gcggcccctt gcagctcgac gccgctgagg cggaagtcgc gcagcgccag ctcgaccacg    255300
     cggcggcgca ccggcggcca ggccgcgaaa tcctcggcgg cctgcaggcg ctggtactgg    255360
     cgatacaggc cttcgtgcag gccgacccag gtggagaact cggtgaccag cggcagcgcg    255420
     gcgttgtagg cctcgcgcag cacgggcgtg ttgaccaccg cgttcaggtg gccggccacc    255480
     gaccaggcgc gccacaggcg ctcggatgcg ctgtccaggg gcgccaccac ggcgtcccag    255540
     gtggcgggca gggccgggtc ggccgcgtgt tcgaccgccg cgcgggcgat atccagcagg    255600
     gcctggacgg ccggcacgat gtgttcgggt ttgacggcgg cgtagtcgac caggtcggcg    255660
     accggcgcaa gcaggggatt ctgggtcatg ggcttgggaa ttccgtggac gagcgggcgc    255720
     ggcccgaagg gcgcgcatgc catgagagtg gggacggacg ggcggattgc aaggcgggca    255780
     tgccaggcgc ggcgcgcctg gctgcgtggg gcagggcctt acgcggcagc gcgttcggcc    255840
     gcttcaaccg tattgaccag cagcatggcg atggtcatgg ggccgacgcc gccgggcacc    255900
     ggcgagatgg cgccggccac ttcgcgggcc gaggccatgt cgacgtcgcc gcacaacttg    255960
     ccgtcggcgc cgcggttgat gccgacgtcg atgaccacgg cgccgggctt gatcatcgag    256020
     ccgtcgatca tgccgggctt gccggtggcc accaccagca cgtcggcgcg gcgcgtctgg    256080
     gcgcccaggt cgcgggtctt ggagttgcag atggtgatgg tcgcgcccgc ctgcagcagc    256140
     agcatcgcca tcggcttgcc gacgatattg ctggcgccca cgatgaccgc ctcggcgccg    256200
     cgcagggcca cgccttcgga ttcgagcatc ttcatcacgc cgtagggcgt gcaggggcga    256260
     aacagcggct ggccggtcat gagcaggccg gcattgctga tgtggaaacc gtcgacgtcc    256320
     ttctcggcgg caatggcctc gatcaccttg tgcgcgtcca tgtgcctggg cagcggcagc    256380
     tgcaccagga tgccgtggat ggacgggtcg cggttgagcg cgtcgatgcg ttcgagcaac    256440
     tgggcctcgg tgaggtcggc cgggtattgc tccttgaccg aatgcaggcc ggccttctcg    256500
     caggcggcga ccttgttgcg cacatagact tgcgaggcgg ggtcgtcgcc caccagcacg    256560
     accgccaggc cggggcgcac gcccttggcc gtcagcgcct gcacgcgctg ggcgacttct    256620
     tcgcgaatgc gctgcgacag ggcggcgccg tcgatgatgc gtgcggtcat gcgtgggcct    256680
     cgggtttggc cagggccact ttcatcaggt ctgctacggt ggtcacttca agtttttcca    256740
     tgatgttggc gcggtgcgcc tcgacggtct tgatgctgat gcccaggtcg tcggcgatct    256800
     gcttgttcaa gcggccggcg acgatgcgct ccagcacctg ttgctcgcgc gccgtcaggc    256860
     gggcaagcat ggcttcgtgg tctttctgcg cctggaactt gctgatccgc tgcaccgcct    256920
     gctccagcat gcgggccacg atctcgcgca ggtcggattc gttgaacggc ttttccagga    256980
     agtccacggc gccctttttc atggtcgaca ccgccatcgg cacgtcgccg tggccggtga    257040
     tgaacacgat gggcagcggg gcgttgcggg cgatcagctg ctcctgcagt tccaggccgc    257100
     tcatgcccgg catgcgcacg tcggcgatca gcacgccgat ctggctggcg tcgtactcgt    257160
     ccaggaaatt ctcgccgctg gcgtaggcgc gtacgcggta gccgttggct tccagcagcc    257220
     agcgcaggga atcgcgcacg gcttcgtcgt cgtcaactat gaatacggtg ctcgacaggt    257280
     ggggcgtgtt catgcgtgca actcctcgga ctggtcgttc tgtgcctgcg actggggcgt    257340
     ggcgcagggc agtgtaaagc ggaaaatggt gccgccggca ggattgggat ccgcccacag    257400
     acggccgtgg tgcgactcga taatggtacg gcaaatgttc agccccatgc ccagtccttg    257460
     cgacttggtg ctgaagaacg gttcgaacag gcgctccggc tcgggcagcc catggccgcg    257520
     atcgaccacc gccacctcga tgtgctgctc gtgcgggatg acggccactt tcagctcgtc    257580
     ggactcgctc ttttccatgg cctccaggcc attcttgagc aggttcaaca gcacctgttc    257640
     gatcaggatg gggtcggcca gcacgtcggg cgcgttcgag ggcacgaagc gctcgatgcg    257700
     gatgcggcgc ttgcgcgcgt cgatctcggc gaacccgatg gcgttgtcga cgatgcggct    257760
     gatcgccacc cgctggcggc gcggttcgct gcgtttgacg aactcgcgga tgcggctgat    257820
     gatcttgccg gctcgctcgg cctgcgaggc ggccttctcc agcgccggca gcagcatgtt    257880
     ggggctggtg tggccggcct tgaccagcgc caccgcgccc atgctgtagt tggcgatggc    257940
     ggtcagcggc tggttcagct cgtgcgccag cgacgaggcc atctcgccca tggtggtcag    258000
     gcggctggtg agctggatct tctcctgctg cacgcgcgag gcttcctcgt ggacgcggcg    258060
     ctcggtgatg tcgcgcgcca cctgcatgcg cacgcggcgg ccgtcggtcc aggccagcat    258120
     gcggtggtgc acctcgaacc agcgctgcac cgagggggcg aacacctcca ccgactcgtc    258180
     ggtgaagcgg ccgcgccgac cggccagcag ctcgtcgtgg ccgccggtct gggcgccgaa    258240
     cacgcgccgg taggtgcggt tggcgaacag cagttccagt ccgtcgtggg tgtcggcggt    258300
     gaccgagatg gcgtcgtcca ggccttcgag cacggtcatg aagcgttcgt gcgcggcggt    258360
     cagggcctcg cggatgcgct tgggttcggt gatgtcggtc atggaggtca tccagccgat    258420
     ctggtcgccg ttggggtcga gcaggggcga gacgtacatg cgcgccgtga agcgcgagcc    258480
     gtcgcggcgc tgcgcctcga cctccagccc gctgctgggc gtcttgcccg aggtcagcac    258540
     ctccagcgtg tgctggtgct gctcgtggcg gccgggcacc cagtacggaa agggcgggct    258600
     gcggccgatc aggtcggctt cgttccagcc tatcatgcgg cagaacgccg gattgacgta    258660
     ggcgatgcgt ccctccatat ccagcacccg catgccggtg gacatggagt tctccatcgc    258720
     gcggcgaaag cccgtctcgg cgatcagggc ggcctcggcc tcggagcgaa agcgcgtata    258780
     gcgccacagc atcagcaggc tgatcacgat gacgcaggac agcgccagca ccacccagat    258840
     cagccgctgc tggcgcagct cctggtcgat ggtgacgaac atgacgctgt cgtcgtggat    258900
     gcgctgcagc cagaagaaca cgcccatcac acatatatag aggacgagca cgagcgccgg    258960
     cgtcagccag tacacgccac gcctgcgcgc gcgggcgtgg tcacggaacg acatcggaat    259020
     attggacttg ggcgggctgg acatggactt cttgccgttg gagccggcat tttagagcct    259080
     gttgcggctt gttgcttgcc ggggaagggg atttccgcga taactgtcgc tacagcggat    259140
     tttgtattat gaaatgccgt accgcaacat gaaaatttcc ttgcgacggg ttaatcttgc    259200
     tacttagaat gccggcttcg gcacaatgca gccgtccgca acccacgcgt aacatggtat    259260
     ccggcatccg gcaacccttg cgccccgcac actgataagc cgggaagcgg ccagaaaccc    259320
     caacaggaga cacacgatgt cctctttcgc ccaggctggc gccctagcgg ccgccaatga    259380
     cgaagacacc ctcgagacac aggaatggct ggaagcattg gccgccgtcc tcgaccgtga    259440
     aggaccgcag cgcgcgcact acctgctgga gcgtctgatc gacgaggcgc gccgttccgg    259500
     cgcccatatc ccgttctcgc cgaacaccgc ctacgtgaac acgattccgc cggggctgga    259560
     gcctgcccat cccggcaacc tggagctgga agcccgcatc cgctcgtacg tgcgctggaa    259620
     cgccatggcg atggtggtgc gcgccaacaa gcacaacccg cccgacggcg gcgacctggg    259680
     cggccatatc gcctcgtttg cctcgctggc caccatgatc ggctgcggcc agaaccattt    259740
     ctggcatggc gagaccgaag agcacggcgg cgacctggtg tacttccagg gccatacctc    259800
     gccgggcatg tacggccgcg cctacctgga aggccgcctg accgaggacc agctcaacca    259860
     tttccgccag gaagtcgacg gcaagggcct gtcttcctat ccgcatccca agctgatgcc    259920
     ggatttctgg cagttcccca cggtgtcgat gggcctgggc ccgctgatgg ccatctacca    259980
     ggcccgtttc ctgaagtacc tgcatgcccg cggcatcgcc gacaccagca accgcaaggt    260040
     gtgggtgttc tgcggcgacg gcgagatgga cgagcccgaa tcgctgggcg ccatcgccct    260100
     ggccgcgcgc gagaagctgg acaacctgat tttcgtcatc aactgcaacc tgcagcgcct    260160
     ggacggcccg gtgcgcggca acggcaagat catccaggag ctggaaggcg acttccgcgg    260220
     ctcgggctgg aacgtcatca agctgatctg gggcggctac tgggacccgc tgctggcgca    260280
     cgacaaggaa ggcatcctgc gccgcatcat ggaagaggcc gtcgacggcg aataccaggc    260340
     gtacaaggcc aacgacggca agtacgtgcg cgagcacttc ttcggcaagc atcccaagct    260400
     gcttgagatg gtcgcgcgca tgagcgacga ggacatctgg cgcctgaacc gcggcggcca    260460
     tgacccccac aaggtctatg cggcgttcga cgcggccagc aagcacgccg gccagcccac    260520
     cgtgatcctg gccaagacca tcaagggcta cggcatgggc cacgtcggcc aggccaagaa    260580
     ccccacccac cagcagaaga agctggagct cgactcgatc cgcgagttcc gcgaccgctt    260640
     cggcatcccg attcccgacg acaagctgga agagctgccg tactacaagc cggccgaaga    260700
     ttcgcccgaa atgcagtacc tgcacgagcg ccgcaaggcg ctgggcggct acctgcccaa    260760
     gcgccgcgcc aaggccgacg agcaactgaa ggcgccggcc ctggacgcct tcaaggccgt    260820
     gctcgagccc accgcggaag ggcgcgagat ctccaccacc caggctttcg tgcgggtgct    260880
     caaccagatc ctgcgcgaca aggacctcgg tccgcgcgtg gtgcccatcc tggccgacga    260940
     gtcgcgcacc ttcggcatgg aagggctgtt ccgccagatc ggcatctatg cgcccgaagg    261000
     ccagaagtac accccggtcg acaaggacca ggtcatgtac tacaaggagt cggccgacgg    261060
     ccagctgctg caggagggca tcaacgaagc gggcgcgatg agctcgtgga tggcggcggc    261120
     cacgtcgtac tccaccaaca accgcatcat ggtgccgttc tacatctatt actcgatgtt    261180
     cgggttccag cgcgtgggcg acctggcctg ggcggccggc gacatgcagg cgcgcggctt    261240
     cctgctgggc ggcaccgccg ggcgcaccac gctcaacggc gagggcctgc agcacgagga    261300
     cgggcacagc cacctgctgg cctcgaccat cccgaactgc gtctcgtacg acccgacgtt    261360
     cgcccatgag ctggccgtca tcatccagca tggcctcaag cgcatggtgg aggaccagga    261420
     gaacgtctac tactacctga ccgtgatgaa cgagaactac ccgcagccgg gcctgaccgc    261480
     cggcgacgag gaaggcatca tccgcggcat gtacaagctg aagtcgcacg gcaagggcaa    261540
     gcagcgcgtg cagctgatgg gttcgggcac catcctgcgc gaagtgatgg cggcccagga    261600
     actgctggaa gccgactggg gcgtggcgtc cgatatctgg agcgtgacca gcttcaccga    261660
     gctgcgccgc gacggcctgg acgccgagcg ccacaacctg ctgcatccgg aaggcaagca    261720
     gcaggtgccg tacgtgacca cgcagctggc caagagcgaa ggcccgatca tcgcctcgac    261780
     ggactacatg aagttgttcg ccgaccagat ccgcccgttc gtgcccaagg accgtaccta    261840
     caaggtgctg ggaaccgacg gttttggccg ctcggacttc cgttacaagc tgcgcgagca    261900
     tttcgaggtc gaccgccact tcgtggtgct ggcctcgctg cgcgcgctgg ccgacgaggg    261960
     caagattccg gccgccaagg tcgccgaagc catcaagaag tacggcatca acccgaacaa    262020
     agccaacccg catcacgcct gagggtaaac agacatgagc aatatcgtgg aaatcaaggt    262080
     accggacatc ggtgacttca aggaggtgga agtcatcgag gtgctggtat cggcgggcga    262140
     cacgatcaag gccgagcaaa gcctgatcac ggtggagtcc gacaaggcat cgatggagat    262200
     tccggcctcg gccgcgggcg tggtgaagtc ggtcaaggtg aaggtgggcg acaagatcgc    262260
     cgaaggcacg gtcatcctgg aagtggaggc ggccggcgag gccgccgccg cgcccaaggc    262320
     cgagcaggcc cccgaggccg ccgaggcgcc caaggccgac gccgcgaagg ccgaggcgcc    262380
     ccaggccgag gcgccggccg ccgccggccc gatcgaagtc aaggtgcccg atatcggcga    262440
     cttcaaggaa gtcgaggtca tcgaggtgct ggtcgccgag ggcgacacca tcaaggccga    262500
     gcaaagcctg atcacggtgg agtccgacaa ggcctcgatg gaaatcccgg cctcggcggg    262560
     cggcgtggtg cagtcgctca aggtcaaggt aggcgacaag gtcgcgatgg gcacggtcat    262620
     cgccgtggtg cagggccagg gcgcagccgc cccggccgcc aaggccgagg cgcccgccgc    262680
     ggcgccggcc gcagccgagc ccgccgcgcc ggcttcgccc gcggctccgg ctccggctcc    262740
     ggcgcagcgg cccgccccgg ccgccgcgct gcaggacgaa gacctcaagc ccggccaatt    262800
     gccgcatgcc tcgccgtcgg tgcgcaagtt cgcgcgcgag ctgggcgtga acctgagccg    262860
     ggtcaccggc tcggccgcga agggccgcat cacggccgat gacgtgcgcg cctacgtgaa    262920
     gcaggcgctg tcggccggcg cgccggctgg cgcctcgggc ggcggcgatg gcgccgcgct    262980
     ggggctgctg ccgtggccca agatcgattt caccaagttc ggccccatcg aagccaagcc    263040
     gctgtcgcgc atcaagaaga tctcgggcgc caacctgcac cgcaactggg tcatgatccc    263100
     gcacgtcacc aacaacgacg aagcggacat caccgacctg gaggcgctgc gcgtggcgct    263160
     gaacaaggag aacgagaaat cgggcgtcaa ggtcaccatg ctggccttcc tgatcaaggc    263220
     ggtggtcgcg gcgctgaaga aattccccga gttcaacgcc tcgctggatg gcgacaacct    263280
     ggtgctcaag cagtactacc acatcggctt cgccgccgac acgcccaacg ggctggtggt    263340
     gccggtggtg cgcgacgccg acaagaaggg catcctggag ctggcccgcg aaacctccga    263400
     gctggccagg aaggcccgcg aaggcaaggt ctcgcccgcc gagatgcagg gcggctgctt    263460
     ctcgatctcg tcgctgggcg gcatcggcgg cacgcatttc acgcccatca tcaacgcgcc    263520
     cgaagtggcc atcctgggcg tgtcgcgctc ggcccacaag ccggtctggg acggcaagca    263580
     gttcgtgccg cgcctgaccc tgccgctgtc gctgtcctat gaccaccgcg tcatcgacgg    263640
     cgcctcggcg gcgcgcttca acgcctatct cggccagctg ctggccgact tccgccgcat    263700
     cgcgctgtaa cgggggcaat cgatgagcaa tatcgtggaa atcaaggtgc ccgacattgg    263760
     tgacttcaag gaagtcgaag tcatcgaggt gctggtcgcc gccggcgaca ccatcaaggc    263820
     cgagcaaagc ctgatcacgg tcgagtcgga caaggcgtcg atggaaatcc cggcctcgtc    263880
     ggcgggcgtg gtgaaatcgg tcaaggtcaa ggtgggcgac aaggtcgccg agggcacggt    263940
     catcctggac gtggaggcgg ccggcgaggc cgccgccgcg cccaaggccg aggcccccaa    264000
     gaccgaggcg ccgaaggcgg aggcaccgaa ggcgccggcc gccaaggcga gcgcgccggc    264060
     tgcggccgcc tacagcggct cggccgacct cgaatgcgac atgctggtgc tgggcgcggg    264120
     ccccggcggc tattcggccg ccttccgcgc cgccgacctg ggcatggaca ccgtgatggt    264180
     cgagcgctat gccaccctgg gcggcgtgtg cctgaacgtg ggctgcattc cctccaaggc    264240
     gctgctgcac aacgccgcgg tgatcgacga agcgcgcgcg ctggccgccc atggcatcag    264300
     cttcggcgag cccaaggtcg acctggacaa gctgcgcggc tacaaggaca gcgtggtcgc    264360
     caagctgacc ggcggcctgg ccggcatggc ccgcgcgcgc aaggtgcgcg tggtcaccgg    264420
     cacgggcgag ttcgccgacc cgcaccacct cacggtgacc gacggcgaag gcaagaagca    264480
     gaccatccgc ttcaagcagg ccatcatcgc cgccggcagc cagtcggtga aactgccgtt    264540
     cctgcccgac gacgaacgca tcgtggactc caccggcgcg ctgcagctgc gcgccatccc    264600
     caagaagatg ctgatcatcg gcggcggcat catcggcctg gaaatgggca cggtgtactc    264660
     caccctgggc gcgcgcctgg acgtggtgga aatgctcgac ggcctgatgc agggcgccga    264720
     ccgcgacctg gtcaaggtgt ggcagaagat gaacgcgccg cgcttcgaca acatcatgct    264780
     caagaccaag acggtaggcg ccgaggcccg caaggacggc atctacgtca gcttcgaggg    264840
     cgagggcgcg cccaaggagc cgcagcgcta cgacctggtg ctgcaggccg tgggccgcag    264900
     ccccaacggc aagaagatcg gcgccgagcg cgccggcgtg gccgtcaccg agcgcggctt    264960
     catcgaggtg gaccgccaga tgcgcaccaa cgtgccgcac atctacgcca tcggcgacgt    265020
     ggtcggccag cccatgctgg cgcacaaggc cgtgcacgaa ggccacgtgg cggccgaggc    265080
     ggcccatggc gagaagtcgt tcttcgacgc gcgcgtcatc ccgtcggtgg cctacaccga    265140
     tccggaagtg gcctgggtgg gcctgaccga ggacgaggcg aagaagcagg gcgtcaaggt    265200
     cgagaagggt ctgttcccgt gggcggcctc cggccgcgcc atcgccaacg gccgcgacga    265260
     gggcttcacc aagctgctgt tcgacgccga gacccaccgc atcgtcggcg gcggcatcgt    265320
     cggcacgcac gcgggcgatc tcatcagcga aatcgccctg gccatcgaaa tgggtgcgga    265380
     catggtcgac atcggcaaga ccatccaccc gcacccgacc ctgggcgaat cggtcggcat    265440
     ggccgccgaa gtcgccgaag gcgtctgcac cgacctgccg ccgatgcgca agaagtaagg    265500
     cgcgcggcat ggcagcacaa gggcccctcg cggggccctt gtgcgttggc gcggcgcatt    265560
     ggccaacgga agagggcggg gcgtgggcag gcgcctgtcc ccgcggggac aggcgctctt    265620
     gcgcgcgccg gacgcaaaaa cgcccggcgc ggtgaggcgg ccgggcgtac gtactgccat    265680
     ggccccgggc gggttgtgcc cgcccggggt gtgccgatgc ttagcgcagc agcgacagga    265740
     cgttttgcgg gacttggttg gcctgggcca ggaccgaggt gccagcctgt tgcaggatct    265800
     ggttcttggt catgttcgac acttcggtcg cgtagtccga atcttcgatg cgcgaacggg    265860
     cggccgacag gttcgtgatc gtgttgttca ggttggcaac ggtcgattcg aaacggttct    265920
     ggatcgcgcc cagcgagctg cgctgttcgt ccacggcctt catggcgtcg tccagcttgg    265980
     acagcgcgtc ggcggcgccg ccggacacgg tgacgttggc gccggcagcg acgtcgttgg    266040
     taccgacggc ggcttccgca gcctgcgagg cgacggcacc cagctggtcg cccagggcgg    266100
     ccttgccgtc cttgtcgaag gtcagggcgt acgaggtcat cgtgccggca ttgtcgacca    266160
     cgaccgcgta ttgcgggttg gcggtatcgc cgtacgagac gacgctgccg tcgcctacgg    266220
     cggcgccagc ggcctgttca gcggccgcca cggcggcgtc gaaggtcacg gtgtcggaag    266280
     cgatggtggt cgtgacggcc gacagcacgt caaagcccag cgcgttgacg gtgcgagcct    266340
     cgccgttgac cgtgccgccc gggacggtgc ccacggcgtc atacaggttc cagttcgagt    266400
     tgcgatcgat cttgatatcg atcgtttcgt tgtccttggc gccgacctgg atcgacaggg    266460
     tcatgtcggt ggcgttggac ttcaggacct tgatgccgtt gaagtcggtc tgctcggcga    266520
     tgcggttgat ttcttccagg cgctggttga cttcctgctg gatcgagtcg atgtccgaag    266580
     ccgagttcgt gccgttggag gcctgaaccg tcagttcgcg gatgcgctgc aggttgttgt    266640
     tgatttcgtt cagcgcgcct tcggtcgtct gggcgatcga gatgccgtcg ttggcgttgc    266700
     gggcagcctg ggtcaggccc ttgacgttgg cggtgaagcg gttggcgatg gcctggccgg    266760
     ccgcgtcgtc cttggcgctg ttgatgcgca gacccgacga caggcgctcg atggcgctac    266820
     ccagggccga ttgggacttg ttcaggttgt tctgggcaac cagcgacaag tagttggtat    266880
     tgatgactgc agccatgttg aggctcccaa gagagaaagg cttcttcaaa ccgggcagct    266940
     aggccgccca tctgtaacat cggactttcg cttgcacagc gccgcgattt cctttgttgc    267000
