(data stored in ACNUC7421 zone)

EMBL: BX640445

ID   BX640445; SV 1; linear; genomic DNA; STD; PRO; 348706 BP.
XX
AC   BX640445;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Bordetella bronchiseptica strain RB50, complete genome; segment 9/16
XX
KW   complete genome.
XX
OS   Bordetella bronchiseptica
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-348706
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; 53acf54010b639e82cfc02859fb3a1de.
DR   ENA-CON; BX470250.
DR   BioSample; SAMEA1705943.
DR   EuropePMC; PMC1855645; 17293531.
DR   RFAM; RF00504; Glycine.
DR   StrainInfo; 494021; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..348706
FT                   /organism="Bordetella bronchiseptica"
FT                   /strain="RB50"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:518"
FT   CDS_pept        160..2523
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /gene_synonym="pps"
FT                   /locus_tag="BB2622"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1436"
FT                   /db_xref="GOA:A0A0H3LMN0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMN0"
FT                   /protein_id="CAE33115.1"
FT                   /translation="MSYVVSFEQLRMTDVDSVGGKNASLGEMISQLAGAGVRVPGGFAT
FT                   TAQAFRDFLQASGLDKRIADRLATLNPEDVRELASAGAEIRQWVIDAPFSPEFEQAIRT
FT                   AFAELDADGKGSFAVRSSATAEDLPDASFAGQQETFLNVVGVDDVLDKIRHVFASLYND
FT                   RAISYRVHKGYAHAEVALSAGIQRMVRSDKGSAGVMFTIDTESGFQDVVFITSSYGLGE
FT                   TVVQGAVNPDEFYVFKPSLERGNYPIVSRRIGSKLIKMEFDPERPEGRAVRTVDVPVSE
FT                   RNRYSLTDDEVIELARYAVIIEKHYQRPMDIEWGRDGVDGKIYILQARPETVKSQQGVN
FT                   DVQQRYRLKATGQVLVTGRAIGQKIGAGKVRVVADISEMDKVQAGDVLVTDMTDPNWEP
FT                   VMKRASAIITNRGGRTCHAAIIARELGIPAVVGCGDATDLLKDGQAVTASCAEGDEGRI
FT                   YDGLIETEVEEVRRGEMPPIDVKIMMNVGNPQLAFDFAQIPNAGVGLARLEFIINNNIG
FT                   IHPKAVLDYPNVDGELKKAVESAARGHASPRAFFVEKLAEGVATIGAAFWPKPVIVRMS
FT                   DFKSNEYRKLVGGSRYEPEEENPMLGFRGASRYIAADFEECFRMECEALKKVRDEMGLT
FT                   NVEIMVPFVRTLGQARKVVELLAAHGLARGENGLKLIMMCEVPSNAILAEQFLEYFDGF
FT                   SIGSNDMTQLTLGLDRDSGMELLAADFDERDDAVKFMLRRAIKACLAANKYVGICGQGP
FT                   SDHPDFAQWLKDEGILSMSLNPDTVVETWQQLAK"
FT   misc_feature    163..1245
FT                   /note="HMMPfam hit to PF01326, DE Pyruvate phosphate
FT                   dikinase, PEP/pyruvate binding domain, score 1.9e-129"
FT   misc_feature    1246..1527
FT                   /note="HMMPfam hit to PF00391, DE PEP-utilizing enzyme,
FT                   mobile domain, score 3.4e-40"
FT   misc_feature    1393..1428
FT                   /note="PS00370 PEP-utilizing enzymes phosphorylation site
FT                   signature."
FT   misc_feature    1549..2517
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02896, DE PEP-utilizing enzyme, TIM
FT                   barrel domain, score 7e-104"
FT   misc_feature    2233..2289
FT                   /note="PS00742 PEP-utilizing enzymes signature 2."