     ctggattacg gcaggtttgc gacggactta agcaaaaaaa gtgaagttcg gaaatgtgcg    267060
     ggggaatctg gcggcaaagg gcatgttcct gcggggacag gcgtccgtgc ggcgcgggcg    267120
     ggatagggca ggcgccagtc cccctgcggg gacaggcgct cgtgcggcgg ggggagatgg    267180
     ggcaggtgcc tgtccccgca ggggactggc accgttggcg cagcgctcgg aaagcagggg    267240
     cgggcaccgg gcaggcaggc gccgcgcggc catggcatgc gcctatacca cctgcgccag    267300
     gtgatgggcg gtgggcaggc gggcccaggc ttgctccttg aggcgggcgc ggatgcgggc    267360
     ggtggcctgg gcgcgcagtt ggcacacgcg cgcctcggtg acgttgagca cggcgccgat    267420
     ttccttgagg ttcaggcctt gttcgtagca cagcgacagc agcagcttct cgcgttcggg    267480
     caggccgtcg atggcgtcga tgagggcgcg gcgcaggtcg ccggcgagca gggcgtcgag    267540
     cggatcggca tgttcggcgc tgctttcagc ccacgggctg tcgctgtcgc cgtcggtatt    267600
     gaaatcttcg tagtgcagga tctgcacgcc ttgcgcatcg gccagcatgc cctggtactc    267660
     ggccagcggc acgcccagct cctcggcgat ctcgccttcg ctgggggcgc gcatcaattc    267720
     ctgttccttg cgctggatgg cggtttcgat gcggcggctc ttgctgcgca cgctgcgcgg    267780
     cagccagtcc tggctgcgca gctcgtcgag catggcgccg cggatgcgcg cggtggcata    267840
     ggtctcgaac tgcgcgtcag ggctttcctg gtagcgccgc acggcgtcga gcaggccgat    267900
     catgccggcc tgcaccaggt cgtccagctg cacgctggag ggcaggcgcg ccaggagctg    267960
     tagcgccagt ttgcgcacca gcggggcata ttggaccagg ctgtcttcgg ggttgggcat    268020
     tcaggttctg tctgcggatg tctcgcgcga acaaagctgc gaacaggtgg ggtgttgctg    268080
     ggcggcgaca gtggcctggc ggtcaggccg ctgggcgcgg accggttcga ccctgtcgtt    268140
     tcaaggggag attgtcggca aatagccgct tttcattcgg agaagaacgc aactttttgc    268200
     acgtttattt acgaaattgc cgacatcgaa atgcaaatga tgtaactcgt cggtaacttt    268260
     accggagata atctgcaaaa tatcaatgtt ttgtcataaa agtcatagaa aatgacacca    268320
     tccatggtaa attgcattca aattgcgatg aaatgataca tttcgcatta agacgaaagc    268380
     aggctggcgc ggggttctcg gggcgcgccg cctggagttc agccccccgg cttgcctaag    268440
     tctcaggagt catgtgtgaa aacagccgat agttccttgc tcgcggatat tcgggaagtc    268500
     aatctttcgt atctgttgct ggcccagcgc atgctgcgcg acgactatgc cgcgtcgatg    268560
     ttccgcctgg gtttcagcaa tgaagtggcc gatatcctga tgcggctatc gccggcccag    268620
     ctggtgaagc tggccagctc cagctcgctg ctgtgccgat ttcgcttcga cgattacagc    268680
     ctcctgtcgg ccctgaccca ggacgtgctg ggcggcgccc tgcaacaggc gcacgccacc    268740
     atcctgctgg cgcgccagcc tgtcgaagag ctggcctgag cgccggctgg atagatagga    268800
     acaagagggc gcaatggcca ccaagagtgt ttcgcaggaa gccgacgaga tcctgcttgc    268860
     cagttcgatg atcacgctgg gcgcgcgtct gcaggtgctg caggccgaga ccggcctcag    268920
     ccacgaccgg ctggcgcggc tgtaccgcga gattcgcggc tgttcgccgc ccaagggcat    268980
     gctgccgttc tcggtggact ggttcatgac ctggctgccg aacatccatt cgtcgctgtt    269040
     ctacaacgtg tatacgttcc tgaaccagcg cacctcgagc cggggcatcc gggcagtgat    269100
     cgacgcatac cgcctgtacc tggagcacgc gccggccgat gccgccgagc cggtgctcag    269160
     cttcacgcgg gcctggatgc tggtgcggtt cttcgacggc ggcatgctgc agctgtcggg    269220
     ctgccgccag tgcggcgggc atttcatcgc ccacgcgcac gatccgcaga ccgatttcgt    269280
     ctgcgccatc tgccgcccgc cgccccgggc cggcaagacg cgcgcggcgg cccgcgcgcg    269340
     cgccgggcag ctcgccgcgc cggcgcggcc gtgagcgcgc cagcttccaa ataggccaaa    269400
     agcaccagaa aaccccccat aacccgcgtt tttgcccgac gggtcagggg ggatcattgg    269460
     cgtcggttct agacttcgtt ggcagaggcc tgatgtgttg attgttatcg gttatgcagt    269520
     ggtcatcctg gcggtggtcg gcagtttcat cggcctgggc ggccatctgg gcgcgctcta    269580
     ccagcctttc gagctgacgc tgatcgccgg cgcggccgtg ggcgccttca tggcgggcaa    269640
     cagccgcaag tcgctcggcc tggtcgccaa ggcgatcccg gaggcgtttc gcagctcgcc    269700
     ctacagcaag gacgtgtaca tggagctgat ggcgcttctg tacgtgctgc tgaacaaggc    269760
     gcgccgcgaa gggctgatgg ccatcgaatc gcacatcgag gatccgctgt ccagcccgat    269820
     cttcaatgag tatccgcgca tcatgaagga tgccaagctg atggagttca tcacggacta    269880
     cctgcgcatc atgatcagcg gcaacatgag ctcgttcgag atcgaaacgc tgatggacga    269940
     ggagatcgag acctaccggc acgagcgcga agtgcccacc catgcgctgc agcaggtggc    270000
     cgacgccttg ccggccttcg gcatcgtggc cgccgtgctg ggcgtgatca aggcgctggc    270060
     ggcggtggac cagccgccgg cgatcctggg cgacctgatc tccaaggcca tggtcggcac    270120
     cttcctgggc gtgctgctgg cctacggttt cgtggcgccg atggccgccc gcatcgaacg    270180
     gcgcacctcc gaatcggtca aggtgctcga atgcatcaag gtgaccttgc tggccagcat    270240
     gaacggctat ccgccccaac tggcggtgga gttcggccgc aaggtgctgt tctcggcggt    270300
     gcgcccctcg ttcggcgagc tggaagagca tgtgcgccag gccaagagcg cggccaccgg    270360
     ccgcgcctga cggagccgcc gcatgagcac ggtcaacaat caccgtgtgg tgatccggcg    270420
     ccgcaaggtg cgccgcggcg gacaccacgg cggcagctgg aagatcgcct acgccgactt    270480
     catcacggcc atgatggcgt tcttcctcgt catgtggctg atcagcatcg tgccgcgcga    270540
     agaactcaag ggcatcgccg agtatttccg catgcccctg cgggtggccc tgaccggcgg    270600
     ccccagcagc tcggccgaga ccagcgcgat ccccggcggc gggcaggacc cgctgcgcag    270660
     ccagggcgac gtgcggcgcg ccgagggcaa ccgggtcgag gcccagccca tgggcgacgc    270720
     cgagcggcgc gaccgccatc gcctggaacg cctgaaggtc cgcctggaaa acctgatcga    270780
     ggaaagcccg gtcctgaaga atttccggcc gcagctgctg atcgacatga cgaccgaggg    270840
     cttgcgcatc cagatcgtcg acaaccagaa ccgccccatg ttcgccaccg gcagcgccga    270900
     cgtgcagccg tacatgcgcg acatcctgcg cgagctgggg ccggtgctca acgacctgcc    270960
     caacaagatc agcatcgccg gccataccga cgcgtcgcag tacgcgcgcg gcgagcgcgc    271020
     ctacagcaat tgggagctgt cggccgaccg cgccaacgcg tcgcgccagg agctggtggc    271080
     cggcggcatg cacgagggca aggtgttgcg catccagggc ctggcctcga gcatgagcct    271140
     ggttaaagat gacccgtttg ctgccgttaa cagacgtatc agtctggtgg tgctcaatgc    271200
     atcgacccag cggcgcatcg agaacgagaa cgccgcggcg gccgatgtca acgcgcgcga    271260
     cgcgcagggc gtcggcgcgg cgctggccgg ccagttggcg gccagcggct cggacggggg    271320
     cgccaggtag cgatagggag aggcatgacg gcaagaattc tggtggcgga cgattcggcg    271380
     acgatgcgca tgatcgtgca ggccgcgttg acgggggcgg gttggcaggt cgtgaccgcc    271440
     agcgatggca aacaggcgct cgaactggcc caggcgcagg ctgtcgacct ggtcgtcagt    271500
     gactggaaca tgcccgtcat gggcgggctg gacctgatcc ggggcctgcg tgggcaggcc    271560
     cgctaccagg atctgcccgt gctggtgctg accaccgagg acgatggcga cagcaaggcc    271620
     gccgcgcgcg atctgggcgt atgcggctgg ctcaacaagc cgctcgatcc ggatgtgctg    271680
     gtcgatctgg cggcggagct gcttggcgtg gcgccaggcg cgtagcggtt tctataggaa    271740
     gcatacgggt catgagttca ggtctggacc tcagtcagtt ctacgaaaca ttcttcgacg    271800
     aagccgacga gctgctcgcg cagatggagc agttgctgct cgagctggat gtgggcgcgc    271860
     ccgacatcga gcagctcaac gcgatcttcc gcgccgcgca ttccatcaag ggcggcgcgg    271920
     ccactttcgg ctgcttccag aagctggccg gaaccacgca tttgcttgag aacctgctgg    271980
     acgcgatccg gcgcggcgag atgggactgc gcgccggcat ggtggacatt ttcctggaaa    272040
     cgaaagacgt gctcaaaagc caactggacg cctaccgggc ctccgaagag cccgaagatg    272100
     ccgtgttcga gcgcatttgc gccgtgttgc gccagctggc gctggaaggc ggacaggcgc    272160
     cggcggccgc ggcgccggcg ccggtagcgg ctcccgaacc cggcccggaa cccgcacccg    272220
     cgccccagcc cgccgcggca tcgacggcgg cgggcctgcc gttgcgggtg cgtttcagca    272280
     aggtctcgga caaggatgcc cagtcgctgc tggaggaaat gggcaacctg ggcgacgtgc    272340
     gcgccagcga gcgcgccggc cagacgctga cggtgtgggt cgacacgacc tgctcgccgg    272400
     acgatatcga agcggtgtgc tgcttcatca tcgacgcgga ccaactggaa atcgcccgcg    272460
     aggccgagcc ggcccacgcg tcggcgcagg cggccgtagc ggccgcgccg gatgccgccg    272520
     ccacaccggc gccggcgccg gttgccgctc ccgccgcggc ccaggccgcc gagccggcgc    272580
     gcgccgcgcg cccgagcatc gcgcccgcgc acgccgacaa ggaatcgacc tcgatccgcg    272640
     tcggcgtcga gaaggtcgac caggtgatca acctggtcgg cgagctggtg atcacgcagg    272700
     cgatgctggc gcagaccgcc tcgacgctcg atccggtgct gcacgatcgc ctgctcaatg    272760
     gcatggagca gctcgagcgc aatgcgcgcg acctgcagga agcggtcatg tccatccgca    272820
     tgatgccgat ggactacgtg ttcagccgct ttccgcgcct ggtgcgcgat atcgccggca    272880
     agatgggcaa gcagatcgaa ctgcagacct atgggcgggc caccgagctg gacaagagcc    272940
     tgatcgagcg catcatcgac cccttgacgc acctggtgcg caacagcctg gaccacggca    273000
     tcgaaacgcc ggacaagcgc gtggcggccg gcaaggagcc ggtgggccaa ctggtgctct    273060
     cggcgcagca caatggcggc aacatcgtca tcgaggtcag cgacgatggc ggcggcctga    273120
     gccgcgagcg catcctcagg aaggccgtgg cccaggggct gacggtcaac gagaactcgc    273180
     ccgacgacga gatctggcaa ctgatcttcg cgcccggttt ctccaccgcc gaccaggtca    273240
     cggacatctc cgggcgcggc gtcggcatgg acgtcgtgcg ccgcaacatc caggacatgg    273300
     gcggccacgt gcagctctcc agcgtgccgg ggcagggaac gaccacgcgc atcgtgctgc    273360
     cgctgacgct ggccatcctg gacggcatgt cggtgcgggt gggcgaggaa accttcatcc    273420
     tgccgctgaa ccatgtgacg gaatcgctgc agccgcaggc cgaccagatc tattcggtgg    273480
     ccggcaacga gcgcgtgatg caggtgcgcg gcgaatacct gccgctggtg gaaatgcacc    273540
     gggtgttttc ggtgggccag gcgcaggccg atcccaccca ggccatcgcc gtcatcatgc    273600
     aggccgagga gcgccgcttc gcgctgctgg tcgatcacct cgtcggccag caccaggtgg    273660
     tggtgaagaa tctcgaatcg aattatcgca aggtgcctgg catttcggcc gccaccatcc    273720
     tgggcgacgg cagcgtggcg ctgatcgtgg acgtattcgc gctggcgcgc gccaaccggg    273780
     aaaagtggtc ccagcccgaa gccattctga attgacggag agacatatca tggcagccaa    273840
     accgcacacc caggccacgc gcgcggaaga cgtgggcaac gagttcctgg tcttcacgct    273900
     gggcgaggaa gaatacggca tcgacatcct gaaagtgcag gaaatccgcg gctacgacgc    273960
     ggccacggtc acgcgcatcg cgaacgtgcc gtccttcatc aagggcgtga ccaacctgcg    274020
     cggcatcatc gtgcccatcg tggacctgcg catcaagttc aacctgggca gcgtcgaata    274080
     caacgagcag accgtcgtca tcatcctcaa cctggaccgc cgcgtggtcg gcatcgtggt    274140
     cgatggggtg tcggacgtgc tgatgctcaa cgcggcccag gtgcgtccgg cgcccgagtt    274200
     cggcgccacc ctgtccaccg agtacctgac cggcctgggc acggtggacg aacgcatgct    274260
     catcctggtc gacatcgaga agctgatgac cagcgacgag atggcgctgg tggagaaagt    274320
     ggcgtcctga cggcggtcag gccgcgggcg gcgcgccgcc cgtcgtttcg ttcaacgctt    274380
     gcagtcaagg agtggttcct gtcatgcgca agttcctcgc gaacctgtcg atacgcggca    274440
     gcctgttggg cgtgctggcg ttcttctctt tcatgctggt cgtcggcgcc gccctgggcg    274500
     tgctgtcgct gcgggtcagc aacgacacgt tgcagggagt caagcagacc caggatgtcg    274560
     ccgacgcgat ggatcgcgtc gtcaacagct acaaggacgc gctcaacggc ctgggccgcg    274620
     ccgcggcgtc gcactatggc gcgatcgtga gcgcgatcgg ccagccggtg caggtcgaac    274680
     agggcctggg cagcgaggcg gcgggcttgc tgcagcgcgc caaggcttcg ctcaaccgcg    274740
     ccgagaccga atacgagtac tacaagggcc tggctcggcc ggccagcgcc gccgacagcc    274800
     tgaaagaagt cgagaacgcc ttcgaggcgc tggtcggcca ggggctccat ccgctggccg    274860
     ccgcgttgga gaagggcgac atggccggct atcagttgca tgcgcagaac gtccttgacg    274920
     cgctggaagg acgtttctcg ggcgccatcg ccgcgttcga cttctggcgc gccagcgagc    274980
     tgctcgacgc ccacgaagtg gccgagacgc gctatcgctt cgtgctggcg gccgtggccg    275040
     cgggcggggt gctggccgcg ctgctggtgt tttcgaccta tctgttcctg cgccgccgcg    275100
     tgctgcagcc tttgcgcgaa gtgggccagc atttcgacaa gatcgccgcg ggcgacctga    275160
     ccgcgcgggt ggacgtgcgc aacagcaacg agatcggcca gctgttcgcc ggcctcaagc    275220
     gcatggagga aagcctgacg cgtaccgtcg cggcggtgcg ccgtggcgtg gacgagatca    275280
     acgtgggttc gcgcgagatc tcggccggca acacggacct gtccagccgc accgaggagc    275340
     aggcggcctc gctggaggag accgcggcct cgatggagca gctggcctcg acggtcaagc    275400
     agaatgccga taacgcgcgc caggccaacc agctggcggg agtcgcctcg gacgtggccg    275460
     agcgtggcgg ttcggcggtg tcggaggtgg tggcgacgat gcaggacatc tcggccagct    275520
     cgcgcaagat ttccgagatt gtgtcggtga tcgacgggat cgcgttccag accaacatcc    275580
     tggcgctgaa cgcggcggtg gaagcggcgc gcgcgggcga gcagggcaag ggtttcgcgg    275640
     tggtggcggg cgaagtgcgc tcgctggcgc agcgcagcgc ccaggcggcc aaggagatca    275700
     aggtgctgat cgaggactcg gtcggcaagg tgggcacggg ctcgcagcag gtcgagcgcg    275760
     ccggggcgac gatgcaggag atcgtggcct cggtcaagcg ggtgacggac atcatgggcg    275820
     agatttcggc ggcctcggac gagcagtcca gcgggatcga gcaggtcaac cgcgcggtgt    275880
     cgcagatgga cgaggtgacg cagcagaacg cggcgctggt ggaagaggcg gccgcggcgg    275940
     ccggttcgct gcaggagcag gcgcagcgcc tggccgaggc ggtcgcggtg ttcaggatca    276000
     acgccggcga agtgatcgat ctgccggccc gccaactggg atcgaggcag gcgccgggtg    276060
     cgcgcgagac ggcgctggcg cacgatgacg cgctggcgct ggggcactga ggtcaggcgt    276120
     ggcgacagca atgacgacgc cggctttcag cgccgagcgc cagttcgagt tccgcgacgc    276180
     ggacttcgcc cgggtacggc agatgatcta cgcgcgcgcc ggcatttcgc tgggcgcgca    276240
     caagcgcgag atggtgtaca gccgcctggc gcggcgcctg cgcgcgctgg ggcagcagga    276300
     gttccgcgtc tacctggacg ggctggagaa cgagccggcc gcgcccgagt gggaagactt    276360
     cgtcaacgcc ctgacgacca acctgaccgc cttctttcgc gagtcgcatc acttccccat    276420
     tctggccgat ttcgcgcgcc agcgcggcgg gccggtatcg gtgtggtgct gcgccgcctc    276480
     gaccggcgag gagccgtact cgatcgccat gacgctggtc gagagcctgg gcgcgcgcgc    276540
     ccaggccagc cagctgctgg ccaccgatat cgacaccaac tgcctgcagc gcgcgcgcgc    276600
     gggcgtctat ccgtacgagc gggtggccaa gctggacccg gcgcgcctga agcgcttctt    276660
     catgcgcgga cgcggcgcca atgaggggca ggtcaaggtg cgcgcggagc tggccgacat    276720
     ggtgcgcttc gagaccttga acctgctggc gccgcactgg ccgatcaacg agaagttcga    276780
     cgcgatcttc tgccgcaatg tcatgattta cttcgacaag ccgacccagg ccaggatcct    276840
     gcggcggttc gtccccttgc tcaagccggg cgggctgctg tttgccgggc attccgagaa    276900
     tttcacctat atcagccgcg acttccgcct gcgcggacag actgtctatg agcaggccag    276960
     cggcgagttg ccagtatgaa gaagatcaag gtcttgtgcg tggacgattc cgcgctggtg    277020
     cgcggcctga tgaccgagat catcaacagc catccggaca tggaggtggt cgcgaccgcg    277080
     cccgatccgc tggtggcgcg cgaactgatc aagaagcaca acccggacgt gctgacgctg    277140
     gatgtggaaa tgccgcgcat ggacggcctg gatttcctcg agaagctgat gcggctgcgg    277200
     cccatgccgg tggtgatggt gtcgtcgctg accgagcgcg gcggcgagat cacgctgcgg    277260
     gcgctggaac tgggcgcgat cgatttcgtg accaagccca agctggggat ccgcgacgga    277320
     ctgatcgagt attccgaggt gatcgcggac aagatccgcg ccgcctcgcg cgcgcgcctg    277380
     cgcgcgccgg cgccggccgg ccacgcggcg ccgctgcgcc tgcgcagccc gttcgccagc    277440
     tccgagaagc tggtgatcgt gggcgcatcg accggcggca ccgaagcgat ccgcgaggtg    277500
     ctgcagcccc tgccggccga cagcccggcg atcctcatca cccagcacat gccggccggc    277560
     ttcacgcgct cgttcgcgca gcgcctggac gcgctgtgcg cggtgaccgt gcgcgaagcc    277620
     agcgacggcg agcgggtgct gcctggccac gtgtacctgg cgccgggcgg cgagacgcat    277680
     atgcgcctgg gccgcagcgg cgccaactac gtgatcgggc tgcaggccag cgagccggtc    277740
     aaccggcacc gcccctcggt ggacgtgctg ttccattcgg ccgccgaggc ggccggcggc    277800
     aatgcgatcg gggtgatact gaccggcatg ggcaaggatg gcgcggccgg cttgctggcc    277860
     atgaaacgcg ccggcgcgcg gaccatggcg caggacgagg ccagttgcgt ggtcttcggc    277920
     atgccgcgcg aggccatcgc gctgggcgcg gccgacgagg tcgtgccgct ggccgacatc    277980
     agtgagcgga ttctgacgcg tttgggcgac cgcgggcatc gcgtttgacg ccccggtccc    278040
     aacggagcgg gcgtccggac attattttct tggagttgag atggtagata agggaatgaa    278100
     gatactggtg gtggatgatt tccccaccat gcggcgcatc atacgcaacc tgctcaagga    278160
     gctgggtttc gagaacgtcg acgaggccga ggacggcgcc atcgggctgg agaaactgcg    278220
     caacggcgcc ttccagttcg tggtgtcgga ctggaacatg ccgaacctcg acggcctgga    278280
     gatgctcaag cagatccgcg ccgacgcggc gctgaagtcg ttgccggtgc tgatggtgac    278340
     ggccgaggcc aagaaggaga acatcgtggc ggcggcccag gccggcgcca acggctacgt    278400
     ggtcaagccg ttcacggccg cgacgctgga agagaagctg aacaagatct tcgagaaact    278460
     cgccggctga ggtaccgaat gaatgcgacg gacactggca tgcaggcaga cccgaccgac    278520
     ctgatccagc ggatcgcctc gttgacgcgc atgctgcgcg acagcatgcg cgagctcggg    278580
     ctggaccagg ccatcaagga tgccgccgag gcgattcccg atgcgcgcga ccgcctgcgc    278640
     tacgtggcgc agatgaccga gcaggccgcc aaccgggtgc tgaacgccac cgaggccgcc    278700
     ggccccatcc aggacggcat ggcgcgcggc gcccaggcgc tggacgcgcg ctggcagcaa    278760
     tggtacgacc agccgctcga gctgccgcag gcgcgcgtcc tggtgcagga cacgcgcgcc    278820
     ttcctggccg cggtgccgca gcacacgcag cagacccagg cgaagctgat ggaaatcgtg    278880
     atggcgcagg atttccagga cctgaccggc caggtcatca tgcgcatgat ggacgtggtg    278940
     ggcgcgatcg agcgcgaact gctgcaggtg ctgctggaca acgtgccgca ggagcgccgc    279000
     gacgaagcca attcgctgct caacggcccg caggtcaacc ccggcggcaa ggccgacgtc    279060
     gtcaccagcc aggaccaggt cgacgacctg ctggccagcc tgggcttctg accagggcag    279120
     ggtgcctgtc cccgtaggga caggcaccga ctgggcgtgg cgcagggtgc ggggcgcctg    279180
     tccccgcggg gacaggcgcc cccacgcgcc ggccgccgcc atcccggaat aacgccgctt    279240
     tccccccgct tcttggctta tcgccgcgcg ggccgtccgc ctagaatctc ggcgggcagt    279300
     ccacaacccg catccgggct gcaaacgaag cgtcgagcat ggccgaagaa agcgatcttg    279360
     aaaagtccga agccgcctct cccaggcgcc tggaaaaggc gcgcgaggag gggcagattg    279420
     cgcgttcgcg cgagctgggc acgttcatga tgctggccgc cggcgtggcg ggcgtatggc    279480
     tgagcggttc gatgctgtac cagggcctga ccggcgtgct gcggcgtggc ctggggttcg    279540
     agccgcgggt ggcgcaggac ccgggcgtga tggtcgagca ggcggtgcat ggcgccgggc    279600
     gggcgctgct gacggtgctg cccatgttcg gcatgttggc cgtggtggcg gtgctgtcgg    279660
     cggtgctgct gggcggcttt gtcttctcga ccaagccgct ggagccgaat ttctcgaaat    279720
     tgagcctttg gtcgggcatc aagcgcatgt tttcggccca gaccgtggtc gaactggtca    279780
     aggcgctggc caaggccgcg ctggtgggcg gggtggcggt ctgggtgatc tggcactacc    279840
     acgacgacat gctgggcctg atgcacgtgg cgcccagcgc cgcgctgacc agcgccatgt    279900
     cgctggtggc gctgtgcagc gccctgatcg tgggctcgct gctgttcgtg gtgctgctgg    279960
     atgtgccctg gcagatctgg aaccatctga agaagctgcg catgaccaag gaagatgtgc    280020
     ggcaggaaca caaggaaagc gagggcgacc cccatgtgaa gggccgcatc cgccagcagc    280080
     agcgcgccat ggcgcgccgg cgcatgatgt cggaggtgcc cggcgccgac gtggtggtga    280140
     ccaacccgac ccattacgcg gtggcgctga aatatgcgga cggcgaggcc ggcgcgccgc    280200
     gcgtggtcgc caagggcacc gggctgatcg ccgcccgcat ccgcgagctc gccgccgagc    280260
     atcgcatccc gacgctcgag gcgccgccgc tggcgcgcgc cctgcatcaa cacgtcgaac    280320
     tgggacagga aatcccgacg gcgctttata ccgcggtggc cgaggtgctg gcgtgggtgt    280380
     tccagctgcg cagctggcgt cccggactgg gacgcgagcc gcaggcgccg acggcgctgg    280440
     ccgtaccggc cgaactggac ccgcacagcc cgcccgccac ccaaggagcc tgacgaatga    280500
     gcgcgctgct ctccatgctg aaaaccaacg gggccgccaa cgccaagctg ctggccggcc    280560
     ccatcctcat cgtgctcgtg ctgggcatga tggtgctgcc gctgcccacc tttctgctgg    280620
     acctgctgtt caccttcaac atcgccctgt cggtgatgat cctgctggtg gcgatgttca    280680
     cgcgcaagcc gctggatttc gccgcattcc cctcggtgct gctgtttgcc acgctgctgc    280740
     gcctgtccct gaacgtggcg tccacgcggg tggtgctgct caacggccac cagggcccgg    280800
     acgcggccgg caaggtgatc gaggcgttcg gccacttcct ggtgggcggc aatttcgcgg    280860
     tcgggatcat cctgttcgtg atcctgacca tcatcaactt catcgtcatc accaagggcg    280920
     ccgggcggat cgccgaagtc ggcgcgcgct tcaccctgga tgccatgccg ggcaagcaga    280980
     tggccatcga cgccgacctg aacgccgggc tgatcggcga ggacgaggcg cgcaagcgcc    281040
     gcgccgaggt ggcgcaggag tcggatttct tcggttcgat ggacggcgcc agcaagttcg    281100
     tgcgcggcga cgccatcgcc ggcctgctga tcatggtcat caacgtgatc ggcggcctga    281160
     tcgtgggcgt ggcccagcac gacctgtcgg taggcgaatc ggcccgcgtg tacacgctgc    281220
     tgacgatcgg cgacggcctg gtggcgcaga tcccggcgct ggtgatctcc accgccgccg    281280
     gcgtggtggt ctcgcgcgtg gcgaccgacc aggacgtggg ccagcagatc ctctcgcagc    281340
     tgttctccaa tcccaacgtg atgttcctga cggccgccat cgtcggcatc atgggcctga    281400
     tccccaatat gccgcacctg gcgttcctga cgctggccgc gctgctggcc ggttgcggct    281460
     ggatggtcta caagcgcaac ctggccgccg ccagccaggc gcagcaaccc gccgagaccg    281520
     ccgccgccca ggcgcaggcg gcggcctccg aggcgacctg ggaagacgtt tcgatggtgg    281580
     accagctcgg gctggaagtg ggctaccgcc tgatcccgct ggtcgaccat gcccagaacg    281640
     gcgagctgct gcaccgcatc cgcagcctgc gcaagaaatt cgcccaggac gtggggttcc    281700
     tgccgccggt ggtgcacatc cgcgacaacc tggaactcaa gccgaacgac taccgcatcc    281760
     tgctttcggg cgtggaaatc ggtcgcggcg tggccatgcc tggccaatgg ctggccatcg    281820
     acccgggcgg cgtagccatg caggtcaagg gcacgcccac caccgacccg gccttcggcc    281880
     tgccggcgct gtggatcgac agcggccagc gcgaccaggc ccaggtggcc ggctacacgg    281940
     tggtcgacgc aagcaccgtg gtggctaccc acctgaacca cctgatgcac cgccacggcg    282000
     acaacctgct gggccgccag gaagtgcagg cgctgatcga acgcatcgga cgcgaatcgc    282060
     ccaagctggt cgaggacctc gtgcccaaga cgctgtcgct caccaccttg cagaaagtgc    282120
     tgcagggcct gctggccgag gaggtgccga tccgcgacat gcgcaccatc gtcgataccc    282180
     tgtccgagca cgcgccgcgc ctggcggccc tggccgccaa cgcgggcggg cagcccgatg    282240
     tgcacgaact ggtcgcgctg acgcgccgtt cgctgggacg cgccatcacc cagcaatggt    282300
     tcccgggcga aggcgagctg cgcgtgatcg ggctggacgt gcgcctggag cgcgtgctga    282360
     cgcaggccat ggccaccagc ggcggcctcg agcccgggct ggccgagacg ctgctgcgcg    282420
     agaccgaagc ggcgctggcg cgccaggagg cgcagggcaa cgctccggtg ctgctgacct    282480
     cgccgccgtt gcgcgcgccg ctgtcgcgct ttctcaggca ccatctgccg cagctgggcg    282540
     tgctttccaa tgccgagatc cccgatgagc gcgtggtacg cgtgacggcg ctcattggag    282600
     gcaatggcga atgaagctga gtcgtttcgt cgcggccagc agccgcgaag tcatgcgcct    282660
     ggtgcgcgag gcgctgggcc cggacgcgct gatcgtgtcc aaccgcagcg tggccgaggg    282720
     catcgaagtg gtggccacgc tggacgagac gcccgccgcg gcgccggcga cgccgttgcc    282780
     cgatgcgccg gccgcgccgc ccgccgacat gcccgctgcg gacgcggccg cgccgctgtc    282840
     catggcgcgc ctgcccgatg cgccgatgcc cgcggccatg ccggccggcc gcgtcgcgcc    282900
     ggggctggag gcgggcgtgc aggccgctat cgacgcgctg cgcggttcgc tggaaagccg    282960
     catggacggg ctgctgtgga gcacgcgcga ggggccgggc cgcgagccgg tgggcgccgg    283020
     gctgttccgc gccttgctcg aagcgggttt cagcatgccg ctggcgcgca tcctgctcga    283080
     gcgcctgccg caggcgctcg acgccacgca ggcgctggcc tgggcgcgca acgaattggt    283140
     gacgcacctg ccggtgctgc gccgcgagga cgacctgctg gccggcggcg gcgtgttcgc    283200
     gctggtcggc cccaccgggg tgggcaagac caccacgctg gccaagctgg cggcgcgctg    283260
     cgtggcgcgc gaagggcgcg agcaggtggc catgctgacc accgacaatt tccggatcgg    283320
     cgcgctggaa caattgcaga tctatggacg cctgatgggc attccggccc attcggtgcg    283380
     cgacgccgat gagttgcgcg acgcgctggg cagcctgggc aaccgcagga tcatcctgat    283440
     cgacaccacg ggcatcagcc agcgcgaccg ccaggtggcg gggcaggcgg ccatgctgtg    283500
     caacgccggc aagccggtgc gccgcctgct ggtgctcaac gcggccagcc agggcgacac    283560
     gctggacgaa gtggcgcacg cctatcgcaa cggcgtgggc gaggatgtgg tcggctgcat    283620
     catcaccaag ctggacgagg cctcgcggct ggcgccggcg ctggatacgg cgatccgcca    283680
     ccggctgccc atccactatg tctcctacgg gcagaaagtg cccgagcaca tggccctggc    283740
     gcgcgccgac gaactgatcg accgcaccct ggccacgctg cagcgggtca agccgctata    283800
     tgcgcccagc gaggccgacc tggccgcctt gtgcagcgcc tctcgcgagc aggcgcgcga    283860
     cgagccggcg cagcgccgcc agatgctggc cgccacgctg ctgggccagg gcggcgccgc    283920
     cgcgcgcgac ctcgacggcg cgctggactg gctgcgcgac gatccggcct gcgcgcaggc    283980
     gcgcagcgac tggcgcgcgg ccatggccgg cccggccacg gcccgggcgc tgggcgacgc    284040
     ggggctggcc ctggcgcgcc aggcctatcc agccgccagc agccgttatc tgctggccat    284100
     gcacggcaag gcggcgctgc gcgccgccgg cctgccgcag gccaccttgc tgtcggcctt    284160
     gctgatgagc gaccgcggcg cggcgctggc cgcgcccgcc cagcaattga tgctgcagca    284220
     tggcctgctg gcggcgtacg cgccgggcga accggccggc gccaatccga ttcaggccct    284280
     gctggcgcgc accgactacc tgtcgggcgc gctggcccaa ttgccgcacg tgcatgtgtt    284340
     cgacgccggc tcggccccgc catggcaggc gctggccggg caggacgccg ggtggctggc    284400
     gcgctgcgcc ggcgccacgc gggtgcagca ggacctgtgt cccactttgc tcagggccgt    284460
     ggcccgcggg ctgggatacc tgccggtggg taatgtggcg gtcccgggca agggcagcgc    284520
     gcccctggcg ctgtgggccg gcagcgcgga tgtctcgctg gcggcgcgtg gccaggcgcc    284580
     gcttgcggtg cgcatggtca gcgcgcgcct gctcgatccc tccagcgggc gccaggtggc    284640
     gcagtggttc ggcctgacca acctggccgc cacgcaggcc gatgcggcca cgctggcgcg    284700
     ctggctggtg cagtacgaac aggcgcgcgg cgctttccgc tatatggcgc atgcctgggc    284760
     ggcgctgccg ccggatgcgg gcgatgccgc ggcgctggcc gcgcgcgcgc tggcggcggg    284820
     acagctgggc gcggcgtgct ggcagctgga acaccaggcg caggccgccg cgatgcgcca    284880
     ggccttgccc ggcctgctgg ggccgggcgc gcgcaagacg cccgcgcggc tggcgcccgc    284940
     ggccttgatg aagttgtttg ccttgctgga gatggccggc tgaaggccgg ccgggccgga    285000
     tcaggtggcg acgatggcgc ggcccgatgc cgcgctggag tagccgcgct tgccgcggcc    285060
     ctgggcgtca taggtggcgg ccgcgccggt gccggcggcc tggcgcaggg cgtcgagcga    285120
     ctcttgcgta tggcgcaggt tcaccgcgat cagggtgccg ttgcgctggt tgtgctcgcg    285180
     cgcctgggcg gcgttggcct gcagggcctg ccacagcggg cccagttcag ggtgggcggc    285240
     ggcagccgcg tcggtgccgg ccggaccgct ggccaggccg gcgccgctca gcagggtgtc    285300
     gcgctcggcg cccagccgcg ccaggtcgtc ggccagggct tccttgcgct gcaccgcggc    285360
     ctgcagcgac tcgtgcgcgc ggcggtccat cagggcttcg gtttccgcct ccagggcgtg    285420
     gaggaactcc accaccaggg cgttttcgcg ttcgaggcag gacttcaggg cggcagaatt    285480
     catggcgggc agcagcggtt tacttgagca aatcgcgggc gctggcgatc aggctgtcgg    285540
     cgatgcgggt ggggtcgatc cgcaactggc cggacgcgat ggccgcccgg atggccgcca    285600
     cacgctcgac gtcgatgtcg ctgccgcctt cctgagccag caattggcgc gaggccgggc    285660
     tgagcgccac ttgcgcgctg cccgaaccgg cctgggcgcc gccgccatag gcttgggcca    285720
     cggcgtgctc ggcgcgtgcg ccgaccgcgt tggggcccac cggatggctg gtcgaggatt    285780
     ggatcttcaa aatattctcc gctgcgcggg accggcccga tgggggcgat ccgcctggtt    285840
     atgcctgtgt aacgacacca tgggcgcaaa ctttagggca cggggatggt aggggtccgg    285900
     tcatgtgtaa cagattttac agctggattt cgaccagtcc ggccgcctgc acgatgccgc    285960
     tgaccacctg gccggaggcg gtgcgtacct ggaccgtcgc gccgggcggg gcgttgtcca    286020
     gcgcctggcc ttcgctgctg accacgaagc cgttgccgcg cgcggtgatg cgcacgctct    286080
     ggccgcgcga taccgactcg gcgctgcgca gcccggcgcc cttgatgggc tggcccgcgg    286140
     cgatgcggtg agcggggcgc atgccgagga tggcggccgc gtcggtgatg acgcccgggg    286200
     gcagggccac caggtcgccg tcgcgggtgg tcaggtcggc cgcctcgatg gtcttgcccg    286260
     gcgcgatctg gcgcgccgcc acgtagtact ggcccggcac gctgacggtg gcctgggcgt    286320
     agaccgtcca ggtgcgcggc gcgacgcagc gcaggccgac cgtcatgcgg gcgcgtaccc    286380
     gcatccccga gggcatgaag ggcgtcaggg cctcgcaggc gtccagccgg tcggtgcgta    286440
     gagggtccag cgtgatggat ggctcgccgg gcagggcggc caattgctgg cgcagatagc    286500
     tttcggccgc cgcggccagc tcggcgggat cctgggcggg gggctcggcc gcggcgcgcg    286560
     gcatggcgcc cgccaggatg gccagcgccg ccaggcgcgc aatggaacgg gaacggggcg    286620
     atttcatgat aggcaaattg tagaagggcg ccgtgccgcg caatagccga attggctcgg    286680
     aaatggcggg ttgtttggct ttttgtggcg gccgcccgca acctaagatg ccgtcatgcc    286740
     aaaaagcgag ccaggccgtg cggccggttt tcttgggcca atcagttcgc acactatcgg    286800
     gacgcgccag atgctagacc ggctaaacga ggatttccgc tttttccagc aatcgatcgc    286860
     gctgcgcgcg caacggcagg aagtgctgtc ctccaatatc gccaacgccg acacgcccaa    286920
     ctacaaggcg cgcgacttcg atttcaaggc cgccatgcag ggcgcgctgg agcagcgcat    286980
     gcgcctgccc gacacgaatc tcgcgctgac ctcggcgcgc cacattcccg gccaggcgac    287040
     cacgccgtcg ccggccgaac tgatgtaccg cctgccttac cagcccagcc tggacggcaa    287100
     taccgtcgac atggacagcg agcgcgtgcg cttcgccgac aacacgctgc attaccagag    287160
     cagcctgcag gtgttgtccg gccgcatccg ttcgctgatg tcggcgatcc aggaataacg    287220
     gagtccagcc atgtccctgt tgagcatttt cgaaatcgcc ggttcggcgc tgagcgcgca    287280
     gtcccagcgc atgaacgtgt cggccagcaa catggccaac gccgacagcg tggccggccc    287340
     cgacggccag ccataccggg cgcgccaggt ggtgttccag gtcaatccgc cgcccggcca    287400
     ggccttcggc caggagatcg gcggcgtgcg cgtggccggc gtggtcgagg accagtcgcc    287460
     cttcaagaaa atctacgacc ccaagcatcc gatggccgac gcacagggct acgtgaacat    287520
     gcccaacgtc gatccggtgg ccgagacggt caacatgatc gccgcctcgc gctcgtacca    287580
     ggccaacgtc gaagtgctca acaccgccaa gcagctgatg ctcaagacgc tgaccatcgg    287640
     ccagtcctga tcggcgcgcg gacatcgcct gcggcacgca taccggagca ttcatccatg    287700
     accaccgtca acgaaaccac ttcccaggcc ggcctggccc tggcgcaggc cggctccaac    287760
     agcgccgccc agggcatcca ggatcaattc ctgacgctgc tggtgacgca gctgcgcaac    287820
     caggacccgc tcaacccgat ggagaacgcc gagctgactt ctcagctggc gcagatctcc    287880
     acggtggaag gcatcaacaa cctcaagaac accatgctcg ccatcagcgg gcagatcgac    287940
     gtgtcgcagt cgatggacgc ggtgtcgatg ataggcaagg gcgtgctgat gccgggcgac    288000
     aaggtgtcgc tgggcaccga ccccaacgac cccgcccagc gcggcgccac gccgttcggc    288060
     atcgatctgc agggcgacgc gaccaaggtg acggtcaagg tgctggatcc ctcgggcgcc    288120
     gtggtgcgca ccatggagct gggcgacctc aagaccggcg tgcacacgct gcaatgggac    288180
     ggcaagaacg acggcggcca gccgctggcc gacggcaagt attcgatcac ggtgagcgcc    288240
     agcgatgccg aagccgtacc ggtcaaggcc gaggcgctga cctacggaca ggtcaagagc    288300
     gtggcgtatt ccaccaacgg cctgcgcctg gacctgggcc tggccggcca gatcagcatg    288360
     ctggatgtgc gcaaggtcat cggggcttcc gggtcggcat gaccccaaac cgggccggcc    288420
     gcgcgccggc gactcacctc aacttctgag agctaacggg acaaagacat gggattcgga    288480
     caagcattga gcggcctgaa cgccgcctcg cagaacctgg atgtaatcgg caataacatc    288540
     gccaactcgg gcacggtcgg cttcaagtcg ggcgcggcct cgttcgccga cgtctacgcc    288600
     agctcgcgcg tcggcctggg cgtgaaggtc agcgccatca accagcgctt cacggtgggc    288660
     aatatatcga tgaccaatgg cgagtacgac atggcgatcg acggcggcaa gggctttttc    288720
     cgcctgaccg accagagcgg cggggtgttc tattcgcgca acggcgagtt catggtcgac    288780
     aagaatttct atgtcgtcaa tgcccagggc tttcgcctga ccggctatcc ggccggcgcg    288840
     gtgggcgccc agccggtgga cctgcaactg ccgccaggca acatcgcgcc gcgaccggcc    288900
     agcaccgccg gcctgcaggg caacctgaac gccaacgcca aacttatcaa ccccaacgat    288960
     acgccggccg tggatggcac ggtggagctg gacggcacgt cctacagttt caccaacgcg    289020
     ggcggcgtgt tcgcctgggt cgcgcccggg ccggtcgatg gcacctacaa cggcggcgac    289080
     atcgtgatcg ccggcggcgc ggtgaccggc gacctggcca gccagccggg ctaccagccc    289140
     tatcagccgc tggtggccgg catcccgttc gacccgacca acccgctgtc gtataccgac    289200
     caggtgccga ccacggtcta cgactcgctg ggcaactcgc accagatggt ccagtacttc    289260
     gccaagcgcc ccgcggtggg caccgagagc gtgtacgagg tctattacgt gctggacggc    289320
     cagcccatgc aggtcaatgg cggcgcctcg cagacgctga acttcgacac cgccggcaat    289380
     ctgctcaacc agccgcccac cgcgcaggtc acgttcgcca atccgggcgg caacgccgcg    289440
     ccggccgacc cgctggccat caccgtcagc tacaacggcg tcacccagta cggcagcgat    289500
     ttcgcgccca aggtggtgca gaacggctat tccagcggcg agtacatggg actgtcggtg    289560
     ggcgaggacg gcagcctggt ggccaagtac accaacggcg agacgcagac catcggcacc    289620
     gtcgtgctgg ccaacttcaa caacgtgcag ggcctgaagc cggtgggcaa caacgcctgg    289680
     gccgagacgt ccgaatcggg gcaggccacc ctgggccagc cgggcaccaa cggcctggcg    289740
     accattgtcg gccaggcgct ggaaggctcc aacgtggacc tgagcagcga gctggtcaac    289800
     atgatcgtgg cccagcgcac ttaccaggcc aacgcgcaga ccatccagac gcagaacgaa    289860
     gtcatgcagg tcttgatgaa catgcgctaa gcgccggcac ccaccagaat cgaaaataga    289920
     aggccaggat ggaccggatc atctacaccg ccatgaacgg cgcggcccgc attgccgagc    289980
     accagacggt gctgggcaac aacatggcca acgtcaacac gccggggttc cgcgagcaga    290040
     tcgcgctgta ccgctcggtg cccatggccg acggcacctc gctgcccacc cgggtctcga    290100
     ccgtggcgtc cacgcccggc aacaacttcg agatgggcaa catgatgacc acggggcgcg    290160
     agctggacgt ggcgctggcc gggccgggct ggttcgcgct gcagacgccg cagggcgagg    290220
     cctatacccg cgccggcgcg ttgcaggtgg gcgtcaacgg cctgctgcag accgccaccg    290280
     ggcagcctgt gctgtcggac cagaacgcgg tcatcgaggt gccggaccag gccagcctga    290340
     cgatcgcgtc ggacggcacg gtcaccgcca tcggcgcggg cgatccgccc aacaacattc    290400