FT   CDS_pept        complement(2591..3310)
FT                   /transl_table=11
FT                   /locus_tag="BB2623"
FT                   /product="probable class-I glutamine amidotransferase)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1437"
FT                   /db_xref="GOA:A0A0H3LT95"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LT95"
FT                   /protein_id="CAE33116.1"
FT                   /translation="MTAALPVLILHTGNPAAALRAAHGSYAEMLRQAAGLDAAGTHVVA
FT                   SYKDEAPRAPGAYRAALITGSPAMVTDRAPWSEAAADWLRQAAGAGLPMFGICYGHQLL
FT                   AHALGGVVGDNPAGRELGTLPVELLPAAATDPLLAGLPAAFDAQMMHEQAVLAAPPGAA
FT                   VLARSAQDAHQMLRLAPRIYTAQFHPEFTPGFVAAHLRHHAALYAAHGLDVERLARAAG
FT                   PTPLAASLVRRFLACCA"
FT   misc_feature    complement(2693..3259)
FT                   /note="HMMPfam hit to PF00117, DE Glutamine
FT                   amidotransferase class-I, score 3.2e-09"
FT   misc_feature    complement(2999..3034)
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT   CDS_pept        3434..3859
FT                   /transl_table=11
FT                   /locus_tag="BB2624"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1438"
FT                   /db_xref="GOA:A0A0H3LNQ5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNQ5"
FT                   /protein_id="CAE33117.1"
FT                   /translation="MWIWFGLAAVALIGEVGSGTFYLLLVALGLAAGGIAAWLGADLAW
FT                   QLVACGLVALLGLLALRRTGVLKKREVNAARNADVNLDIGQSVMVDAWSDAGTTQVYYR
FT                   GAQWQAELAHGQPRQAGRHIIAEIRGTRLVLAPAPAA"
FT   misc_feature    3434..3526
FT                   /note="Signal peptide predicted for BB2624 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.622) with cleavage site
FT                   probability 0.235 between residues 31 and 32"
FT   misc_feature    join(3452..3520,3563..3616)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2624 by TMHMM2.0 at aa 7-29 and 44-61"
FT   CDS_pept        3913..4839
FT                   /transl_table=11
FT                   /locus_tag="BB2625"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1440"
FT                   /db_xref="GOA:A0A0H3LVS8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVS8"
FT                   /protein_id="CAE33118.1"
FT                   /translation="MIDVSTVVLIVIVILALMIVVKAIAIVPQQHAWVVERLGKFDRVL
FT                   SPGAGFVIPFIERVSYKHSLKEIPLDVPSQVCITRDNTQLQVDGVLYFQVTDPMRASYG
FT                   SSNYISAITQLAQTTLRSVIGKLELDRTFEEREFINSTIVASLDEAALNWGVKVLRYEI
FT                   KDLTPPNEILRAMQAQITAEREKRALIAASEGRRQEQINIATGEREAAIARSEGEKQAQ
FT                   INQAQGEAAAVLAIAEATAKAIEQVGEAVRQPGGMEAVNLKVAERYVDAFSNVAKEGNT
FT                   LILPSNLSDVGGLIASAMTIVKSTKSA"
FT   misc_feature    3913..3987
FT                   /note="Signal peptide predicted for BB2625 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.709) with cleavage site
FT                   probability 0.611 between residues 25 and 26"
FT   misc_feature    3931..3999
FT                   /note="1 probable transmembrane helix predicted for BB2625
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    3979..4503
FT                   /note="HMMPfam hit to PF01145, DE SPFH domain / Band 7
FT                   family, score 1.1e-70"
FT   CDS_pept        4905..6062
FT                   /transl_table=11
FT                   /locus_tag="BB2626"
FT                   /product="probable membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1441"
FT                   /db_xref="GOA:A0A0H3LMN3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMN3"
FT                   /protein_id="CAE33119.1"
FT                   /translation="MLAPVTLLVISTLSSLVTLGVLGSLLRSGIAGIRELMWANVLVLC
FT                   SLLLFTLQANPAMPPWLAIQAPNVLISSGVVLFCAGVFRFMQQRPPWRLLLLGLALSIG
FT                   ANIWFHYVDPSVNARVVAASGLHALLWGGSAWTIYRNMPLRRSRYSYWFAGVTATVAAL
FT                   GHALRTAVYGLQIEQTQGLLQSSVWNVAFLAIGVLVMPSMTLGMIMMIHDRMLAERERE
FT                   ANQDFLTGLLSRKAWWREGERLCARALRTGRPLTLLALDIDRFKQVNDQHGHAAGDVVL
FT                   RHFGSLATALLRSGDVIGRLGGEEFVALLPDTDGDTGVSVAERLLASVRATPCSHGGKA
FT                   LTYTFSGGVAQYRAGDTLPVLVERADAALYAAKQAGRDRIRNRAG"
FT   misc_feature    4905..4973
FT                   /note="Signal peptide predicted for BB2626 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.772) with cleavage site
FT                   probability 0.371 between residues 23 and 24"
FT   misc_feature    join(4914..4982,5016..5075,5085..5153,5172..5240,
FT                   5250..5318,5352..5420,5463..5531)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BB2626 by TMHMM2.0 at aa 4-26, 38-57, 61-83, 90-112,
FT                   116-138, 150-172 and 187-209"
FT   misc_feature    5559..6041
FT                   /note="HMMPfam hit to PF00990, DE GGDEF domain, score
FT                   4.8e-48"
FT   CDS_pept        complement(6043..6510)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /gene_synonym="smqB"
FT                   /locus_tag="BB2627"
FT                   /product="SsrA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1442"
FT                   /db_xref="GOA:Q7WJ73"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ73"
FT                   /protein_id="CAE33120.1"
FT                   /translation="MSIIDNRKATHDYFIEDRYEAGMVLEGWEVKAIRDGRVQLKESYV
FT                   IVRDGEIYLLGMHVSPLPTASTHIRPDATRTRKLLLKAEEIRKLIGKVEQRGYTLVPLN
FT                   LHYKNGRIKLDFALGRGKKLYDKRDTAREKDWQREKERVLKHDTRVNQRDS"
FT   misc_feature    complement(6304..6510)
FT                   /note="HMMPfam hit to PF01668, DE SmpB protein, score
FT                   2.9e-39"
FT   misc_feature    complement(6412..6450)
FT                   /note="PS01317 Protein smpB signature."