     tcaacctggg ccggctgaag atggtcaacc cgccaccgca gcagctggtg catggcgacg    290460
     acggggtgtt ccgcatgccg cagcagcccg gcggccagcc cgccgcgccg ctgccggccg    290520
     atccgtcgca gcgcctgttg agcggcgtgc tggagggcag caacgccagc cccatgggcg    290580
     ccatggtggg catgatccag aacgcgcggc ggttcgagat gcagatgcag gtgatacgcg    290640
     aggcggacaa gaacgccgag cgcgccaacg ggattctggc cgcggccagc tgattatcaa    290700
     cgcgcgcgcc gaagcgccgc gccaggagtt ttcatcatga tgcgttcgtt gtgggttgcc    290760
     aagacgggcc tggaaggcca gcagacgtcg atggacgtca tttccaacaa cctggccaac    290820
     gtccagacca atggcttcaa gcggggccgc gcggtgttcc aggacctgat gtaccagacg    290880
     ctgcgccagc ccggcgcgca ggtcggcgac gccaaccagc tgccctccgg gctgcagctg    290940
     ggcacgggcg tgcaggtcgc cgccacccag cgggtgttct cgcagggcaa catgaacaac    291000
     accggcggcg agatggacat cgcgatccag gggcgcggct tcctgcaggt agagctgccc    291060
     gacggcacgc aggcctacac ccgcgacggc tcgctgcagg tcgaccagaa cggccagctg    291120
     accactgccg gcggctatgt gatccagccg cccatcaacg tgcccgacaa cgcgctgtcg    291180
     ctgaccatcg gcaaggacgg cacggtgtcg gtcacccagc ccggcgcggc cggcaccaac    291240
     gtgcagatcg gccagctgca ggtcgccacc ttcatcaacc ccaccggcct gcagagcgtg    291300
     ggcgagaacc tgtacctgga aaccgactcg tcgggaccgg ccaacctgct gcagccgggc    291360
     atcgatggcg caggccagat cctgcagcag tacgtggaaa cctccaacgt caacgtggcc    291420
     gaagagctgg tcaacatgat caccacccag cgcgcctacg aaatgaacag caaggcggtc    291480
     aagacctccg acgaaatgct ggcccgcctg acccaactgt gatgctgaag accgtattgc    291540
     gcctgccggt ctgcgccgcg ctgctggcgc tggccgcggg ctgcgcgatg attccgcccg    291600
     aaccggtggt gaccggtccg ctgaccgcgc cgcctccgcc gccgccgcaa ccctcggcgc    291660
     ggcccaacgg ctcgatctac cagccttcgg cctacggcaa ctatccgctg ttcgaggacc    291720
     gccggccgcg caacgtgggc gacatcgtca ccatcgtgct ggaggaaaag accaacgccg    291780
     ccaagggcgt ggccaccaac accagccgcg acggctcggc cacgctgggc gtggcggccg    291840
     cgccgcgctt catggacggc atcatcaacg acaagctgga taccgatatc tcgggcggca    291900
     ataccgccaa cggcaccggc aagagcagcg ccaacaacac cttcaccggc accatcacga    291960
     ccaccgtgat cggggtgctg cccaacggca atctgcagat cgccggcgag aagcagatcg    292020
     ccatcaaccg cggcagcgag tacgtgcgct tctcgggcgt ggtcgacccg cgatcgatca    292080
     ccggcagcaa tacggtgtcg tcgacccggg tggccgacgc gcgcatcgaa taccgcagca    292140
     agggcgtcat ggacgaagtc cagaccatgg gctggctgca acgctttttc ctgatcgctt    292200
     cgccgttctg atcatgacat ttccgacctc gctatccgtt ttgctgattc cgctggcgcg    292260
     cgccgtgctg gccctggcgc tgctgggcgc gggcgccgcg catgccgagc gcctcaagga    292320
     cctggcctcg atccagggcg tgcgcggcaa ccagctgatc gggtacggcc tggtcgtggg    292380
     gctggacggc agcggcgacc aggtgcggca gacgccgttc acgcagcaaa gcctgaccaa    292440
     catgctgtcg cagctgggca tcacggtgcc gcagggcagc aacatgcagt tgaagaacgt    292500
     ggccgccgtc atggtgaccg cgaccctgcc gtcgttcgcg cggcccggcc agaccgtgga    292560
     cgtggtggtt tcgtcgatgg gcaacgccaa gagcctgcgc ggcggcacgc tgctgatgac    292620
     gccgctcaag ggcgccgaca accaggtcta tgccatcgcc cagggcaatc tcctggtggg    292680
     cggggccggg gcctcggccg gcggctccag cgtgcagatc aaccagctca acggcgggcg    292740
     catcagcaat ggcgccatcg tcgagcgcgc cgtgcccacc atgtacgcgc aggacggcac    292800
     ggtgtacctg gagatgaaca acaccgattt cggcaccacc cagaacgccg ccgcggccat    292860
     caaccgccag ttcggcgccg gcaccgccat ggcgctggac ggccgcgtga tccaggtgcg    292920
     cggcccgctg gacccgtcca tgatgccggc gttcatgtcg caggtggaga acctgcaggt    292980
     cgcgcgcgcg ccggccacgg ccaaggtcat catcaacgcg cgtaccggct cggtggtgat    293040
     gaaccgcacg gtcatgatcg aggaggccgc ggtggcgcac ggcaacctgt cggtgatcat    293100
     caatcgccag aaccaggtgt tccagcccga cacgccgttt accgagggcc agaccgtggt    293160
     cgtgcccaac acgcagatcg aggtgcgcca ggacggcggc gcgctgcagc gcgtgaccac    293220
     cagcgccaac ctggccgacg tggtcaaggc gctcaacgcg ctgggcgcca cgccgcagga    293280
     cctgctggcc atcctgcagg ccatgaaaac cgccggcgcc ctgcgcgccg acctggaaat    293340
     catctaaggc ccgtcgaccc agccatgtca ttcgtcagct ataccccccg cccgggcgtc    293400
     caggaatcgg tcttcgacct gggccgcctg gccgacctca agcgcgacgc ggtcaaggcg    293460
     ccggacggcc agcgccagca aacggaagtg gcccggcagt tcgaggcgct gttcctgcag    293520
     atgatgctca agcgcatgcg cgaggcgacg cccaaggagg gcctgttcga ttcgcagcag    293580
     accgagatgc tgcagggcat ggccgacgag cagctggccc tgcagctggc ctcgccgggc    293640
     atcggcctgg cgcaggcgct gctggggcag atgcagcagg gccagccgcc ggtcccggcc    293700
     gccgcggcag ccggcggcga cgccgcggcg gcccgcgcac tggccggcac cgctgcgccc    293760
     gcgccgctgg tgcgcgacct tcgcggcaac tatgtacaac cggaccctgc gcccaggcgc    293820
     gaggtcaacg cgctgctgga tgtgttgcgc agcaaccggg cgcgcgaccg cgccatggcg    293880
     gcggccgagg gcgcgccctc gcacgtggtc gacttcgtgt cgcgcatgtc gcgcgcggcc    293940
     aatgtcgcgg cgcagcaaag cggcgtgccg gcgcgcctga tcctgggcca ggcggcgctg    294000
     gaatcgggct ggggccggcg cgagctgcgc cacgaggacg gcagcaccag ttacaacctg    294060
     ttcggcatca aggcgggcgc cagctggaag ggcaaggtcg tcaatgtgat gacgaccgag    294120
     tacgtcgacg gcgtcgcgca gaagttggtg cagccgttca gggcctattc gtcctacgaa    294180
     gagtcgttca gcgactacgc ccgcctgatc ggcaacagcc cgcgctacga ggcggttacc    294240
     caggccggca acgagatcga ggcggcgcgg cgcatccagg aggccggcta cgccaccgat    294300
     ccgcgctatg ccgaaaagct gatcagcatc atgggccagc tgcgcaccag cgtggcgcgc    294360
     gccgattttt ccggcggcct ctaaatattg gcggcgggct gccgttaact aggcatctga    294420
     accgcgtgcg gtgaattacg gggcattgct agcatgaatc tgtacaactt ggcgctgacc    294480
     ggcctgaacg cttcgcaagc cggcctggag acgaccagcc acaacatcaa caatgccacg    294540
     acggtcggct acagccgcca gcgtgtcatc acctcgaccg ccggcgccgg cgagaccggg    294600
     cagggctttt tcggccgcgg tgtgcaggtg gataccgtga cgcgccagta cgacagcttc    294660
     ctgtaccgcc agctggtcgg cgcgcaaggc agcagcgccc agctgagcac ccacctcgcg    294720
     caagtgtcgc aggtgaacaa tctgttcggc gatcgcaccg tcggcatcac gccggcgctc    294780
     gcgggcctgt tcaccagcac caacgcggcg gccaccaagc cggccgatcc ggccgtgcgc    294840
     gccgacatga tcggcaaggc caacagcctg gtcacccaga tcaataccgc ctatcaggag    294900
     ctggaaaacc agcgcaacgg cctcaatacg cagatctcga ccacggtcga gcaggtcaac    294960
     agctacctgg agcgcatcaa cgacctgaac aagcagatcg tgatcgcgcg cggcaaggac    295020
     gggcacgcgc ccaacgacct gctggaccag cgcgaccagg ccgtctcgga actgaaccag    295080
     ctgaccggca tccgcttcta cgagcagggc gatacgttca acatcacgct gcaaagcggc    295140
     cagaccctgt tgtcgggcac gaccgtctat ccgctgcagg cggtgccctc ggccagcgat    295200
     cccaagcgcc tggcggtggc ctatacgctg ccgtccgggc cgggcaccac catccaggtg    295260
     gaaatgaacg acagcgaggt caccggcggc cagctgggcg gcctgctgag tttccgcagc    295320
     cagtcgctgg acgcggtgca ggaccagctg ggccagctgg ccatcgggct agccatggcg    295380
     ttcaacgcgc aacaccgcga gggctatgac ctggacggcc agccgggcgg cgacatgttc    295440
     ggcctgcagg cgccggcggc gatccgcaat tccggcaata ccagcacggg cgagtggcag    295500
     tcggcctata ccgacgccga cgccatccgc gccagcgcct atcgcatcca gtacgacggc    295560
     gccaactaca cggtgacgcg cctgtccgat ggcagcagct tcgacgtgac gcccagcggc    295620
     acgccgccca cgctgtcgtt cgacggcctg accctgaccg gcagcggcac gccggccgcc    295680
     ggcgacgcct ggacgctgca gccggcccgc gacgcggcgc gcgacctcaa gcaattgatc    295740
     agcgatccca gcaagctggc gctggccgat tcggcgctcg gcacgaccaa cggcaacaac    295800
     ggcctgaagc tggccgagct gcagaccgcc aaggtgctgg gcaacggcag catgagcctg    295860
     aacgagatgt tctcgcagct cgtcaataac gtgggcgtgc agacgcagca ggtcagcacg    295920
     gccaacacgg cgcaggccaa cctggtcaag cagcaggcca ccgcccacct gtcggtgtcg    295980
     ggcgtgaacc tgaacgaaga gtacgtcaac ctgacgatct tccaggagca gtaccaggcc    296040
     agcgccaaga tcctggatgt ggccagcacg gtgttcgaca ccttgctggg cctgcgctga    296100
     gcgcgacgct aaacaagaga ttggagttcg acgatgcgtt tgagcaccgc actgatttac    296160
     cagaatggcc tgaacggcgt gctgaaccag gaagccgcca tggcgcgcct gcaggagcag    296220
     ctctccagcg gccgccgggt gttgacgccg gccgacgatc cgctggccgc cgcgctggcg    296280
     gtcaacgtct cgcagacgtc cagcatgaac agcaactacg acgccaaccg caagcaggcc    296340
     gagcaggcgc tgggcgccca gaccaatacg ctgcagtcgg tcgtcaagaa catgcaggaa    296400
     atgctcaagc gggtggtcga ggccggcaac ggcaccatga gcgatgccga ccgccaggcg    296460
     ctggtcatcg cgctcaaggg cgcgcgcgag gaactggtgg ggctggccaa cgccacggat    296520
     ggcaacggac agtacctgtt ctccggctac aagggcttta cccagcccta cagcttcgac    296580
     gccgcgaccg gcaaggtgac ctataacggc gacctgggcc agcgcggcat ccaggtcgac    296640
     cagagccgcc tgatgagcgg cggcgatgtc ggcagcgaca ttttcaacag cgtcaccagc    296700
     ggcacgctgg cctatatcgc cgatgccggc gcgggcaatg ccggcaccgg acaatacagc    296760
     gcggtgtcgt tcgacggtcc gcgcgccggc aactacgtgg gccgcgattt ccgtatcgag    296820
     ttcacgcgcg atgcggtgac cgacgagctg cagtactcgg tgctcagcga cccgccggtg    296880
     gtgccgcccg aacagccgct gccggccaat atgccttact cggagggctc cgtgatcgac    296940
     atgaacggcg tgtcgatcaa gttgagcggc cagcccgagg cgggcgacgt gttcaccgtg    297000
     gagacgccca agtcctggaa gatgggcgtg cagggcgacg cggccaacac cggatcggcc    297060
     acgctgacgc cggtgtccct gccggacggg ctgaccggca agaacctgag cgtggcgttc    297120
     ctggacgacg gcgccggcgg cctgctctac agcgtgacca gcacgccgcc ggaccccagc    297180
     ctgcctgcca acgtgccggt caagccgggc gatgtcatcg acatcggcgg cctgaaggtc    297240
     aaggtggacg gccagccggc cgccggcgac acatacgccg tgaccacgcc gaagtcggcc    297300
     aacgtggacg tgttcgacac gctcaacgac ctgatcggcg cgctcgatac gcccatcagc    297360
     ggcgatccgc aggccgccgc ggcgctggcc aacacgctgg ccacggccaa caagaagctg    297420
     aacctgtcgc tggacaacgt gctgacggtg caggcttcgg tgggcgcgcg cctcaatgaa    297480
     ctggaagcgc tgggcaatac cggcgcgcag aagggcttgt cgtacgtcaa gcagctgtcg    297540
     gacctggagg acgtgaacat ctaccaggcg accagcgact tgctgttgcg gcaggttgca    297600
     ttacaggcgg cctcgctggc cctgcagcgc atacagggaa acagcctgtt ctcgatgggt    297660
     cgatagatcc acggcaggtc tcgtagtcgg gaaatggcgc gcgctcccct cgaggagcgc    297720
     gtgttcgatg gaaagcggat aaacatgtgg tcgaatttga aggtacgcac ctgcatcacc    297780
     ctggtgctgg gcctgtttct ggtggcaatg ctggtgtcca acgcaatggc ctggctgggc    297840
     atgagctcga gcaacgacaa gctggagcgc gtcaataacg cgtattcgaa ccaggccgtg    297900
     ccggcctacg aggcctacgt catgctgctg cgggcgcggc tgaacatggt ctcgtcgatg    297960
     atggacctgc aggaagggcg gttgaaggag tcggccgata cgctggcgca cgcgcagcgc    298020
     caggccggcg aagcgcgcga gcgcttcgag gccttcctgg cggtggccaa ggcttcgtcg    298080
     ggcgccgacc gggtcggcgc ggtggagacg gcgttccatg cctacctgga ggtggcggcg    298140
     cgccagatgg aggccatgca gaaccagaag ctgggcgagt tcgtgcagct caacccgtcc    298200
     gcgcagcgcc tgaacactgc tttcgatacg gcggcgtcgg cgtacctgga ccagatcgac    298260
     acggacaccg acgcgctggt ggacgatgcg cgcgccgaac acctgcgcgc caatacggta    298320
     acccttgtgt tgattgtcct ggcgttggcg ctgtgcgccg gctgcggggt gttcatcggc    298380
     cgcgccgtgc tgcgcccgct caaggaagcc ggccagcact tcgacaggat cgccgcgggc    298440
     gacctgaccg cgcgggtgga tgtgcgcagc accaatgaga tcggccagct gttcgccgcg    298500
     ctgaagcgca tgcaggagag cctgacgcgt accgtcgcgg cggtgcgccg cggggtggac    298560
     gagatcaacg tgggttcgcg cgagatctcg gccggcaaca cggacctgtc cagccgcacc    298620
     gaggagcagg cggcctcgct ggaggagacc gcggcctcga tggagcagct ggcctcgacg    298680
     gtcaagcaga atgccgataa cgcgcgccag gccaaccagc tggcgggagt cgcctcggac    298740
     gtggccgagc gtggcggttc ggcggtgtcg gaggtggtgg cgacgatgca ggacatctcg    298800
     gccagctcgc gcaagatttc cgagattgtg tcggtgatcg acgggatcgc gttccagacc    298860
     aacatcctgg cgctgaacgc ggcggtggaa gcggcgcgcg cgggcgagca gggcaagggt    298920
     ttcgcggtgg tggcgggcga agtgcgctcg ctggcgcagc gcagcgccca ggcggccaag    298980
     gagatcaagg tgctgatcga ggattcggtc ggcaaggtgg gcacgggctc gcagcaggtc    299040
     gagcgcgccg gggcgacgat gcaggagatc gtggcctcgg tcaagcgggt gacggacatc    299100
     atgggcgaga tttcggcggc ctcggacgag cagtccagcg ggatcgagca ggtcaaccgc    299160
     gcggtgtcgc agatggacga ggtgacgcag cagaacgcgg cgctggtgga agaggcggcc    299220
     gcggcggccg gttcgctgca ggagcaggcg cagcgcctgg ccgaggcggt cgcggtgttc    299280
     aagatcaatg ccggcgaagt gatcgacgtc tcggcgcgcc agctggcgca gcagcgccag    299340
     gcgccgcgcg tgggggccgc gccggccagc gctgcggcgc ccgaggcgcc gcccgaaccg    299400
     gcgccggcgt cggcgccgcg gctggcgcgc ccggccgcgc gcgcggacgt ggcggccgag    299460
     gcggccagcg cgcgccggcc cgcccgccgg ccggccgcga ccgagccggc ggcccggacg    299520
     atggccgcgc cgtcgcgccg ccgtccgccg gccgatgatg attgggagtc gttctgagcc    299580
     ccgtggggcg aaatggcggc cgggtagttc tgtttggcgg tttttgcagt ggcagcacag    299640
     agccggagcg ccaggcggcg cttcgcatga tgacctacgt aagagacgat acaggcaatg    299700
     ttcgcgaatc tgaaagtgcg taccgggctg ttgttggcgc tagtggcgct ggcattggcg    299760
     gcattggttt ccatcgcgtt ggggtgggaa agcgtccggg agggctcgcg ctccctgcat    299820
     gcgctcgata gcgtgagcgt gcagcagggc agcctgctca aggacgccta tgcgcagatg    299880
     ctgcgggcca cgattcgcgc ggacatcgcg gcggtgcagc ggcgcggcgg cgatgccgcc    299940
     ggcgcgctgg agaacgagcg caccgtcaag caattgatgg gcgaagccaa gtccaggatc    300000
     gaagcgtttc gcaaagttcc caagctgtcc gagttgggcc gttcgatgga aaccggcctg    300060
     accagcagct tcggcagctt cgccgcctcc ctggacgaaa tgatggcggc gctggagcgc    300120
     aacgacgacg cggcctacct gcagctgaag aatgtgaagg cagggcaggc cagcgccgcc    300180
     ttcgccgccc ggctgggcga attctcggcc aacctggaca agctgagcag cgagacgctg    300240
     gccgcgcacg agacgcgcga aaccatcatg ctttatgtgt acgcggcctt gctgctgttg    300300
     atcgtgggcg tgatcgcggg cagctatctg tacatgacgc gcgcggtggt gcgtccgctg    300360
     cagcgcgcca gccagcaatt cgagcgcatg gccgccggcg acttgagcgc gcgcatcgaa    300420
     ggcaactccc gcaatgagat cggggccttg ctgacggcgc tgcgccatat gcaggagagc    300480
     ctgacgcgca ccgtggcgac ggtgcgccgc ggggtggacg agatcaacgt gggttcgcgc    300540
     gagatctcgg ccggcaacac ggacctgtcc agccgcaccg aggagcaggc ggcctcgctg    300600
     gaagagaccg cggcctcgat ggagcagctg gcctcgacgg tcaagcagaa tgccgacaac    300660
     gcgcgccagg ccaatcagct ggcggccagc gcctcggacg tggccgagcg cggcggttcg    300720
     gcggtgtcgg tggtggtggc gacgatgcag gacatctcgg ccagctcgcg caagatttcc    300780
     gagattgtgt cggtgatcga cgggatcgcg ttccagacca acatcctggc gctgaacgcg    300840
     gcggtggaag cggcgcgcgc gggcgagcag ggcaagggtt tcgcggtggt ggcgggcgag    300900
     gtgcgctcgc tggcgcagcg cagcgcccag gcggccaagg agatcaaggt gctgatcgag    300960
     gactcggtcg gcaaggtggg cacgggctcg caataggtcg agcgcgccgg ggcgacgatg    301020
     caggagatcg tggcctcggt caagcgggtg acggacatca tgggcgagat ctcggcggcc    301080
     tcggacgagc agtccagcgg gatcgagcag gtcaaccgcg cggtgtcgca gatggacgag    301140
     gtgacgcagc agaacgcggc gctggtggaa gaggcggccg cggcggccgg ttcgttgcag    301200
     gagcaggcgc agcgcctggc cgaggcggtc gcggtgttca ggatcaacgc cggcgaggtg    301260
     atcgacgttt cggcgcgcca gctggcgcag cagcgccagg cgccgcgcgt gggggccgcg    301320
     ccggccagcg ccgtggcgcc cgaggcgccg cccgaaccgg cgccggcatc ggcgccgcgg    301380
     ctggcgcgcc cggccgcgcg cgcggacgtg gcgaccgagg cggccagcgc gcgccggccc    301440
     gcccgccggc cggccgcgac cgagccggcg gcccggacga cggccgcgcc gtcgcgccgc    301500
     cgtccgccgg ccgacgacga ttgggaatcc ttttgaacgc cgcgggccac agggagcacg    301560
     ccatgccgag atggatagcg ggattgggcg ccatgctggc ggtgctgtgg ctggcaggct    301620
     gcgcggccac cggacacaac ttcgatcccg gccgcctgtc gcggctgacg ccggggcaga    301680
     caacgctgga agaggcggcg cgcgaactgg gcgcgccgcc ggacacgatc tatggccaac    301740
     gggacggcgg tgtgctggcc ctgtggcagt tcaagatcac gttcgtcacc gacgggttct    301800
     acagccgcaa ggaagccttg ctgcagttcg gccccgacgg acggctgatg cgtctggtcg    301860
     acagtaccaa catcctgctg gagccttggg aacgccgcaa gttgctgggc cccgagccgc    301920
     cgtggcccgc cgaaccggcg gtgccgcaag tggctcccca ggcggcgccg gttgccatac    301980
     cggtgccggc ggctccagcg caatagtcgc ggacgctacc gacgccggat tgccgccggc    302040
     gtggccgctt tccctgggac gccccgcgcg ccaggggaag cgtcattttt ttgaaattcc    302100
     tgaaggacgg ggggaaacat ggaagctggt ttcgaaactg gtgccaagaa ggtcaaggcc    302160