FT   CDS_pept        6576..7010
FT                   /transl_table=11
FT                   /locus_tag="BB2628"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1443"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMN4"
FT                   /protein_id="CAE33121.1"
FT                   /translation="MHKVQRSVLVPYSAAQMFDLVADVEKYPEFMPWCGGAEVHSRSEH
FT                   GMQASILISFAGLKQRFSTRNTHDYPQRIDLELVDGPFSMLVGHWVFQPLAEDACKVLF
FT                   TLEYAFSNRALEMVVGPVFNRIAASFIDSFTKRAQAKYGE"
FT   misc_feature    6576..7004
FT                   /note="HMMPfam hit to PF03654, DE Uncharacterised protein
FT                   family (UPF0083), score 3.2e-53"
FT   CDS_pept        7000..7350
FT                   /transl_table=11
FT                   /locus_tag="BB2629"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1444"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTA1"
FT                   /protein_id="CAE33122.1"
FT                   /translation="MANDTPAPAGSLRVTVCHACPDGAWQRAVTLPAGATVADAVAASG
FT                   FAAAHRGQDPWAHGVGVFGKAQAADAPLADGDRVEIYRGLSFDPKESRRRRAEHRRALA
FT                   ARGGKARPAGLL"
FT   misc_feature    7033..7284
FT                   /note="HMMPfam hit to PF03658, DE Uncharacterised protein
FT                   family (UPF0125), score 3.4e-17"
FT   CDS_pept        7547..8701
FT                   /transl_table=11
FT                   /locus_tag="BB2630"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1445"
FT                   /db_xref="GOA:A0A0H3LNR0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNR0"
FT                   /protein_id="CAE33123.1"
FT                   /translation="MDFELTDEQRAFAQAARDYAQGELAPHAARWDAEGIFPREAFARA
FT                   GELGFCAIYASEEIGGLGLPRLDATLVFEEMAAVDPSTTAFLTIHNMATWMVGQWARPA
FT                   VREQWGPLLASGEKLASYCLTEPNAGSDAGSLATRAERQGDDYVLNGAKAFISGGGDTD
FT                   LLVVMARTGGDGPGGVSAFAVPADAAGIAYGRKEEKMGWNSQSTRPITFEQVRVPASHM
FT                   LGEPGEGFKIAMKGLDGGRINIGTCSVGAAQGAMDAARRYMDERRQFNRKLAQFQALQF
FT                   KLADMATHLVAARQMVRLAACKLDAGSADASTYCAMAKRFATDMGFQICLDAQQIHGGY
FT                   GYLRDYPLERLVRDTRVHQILEGTNEIMRVIVARQLLEKGADIR"
FT   misc_feature    7559..7909
FT                   /note="HMMPfam hit to PF02771, DE Acyl-CoA dehydrogenase,
FT                   N-terminal domain, score 1.9e-17"
FT   misc_feature    7913..7951
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT   misc_feature    7913..8215
FT                   /note="HMMPfam hit to PF02770, DE Acyl-CoA dehydrogenase,
FT                   middle domain, score 5.7e-46"
FT   misc_feature    8225..8677
FT                   /note="HMMPfam hit to PF00441, DE Acyl-CoA dehydrogenase,
FT                   C-terminal domain, score 6e-71"
FT   misc_feature    8549..8608
FT                   /note="PS00073 Acyl-CoA dehydrogenases signature 2."