     aacaagcgcg cgcgagcgcc caagcaaaag cgcagcctcc gcctgcgtga cgcccatgtc    302220
     ggttcgctgc tgatgtgggt gctgggcgtg ttcgcgctca tgattgccgg cgtcggtgcg    302280
     atggccgcgt atttcctgca acagaattac cagtcggtgg gggagatcaa cgccctgacc    302340
     gatcgggtcg cccaggtgga aatcatcaat agcgacatgc tgcgtgcgcg cgtttcgctg    302400
     atggtgtcgg cgcgccagct gcaggaatcg ggctggggca gtggcgcaaa cgccgcccag    302460
     gccgctgccg cttcgctgaa ggacgccacc gatctgctcg cgggtgttcg cacccgcttt    302520
     gccgatttcc agaagaacat gctggaagac gataccggcc gccagctgtc gatgaacctg    302580
     gtgcggcgct accgctcgta tatcgacgat ggcgtggaca ccatggtcga agccctgcgc    302640
     agcgaggact actcgacctt ctacatggtc aacaatgaat acggcacgcc gcgcagcgcc    302700
     gccttcattg ccgccatcgg cgacttcagc aagtacatca acgaacagca gcaagccacc    302760
     atggaagcgg cgcgcaccaa cttcgaccgc gccctgatgg cggtgacggc ggccgtggtg    302820
     ctggccttgg tccttatgct ggtggcgcgc acggtgttcg gccgcctggt ggtgcgtccg    302880
     ctcaaggagg ccggccagca cttcgacagg atcgccgccg gcgacctgac cgcgcgggtg    302940
     gaggtacgca acagcaacga gatcggccag ctgttcgccg cgttgaagcg catgcaggag    303000
     agcctgacgc gcaccgtggc gacggtgcgc cgtggcgtgg acgagatcaa cgtgggttcg    303060
     cgcgagatct cggccggcaa cacggacctg tccagccgca ccgaagagca ggcggcctcg    303120
     ctggaagaga ccgcggcctc gatggaggag ttggcctcga ccgtcaagca gaacgccgac    303180
     aacgcgcgcc aggccaatca gctggcggcc agcgcctcgg acgtggccga gcgcggcggt    303240
     tcggcggtgt ccgaagtcgt cagcacgatg gacgggattt cggccagttc gcgcaagatc    303300
     tccgagatcg tgtcggtgat cgacgggatc gcgttccaga ccaacatcct ggcgctgaac    303360
     gcggcggtgg aagcggcgcg cgcgggcgag cagggcaagg gtttcgcggt ggtggcgggc    303420
     gaagtgcgct cgctggcgca gcgcagcgcc caggcggcca aggagatcaa ggtgctgatc    303480
     gaggactcgg tggacaaggt gggcacgggt tcgcagcagg tcgagcgcgc cggtgcgacg    303540
     atgcaggaga tcgtggcctc ggtcaagcgg gtgacggaca tcatgggcga gatctcggcg    303600
     gcctcggaag agcagtccag cgggatcgag caggtcaacc gcgcggtgtc gcagatggac    303660
     gaggtgacgc agcagaacgc ggcgctggtg gaagaggcgg ccgcggcggc cggttcgctg    303720
     caggagcagg cgcagcgcct ggccgaggcg gtcgcggtgt tcaagatcaa taccggcgaa    303780
     gtgatcgaag tgccggcgca ccaattgtcc ggctacgcgg cgcccctggt cgcgcagtcc    303840
     tgaccggcac cccgacgccg cggccggctg gccgcggtcc gggccatccg tccgccaggg    303900
     cgggaaagcg gcgatccgcc gcggccagcg ccgcgccgga tcgtcttttt acaggcagcg    303960
     gccgcgcggg cggcccgcat gtccgagatg tgtagttcag cagttccaca ggagactggc    304020
     agtgcgcgtt aacctcccga tatatgacgt agagaccaag ctgcgcgagg accaatacct    304080
     gatctcgcgc accgacacca aggggcggat cgtctatgcg aaccccgcct tcgtcgaggt    304140
     cagcggcttc gagcgcgacg aattgatcgg caaggcgcac aacctggtac ggcatcccga    304200
     catgccgccc caggcgtacg aggacctgtg gcgcaccctg caggctgggc agtcctggct    304260
     gggagtggtg aagaaccgcc gcaaggacgg cggtttctat tgggtgctgg ccaatgccac    304320
     gcccatctat gaggatggcg aggtggtcgc ctattcgtcg gtgcgcgtca aggccagcga    304380
     cgagcagatc gaggccgccg aagccgccta tgcgcagttg cgcgccggca cgctgcgtgg    304440
     ccggcgcctg tggcgcggcc aggtggtgtc caccggctgg cggcgggtgc tggccgccgc    304500
     cgcgtttccg ttgcgcggcg gtctgagcgc gcgcatgctg cgccagtcgc tgctggcggc    304560
     gctggccgtg gccggcgcgg gcgccgccgc gctggcgccc tggtggccgc aatggagcgg    304620
     cgcgcaggcc ggcgccgcga gcgcggccgt ggcgctggcg gcgctgggcg tgctcgcgat    304680
     gcagtggcgg ctgcgcggcg cggtgctgcg caccatggaa ggcgcggccg acatggcgcg    304740
     ccaggtggcc gccggcaacc tcacgacgca gatcggcagc gacgccaacg acgaggtcgg    304800
     caagctggcg ttctcgctgg acgtgatgcg caagagcctg gtcggcatcg cgcgcgacgt    304860
     gtacggcggc atcgagggca ccacccaggc tgccctgggc atcgcgcgcg gcaaccagga    304920
     gctgtcggcc cgcaccgacg accagagcgc ctcgctgcag aacacggcgg ccagcatgga    304980
     agagctgacc tccaccgtgc gccagaacgc cgacaacgcc cgccaggcca atgacctggc    305040
     cgcgcgcagc atggacgtgg cgcgccgcgg cggcgacgcc gtcggacggg tggtcgatac    305100
     catgcacggc atctcggaca gctcgcgcaa gatcgccgac atcgtcaata tcatcgaggg    305160
     catcgccttc cagaccaaca tcctggcgct gaacgcggcg gtggaagcgg cgcgcgccgg    305220
     cgagtccggc aagggcttcg ccgtggtcgc cggcgaagtg cgcagcctgg cccagaagag    305280
     cgcccaggcc gcgcgcgaga tcaaggacct gatcgaggac tcggtcagcc gcgtcaccga    305340
     aggttccctg caggccgagc aggccggcgc caccatgcag gagatcgtcg acgcggtgcg    305400
     cggcgtcacc gacatcatcg gcgaaatctc ggtggcctcg cagcagcagg ccagcggcat    305460
     cgaacaggtc gacgaggccg tctcgcagat ggatggcatg accgtgcaga actccggcct    305520
     ggtgcagcaa ctgggcaaca ccgtggcgca actcggccag cagtcggccg cgctgcgcga    305580
     aacgatacgc gtgttccgga tggcgcgcga acaggggtga gggcggtgcc gccggacgcc    305640
     gctgggtgcc agtccctgcg gggacaggca ccgcaaggag tcggcgggtg ccagtccccc    305700
     tgcggggaca ggcacccgaa ggggttactt gcccgccagg ccgttggcga cgttgttcat    305760
     ggtgttcagg ccctgttcga acaggcgctc gaggaagggg ccggaatgcg gcagcacgat    305820
     ggccagcagc accaggccga cgatgaggct gacgggaaag ccgatggcga acaccgacag    305880
     ctgcggcgcg gcgcggttga ggatgcccat ggccaggttg atggtcagca gggcgcagat    305940
     cagcggcagc gccagcagca ggccggagac gaagatggtc gtgccccatt cggccaggat    306000
     cccccagccg ttgcggtcca gcacgccgac cgcgaccggc agcgtgtcga agctgcgcac    306060
     cagcgcgccg agcaccagca ggtggccgtc cagcgccagg aagaccagca tcgcgacgat    306120
     attgaacaac cgcgagagca ccgcggtgtt ggcgccggtg gcggggtcga agaacgacgc    306180
     gaacgacagg cccatctgca ggccgacgaa ttcgcccgcg gtctgcaccg cggcgaacac    306240
     cacccgcatg gacagtccca gcgcgatgcc gatgagtacc tgctggccca gcaggaacag    306300
     cccggcgtag gaactgggcg ggacggcagg catggggccg atcgccggcg ccacggcgat    306360
     cgtgagcatg aaggccaggc cgatcttcac gcgcgtggga atggtggact cggaaaacag    306420
     cggcgcggcg ccgaccaggg ccaggatgcg cacgaacggc cacaggaact gggccagcca    306480
     gccgttgagc tgttccatgg tgaacgcaat catggcgcgg cgcggccagg cgcgttcagg    306540
     acaccagcat cggaatctgg ccgatcagct ggcggatgta gtcggtcagc aggcccagca    306600
     gccaagggcc cagcagcacc agggtgccgc acatggccag cagcttgggg atgaacgaca    306660
     gcgtcatctc gttgatctgc gtggcggcct ggaagatgct gatgaccagg ccgacgatga    306720
     gcgtgaccag cagcagcggt ccggccagcg ccagggcgac cttgagcgcc tggtaggtca    306780
     tcgacatcac ggtttcggcg gtcatggcgg cctccctcgc gctattggta gaagctctgg    306840
     gccagcgagc cgagcagcag gtgccagccg tcggccagca cgaacagcat cagcttgaac    306900
     ggcagcgcca cggtgaccgg cggcaccatc atcatgccca gcgccatcag gacgctggcg    306960
     accaccaggt cgatgatgag aaagggaatg aagatggtaa agccgatctg gaacgccgtc    307020
     ttcagttcgc tggtgatgaa agccgggatc aggatgcgca tcggcacctg ggacggatct    307080
     tccatggccg gcaggttggc caggttggcg aacagggtga ggtcgttctc gcgggtctgg    307140
     tgcagcatga agttgtgcag gggcgagccg gcgcgctcga ccgcggtttc gaacggaatg    307200
     ctgcccgcgg ccagcggctg gtaggcgtcg gtgtagattt tgtcgaacac cggcgacatg    307260
     gtgtagaaag tcaggaacag cgccagcccg atcagcacgt ggttgggcgg cgacatcgcg    307320
     gtgcccatgg cgctgcgcag cagccccagc acgatgatga tgcgcgtgaa gccggtcatc    307380
     atcagcagcg ccgcgggcag gaacgacagc gaggtcatca gcagcagggt ctgcatgctg    307440
     agcgagtagg tctccgagcc attgggcccg ggcgtggcgg tcagggccgg cagggtggcc    307500
     tgcgccagcg cgccgctggg ccacagcgcg gcggcggcca cggcgacggc ggccatggcg    307560
     ggccaccagg gcgcgcgcgg gcgcgtatcg gaaaaacgga agctgatgct catggcgggc    307620
     aagcctaggg cctgtctact cgatggccgc gctgcagcgc ctggcccagt ttggcggcaa    307680
     aggtgccggc cgcggccggc gaaggatcgg gcagctggcc ggccggcagg gtgtgcaggg    307740
     tggtcaactg gttgggcgtg acgcccagca ccagccaggt gccttcgatt tcgagcacca    307800
     ccacgcgttg gcgcgggccc aggctcatgc cgccgacctg gcgcagcaag gcgccgccgt    307860
     ggcgctggat caggcccgag cgccgcgcca gccaggccga aaccaggatg gccgcgatca    307920
     ccagcgccag gccgatgaca acgcgcagga cggcggattc ggtcataagg cggctttcag    307980
     cggcggctgt tcaagcggtt gatgcgctcg gacggcgtga tgatgtccgt caggcggatt    308040
     ccgtacttgt cgtccaccac gaccacttcg ccctgggcga tcaggtagcc gttgacgaag    308100
     atgtccatcg gttcgccggc caggccgtcc agttccacga ccgagccctg gcccagttgc    308160
     agcaggttct tgatggtcag gcgtgtgcgg cccagctcca ccgtcatctg caccggcacg    308220
     tccatgatca ggtcgatgtc ggtgccctgg ccggtctcct tggtggccag cggcttgaag    308280
     acggactgcg cggccggctg gacggccggc gcggcggcgg gcgcggcgtt ctgctcggcc    308340
     agggcgtcgg cccagtcgtc ctgcggcttg aggccgtcgg cctgggtggg cgcggcggcg    308400
     cggttctgtt cggcgagcgc atcggcccag tcgtccgccg ccggggcggg cgcgccggcg    308460
     ccggtctggt cgggccgctc gttcgtatca gtcatggtcg ggggcctcgt tggaatcggt    308520
     atcgtcgtaa ttgatcaggt tttgcacgcg cagcgcgtat cggccgttga aaacgccata    308580
     gccgcactcc atgagcggta cgccgtcgac gtgggcggta acggtctcgg gcacggcgat    308640
     cggcagcaca tcgccggtct tcatgcgcat cagctcgccg atgctcgaag ggatgtggcc    308700
     gaattccgcc accaggtcga tgtcggcgct gcgcacctgg cgctgcagct gctgcgccca    308760
     gcgctggtcg acttcctcga gcgcggtgtc ctgcagcggg cgcgtcagca ggtcgcgcac    308820
     cggttcgatc atcgagtagg gcaggcagat attcaggtcg ccgccggtcg cgccgaattc    308880
     gatgtgaaag ggcgacacca ccaccacttc gttattgccg gtgatgctgg cgaacttggt    308940
     gtgcatttcc gagcgcacgt actcgaactc gatcgggtag accgggtccc aggatttgcc    309000
     gtagctctcc agcgtcaggt tgagcaggcg gcggatgatg cgctgctcgg tcgtggtgaa    309060
     gtcgcggcct tccacgcggg tgtgatagcg gccgtcgccg ccgaacaggc tgtcgatcac    309120
     caggaacacc aggttcgggt cgtaggtgaa cagggcggtg ccgcgcagcg gcttcatctg    309180
     aatcatgttc agattgctgg gcaccggcag gttgcgctcg aaatcggcgt acttcaggat    309240
     cttgatggcg ccgacggtga tgtcggcgtt gcggcgcatg aagttcagca gcacgttgcg    309300
     catgtggcgc gcgaaacgct cgttgatgag ctccagcgtc tgcatgcgcc ggcgcaccac    309360
     gcgttcgggc gagctgaggt cgtaggcgcg cggggcgccg gcctcgtcgc cggccggctg    309420
     cttctcgtcg ctttcgccgg tgactccggc cagcagcgcg tcaacttcgt cctgcgaaag    309480
     aaaagcctcg taggccatgc ttattgcacc acgaatgccg tgaacagcgc gtcggtcacg    309540
     tactggccgt caggcagcgg cgagaacggg cgtttcaccg cctcggtgat ggcgtgcgcc    309600
     atctcggtct tgccctgcag cgtctggacc gcctgcggcg attgcgagga cagcaccatc    309660
     aggatgcggc tgcgcacctc gggcatgtac ttctcgatgc gctggcgcgt ctgctcgtcg    309720
     ctgacgcgca gcgtgatccc gacgtgcagg atgcgctcgc tgtcggcgtt ctgcagcgtg    309780
     acggtgaacg cttccagcgg gatgaagatc ggcgccggca ccaccggcgg cgtcgccggc    309840
     ggcgcgacga actgcatggg cgttgcctgc ggctggccca cgcccagttg cacgggtacg    309900
     gccaccggcg gctgcatgcg cttcatgaag taccacgtgc cggccacgct ggcggcgacc    309960
     accagggcca ggaccagcag catgagcagc gggcgaagca gccggccggc gccgcccggg    310020
     cgcaggggaa gggtcgtgcg cggcggcatg gtggaagttt tggtcgttgc catctcgatg    310080
     tcgatgcgta gtgccgctat gaaacggact ttgatggaat taaggcattc tgccgcaatt    310140
     cacgcccgcg ctggcaggcg aaaaacaggg cgaaagccgg gtatctcaag ctattgctgc    310200
     gctgcgcgcg gccctcatgc gaaggtgtcg accaaggcat cggcgttgcg cgccggcgtg    310260
     gcggccacga cgacggtctc gctgtctgcg cccgctgcgc tgccgcccga cgcgccagcg    310320
     ccgcggcctt gctgctcggc aaagccctgc tgcgcggact ggtcgccgac actggtctgg    310380
     cccagcgaga tgccggcctg ggccagcgcc tgctgcagtt gcggcaaggc ggcctcgacc    310440
     gcctggcgca ccgccgcgtg gacggagacg aacgcggcgc tggccacgcc ttcgtgcagg    310500
     ttgatgctga cccgcaaggg gcccaggtcg ggcggatcca ggcgcagttc ggccgtatgg    310560
     tggccctggc gagcatcgtg gctgatggtg acgagctggc ggcccagctc ctggccccat    310620
     tggctggatc ccaccggcga ggcgacctcc agccccagcg gctgcgcggc ggcgggcagg    310680
     cttgcggggg ccgggttgcc gacagcctgg cgcgccgcaa tgtgcgcctg ggccgccgcg    310740
     tgcagggccg cgccgtgttc ggccgcggcc agcggttgcg gctgggccgg cgcggtggca    310800
     gggggctcgg ccgcctcgcc gccgtcttgc ggcgtgccgc cggtcgacgg cagcgggtgc    310860
     ggcaggctgg gcgcggcggg cggcgttgcg gcggtttcgg cggtttcggc ggccggcgcg    310920
     ttgggcgcgc tggcggccac ggcggcctgg gccgcaacgg ccggttgcgc ggtttgcggc    310980
     agggctggcg gcatggccgg cgcggtatcg gcgggcgggg cgccggcggc ggccggcgcg    311040
     gccggcgcgg ccggctggcc ggccagcagc gccgcgtggg cgggttgccg ggcggcggcg    311100
     cctgccgcct gggtggcggc cgcaacctgg gcgttgacgg cggcggcttc ggcggcgatc    311160
     tccagggcct gcagcggcag cgcgggagcc ggcgcggttt gcgccgccag cgcggccagc    311220
     gtggcggcgt cggcggcgtc ggcggcgtcg gcggccgtct cggcagcggg ctcctgctgg    311280
     ccgtccaccg gcaaggccgc ggtgtcgccg ggtttgccgg cgccggccgg gttctgggtc    311340
     gcggggcctt gggccggcgc gccggcctgg gcgccgggcg cggcaggcgt gccggcttcg    311400
     ccgggtttgc cgccttgctg gcgggccagc acttgcgaga agctgggacc cttgccggcg    311460
     gcggccgggc cgccttgcgc ggccggaccc ggcgcaggcg tcagggcggg aatgggcagg    311520
     gtagcggtcg tcatagcggc tgtcctgtta cggctcatgg atatcagaaa cccgcctggc    311580
     ggcgtaccag tcgggcggag tattcatcgt tggcgcgttg ctcgcgccgc gcctcgagca    311640
     gagcctgggt gcgcgattcg cgctgcgcca gggtgtcgaa cgaattcagc ttgcgctttt    311700
     gctgctgcca gttgaggcgc ccgtcgttca ggtgcgcctc ggcccggtgc aggacatggc    311760
     gttgctggcc gatggcatcg tccagcgtgg cgatgaagcg ctggtagtta tggcagtcgg    311820
     cggccgacat gcccgactgc atggcggtct gcatgcgttg caggtagtcc tggcgatagt    311880
     cctgcagcat gttgagctgc tgctcggcgt tgttgcgctc ggcgctcagg cggcccagtt    311940
     cgcgggcggc ctcgtcggtg ctgtccttgg ccaggccgat cagcatgtcc agtggcaatt    312000
     ggctaggcat aggcctccct cgtttccagg ctgcgctgca gttgatcgat ggccgtgcca    312060
     tagtccacgc tgtcgccgat gttctgctgc aggtacgctt ccaggcgcgg atagcgcgca    312120
     atcgcgtcgt cgagctgcgg atcggcgccg gccacgtatg cgccgaccga gatcaggtcg    312180
     cggttgcgct ggtagcgcga caggatctgc ttgaagcggc gcacctgctg gaattgctcg    312240
     gtcgtgatca gcgaggtcat ggcgcgcgag atcgaggctt cgatatcgat ggccgggtag    312300
     tggccggcct cggccaggtg gcgcgacagc acaacgtgtc cgtccaggat ggcgcgcgcc    312360
     gaatcggcga tcggatcctg ctggtcgtcg ccttcggcca gcaccgtata gaaggcggtg    312420
     atcgacccgg ccttgccgtt ggggcccggc gcgcccatgc cggtgcgttc gaccagcgcc    312480
     ggcagcttgg cgaacaccga gggcgggtag cccttggtgg ccggcggttc gccaatcgcc    312540
     agggcgattt cgcgttgcgc catggcaaag cgcgtgagcg agtccatgat gagcagcacg    312600
     tccaggccct ggtcgcggaa atgttcggcc aggcgcgtgg cataggacgc gccttgcagg    312660
     cgcagcagtg gcgagacgtc ggccggcgcg gcgaccacca ccgagcgggc caggccttcg    312720
     gggccgaggt tgtgctcgat gaattccttg acttcgcggc cccgttcgcc gatcaggccc    312780
     accacgatga tgtcggcgcg ggtgtagcgc gccatcatgc ccagcagcac gctcttgccc    312840
     acccccgacc cggcgaacag gcccatgcgc tggccccggc cgacggtcag caggccgttg    312900
     atggcgcgca cgcccacgtc gagcacgctg tcgatgggcg cgcgcgacaa ggggttgatg    312960
     ggcagggcgg tcaggggcgc ctgttcggcg ccggccagcg ggcccaggcc gtcgagcggc    313020
     cggcccgcgc cgtcgacgac gcggcccagc atggcgttgc ccaccggcag gtggcggccc    313080
     acctgcggct tggcgttgcc gttgagttcg gccttgcgcg gcagcggcac gggccgctgc    313140
     acggcgggct cggccggcac cacgcgggcg ccgggcggca ggcccgagat gtcgctttgc    313200
     ggcatcaggt aaagcgtgtg gccgtcgaac cccaccacct cggcgtcggc ccagtggtca    313260
     tggccgcgcg ccagctcgat gcggcaggcg gcgcccaccg gcaggcgcag gccggtggcg    313320
     tgcagcacca gtccggcggc gcgcgtgatg cggccgctga ccagccaggg ctcggtcgag    313380
     gcggcgcgga tcgaaccgat ctgcagttgt gtctgccagc ggtcggccac cggcacggcg    313440
     gccgtatcgg ccggcagcgg cagggcgggc gggttcacgc ggtttcctcc caggcggcgc    313500
     tgcggcccag cgaggccgcc acgcggcgcc agcgcgtctg cagggtggcg tccacatcgc    313560
     cgtaggcggt ctcggtgcgg caaccgccgc gcgtgatcga ttcgtcggcc tgcagccgcc    313620
     agttggcttc gttcagttcg tcggccagat gcgtgcgcac cagttccagg tcgtcgggat    313680
     ggacccacag gcgcatggcc gcgccggtgg ccggattgat gtgcaggact tcgcgcaccg    313740
     ccgccaccat cgtctcgggg tgctccgcca gggtggtgcg cagcacctgc ccggcgatat    313800
     ccagggccag cgtcagcagg ctctggccca tgttgtcttc caggcgcgcg accgaggcgg    313860
     cgcaggcctg cgccagcgcg tgcaggcgtt cggcctgctg gcgggcctct tcgcggccct    313920
     gcgccagccc ctcggcatgg ccttcggcgc ggcctgccgc cagtccttgc gcatggccgg    313980
     ccgcgtaacc ctcgcgctgg ccttgctcct ggccggcctg gtggccggcg gcatggccgg    314040
     cccgctcggc ggtggcgcgc cattcgcgca gcagctcctc ggggtccggc gcgggctcgg    314100
     gctcgggttc gagcgccgcg ggttcgggcg tctcggcctc ggccggctcg tcgaacgaca    314160
     gcatctgcca gcggcgccag gcggcgctgc ggggcagggc ggccggctcg cgcgcgaggg    314220
     cctcagacat aggcgtcgtc cccttgcgtg cccagcacga tctggccgct ttcggccagg    314280
     cggcgggcaa tctgcaggat cttcttctgc tcgccttcca ccttggacat gcggatcggc    314340
     ccttgcgcct ccaggtcttc gcgcagcatc tcggccgcgc ggctggacat gttgcgcagg    314400
     aacttgttgc gcagttcgtc gccggcgccc ttgagggcga ccatgagggt atcgttgtcg    314460
     atttccttga ggatgagctg gacggcgcgg tcctcgacgt cgagcaggtt gtcgaagacg    314520
     aacatctcgt cgatgatctt ctgggccagg tcggagtcgc gctcgcgcag gctttcgacc    314580
     acggcctctt cctgcgacga attcatcatg ttcaggatct cggcggcggt gcgcacgccg    314640
     cccatcttgc tgcgcttggc gccctggccg gccagcaccg agttcagcac gtcggtcagc    314700
     tccgagaggg cggccggctg cacgccgccg aaggtggcga tgcgcagcat cacgtcgttg    314760
     cgcatgcgct cgctgagcat ggccagcacg ctggcggcgc ggtcgcgctc caggtgcacc    314820
     aggatggtgg cgatgatctg cggatgctcg tcgccgatca gctcggccac cgtatgcggg    314880
     tccagccagt tcagcgcgtc gatgccgctg ccgccttcgc cggcctccag gatgtcctcg    314940
     atcaggccgg cggcccggtc gctgcccagc gccttggtca gcaccgtgcg gatgtagtcg    315000
     tccgagccca gcgtcacggc catgaactgg tcggcctcct ggcggaattc ctccagcacc    315060
     accgccacgt cgccgcgcgt gacctgcttg aggctggcca tcgccgcgcc cacctgctgg    315120
     acttcgcgcg cgctcaggta cttgaagacc tcggcggcgg cgtcctcgcc cagcgacatc    315180
     atcaggaccg cgctgcgtgt catgccgtcc agcggctttc cgtcattttt catctttgct    315240
     catccacgaa cgcaggacca tggcgacagc gcgcggatcc ttgcccgcca tgtcgcgggc    315300
     gagctgcagg ttgtcttcgt agcggttgac ttcgcgggtg cgcgcggcgg cctgcgcttc    315360
     gcgctcggct tcctggcgct gcgcggcggc cacttcggga tcgacctgcg ggtagaagta    315420
     gtcggtgacc accgggcgga tcttgcggta cagccagaag gccaggatca ggccgaacat    315480
     ccagcccagc gccgtcttga tcatggcgat cagttccggg tcgcgccaca gcggcacggc    315540
     gacaggcgta tcgttgaact ggctgttgac caggttcagc gagtcgccgc gcgcttccga    315600
     atagcccatg gcctcgcgca ccaggttggt cagcttgttc agctcctcgg gcggcagcgc    315660
     ctcggattcg ccttccttgt tgggcaggta gttcaccacc accgccaccg acagccgctt    315720
     gagcatgccc accggctgct tgacgtggct gatggtgcgg tcgacttcgt aattgatggt    315780
     ggcgtcgtgg cggtcgttgc tcggcgccgc ggcgcctggc tgcgtctggg tggtggtggc    315840
     gccggcggcc tgttgctggg cgcgctgctg ctgttgctgc tgcggggtgc cggcgacggc    315900
     gggcggattg acgatgggcg cctgcgcgtt ggccggcggc tggttgctca gcgcgccggg    315960
     cacgccctgc gcggcgttcg gcccggtctg gcgcgaatcg ctggtctgct ggctgcgcac    316020
     ggcggcctgg ccgggttcct ggttgggccg atagacctcg gaagtctctt cgcggcgggc    316080
     gaagtcgatc tcggcgctgg cctgggcatg cacgttgccg gggccgacca gcgggttgag    316140
     gatggtcagg atgcgctcga ccgtgcgctg ctccatttca cgcacgaagc gcaactggtc    316200
     ggcgtccatg ccgcggcctt cgcccagcgg cgccgacagg agccggccgt tctggtcgac    316260
     gatggagaca ttctcggcgg tcagctcggg cacgctggag gccaccagcc aggccaccgc    316320
     cgacacctgg gcgtcgctca ggctgcggcc cggatacagg ttgagcagca ccgaggcggt    316380
     cggggcctgg cggtcgcgca cgaacagcga ctggcgcggc atggccaggt gcacgcgggc    316440
     gtgctgcacg gtatgcatgg cctcgatcga gcgcgccagc tcgccttcca ggccgcgctg    316500
     gtagttgatc tgctcggcga actggctggc gccgaagcgg gtgttgtcca gcagttcgaa    316560
     acccaccgaa ccgccgcgcg gcaggccctg gctggccagc tgcatgcgcg tgtcgtagac    316620
     ccgctcggcg ggcaccagca gcgcgctgcc gttgtcgctg aagcgatagg gcacgttcat    316680
     ctggcccagc gccgagacga tggcgccgcc atcgcggtcg tccagattgg agaacagcac    316740
     cttgtaatcg ggctcgcggc tccacatcgc caccgccgcc accacggcga tcagcgccgc    316800
     cgccgcccca agcaggacag gtttgggcag ggcgcgcagt ttctccagca cgggaaacct    316860
     cgccagcagc gacgcgctca gggttgcctg ctggttcatc ggcggctccc gctggcttcg    316920
     cggtggggat aaacgtacga catggatgct cggggcaggt tacgcatgca acgtgctttg    316980
     ggtgtgggag cgtggattat ggatgggccg cgcgcaatcc caatgcccga aaacaaccgt    317040
     cttttcggcg ctatttgatc cgtatcgttc ctgcgtgcgc ggcacgcggc cgccgggcgc    317100
     catccaagcc gggaagtggc ggcttttttg gcgccttttg cgccctatgc gcaagccctg    317160
     cgcgcgatag tcttgcaacc caggatccgc ttattccgca gaggtatcgc aatggctgta    317220
     tcaggactgt ccggcatcga gagcatgctg tcgcaaatgc gcgccgtggt gcgcgccgcg    317280
     caaagcggcg gcgccaccga ggccgaactg gcgcctgggc cgtccggctt cgccgccgag    317340
     ctgcaacgct ccatccggcg cgtgtcgcag gcgcagaatg ccgccagcga ccaggccaag    317400
     gcgttcgagc tgggcgcgcc cggcatttcg ctcaatgacg tgatgatcga cctgcaaaag    317460
     gccagcctgg gcttccagac ctcggtgcag gtgcgcaacc gcctggtcgc cgcctacaag    317520
     gaaatctcct cgatggcggt gtgacgccgg cgccgcctca ggccggcgcc tggggcgggc    317580
     gggcgcaggt gtggcgcacc gcgctgggaa acagcgaaag cacggcgatg ctgccgtcgc    317640
     caaagcgcag cgtgaccgga ctgtccacgc agaaatggat gcgcgccccg tcggccgtct    317700
     gggcgtgaaa ggccagcggc ggttcgtcct cgtcggccat gcgcgccagc atgacggggt    317760
     cggggcaggc caggtcgagc gggcgccaga aaaaataccc gtccttggca tccggcccca    317820
     ggatgcgcac cggccagggg cgctggtcga tgccggaaat cacgatctgg caatcggggt    317880
     ggcgcagttc ctgcagcgtg ctgcgtatct gatcggactg ggtcagaacg acgatctggt    317940
     cctgggccgt catgcgccgt cctcaggcct gcggcgccag cacttcgggc agctcgcgcg    318000
     cttcgagccg atatagccag gccagcagct cggccaccgc cgtgtagagt tgcggcggta    318060
     tatgggcgtc caggtccacc tgcatcagca ggccgaccag ttcgcgcgat tcatgtacat    318120
     gcaggccgtg ttcgcgggcg gtgcgcacga tggtgtcggc cagctggccg tagcccttgg    318180
     cgaccacacg cggggccgct tcgccgccgt cataggacag cgccacggcg accgggcggc    318240
     tggcgtcgtc ggcggcgggc ggggcgggcg tattcatgct tcgggcagat caaagccggg    318300
     cgcgccaatc gcgtcgaccg acagattggt aagcgtcagg ccggcggccg acagttgctg    318360
     gcgcagcgcg tcggcggcgg cgccgatctc ggcggcgctg tccggggcca cgacgtgcag    318420
     caccagctgg ttggccgcca ggttcaggcg cgcctcgacc gtgcccaggc gcggcaggtt    318480
     gagtttcagg cgggtggccc agtgggtgcc gggctggcct gccgcgtcat cgccatgctc    318540
     gcgcgcgacc tcccattcca tgggtgtgcc gggccaggcc tgcccctgcc atgcgagcat    318600
     ctgattggcc agcacatcca gctgttggcg caccagcagc gtggcgtcct ggtgaatgcc    318660
     gggcaccggc gcgccgggcg tatgcgtggc gggctggcct ggcggcgcgg gttcggccgc    318720
     gggcagggcg cgcgccggcg tcgcgttttc gggcgcgcgt ggcgtggcgg ccggctcggc    318780
     gccggcggcg ggcagccgcg cctgcggttc ggcctgcaac tgctgcacgc tgcgcttgcc    318840
     gaaggccagg tcgctcaggt gggattcata gaacaggccg ctggcctgca gcgtctggcg    318900
     caatgcctgg gccagtgccg gcgcggccgg cagcacggcc cggcccgcca gggcggcgag    318960
     cgtggcgggc ggcgtctgcg cgggcgtcct ggcgcttgcc gcgccggcct gcgccgcttc    319020
     cgggcgggag ggcgtactcg cggcgccgcc ggccgcggcg ctggcctggg caggcgcgtt    319080
     gggggcggcc gcggcaggct ggccgccggc gggcgggctg gcgccatcct gggccggcgg    319140
     cgtccacagc ggcgcgcggg cgcttaccgc cggcgcctgg ccgggatact gcgccagcag    319200
     ggcgagaatg gtgcgcgcgg tctggcccag cgtggtcggt gcggaggccg tcgtgccggt    319260
     gctggtctgc aggccgcggg cggccagcgc cagcgcggcc gcggtcttgg cgtccacccc    319320
     cgcggcgccc tggcgcgcgc cgcgctcgcc gccggcctgt accgcctggc gcggatcgcg    319380
     cgtggctgtc tgggatgcgc cggggcgggc ggcctcgccg ggttgggcga ccgcgtcggg    319440
     gcgtgcgccg gataccaggt tggattgcgc cgacatcgtg gtgcccagta cggcgtcgag    319500
     ccgctgcacc agaatgctgc ccagggcggg cgggccgaca ctcatgtgcc gttggccttg    319560
     ccgctatagg tggccagcag cgactgctgg cgtttcatgc gtcccagcag gtcgctcagg    319620
     cgggccagct gcggcagggc gaggtcgcgc accgccgcgt cgttttcgag gatgcgcacc    319680
     agcaggtcga acttcatgcc gcgggcggct tcgtccagcg gctcgcccgg ttccagctcg    319740
     cgcagccgct ccaccaggca gacatattcc tggccgtggt tcaggaccag gtcccaattg    319800
     ctggcattgg ccgccgccag catcctgctg gtcaggttgg caatgtcctg gtaaatctcc    319860
     aggaccgggg catgctgcgt taacgccgtc atagatttct cgcgctgggg gcggctggac    319920
     aaaaagtgcc ttcctggttt caggccggaa cggcaggcgc tgggtggtcg accgaggcct    319980
     gccatgcttc ggacagatcc gccagcaagc ggtccgcgat gtcgagctgt tccttgtcgg    320040
     ccttcaggtt ggcggtcagc agcgtacggg taatgtagtc atacaggcgc gccaggttgg    320100
     ccgccacctc gccgccggca tcctggttca gccccagctt caatccctcg tcgacgatgc    320160
     ggatggcctt gccgatggcc tgtccgcgct cgacgatgcg gccggcctcg agatgcaggc    320220
     gggcctgggc gatggcggcg cgcgccccgg catacagcaa ggtgatcagg cgctcggggg    320280
     tggcgctcat gacctgggtt tccaggccga tatcgctgta tgacttgaca gagtaggagc    320340
     cggtggggcg gcgcgcggcg tacgtcatgg ctggcttact tcttggtgcc ggacagggcg    320400
     gcgaactgtt gggacaggta gttgctggtg ttgttcatct gcgtgacgaa gacatcgagc    320460
     tgcacgaact gcttgcggta ggcctcgatg gtcgcggcga tgctcagttt ctggcggtcg    320520
     tactggttct gcagcgactc gagcgtttcc tccaggcctt cctggcggat cttgatcgag    320580
     ccctcgtcgc cgaggatctg ctcggtcgcc agcttcacct tttcgcccag gccgaacgga    320640
     cccgagaaaa tgcgcgccac gtcggccggg ttgtcgcgca gggcggcttc cagcttttcg    320700
     gtatcggtct tgagcgagcc ggtcttggga tcggtggtga tgccaagctg gctcagcgtg    320760
     cgcagggtgc cctcgccggt ggccacgcgc agcgccgcgg cgatggccga ctggatgttg    320820
     cgggtggtgc cgtcgccggt cagggcgctc tgtttctccg ccttgacgtc gaatgccgtc    320880
     aggtccgcga tggtggtctg caggccgttg taggccttga cgaaatcgtt gacggccgtg    320940
     gcggccacgc tcgggtcgct ggagacggtc acggtcagcg gcgccgcggt ctgcttggtc    321000
     agggtcagcg tcagcccgtc gatggcggtc tcgaccgtat tggtgtcgct gaccacgggg    321060
     atgccgttga tggtcagctc ggccttctgg gcggccagct gcaccgtcag attggaggcg    321120
     ccggcgttgg ccgcgtcgaa gtcgagaatg tccgcgactt cctggttgcc gctcaccgtg    321180
     atccgggtga ccgcggcttc ggtgccttcg gtcttgttgt tcagcatcag gtagtgcttg    321240
     ccattgccgt cgctgatgac ggtggcgcgc acgtccaggc cgtcggtgcc gttgatggcc    321300
     ttgacgatgc cgttcagcga cgtgtcctcg cccagcgtga cggtcgtggt cgtgccgtcc    321360
     ttctggacga tctcgatcga gccgcccgtg ccgtgcttgt ccgtgcggct gtccagctcg    321420
     cccgactgca ggttctgcgc ggtggccagc ttgtcgatgt tgacggtgta ttgacccggc    321480
     acggcgccgg ccgcggtctt caccgacagc ccgtcgccgg agaccacggc cttcacggcg    321540
     ctgagcgtgt cgatgctgcc gagcgtggcg gcggccttct ggacggcctc gaccgcggcc    321600
     tggatcttgc tgtaggccga aatgcgcgtc tcgtagctcg cctggcgcgc ggtgatcagc    321660
     gtcagtttct tctcttcggc tgcctgcagc ttttccagga tgccctcaag ctccaggccg    321720
     gaggacccga gagaggaaat ggtggccatg tggtgctcct tctagctatg cgattctgtc    321780
     aaaaattggc gccgcctatt ggccgggtaa aggcataagg tcgggctatt tccttgctta    321840
     cgccgctttt gccccattct ggtgcacgcg cgcagcgcga tatgctgcct caggccgtgg    321900
     tctcgacggc attgccctgc atcttgacga tcatcttggc gatgcgtatc accgcctcgg    321960
     acggaatggt gcgcagcaca tcccccgttt cggcgtccac gatcgagacc accacctggt    322020
     gcacgtccgg gtcgatctcg aactgcagct gcgtggacca ggccttcaac tgcgcattga    322080
     tttcctccag cgcccggtcc atcggcagct tgggcgcgcc gtactggtcc tgcgtggcgg    322140
     attgggcgcc gccgccgttg gcggccgcgg cggcaggcgc cacggcggcc gccggctgtg    322200
     cggggacagg ggcgggcgcg gcggaaacca gcgcgggcgc cgcggcgttg atagggctta    322260
     cggccatgat cactccaaca agcgataacg ggcgtcgaaa gggacgcgat gggttttcga    322320
     gggaaccttc agctaccata acgacacgct tgcgccgaac tttagacccg gggcgctttt    322380
     tttggggccg gatccttttc catcccgctg cgcgggtgtc cccgaacggg gaccggcacc    322440
     cgctggcttc ccaggtgcct gcccgtgcgg tgcgcctgtc ccggcgcaga caggtaccgt    322500
     cttggtggtc aagcgctcat ggcgtagacc agtgtgcctg tcccggcggg gacaggcaca    322560
     ccctgccgca cgccatcgac gcttgagggc caagaaggta tcggtccctg ccgggccgcc    322620
     gcggcgccgg gcgcgtcggg atttcgagtc cggctccgcg tttccgtccg aaagaccccg    322680
     cgcgccgagg gcgcttgggg aaaacaccaa ggccacgctg ctaaactgcg ccctgtttcg    322740
     atttgccttc atcgccatgt ccacctcccg ccccgacgcc agcgcagacc tgcctgcctg    322800
     gctgcagtac ctggaatcca tccacgccaa ggccatagac ctggggctgg accgggtgcg    322860
     gcaggtggcc ggccggctcg acctgagcct ggacggggtc aagttcatgg tgggcggcac    322920
     caacggcaag gggtccacct gcgccatgct cgaatccatc ctgctggccg cgggctaccg    322980
     ggtgggcctg tacacctcgc cccatctcat cgatttcaac gaacgcgccc gcatcaacgg    323040
     cgaaatcgcc agcgacgcgg cgctggtgca gcagttcgag gcggtcgagg ccgcgcgcgg    323100
     cgatatctcg ctgacctatt tcgagttcac cacgctggcc atcctgcgcc tgttcgcgca    323160
     atcgcgcctg gacgccgtgg tgctggaagt cggcctgggc ggccggctgg acgccgtcaa    323220
     tatcgtcgac gccgactgtt ccatcatcac cagcatcgac ctggaccata ccgactggct    323280
     gggcgatacc cgcgagaaga tcggcttcga gaaggcgcac atctaccgcg cggggcgtcc    323340
     cgccatatgc gccgatccgg tgccgccgca atcgctgctg gaccacgtgc aggcgatcgg    323400
     cgccgacctg tggctgctcg gccgcgacta caactattcc ggggaccgcc agcaatgggc    323460
     ctacggcggg cgggcgcagc ggcgcaacgc gctcgcctat cccgcattgc gcggcgccaa    323520
     ccagctgctc aacgcggccg ccgcgctggc cgcgctcgaa gccgtgcgcg accgcctgcc    323580
     ggtgccgcag caggcggtgc gggtggggct gctgcaggcg tcgctgccgg gccgcttcca    323640
     gatcctgccc gggcagccga ccgtcatcct ggacgtggcg cacaatcccc atgccgccgc    323700
     ggtcctggcc cagaacctcg acaacatggg gttccatccc tatacgcacg ccgtattcgg    323760
     catgctggcc gacaagaacg tcgatggcgt catcgccagg ctgggcagcc gggtcgacca    323820
     ctggtactgc gccggcctgc cgggcccgcg cgggctggat gggcaggccc tggccggtca    323880
     tgtgcgccag gtgctgcccg aggcggaagg cgccgccgaa acgcctaccg tgcaggcctg    323940
     cgccgacccc gccgcggcct atgcggcggc gcgggaaaag gcgggcgagg gtgatagaat    324000
     catcgtgttc gggtcatttc tcacggtggc ctccgtcctg caggcgctgg gccgcaaaat    324060
     ctaagcggat cgcgccagcg caagggcggc gcgcaccggc cccgcccgca aggaattctg    324120
     ctccatggga ttgttcacta gcaaagattc ggcctccgag acgcagtcct cgcgaccgcg    324180
     tccatccgta tccagcgagg cgcaggccgc cgagctgcgg gcccgggcca ggcgccgcct    324240
     ggcaggcgcc gtcgcattgg tgctcgccgc ggtcatcgtc ctgcccatga tcctcgactc    324300
     cgagcccgtg ccggtcgaca gcgacatccc catccgcgtc ccggaccgca attcggcctt    324360
     ccagcccacg gtcaacgatc cgcaggccgc cgcgccgcag ccggaacagc ctgcgccgca    324420
     ggcgccggcc ggcacgcccg aggcgggcgc gccgcagccg cccgcgctgg cgtccgcgcc    324480
     gccgcagacg ccgcctccgg gccagacgcc ggcccagccc cagacgccgc ccgcggccca    324540
     gccgccggcc acgccgccgc agcaggccgc cacgccgccg gccgcgccca agcccgaggc    324600
     caagccggaa cccaagcccg ccaagccggc ggcgccggcg cgctcggacg acggcgcgcg    324660
     cgcgatggcg ctgctggagg ggcgttcgcc gccgccggcg cagcccaagc cggccgccaa    324720
     cggcaatttc gtgctgcagg tggcttccta taccacgcag gccgatgcgc aggcgcgccg    324780
     cggcaagctg caccaggccg gcgtcaccaa tgcattcgtc gagcaggcct cgatcaacgg    324840
     caagcaacag tatcgactgc gcgtggggcc gttcccctcg cgcgaggcgg cccaggcggc    324900
     gcaggcgcgc ctgcgcacgc tgggctatga caacggtttc atcgccgcac agtgaccggc    324960
     ttcgatttcg tcgtcctgac gatcctggcc gtgtcggccg tgctggggct ggtgcgcgga    325020
     ctgctcaagg aaattctgtc gctgcttgcc tatctgctgg cgttcgtcgc ggcgatctgg    325080
     tgggggccca cggtctatgt ctggcttgaa ccgtatatcg aaaccgcgct gctgcgcatg    325140
     ggcatcgcct atgccgtggt gttcatcatc gtgctgctgg ccgtcggcct ggtcaacatg    325200
     acgctcgccg ccctgatccg caccaccggc ctgacgccgg ccgaccatgg cctgggcgcg    325260
     atgttcggcc tggcgcgcgg cctggtgctg gtgctggtgc tggtggcgct ggcgggtttc    325320
     acgcccttgc cgcaggaaga ctggtggcgc gacgccatgt tctcgcactc ggccaccgag    325380
     gccgtccggc aggtcaagtc ctggctgccg ccctcgctgg cgacgtggct gccttactga    325440
     attcgctttt cgctttacgc tttatctact aggaactcac catgtgtgga atcgtcgggg    325500
     tcattgggcg cgggccggtc aaccagctgc tctatgacag cttgctgctg ctgcaacacc    325560
     gggggcagga cgcggcgggc atcgccacgc tgcagggcaa ccacttcaac atgtacaagg    325620