FT   CDS_pept        8698..9870
FT                   /transl_table=11
FT                   /locus_tag="BB2631"
FT                   /product="enoly-CoA hydratase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1446"
FT                   /db_xref="GOA:A0A0H3LVT2"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVT2"
FT                   /protein_id="CAE33124.1"
FT                   /translation="MNAPVLFEERIADNGVRLGVATLNAPQTLNGLSLEMVELLDARLR
FT                   AWAADAAVAMVILQGAGEKAFCAGGDLHGLYRSMRENTGGDPWANTHARRFFEHEYRLD
FT                   YLIHTYPKPVLCWGHGIVMGGGVGLMMGASHRVVSETTRMAMPEITIGLFPDVGGSWLL
FT                   NRMPGRTGLFLALTGAHVNASDAFFAGLADFRLDSAQWPDFCASLLSLPWAGQPGGPGT
FT                   GNAAPRSINDGLLRQALLAHEPATQLEPGPLRQHSFLVNSLCSGKRLDDIYAEIAELKD
FT                   HADPWLARAAATMLAGSPGSARLAYALQQHTRLRSLADVFRIEYVAALACAAHGDFAEG
FT                   IRALLVDKDRQPRWNPATLSEASDDWVRKFFDEPWPAGQPHPLADLGHGA"
FT   misc_feature    8752..9288
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 2.4e-14"
FT   CDS_pept        9918..10811
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="BB2632"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1447"
FT                   /db_xref="GOA:A0A0H3LMN7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMN7"
FT                   /protein_id="CAE33125.1"
FT                   /translation="MSSIAFIGLGNMGAPMALNLVKAGHDLTVFDLVPAAVKTLTDAGA
FT                   RAAGSAAEAVQGAELVISMLPASKHVEGLYLGQDLLASIGASALVIECSTIAPDSARKV
FT                   AAAAQARGIAMIDAPVSGGTGGAAAGTLTFIVGGEAPALERARPVLASMGKNIFHAGGA
FT                   GAGQVAKICNNMLLGILMAGTSEALALGVANGLDPKVLSDIISKSSGRNWATELYNPWP
FT                   GVMEHAPASKGYAGGFGVDLMLKDLGLAAEAALGTRSSIPLGELARNLYSLHSQGGSGG
FT                   LDFSSIVNLYSPGERN"
FT   misc_feature    9918..10403
FT                   /note="HMMPfam hit to PF03446, DE NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 0.0015"
FT   misc_feature    9933..9968
FT                   /note="PS00895 3-hydroxyisobutyrate dehydrogenase
FT                   signature."
FT   CDS_pept        10857..11294
FT                   /transl_table=11
FT                   /locus_tag="BB2633"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1448"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMN8"
FT                   /protein_id="CAE33126.1"
FT                   /translation="MPDTEAFEAARQRVHDNFARQSVMALIGARLGAVEPGEVEIALPY
FT                   RADLCQQNGFLHAGISTTIADSAGGYAAYTLFGPGEDVLTSEFKMNFLAPADGEHFVAS
FT                   GKVLKPGRRLSICQVELRACRGERSTLCLVGLMTAVRVTPR"
FT   misc_feature    10905..11282
FT                   /note="HMMPfam hit to PF02584, DE Uncharacterized protein
FT                   PaaI, COG2050, score 0.00016"
FT   CDS_pept        11354..12043
FT                   /transl_table=11
FT                   /locus_tag="BB2634"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1449"
FT                   /db_xref="GOA:A0A0H3LTA4"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTA4"
FT                   /protein_id="CAE33127.1"
FT                   /translation="MPARSHHRIFRSGWLRAAVLGANDGIVSTASLIAGVAAAQASHAA
FT                   ILTSGLAGLVAGALSMAAGEYVSVKSQADIEAADLRLEQSSLKRNSREELEELTGIYVE
FT                   RGLSPDLAGQVARQLTRHNALDAHARDELGISVHNRAQPVQAALASAASFAVGAALPLA
FT                   IAMAAPLAQLMPVVIAGSVAGLGILGAVAARAGGAPVGPAAVRVVLLGAAAMALTAGVG
FT                   ALFGVAV"
FT   misc_feature    11354..11485
FT                   /note="Signal peptide predicted for BB2634 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.967) with cleavage site
FT                   probability 0.865 between residues 44 and 45"
FT   misc_feature    join(11390..11458,11486..11554,11789..11857,11870..11929,
FT                   11966..12034)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2634 by TMHMM2.0 at aa 13-35, 45-67, 146-168, 173-192 and
FT                   205-227"
FT   CDS_pept        complement(12053..13069)
FT                   /transl_table=11
FT                   /locus_tag="BB2635"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1845"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNR4"
FT                   /protein_id="CAE33128.1"