     cgcacggcct ggtgcgcgat gtgttccgta cccgcaacat gcgcgcgctg ccgggcacca    325680
     gcggcgtggg ccaggtgcgc tatcccaccg ccggctccag cgccagcgag gaagaggcgc    325740
     agccgttcta cgtcaatgcg ccgttcggca tcatgttcgc ccacaacggc aacctgacca    325800
     actggcgcga gctgcgcgag tcgctctacc gcgtcgaccg ccgccacatc aataccaatt    325860
     ccgattccga agtgctgctc aatgtgctgg cgcacgagct gcaatcggcc gccagcggcg    325920
     tgtcgctcga cgatgacacg atctttcgcg ccgtctccgc ggtgcaccag cgcgtcaagg    325980
     gcgcctacgc cgtggtggcg cagatctcgg gctacggcat gctggcgttt cgcgatcccc    326040
     acggcatccg gccgctgtgc atcggccgcc aggagaccga ggaaggcgtg gaatggatgg    326100
     ccgcctcgga atccgtggcg ctggaaggca gcggttttgc cttcgtgcgc gacgtcgagc    326160
     ccggcgaggc gatattcgtc gacctcgacg gccgcatgac cagccgccag tgcgccgaca    326220
     atgcgcaact ggtgccgtgt atcttcgagt acgtgtactt tgcccgcccc gattcgctga    326280
     tcgacggcgt ctcggtgtac gacgcgcgcc tgcgcatggg cgaatacctg gccgacaagg    326340
     tcgcgcgcag catgcgcctg ggcgatatcg acgtggtgat gccgattccc gactcgtcgc    326400
     gcccggccgc catgcagctg gcgcaccggc tggggctgga ctatcgcgaa ggcctgatca    326460
     agaaccgcta cgtgggccgt acgttcatca tgccgggcca ggcggtgcgc cgcaaatcgg    326520
     tgcgccagaa actgaacgcc atcggcatgg aattcaaggg caagaacgtg ctgctggtcg    326580
     acgattccat cgtgcgcggc accaccagcc gcgagatcgt cgacatggcg cgcgcggccg    326640
     gcgccaacaa ggtgtatttc gcctccgcgg cgcctccggt gcggttcccc aacgtgtacg    326700
     gcatcgacat gccgacccag aaggaactga tcgccaccgg ccgcaccgat gacgaaatcg    326760
     cccgcaccat cggcgccgac gcgctgatct accaggacct gcaggacatg cagcaggcgg    326820
     tgcgtgacat caatccgcgc ctgagccgct tcgaggcatc gtgtttcgac ggcgagtacg    326880
     tgaccggcga catcaccgcc gaatacctgg cccgcctggg ccagtcgcgc gacagcagcg    326940
     ccggcgacga agaggccggc ggcctgcagt tcaacatggg ctacgcggcc aacgacgcct    327000
     gaccggcgcg gcgcggccgg cttgcgcaag ccggccgcgc ggccgtcagg cgttgcgccg    327060
     caacgccgcc ggcagggcca gcgccagcac gatcacgaac agcgccaggc tccatatcgc    327120
     atactcgatg cccagcaccg ccaccgtggc gtccatgcag gtggcataga tgccgaacag    327180
     ccagggcagg gcgccgtcca gtcccgtggc gctcatgaaa cgatcggcga aggtctggtc    327240
     gcacgacagc atcttggccg ccacgctgta ctggtaccag gcggcgacga tgccgcagat    327300
     ggccagcagc gccgccagca tggcggccag gcgcgccgcg atggcgccgg ccagcgcgcc    327360
     ggccagggcc accacgccga tgcacaggta gatcagccgc tgcagcacgc accaggcgca    327420
     cggcggcata tcgaagacat gctgcgacag cagggccagg cccacggcgc caaagcacag    327480
     gatggcgatc aggaaaagca ggcgttcgcg gtatcgggtc atgggggcag ggacgggaaa    327540
     cggaaagggg cgggcggatg gccgcgccag ggttaggccg gcggcgccgc aataggttgc    327600
     atgatctgcc gcatgacgtc cagcagcagt tcgctcgcgc cgctccagaa gatctgcacg    327660
     cccaggcaca gcatgatgaa cgccgacagc cgcatgaaca cggcggtgcc gttgtcgccc    327720
     agccggtgca gcatctgcgc ggcaaagcgc aggcagatga acagggtgaa ggccaccagc    327780
     gccacgccgg gcagcgagcc ggccaggcgc gccaggctga gcatgtggtt ttcgtcgcgc    327840
     agcgacgcgc ctaccgtgat gcaggcggcg atggtgccgg ggccgcagct gatcggaaag    327900
     gtgagcgggt agaaggcgcg cgcctgcgcc atctcgggcg tgaacgattc ggccatctgg    327960
     gcgtgccgcg acgtatcggc atcgggcgag ttgaccagcc gccaggcgct gtagatgacc    328020
     agcatgccgc cgcccacgcg tacgatggcc agcgaaatcc cgaagaaact gagcaccacg    328080
     ttgccggcga tcatggcgcc gatcatcatc aacgccacgt tgatggccac gcgcttggac    328140
     agctgggcgc gggtctgctt ggacgcgccc tcggtcagcg tccagaagat cggcgtgatg    328200
     gccggcgggt tgagaaacgg cagcagcgtg gccagggcaa agaagaagct gcgtccgaaa    328260
     accagcaggt actcgttgta tggcatggcg gcgggggcgg tggcggggtg aaggccgcgg    328320
     ccgttcaggc ggcctgctgg cgcggctcgt cgccggccag cgcgtccagg atggcgcgtt    328380
     cgaactgcat ctggctgcgc gggcgctcca gcgccgagcc cgacacgatg aacacgtcct    328440
     cgacgcgttc gcccagcgtc atgatcttgg ccatgatcag gtccacgccg tgttcggcga    328500
     atacgcgcgc cagcgcgtac agcaggccgg gccggtcggt cgcggtgacc gacaggcgcc    328560
     aggactggct gcgttcgtcg ggcgagagct cggcctgcgg catgaccgga aacacccgcg    328620
     agcgccgggc gtggctgtgc ggcaggcgcc gtggcgcatg tgcgtgccgg gcggcgtgcg    328680
     gatcgcgcag gcgttcggcc agctcgtgct ccaccagggt ggcctgggcg cgcaggtcgg    328740
     cgaagccctc gggcgccagc acgatgaagc tgtccagcgc ccagccgtgg cgggtggtgt    328800
     gcacgcgcgc atcctgcacg ctgagcgact tggcgtcgaa gtagccgcag gtcgtcacga    328860
     acagatccgg cgcgtcgcgc gtgtagacca tgacctgcag cccctcgccg tgctcggtgg    328920
     ggcggacccg caccaccggc tcgtcgggcg ccacctggta atacaggtgg cgcgtgtgcc    328980
     aggcgatctc ggaggcgtcg tggcgcagga agtaggcgat gtccagctgg ttccagaagg    329040
     cttcgcgggc gtcgtcgcgc aggcccgcca ggcgggtcag gcgggccgcc tcgtccttgc    329100
     gctcggtcag cacggtgtgc gcgtcggcgt gcgcgccgcc cagcgccgcc agggtcaggc    329160
     ggaaaaggtc ttccagcagc ttgcccttcc aggcgttcca gacgcgcggg ctggtgccgc    329220
     ggatgtcggc cacggtcagc aggtagaggg cggccaggcg gcgttcgtcg cccacctggg    329280
     cggcgaagtc gcgcaccacc tgcgggtcgg acaggtcgcg cttctgggcg accgccgaca    329340
     tcagcaggtg atggcgcacc aggaactcga ccagctcggc atcggccgga tccaggccgt    329400
     ggtcctgcgc gaagcggcgc acctcgcgcg cgcccagttc ggaatgatcg ccgccgcggc    329460
     ccttggcgat atcgtggaac agcgccgcga catacagcag ccagtggcgg tccaggccgg    329520
     cgatcagctg gctggccagc gggtattcct gggcgtgctc gggcatggtg aagcggcgca    329580
     ggttgcgcac gaccgccagg gtgtgctggt cgaccgtata gacatggaac aggtcgtgct    329640
     gcatctggcc gacgatgcgc cggaacaccg gcaggtagcg tggcaggatg ttgagcatgg    329700
     tcatgcggcg caactcgtgg acgatgccgc gcggctgctg caggatctgc aggaacagct    329760
     tgcggttgac cggattgcgg cggaactgcg cgtcgatgcg gtggcgcgaa tgccagatgg    329820
     cgcgcagcgt gcgggccgac atgccgatca gttccggatg ctgctgcatc accaggaagg    329880
     cgcgcagcag cagcgtcgga ttgcgctcga agccatcctc gcgcacgatg tccagccgct    329940
     cgcgcaggtt gcggaaatcg tcgtcgatca ggcgcgcgtc gctgtccggg cgcgggaaca    330000
     gccgttcctc gatgttctgt accaggatga cattgagctg ggtcaccagg cgcgcggccc    330060
     agtaataacg ctgcatcagc agttcgctgg cgcgccgcgt cgccgtcgac gcaatgccat    330120
     agaccgcggc caggcccggt tgcaggtcga acaggacgcg gtcttcgcgc cggcccgtca    330180
     gcaggtgcag ctcgatgcgc aggcgcttga aggcctgttc ggcgcgccgc aggtcgcgcg    330240
     cttcggacga ggtgagcaag ccggcctggg ccacctcgcg ccagctgtgg ccgaagccgg    330300
     cggcgcgggc catccacagg atgacctgca ggtcgcgcag gccgccaggc gactccttgc    330360
     aattgggttc cagcgcgtag ggcgtgtcct ggtagcgggc gtggcgctgc tgcatctcca    330420
     cccgcttggc ctggaagaac accgccgcgt ccagccgtgc ctgcatggcg ctgtccaggc    330480
     gcttcatgag cgtgcggctg ccggccagcc agcgcgattc cagcagcgcc gtctcgacgg    330540
     tgatgtcgcc gcgcgcctcg cgctcgcagt cttccagcgt gcgcacgcta tggccgggtt    330600
     ccaggcccag gtcccacagg gcggccacca atgcctcgac cgcgcgcgca tcggccgccg    330660
     acgggggctg cggcagcagg atcagcaggt cgacgtcgga atgcggatac agttcgccgc    330720
     ggccatagcc gccgaccgcc gccagggtgg cgccggccgg cagcggacac agcttgacca    330780
     gctcgcgcag cgcctggtcg acgatgcgcc gcaattcggt cagcagcatg tccggccggg    330840
     gatgctggcg aaactgcgcg acggctgccg cccgggcggc ctgcatgcgc tgcttcagcg    330900
     gattcagatc gacgtggggc atggggcagc cttgccgcgc ggcggcgggg gtcagagagc    330960
     cgggatttcg accggccgtg tcacgaaggc cggcggggcg ggcatgccgg gcgagaccgt    331020
     cagcacttcg tagccggtat cggtgaccag caccgtgtgc tcccactggg ccgacaggct    331080
     gtggtcgcgc gtcaccaccg tccagccgtc ggccagctgg cggatttcgc gccggccggc    331140
     gttgatcatg ggctcgaccg tgaacagcat gccggtcacc agcttgacgc cggtgccggg    331200
     cttgccgtag tgcagcacct gcgggtcttc atggaagcgc tggccgatgc cgtggccgca    331260
     gaattcgcgc accaccgaga aaccctgcgc ctcggcgtac ttctggatgg catggccgat    331320
     atcgcccagc gtggcgccat tgcgcacctg ttcgatgcct ttccacatgc agtcgtaggt    331380
     gatgtcggtc aggcggcgcg acaggatcga gggctcgccc acgtgataca tgcggctggt    331440
     atcgccgaac cagccatcct tgatgatggt gacgtcgatg ttgagcgaat cgccgttctt    331500
     gagcaccttg tcgcccggta tgccatgaca gacctggtgg ttgaccgagg tgcagatggc    331560
     gccggtgaag ggcgggtagc cgggtggggc gtagcctatg gtggccgact tgaccttcag    331620
     ttcgtcggtc aggtaggcca ggcacagctt gtccagctcg cccgtcgtga cgcctggttt    331680
     gacgtacggc gtaatgaagt cgaggatttt ggcggcgtct tggcaggcgg cgcgcatttt    331740
     ggccagatcg gccggatcgg taacgatgcc catgtatcag cttgagtggc gcggtcgaaa    331800
     aatagtagaa ttataggctt gcctggaaaa gcacgccctg tcttggcccg gaatgtgatg    331860
     tcgaacgtga tttgtcttgc gcgatgatag gcgcgaggac aggccggttg aaagagcagg    331920
     gcaggcaggc aagtagcaaa gcagtaagtg taaggctata cggtttgtct tgcgttcgca    331980
     cggagtcttg cccggtgttt tgggcgattt gtgcggggcg aggcgggccg gatgggccgg    332040
     atggctggga aagggtagac tggctttggc ctgcggttgg cgcgttgcgc ggtatcgcgg    332100
     gttgatgtgg caccattttc tcgatcgacg ctttagagca gcggtgcagg cgcggtgtgg    332160
     gcgcccggct taagttcttg gcggctcgcg ctggcgggct gcctgaagaa ctgccccggg    332220
     atcctgattc cagcggcccg attccgctgc caacaaggca gccagctggg ggcgacaatg    332280
     tcggccgcca gcgcggatcg agacaggtgg cgccggccgc gtgcgcccgc gaccgtctgg    332340
     gttcattgct gcgtccctgg tttggggcgc ggcgatcggt cggctcggtt tgtttttttt    332400
     atttcatcct gtttgtcagg aaatcgcgcg ttatgccacc cagggtgtcg gttttatccg    332460
     atgcaggtgt agcgcaagac ttaaccctcg gagatagtta tgtccctcat gcgtgaaatg    332520
     ctggaagctg gcgtccactt cggccaccag acccgttact ggaaccccaa gatggccccg    332580
     tacatcttcg gtcaccgtaa caagattcac atcatcaacc tcgagcagac ggtcgccaag    332640
     taccaggaag cctcgaagtt cgtcaagcaa ctggtcgccc gtggcggcaa catcctgttc    332700
     gtcggcacca agcgcgccgc gcgcgaactg gtggcaaccg aagccgcccg ctgcggcatg    332760
     ccctacgtcg acgcccgctg gctcggcggc atgctgacca acttcaagac ggtcaagagc    332820
     tcgatcaagc gcctgaagga catggaagcc atggtcgccg acggcggctt cgagcgcatg    332880
     accaagaagg aaggcctgct gttccagcgc gaactggaca agctgaacaa gtcgatcggc    332940
     ggcatcaagg acatgaacgg cctgcccgac gcgctgttcg tcatcgacgt cggctaccac    333000
     aagatcgcgg tcgccgaagc caaggtgctg ggcatcccgg tcgtggccgt ggttgatacc    333060
     aaccactcgc ccgacggcat cgaccatgtc attcccggca acgacgactc ggcccgcgcc    333120
     atcgcgctgt acgccaaggg catggccgac gccgtgctgg aaggccgcga gcagaacatc    333180
     aatggcctgg tcgaggaaat cggcgaaggc caggaagagt tcgtcgaagt gcaggacaac    333240
     caggcctgat agccggttgc cgcgccggcc gggccggcaa gcctcgggcg ctgggcgccc    333300
     gggctgccgc ccggatgccg gcgccgaggt gggctcccgc ctcacgaccc gcccaggcgg    333360
     gtgccatatc gaatcaacca tatgtcccgg ttcatgcttg ccgggccatg tcttagcgaa    333420
     tttggagcaa acatggctga aattaccgcc gccctggtca aggaactgcg cgagaagacc    333480
     gatgcgccca tgatggagtg caagaaggct ctgaccgaag ccgaaggtga tctggcccgc    333540
     gccgaggaaa tcctgcgcgt caagctgggc aacaaggcca gcaaggccgc cgcccgcgtg    333600
     accgccgaag gcctgatcgg cctgtacatc gccgccgacg gcaagcaggg cgccgtcatc    333660
     gaagtcaact gcgagaccga cttcgtcgcc aagaacaccg atttcatcga tttcatcaac    333720
     aagctggccg agctggtcgc cacgcagaat ccggccgacg tggccgcgct gtcggcgctg    333780
     ccgttcggcg aaggcacggt cgagaccacc cgcaccgcgc tggtgggcaa gatcggcgaa    333840
     aacatctcgg tgcgccgctt cgagcgcatc cagaccccga actcgctggc cagctacgtg    333900
     cacggcggca agatcggcgt actggtcgag ttctccggcg ccgaggaagt gggcaaggac    333960
     ctggccatgc acatcgccgc gaccaagccc aaggccctca atgccgacgg cgtcaacgcc    334020
     gaagacatcg ccgccgagcg ctcggtagcc gaacagaagg ccgccgaatc gggcaagccc    334080
     gccgaaatcg tcgccaagat ggtcgaaggt tccgtgcaga aattcctgaa ggaagttact    334140
     ctgctgtcgc aacccttcgt caagaacgac aagcaaacga tcgaacagat gctcaaggaa    334200
     aagggcgctt cgatcaccaa gttcgttctg ttcgtcgttg gtgaagggat cgagaagaag    334260
     accgccgatt tcgcttccga ggtcgccgcc gccgccgctg gccgcgcctg acgcgtcatc    334320
     gtaggggccg gccaggacgg ggcttcccga actgccggcc tatttcttgt cttacacttt    334380
     cgtcggatcg tttctcggga tatcacctat gagcagcaga tcatataaac gggttcttct    334440
     caaactttcc ggcgaggcgc tgatgggcga agatgccttt ggcatcaatc gctccaccat    334500
     cgtccgcatg accgatgaga tcgccgaagt cgccgcactg ggcgtcgaac tggccatcgt    334560
     catcggcgga ggcaatattt tccgtggcgt cgccccgggc gcgcagggca tggaccgcgc    334620
     gaccgccgac tacatgggca tgatggcaac catcatgaac gcgctggcgc tgcaggacgc    334680
     gctcaagcac aagggcgtcg acacgcgggt gcagtcggcg ctgaacatcg accaggtggt    334740
     cgagccctac atccggccca aggccctgcg ctacctcgaa gagggcaagg tcgtgatctt    334800
     cgcggccggc accggcaacc cgttcttcac caccgatacc gcggccgcgc tgcgcggtgc    334860
     ggagatcggc gccgaaatcg tgctcaaggc aaccaaggtc gacggcatct acagcgccga    334920
     tcccaacaag gatccgaccg cgacccgcta cgcgcgcatc agcttcgacg aagccatcgt    334980
     gcgccggctc gaggtcatgg acgccacggc gttcgcgttg tgccgtgacc aaaagctgcc    335040
     catcaaagtg ttttcgatca acaagtccgg cgccctcaag cgggccgtca gcggcgaaga    335100
     cgaaggcacg ctggtacacg tttaagaaaa ggaaattcca tgagcgtcgc agatattcgt    335160
     aagtccgctg aaaccaggat ggccaaatcg cttgaaacgc tcaaggcgag cctggccaag    335220
     attcgcacgg gccgcgccca taccggcatc ctggatcacg tgcaggtcga gtactacggc    335280
     tcgccggtgc cgatcagcca ggtcgccaac gtgaatctcg tcgatgcccg caccatcagc    335340
     gtgcagccgt acgagaagag catggcgggc ccgatcgaaa aggcgattcg cgagtcggac    335400
     ctgggactga atccggtctc gatgggcgaa accatccgcg tgccgatgcc ggccctgacc    335460
     gaggagcgcc gccgcgacct gaccaaagtg gtcaagagcg aaggcgagga cgccaaggtg    335520
     gcggtgcgca acctgcgccg cgaagccaac gaggcgctca agaagctggt caaggacaag    335580
     gaaatctccg aggatgacga gcgtcgcgcc caggatgatg tccagaaact gactgaccgt    335640
     gccgtcggcg acatcgacaa gatgatcgtc cagaaagaag cggaaatcat gaccgtataa    335700
     ttccggttga ggtatcgggg ccgtatcgac ggctccggtg tcgatatcgg aatctgttcc    335760
     gtacgcgccg tcccggccgc gctggtcctg tcggatttgg cgcaggcgcg acggcgcagg    335820
     cttttgcaat acctttttgc ttgccgcctt gcgccaagct ccagccatgg cactcagttc    335880
     gactcaggcg attccggaaa cgggggacat ccccaggcac gtagccatca tcatggatgg    335940
     caacggccgc tgggcgacgc gccgccacct gccgcgcacg gcagggcacg ccaagggcgt    336000
     gcacgcggtg cgccgcgtgg tcgaggcctg cggccggcgc ggcgtgcgct acctgaccct    336060
     gttcgcattc agttccgaga actggcgccg tccggccgac gaggtgtcgc tgttgatgcg    336120
     gctgttcgtg caggcgctcg agcgcgaagt cgacaaattg caggaccagg gcgtgcgcct    336180
     gcacgtggtg ggagacctga gcgcgttcga gcccaagctg caggaactga tcgcccaggc    336240
     gcaggaacgc accgagcaca acgaccggct gcacctgacg gtggcggcca attacggcgg    336300
     ccgctgggac atcctgcagg ccacgcgcgc catgctgcgc gccgatccgg gcctggccca    336360
     ggatcccgac cgcatcgacg aggcgcggct ggccgagcat ctttcgatgg cctgggcgcc    336420
     ggaaccggac ctgttcatcc gcaccggcgg cgaacagcgc atttcgaact tcctggtctg    336480
     gcaactggcc tacgccgaat tctatttcac cgaacaattc tggcccgatt tcggcgccga    336540
     cgagctcgat gccgccttcg agtggtatcg cacgcgcgag cggcgcttcg gccgcaccag    336600
     cgcgcaattg cgcggcggcg ccaagcgctg acccccaagg agacgtattc atgctgggcc    336660
     agcgcatcat caccgccgcc gtattgcttg ccgtcctggc cttgacgctg gcgctggcca    336720
     acccgtggtg gttcgtcgcc ttgctggcgc tgggcgcggc ctgcgccgcc tgggagtggc    336780
     tgcgcctgac ggtgcgccag cccccctcgg gtgcgctgtg cgtcggcctg gcggcggcgc    336840
     tgctggcggc gatgctggcc atggcgcagg cctggatcca gggaggcgtg tccggcctgc    336900
     ggctcgaggt ctgggtcggc tactggctca ccccggcggt cgtggccgtc tggctgctgg    336960
     gcgcgggcac ggcggtcgcg cgcggccgcg ccgacgcgcc ggcggccagc ctgggctgga    337020
     cgctgttcgc cattcccgcc gtgctggccg cctggtcggt gttggcgctg atgtatctgt    337080
     cgcgcggcgg cgcctatgtg gtgtcgctgc tggcgctggt gtgggtggcc gatatcgccg    337140
     cctatttcgc cggccgcgcc ttcggcaagc gcaagctggc gccgcgggtc agcccgggca    337200
     agacggtggc cggcgcggtg gccggcgtgc tgggcgcggt cgcgtggatc gccctgagca    337260
     gccaatggga tggaacttat ggccaggcgc tggtcgaacg ctggtcctgg tggctggcgt    337320
     tgccggcggc cgccttgctg ggcgtcgtct ccatcgtcgg cgacctgttc gagtccttgc    337380
     tcaagcgccg cgccggccgc aaggattcca gcgcgctgct gcccggccac ggaggcgtct    337440
     atgaccgcat cgacgccatc ctgccggtgg cgccgctggc gttgctcatg tctggagtgt    337500
     tgttttgacc cgttttcaac gcgtcgccgt cctgggatcg accggatcga tcggcgacag    337560
     tacgctcgac gttatcgcgc gccacccgga tcggctgggc gtgtatgccc tgtcggccta    337620
     tagccgcatg gacaagctgg ccgcccaggc ggccgcctgc ggcgccgccg tggtggtcgt    337680
     gcccgacgat gcggcggctg cgcgctttcg cgccgcctgg cgcggcaagg ccgccatgcc    337740
     cgaggtgcgg gtcgggccgc gcgcgctggc cgagacggcc gccgcgcccg agtgcaccac    337800
     ggtcatggcc gccatcgtcg gcgccgccgg cctgccggcg gccctggccg cggcgcaggc    337860
     cggcaagcgg gtgctgctgg ccaacaagga agcgctggtg gcggccggat cgctgttcat    337920
     ggcggccgtg cgcgagaacg gcgccgaatt gctgcccatc gacagcgaac acaacgccat    337980
     cttccagtgc atgccgcagg gcgcccgggc ggccgcgccc accgcgcccg cgcccggcgt    338040
     gcggcgcctg ctgctgaccg cctccggcgg cccgttccgg cgccaggacc cggccgacct    338100
     gcacgaagtg acgccggccc aggcctgcgc acatcccaac tggagcatgg ggcgcaagat    338160
     ttcggtcgat tcggccacca tgctgaacaa gggactggag gtcatcgagg cccattggct    338220
     gttcgccatg ccgtccgaac gcatcgacgt gctgatccat ccgcaaagcg tcgtccattc    338280
     catggtcgag tacgacgacg gctcggtgct ggcgcaactg ggacagcccg acatgcgcac    338340
     gcccatcgcc tacgggctgg gctttccgga gcgcctggcc agcggggtgg ggctgctgga    338400
     cctgacgcgc tgggggcggc tggatttcga gcagcccgac ctgcagcgct tcccgtgcct    338460
     ggcgctgtcg ttcgccgcgc tgcgcgccgg ccagccggcc tgcgtggccc tgaacgcggc    338520
     caacgaagtc gcggtggccg cgttcctgga agggcgcctg cgctatacct ggatcgcccg    338580
     ggtcatcgag gcggtgctcg agtggcaggc caagcaggca tctgttaccc tgaccagcct    338640
     ggatgacgtg ctcgacctgg atgcgcgcgc gcgctcattc gccggcaatc tcggcctggc    338700
     gtgacgcgcc gggccgcctt tcgcgtccac ccgagtctga tccatgcttt tcacgctgct    338760
     ggcctttgtc gtcgccctgg gcaccctgat tacgttccat gaactgggcc actactggat    338820
     cgcccggctg tgcggcgtgc gcgtgctgcg tttttccgtc gggttcggcc gggtgctggc    338880
     gcgccgcacc gaccgccacg gcaccgagtg ggccatttcc gcgatccccc tgggcggcta    338940
     cgtcaagatg caggacgatc cgccggcagg cgccagcgcg gccgaggcgg cgcgctcctt    339000
     caatgcccag ccggtcgggc gccgcatcgc catcgtggcc gctgggccgc tgttcaatct    339060
     ttttctcgcc gtggtcctgt atgccggcct gaacctggcc ggcaccgaag tgcccgcgcc    339120
     ggtggtgggc cagccggcgg ccggcacgcc ggccgcgcag gccggcctga tggccggcga    339180
     ccgcatcgag gcggtgcagg ggcgcgcggt cgattcctgg aatgacgcgc gctggcgcct    339240
     gctggacgtg ctttccagcc agggcgaggc gcagctggaa gtgcgcggcc ccggcggcgc    339300
     ggcgcgcggt ctcgtgctgc aggtgccggg cggcaaccgc ctggatccgg ccgacggcga    339360
     cccgctggcc gagaccggcc tgcgcctggc ccagcccaag ccggtggtgc gcgaggtcat    339420
     cgccggcggc gccggcgagc aggccggcct gcgtggcggc gacctgatcg tggcggccgg    339480
     ccaggccgcc gacctggacg cgggcgcgct ggtggccctg atccagcgcc atgccggcca    339540
     gcccctggcc ctgacggtgc agcgcggcgc cgaccgcctg accctgacgg tggtgccgcg    339600
     ggccgaatcc gtgcagggcc aggaggtggg ccgcatcggc gtgcagctgg gcggggatat    339660
     ccccatggtc acggtgcgct acggggtgat cgacagcgtc tggcgcggcg cccagcgcac    339720
     ctgggacacg gcctggctgt cgttgcgcat gatgggccgc atggtgctgg gggaggtctc    339780
     ctggcgcaat atcagcggcc cggtcacgat cgccgattat gccggccaga ccgcccggat    339840
     cggcctggaa gcctatattg cctacctggc gctgatcagt atcagcctgg gcgtattgaa    339900
     cctgctgccg atacccatgt tggacggagg gcatctgctg tactatctcg tcgaaattgt    339960
     aaaaggcagt cccgtttccg atcgctggat agacatcggc cagcgagccg gcatcggcct    340020
     gctcgcagga ttgatgggct tggcactgtt caatgatttt gcgcgcctgt tcacttaggc    340080
     acgaatagaa taaaatcccc cgccatttgc acgaccaagg atacccaagg atgtctctac    340140
     gccggatgtt tcatcacaaa aagggcgtta taccgggttt gttagccgcc gcgcttcttg    340200
     cgcccgcgct ggcccatgcc ttcgagccct ttgtcgtgcg ggatatccgc gtggagggca    340260
     ttcagcgtac cgacgccggc acggtgttcg gctacctgcc ggtcaaggtc ggcgagaagt    340320
     tcaccgacga ggaggccacc gaggcggtgc gccgcctgta cggcacgggc tttttcagcg    340380
     acgtgcagat ccagaccgac aacaacgtcg tcgtggtcgt ggtgcaggag cgccccacga    340440
     tcgcctcgat cagtttcaat ggcatgcgcg agttcgactc caaggccatc accaagtcgc    340500
     tggctcaggt gggtttcggc gaagggcgca tcttcgacca gtccatgctc gaacgcgccg    340560
     agtacgagct gaaagaacag tacctggcca agggcaagta cggcgtcgaa gtcaccgcga    340620
     cggtcacgcc gctgccgcgc aaccgggtgg gcgtcagttt cgacgtgttc gaaggcgaag    340680
     tggccaagat ccgcgaaatc cgcgtggtcg gcagcaaggc tttctcggaa ggcgagctgc    340740
     tcgaccagtt cgacctgacc acgccgggct ggctgacctg gtacaccaac accgacaagt    340800
     actcgcgcga gaagctggaa ggcgacatcg agcggctgcg ctcgttctac ctggaccagg    340860
     gctacctgga gttcacggtc gagccgcccc aggtcaccat ctcgcccgac cgcaaggaca    340920
     tctacatcac catcaccgtg cacgagggcg agccctacaa ggtgcgcgaa gtgaagctgg    340980
     ccggcaacct gatggggctg gacagcgaaa tcaacaacct ggtcgagatc aagccgggcg    341040
     aggtcttctc cgccgccaag gccaacaact cggccaaggc cattaccgac tacctgggcg    341100
     acctgggcta cgcattcgcc aacgtcaacc ccaacccgca gctcgaccgc gccaagcacg    341160
     aggccgacgt cacgttctac gtcgacccga gccgccgcgt ctacgtgcgc cgcatccaga    341220
     tcggcggcaa cacgcgcacc cgcgacgaag tggtgcggcg cgaaatgcgc cagcaggaag    341280
     ccgcctggta cgacgcgggc gacatcaagg tgtcgcgcga ccgcgtcgac cgcctgggct    341340
     atttcaacga ggtcaacgtc aagaccgatc cggtgccggg ctcgcccgac caggtcgacg    341400
     tcaacgtgga cgtcaaggaa aagcccaccg gcatcatcaa cctgggcgtg ggctacggtt    341460
     cgtccgaaaa ggcgattctg tcggccggta tcagcgaaga caacgtcttc ggcagcggca    341520
     ccaacctgac gctgcagttg aataccagca agaccaaccg cgccgtggtg ctttcgcaca    341580
     ccgatccgta tttcaccaag gacggcatca gccgcaccac ctcggcctac taccgcgtca    341640
     ccgagccgtg ggacaacaac gacggcgact accgcgtgaa ggccatgggc ctgggcatga    341700
     acttcggcgt gcccatctcc gagtacgacc ggatcttcct gggcggcacg ttcgagcgca    341760
     accagatcga tctgtacaac aactcgccgc aggcctatcg cgacttcgtc gaccagtacg    341820
     gcgattcgac caacgcgctg atcttcaaca ccggctggtc caaggacacg cgcgacagcg    341880
     cgctggcgcc gaccaagggc gcgtacacgc gcctgaaggg cgacttttcc acgatggatc    341940
     tgaagtacta cctgctgacg gcgcagcagc agtactacct gccgctgggc cgcagctaca    342000
     cgctggccct gaacggcatg atcgactacg gccgcagcta cggcggcctg gactacccgg    342060
     tgatcaagaa cgtgtacgcc ggcggcatcg gcacggtgcg cggctacgag ggcgcctcgc    342120
     tgggcccgcg cgaccgcctc acgggcgact acatcggcgg ttcgcgccgc atggtggcca    342180
     acgcccagct gtacctgccg ttcccgggcg cctcgaagga ccgcacgctg cgctggttcg    342240
     tgttcaccga tgcgggccag gtcgcggccg gcagcggcat gtcgtgcacg gccggcaagc    342300
     cgggcagcga agtggaggat ccgtgcggct ggcgcttctc ggccggtatc ggcctgtcgt    342360
     ggcagtcgcc gctgggtccg ctgcagttgt cgtacgctcg cccgctgaat tcgaagtccg    342420
     gcgacgacac gcaggcgttc cagttccaga tcggcacggg tttctgatcg ctgcggggaa    342480
     gcctgcgagc cgttacgcat gaaaacatgg gaaatggccg gttgcccggc cgtcccgcag    342540
     tttagtggca caatatcgtc tttgctttac ctcattggaa ggtgagattt tcatgatgtc    342600
     tgatttcgca cttaatacct cgggttccaa gcgcgccaaa cgaggggccg gcaagctggg    342660
     cgtatcgctg gcgctggcgg gtgctttgct gttcgggtcg tccgcggcgg tcaccgcgca    342720
     ggcgcaaggc accaagatcg gcttcgtgaa cacggagcgg atcctgcgcg aatcgggtcc    342780
     ggccaaggcg gcgcaaagca agatcgaatc cgaattcaag cgccgcgacg acgaactgca    342840
     gcgcctgagc agcagcctgc gctcgcaggc cgagaagttc gacaaggatg ccccggtgct    342900
     gtccgaatcg gaccgtgtca agcgccagcg cgagctgagc aacctcgaca tggacctgca    342960
     gcgcaagcgc cgcgagttcc aggaggattt caaccgccgc cgcaacgaag agttctcgag    343020
     catcgtcacc aaggccaatg acgccatcaa gcgcattgcc gagcaagaga actacgacct    343080
     catcatccag gacgccgtta cggtcaaccc ccgtatcgat atcaccgaca aggtgatcca    343140
     gagcctgggc cgataagcac gcccatgccg gttctgctgg accctgaaaa cgcgctcgct    343200
     ctcgatgtcc tgctggccgg caccgatgcc caggggctgg actggcacct gagcgccccc    343260
     gatgccgccg atctgcccag gatccgcggc atcggcacgc tgtcttcggc gggaagcgag    343320
     gaaatcagct tcctgtccaa tccccgctac cagaatcagc tggccaccac gcgcgccgcc    343380
     gcggtcatcg tgacgcccga cgtcgcgcag gcccggcagg agcagggcgc gtcgggccac    343440
     gtgctggtgg tgtgcaagca tccctatctg ctgtatgcgc gcctggcgca gtggttcgag    343500
     cgcgccagcc ggccagccgg gcccgccggc gtgcatccgt ccgcggtggt cgaccccagc    343560
     gccgagatcg acgccgatgc gcgcgtcggc gcgcagtgcg tcatcgaggc gggcgcccgc    343620
     atcgggcgcg gcgccaggct ggggccgggc tgtgtgatcg gcgccggctc cacggtaggg    343680
     gccgacagcc tgctgcatcc gcgcgtcacc ctgtacgcgg gcgtgcacgt gggcgagcgg    343740
     gccatcatcc acagcggcgc cgtgctgggc gccgacggtt tcggtttcgc gcccgatccc    343800
     acgctgggcc gcggcgcctg gggcaagatc ccgcagttgg gcggggtgag ggtgggcaac    343860
     gatgtcgaaa tcggcgccaa caccaccatc gaccgcggcg cgctggacga cacgatcgtg    343920
     ggcgacggcg tgaagctgga caaccagatc atggtggcgc acaacgtgcg gatcggcgcg    343980
     cataccgcca ttgccgcctg tgtcggcatc gccggctcga ccaccatcgg cgagcgatgc    344040
     accatcggcg gcgcatcgat gctgtccggg cacctggcca tcgccgacga cgtcaatatc    344100
     tcgggcggca ccgcggtgac atcgaacatc gcgaaggccg gccgctacac cggcgtgtat    344160
     ccttacgccg aacacagcga atggcagcgc aatgccgcgg tcattcagca attggcgctg    344220
     ctgcgccggc gcttgcgggc cctcgagcgg gaataatccc gcacggcccg tgtgcccggc    344280
     tggcggcgca ttgcaacata atctattttt gctttgcagg aaaacaaatg gaactcgaca    344340
     tcaaggggat catggaccgg ctgccgcatc gctacccgat gctgctgatc gaccgtgtgc    344400
     tggagatggt gcccggcaaa tccatcgttg ccatcaagaa cgtctcgatc aacgagccgt    344460
     ttttcacggg ccattttccg catcatccgg tcatgccggg cgtgctgatc gtcgaggcca    344520
     tggcgcaggc ttcggccctg ttctcgttca ccgacgagaa cggcgggctg aagtgcgacg    344580
     gcgccaagac cgcctactac ctggtgggca tcgacggcgc gcggttccgt aaacccgtgg    344640
     tgccgggcga ccagttgcgg ctggaagtcg aggccgagcg cctgtcgcgt accatctgca    344700
     agtaccaggg ccgggccctg gtcgacggcc aactggtcgc cgaagccaag ctgatgtgcg    344760
     cgatccgtag cctggaagag taaatgtcag gaaacatcca tcccaccgcc gtggtcgatc    344820
     cggcggcaca gatcgacagt tcggtcgtga tcggcccata cagcgtggtg gggccgggag    344880
     tcagcattgc cgcgggcacc gaggtcggcg cgcactgcgt gctcgacggc gtgaccagca    344940
     tcgggcgcga caaccgcttc taccgctttt gctccatcgg cggcatgccg caggacaaga    345000
     agtacagcgg cgaaccgacg cgactggtca tcggcgaccg caacacggtg cgcgagttca    345060
     ccacgttcaa caccggcacg gtgcaggacg gcggcgtgac cagcatcggc gacgacaact    345120
     ggatcatggc ctacgtgcac atcgcgcacg actgccatat cggcaacaac accatcctgg    345180
     ccaactcggt gcagctgggc ggccacgtgc aggtgggcga ctgggccatc gtgggcggcc    345240
     tgaccggcgt gcaccagttc gccaagatcg gcgcgcacag catgaccggc ggcaacagct    345300
     cgctgatgca ggatgcgccc ccgttcgtgc tggcggcggg caatccgtgc cggcccgtgg    345360
     gcgtcaatgt cgaaggcttg aagcggcgcg gtttctcggc ggcggccatc tcggcgctgc    345420
     gcgatgcgta caagtcgatc taccggcgcg gactgtcgct ggacgaggcg cgcgccgagc    345480
     tgcgcgcgcg ccagcaggcc gagccggatg tcgccgagca tctgcagacc atgctggact    345540
     tcctggacgc ttcgacgcgc ggcatcatcc ggccatgagc ctgcgcatag gcatggtcgc    345600
     cggcgagcct tcgggcgacc tgctggccgg gcgcatcatc gccggcctgc aggcccgggc    345660
     acccggcgtg cactgcgccg gcataggcgg gccccagatg gcggcgcgcg gcttcgaggc    345720
     ctggcacccc atgcatgcgc tcacggtgtt cggctacatc gatgcgttca agcggattcc    345780
     cagcctgctg tcgacctacg gcgacgtcaa gcggcgcctg ctggccgagc cgccgtcggt    345840
     gttcgtgggc atcgacgcgc cggatttcaa cctgcgcctg gagcaccagt tgcgccaggc    345900
     cggtaccccc accgtgcatt tcgtcggtcc ctcgatctgg gcctggcgct acgaacgcat    345960
     caacaagatc cgcgccgccg tctcccacat gctggtgctg tttccgttcg aggaagcgct    346020
     ctatcgcaag gaaggaatcc cggtcaccta tgtcggccat ccgctggccg gggtgattcc    346080
     catgcagccc gatcgcgccg cggcccgcgc gcggctgggc atcgacgccg acgcgcgggt    346140
     gctggccatc ctgccgggca gccgctcgtc cgagatccgc ctgcttgcgc cgcgtttcct    346200
     gcaggccgcg gccgagctgg tccggcgcga tccacgcctg caatgcgtgg tgcccatggt    346260
     caacccgcag cggcgcgccg agttcgaggc tatcgcggcc cagcatccgg tgccgggcct    346320
     gcgttgcgtg accgccgccg aggggcaggg cgagacgccg gtggcctggt ccgtcatgga    346380
     ggcgagcaac gccgtcctgg tggccagcgg cacggccacg ctggaaacgg cgctgtacaa    346440
     gcggcccatg gtcatttcgt acgtgctgtc gccgtggatg cggcgcatca tggcctggaa    346500
     atccgggcag caacgtccct acctgccgtg ggtggggctg cccaatgtgc tgctgcgcga    346560
     tttcgccgtg ccggagctgc tgcaggacga ggccacgccg gccgcgctgg ccgaggcgac    346620
     ctggcaggcg ctgaccgacg aggccggcgc ggcgcgcatc gaggcgcgct ttaccgcctt    346680
     gcaccaggac ttgctgcgcg atacgccggc gctggccgcc caggcgattc tggaggtggc    346740
     cgatggagca gcctgacctg ttcggcacgc tggcgccgct gcccgccatc attgccggcg    346800
     tcgacgaagc cggtcgcgga ccgctggccg gcgcggtcta tgcggccgcc gtcatcctgg    346860
     acccggaccg gccggtcgac ggcctggccg actccaaggt gctcaaggcc gagcagcgcg    346920
     aagcgctggc ggtgcagatc cgcgcccagg cgctggcctg gttcgtggcc agcgccagcg    346980
     tgcaggaaat cgacagcctg aacatcctgc gcgccaccat gctggcgatg cagcgcgccg    347040
     tggccggcct ggccatggcg ccggaactgg ccatggtcga cggcaaccag gcgcccaagc    347100
     tgcgctgcgc cgtgcagacc gtgatcaagg gcgatgcgct ggtgccggcg atctccgccg    347160
     cgtccatcct ggccaagacg gcgcgcgacg ccgacctgct gcgcctgcat gccttgtatc    347220
     ctcaatacgg cttcgaccag cacaagggct acggcacgcc gcagcacctg tccttgctgc    347280
     gcgagcacgg cccgtgcccc gaacaccggc gcagcttcgc gccgatcaag gcgtacggcg    347340
     cgccatgaag cacctgagtt cgcgcgacaa cccggcggtc aaggcgttgc acaagctggc    347400
     cgccggcggc ggccgccgcg acggacggat cctgctcgac ggcgtgcatc tgtgccaggc    347460
     ctggctggcg caccaaggca cgccgctgca ggcgctgttc gatgtcgcgc ggctggacca    347520
     tcccgagatc cgcgccctgg ccggccaggt gccgccgcag cattgcctgg cgctggattc    347580
     gcgcctgctg caggggctgg ccagcgtcga gagcggccag ggcgtggtgt tcgtggcgcg    347640
     cgcgcccgaa cccgcgctgc ctgaacgcat cgacgagaac tgcgtgctgt tcgaccggat    347700
     ccaggacccg ggcaatgtcg gcaccttgct gcggacctgc gcggcggccg gcgtgcgccg    347760
     ggtgctgctg gcggccggca cggccgcggc atggtcgccc aaggtgttgc gcagcggcca    347820
     gggcgcgcat ttcgcgctgc atatccacga acacctggac ctggaggcgg tgctgccgcg    347880
     gctggacgtg ccgctggtgg ccacgaccct ggcgcggtcc ggctcgctct acgacacgga    347940
     cctgccggcg tgctgcgcct gggtgttcgg ccacgaaggg cagggcgtgg ccgaggcgct    348000
     gctgcgggcg gccgcgctgc gcgtgcacat cccgcacgag tcggcggcgg tcgagtcgct    348060
     caatgtgggc gccgccgccg ccatctgcct gttcgagcag cgccgccagc gccgctgacc    348120
     cgcccgcgcc tagacgcgct ccagtccgac ctcctgcagc accgtggtgg cgatttcctc    348180
     gatcgacttg gtggtcgtcg acagccacga aatgccctcg cggcgcatca tgcgctcggc    348240
     ctcggccact tcgtagcggc attgctccag gcgcgcgtaa tggctgttgg ggcggcgctc    348300
     gttgcgcacc tcggccagcc gctcgggctg gatcgacagg ccgaacagct tgccgcggta    348360
     cggcgcgatg gtcttgggca gcgcgccgcg ctcgaaatcg tccggggtga gcgggaaatt    348420
     ggcggccttg acggcgtact gcatggccag atagaggctg gtcggggtct tgccgcagcg    348480
     cgacacgccc accaggatca cgtcggcctg gtccagctgg ttgacgaact ggccgtcgtc    348540
     gtgcgccagg ctgaagttga tggcgtcgat ccggttgcgg tatttctcgg agttggccgc    348600
     catgtgcgag cgtccgatgg agtggctgga cttcaagccc agggcctgct cgatgtggct    348660
     gacgaatgtt ccaaaaagat cgaggaaaac gccgttcgac tggcgaacca gcgccaggat    348720
     ctcggggttg accagggtgc tgaagacaat cggcggcacg ccggcctcga gcgcgttgcg    348780
     gttgatgcgc gccaccacct cgcgcgcctt gtccagcgta tcgatgaagg gcaggcgcac    348840
     gggcttgaaa ttgacctcgt cgaactgcga tagcacggag tggctgaagg tctcggcggt    348900
     gatgccggtg ctgtccgaaa cgatgtagac cgcacgttca ataggggtag aagtcatatg    348960
     taaaaaattc caaccaggta ccgggaggct tgtgcccaag cgagtaca                 349008
//

If you have problems or comments...

PBIL Back to PBIL home page