FT                   /translation="MHAFYDSIPARADGSAQCAPLASLRVIGAAGADALAFLHGQLTQD
FT                   VTGQPADHARLAGYCTAKGRLLATLVMWRAAAADESAPVWQALVRADVAEAVLKRLSMF
FT                   VLRAKARLAPVPAWAAGVQCAPAALAALQDAAGGALPAAPWQRAELPTGTWIGAPSADA
FT                   QPRWWWIATEAQLERAGALAAHLGRASESAWQAADLAAGLPWIGAATQDVFIPQTVNLD
FT                   LIGGVSFTKGCYPGQEVVARSHYRGTVKRRMAHGVIAEAPADLPDPLAGQDIYDSARPD
FT                   EPCGRVVDAARSDGQLALLFETTLASLPDGDLRLLSAQGPRIALAPLPYELAGNAAG"
FT   CDS_pept        13236..14282
FT                   /transl_table=11
FT                   /locus_tag="BB2636"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1846"
FT                   /db_xref="GOA:A0A0H3LVT4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVT4"
FT                   /protein_id="CAE33129.1"
FT                   /translation="MRTLMRKRIRFYFLLLVLVALLGAALAAGGAWTWMHRPVALKSDR
FT                   IDFVVDPGSTPRAIARTLNQAGVAVWEPGFVWMARLSELDKQIKAGGYQAIDGDSPWQL
FT                   LQRLARGDMSQRQITFLEGWTFRQMRQALREHPDVKQTLGETSDEALMERLGSTVTHPE
FT                   GMFFPDTYVFTPGSTDFDILRRAYQEGQRILESTWAKRQDGLPVGTPYEALILASIVEK
FT                   ETGHGPERARVAGVFANRLRIGMLLQTDPTVIYGMGEAYQGRIRKRDLQTDTPWNTYTR
FT                   PGLPPTPIAAPGRAALLAAVQPERHKYLFFVSRGNGTSEFSVNLNDHNRNVSRYILGQG
FT                   QPQQGSQQ"
FT   misc_feature    13236..13316
FT                   /note="Signal peptide predicted for BB2636 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.719 between residues 27 and 28"
FT   misc_feature    13248..14249
FT                   /note="HMMPfam hit to PF02618, DE Uncharacterized BCR, YceG
FT                   family COG1559, score 2.5e-87"
FT   misc_feature    13572..13637
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1112.000, SD 2.97 at aa 113-134, sequence
FT                   MSQRQITFLEGWTFRQMRQALR"
FT   CDS_pept        14279..14905
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BB2637"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1847"
FT                   /db_xref="GOA:Q7WJ63"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ63"
FT                   /protein_id="CAE33130.1"
FT                   /translation="MTPRGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGT
FT                   PVGEKLRELLLSEPMALETETLLMFAARCEHVREVIAPALARGEWVVCDRFTDASYAYQ
FT                   GGGRQLGAARVAALEQWVHPDLQPDRTWLFDVPLDVARARLARSRQLDRFEREEDAFFE
FT                   RTRAAYHERARSSDGRIRIIDSSRPLEVVRAQLDSEVRELVAQAA"
FT   misc_feature    14306..14866
FT                   /note="HMMPfam hit to PF02223, DE Thymidylate kinase, score
FT                   5.4e-57"
FT   misc_feature    14312..14335
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    14687..14716
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   CDS_pept        14902..15954
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BB2638"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1848"
FT                   /db_xref="GOA:A0A0H3LMP2"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMP2"
FT                   /protein_id="CAE33131.1"
FT                   /translation="MSLGRFLPWQTEIARSWLSGRDRFAHAWLIHGNGGIGKLDFAAAA
FT                   AASLLCESPRQGLACGECAACAWVASGNHPDLRRIRPEAVALEEGADQTEGAEEAEAGS
FT                   GGAAAKRAPSKDIRIDQIRALEPWFNTATHRGGWRVALLYPAHALNVISANALLKVLEE
FT                   PPAHTVFLLVADAPDRLLPTLVSRCRRLPLPTPSAGQALQWLGEQGVEPAADWLAAAGG
FT                   APLAAQRLAARGDAPCPAWLAQLVQPLAAGKAPDVGMLTENLEKVAAAEWIDALQRLFT
FT                   DLTLAAHGAASRYYPSLAEPVRQAAARAQPAQLAETARWLSRQRGLATHPLNAKLFVHA
FT                   ALQRVVLSCQ"
FT   CDS_pept        15995..16774
FT                   /transl_table=11
FT                   /locus_tag="BB2639"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1849"
FT                   /db_xref="GOA:A0A0H3LMP1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMP1"
FT                   /protein_id="CAE33132.1"
FT                   /translation="MVRMYVDSHCHLNFPELAQDLPAVLDRMAANQVTHALVVSVNMPD
FT                   WPGLMQLVEPHGNLWASVGVHPDYEDTPDPEPAELERLAAHPKVVAIGETGLDYYRLSE
FT                   PLDWQRERFRRHIRAARSTGLPLIVHTRASAQDTVRLLREEGADEVGGVMHCFTESWEI
FT                   AQQAMALNFHISLSGIVTFKNAQLVHEVAANMPLDRLLIETDSPYLAPVPYRGKLNDPS
FT                   KVIHVAEKIAELKGIPVAEVAHASTENFFKLFNKIKR"
FT   misc_feature    16007..16033
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT   misc_feature    16022..16759
FT                   /note="HMMPfam hit to PF01026, DE TatD related DNase, score
FT                   2.1e-88"
FT   misc_feature    16565..16615
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT   CDS_pept        16825..17661
FT                   /transl_table=11
FT                   /locus_tag="BB2640"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1850"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTA9"
FT                   /protein_id="CAE33133.1"
FT                   /translation="MKPLRTRFLRWRGAAAGGLLAGALLASPAWAAKQADWWVYVHNDK
FT                   ARDIGALLAAGADPNVRYDNGQPAIMRAVVDNAWEVFDVLAANRRTDLNAENPAGETPL
FT                   MYLAVAGQTERAQALIARGAQVNRLGWTPLHYAASKGRLETARMLLGKQALVNAPSPDG
FT                   TTPLMMAAYSGDRRMVQLLLDAGADITTRNLKGMSAADWAAFGKSEALARELKPMIARA
FT                   EAERQARHGAVATPKLAPAAETPPTAQPAAAPAAASQPGEGRSLSGVSGVRLNSYD"
FT   misc_feature    16825..16917
FT                   /note="Signal peptide predicted for BB2640 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 31 and 32"
FT   misc_feature    17209..17307
FT                   /note="HMMPfam hit to PF00023, DE Ankyrin repeat, score
FT                   2.3e-07"
FT   misc_feature    17308..17406
FT                   /note="HMMPfam hit to PF00023, DE Ankyrin repeat, score
FT                   6.5e-09"
FT   CDS_pept        17978..18715
FT                   /transl_table=11
FT                   /locus_tag="BB2641"
FT                   /product="probable transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1851"
FT                   /db_xref="GOA:A0A0H3LNR9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNR9"
FT                   /protein_id="CAE33134.1"
FT                   /translation="MQEQAIAGGAERVLYVLATLAREEAPLTVAALAERTGLAQSTLYR
FT                   QVALLKRWGFVLEQAGAYTPGPLCVQLARGFDQSSYLIQEALPDMTRLAADSGETVGLL
FT                   VAMSDQAVCLEMVESRHPLRCSFVKGRGLPLARGASAKSLMAFMAPARLQGRLHELAGQ
FT                   GVDAAALARDLEAIRAAGYAVSDSEVDAGVWGCSAPVFERPHQAAGSVTLMAPSTRVAE
FT                   RTANLINLTLAAAKRISSRLQHS"
FT   misc_feature    18056..18121
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1775.000, SD 5.23 at aa 27-48, sequence
FT                   LTVAALAERTGLAQSTLYRQVA"
FT   misc_feature    18164..18700
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 5.3e-15"
FT   CDS_pept        18790..19533
FT                   /transl_table=11
FT                   /locus_tag="BB2642"
FT                   /product="putative glutamine-binding periplasmic protein
FT                   precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1852"
FT                   /db_xref="GOA:A0A0H3LVT9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVT9"
FT                   /protein_id="CAE33135.1"
FT                   /translation="MTTRRQLLTAALTLSLAWGAGAAHAQETIRAVTDATFPPMEFVKD
FT                   GKRTGFDIELVEALAQAMGKKIEWIDIDFKGLIPALQAGRADIAVSAIYITAERQKVVD
FT                   FTDPYYAGGLVVLTKKDGPVKSLKDLEGRKVSVQVGTKSVNYLKEHFPKVQRVEVEKNQ
FT                   EMFNLVQIGRADAAVTGKPAAKLFAQSTQDLAVLSEQITTEEYGIAVPKSKSGLTRELN
FT                   EALKKLKADGTYERIVNKWFEAQAK"
FT   misc_feature    18790..18864
FT                   /note="Signal peptide predicted for BB2642 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   misc_feature    18874..19521
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 6.1e-73"
FT   misc_feature    18937..18978
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   CDS_pept        19530..20198
FT                   /transl_table=11
FT                   /locus_tag="BB2643"
FT                   /product="glutamine transport system permease"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1853"
FT                   /db_xref="GOA:A0A0H3LMP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMP7"
FT                   /protein_id="CAE33136.1"
FT                   /translation="MMLDFAPVFADFDALLRGAVVTVEVTACALLLGCVIGLLVGVGRL
FT                   NPQRRFIYNLCSVYLLFFRGTPLLVQLFIWFFGLPQFGITLPAFACGVLGLGIYSGAYV
FT                   SEIVRGAIQSVDRGQMEAARSLGMSSAQAMRIIILPQAVVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIHDLMHEGQKIISVSYRSLETYLVVALIYLVLTTATTTILRRIEHRLRAGGMVQ
FT                   "
FT   misc_feature    join(19587..19655,19692..19760,19773..19841,20085..20153)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2643 by TMHMM2.0 at aa 20-42, 55-77, 82-104 and 186-208"
FT   misc_feature    19860..20072
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 5.4e-16"
FT   misc_feature    19863..19949
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    19878..19943
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1093.000, SD 2.91 at aa 117-138, sequence
FT                   RGQMEAARSLGMSSAQAMRIII"
FT   CDS_pept        20195..20968
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BB2644"
FT                   /product="glutamine transport ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1855"
FT                   /db_xref="GOA:A0A0H3LMP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMP5"
FT                   /protein_id="CAE33137.1"
FT                   /translation="MSTQEMIRIRGLRKAYGEHEVLRGIDFNVEASQVVVVIGPSGSGK
FT                   STLLRCCNGLEVAQGGTIDICGHNLLKDGRLLPEAELNRLRMQVGMVFQGFNLFPHLSV
FT                   LDNVTVGPRTLRGMSRAQAEELGGDLLAKVGLREKMAAMPGSLSGGQKQRVAIARALAM
FT                   QPRVMLFDEPTSALDPELVGEVLQVMKLLAREGMTMMVVTHEMGFAREVADVVAVMDGG
FT                   SIVESGPPELIFSQPREARTRAFLQAVLSASQGAA"
FT   misc_feature    20288..20860
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   4.4e-58"
FT   misc_feature    20309..20332
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    20633..20677
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        20965..21918
FT                   /transl_table=11
FT                   /locus_tag="BB2645"
FT                   /product="probable arginase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1856"
FT                   /db_xref="GOA:Q7WJ55"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ55"
FT                   /protein_id="CAE33138.1"
FT                   /translation="MSVANDSASIWTARDDSGERGDTRRLAHIVALGQDAGAGDAAVLG
FT                   FACDAGVARNQGRRGAALAPRAIRRMMAGLPAHNLRRLVDAGDVVCEDDQLEAAQDALA
FT                   GRVAALLQAGAHPVVLGGGHEIAWGSFQGLRRWLDARGDREPVLVLNLDAHFDLRTGRP
FT                   GSSGTPFDQIAEYCAARGHALQYACLGVSPLGNTPALYARAAEVGAVWVEDRHMQEAHL
FT                   GERLAQLDALLAAAGHVYLTIDLDVLPAATAPGVSAPAPYGVPLAVVEEVAMHVRASGK
FT                   LRLADLAECNPAYDIDHRTARVAARLAWRLLGGAAR"
FT   misc_feature    21082..21912
FT                   /note="HMMPfam hit to PF00491, DE Arginase family, score
FT                   5.9e-08"
FT   misc_feature    21322..21363
FT                   /note="PS00147 Arginase family signature 1."
FT   misc_feature    21409..21435
FT                   /note="PS00148 Arginase family signature 2."
FT   misc_feature    21688..21753
FT                   /note="PS01053 Arginase family signature 3."
FT   CDS_pept        22111..23400
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /gene_synonym="gdh"
FT                   /locus_tag="BB2646"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1857"
FT                   /db_xref="GOA:A0A0H3LTB4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTB4"
FT                   /protein_id="CAE33139.1"
FT                   /translation="MSQAPAHSLPSYLDAEHLGPWGIYLQQVDRVTPYLGPLARWVETL
FT                   KRPKRALIVDVPIEMDNGSIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALAAWM
FT                   SIKNAAVNLPYGGAKGGVRVDPRTLSHSELERMTRRYTSEIGVIIGPSKDIPAPDVNTN
FT                   AQTMAWMMDTYSMNEGATATGVVTGKPIALGGSLGRVEATGRGVFVVGCEAARDLNLDV
FT                   SKARIVVQGFGNVGGTAARLFHEAGAKVIAVQDHTGTIHNDGGLDVHKLLAHVGNQGGV
FT                   AGFTGAQQLADDDFWGLETDFLIPAALEGQINENNAARVRAKVVVEGANGPTTPEADDI
FT                   LRENGVYVVPDVLANAGGVTVSYFEWVQDFSSFFWSEEEINQRLERLMREAYSAVSQVA
FT                   KEHKVTLRTAAFIVACTRILQARQVRGLYP"
FT   misc_feature    22252..22644
FT                   /note="HMMPfam hit to PF02812, DE Glu/Leu/Phe/Val
FT                   dehydrogenase, dimerisation domain, score 2.5e-64"
FT   misc_feature    22447..22488
FT                   /note="PS00074 Glu / Leu / Phe / Val dehydrogenases active
FT                   site."
FT   misc_feature    22690..23388
FT                   /note="HMMPfam hit to PF00208, DE
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase, score
FT                   2.9e-95"
FT   misc_feature    22999..23040
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   CDS_pept        complement(23476..24972)
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="BB2647"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1858"
FT                   /db_xref="GOA:A0A0H3LNS3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNS3"
FT                   /protein_id="CAE33140.1"
FT                   /translation="MTLHDSAYWRAQAAALAPEGRAYIDGAYCDAADGATFAAHSPIDG
FT                   RKLADVAACGAADVDRAVAAARRAFEAGVWSGLAPRERKHRLLRLAALITKHQEELALL
FT                   ETLDMGKPIRDALAFDLPETARCYAWYGEAIDKRYDEIAPTGADALATITREPLGVVAA
FT                   VVPWNYPLMMAAWKVAPALAVGNSVILKPAEQASLSALRLAALAEQAGIPPGVFSVVPG
FT                   LGAQAGQALGLHPDVDCIAFTGSTATGKRFMTYSGQSNLKRVWLECGGKSPHIVFADCP
FT                   DLDRAAQVAALAIFSNQGEVCIAGSRLYVQHGIYDAFMEKVAAFAATLRPGNPLDPDSA
FT                   LGAMVDERQTQAVMARIAAGAQEGARLRLGGRQVLTNSGGYYIEPTIFDCPGQDNSLVR
FT                   EEIFGPVLAAQGFADEDEAVALANDSIYGLGAGLWTADLGRAHRLSRRLRAGLVWVNCY
FT                   ADGDITVPFGGVKQSGFGRDKSLHAMDKYSDLKTTWISLR"
FT   misc_feature    complement(23482..24894)
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 1.7e-192"
FT   misc_feature    complement(24055..24090)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    complement(24154..24177)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    complement(24307..24372)
FT                   /note="Predicted helix-turn-helix motif with score 992.000,
FT                   SD 2.57 at aa 201-222, sequence LRLAALAEQAGIPPGVFSVVPG"
FT   CDS_pept        complement(25022..26269)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BB2648"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1859"
FT                   /db_xref="GOA:A0A0H3LVU3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVU3"
FT                   /protein_id="CAE33141.1"
FT                   /translation="MSNNSPISIDGQRLWQSLMDLARIGATPKGGNCRLALTALDGQGR
FT                   DLVTGWMRDAGLTVRVDQVGNIFARRAGRDPSRAPVMTGSHIDTQPTGGKFDGCYGVLA
FT                   GLEVMRTLDDHGVQTDAPLEVAIWTNEEGSRFLPVMMGSGVFAGKFPLETALTARDAEG
FT                   KSVADELRAIGYAGADPVGGRAVDAYFEAHIEQGPILEHEDRIVGVVTGSLGVRWYDVV
FT                   VQGMEMHAGPTPMPIRKDALYAASHLLQAVVEIANAHQPHGRGTVGEIHAYPGSRNVIP
FT                   GQVRFTVDLRHEDEATLATMDALWRQACADTAARHAVSVQCEQVQYFAPTPFHPDLVGK
FT                   VRDGAQRRGLPAMDIVTGAGHDAVYMAAVAPTAMIFVPCKDGISHNEIEDAQPAHLEAG
FT                   CNVLLDAMVARANAPR"
FT   misc_feature    complement(25190..26218)
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 1.5e-19"
FT   misc_feature    complement(25775..25798)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(26279..27988)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BB2649"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1860"
FT                   /db_xref="GOA:A0A0H3LMQ2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ2"
FT                   /protein_id="CAE33142.1"
FT                   /translation="MTTPALPERNGGQILMQQLRVHGARRVFMIPGESYLPCIDALNEH
FT                   RGAIDAIVCRQESGAAYMAEAYGKLTGEPGICFVTRGPGATNASIGVHTAYQDSTPMIL
FT                   FIGQVGNDFMEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEFIARAFAVATSGRPGPV
FT                   VLALPEDTLWGRARVADMPRYQRARCLPGAADLARMVELLDQAERPFMLLGGTGWSAEA
FT                   IGQAAAFAERFELPVGTAWRRLECFDQRHPNAAGHVGWAMAPELRQRIAGADLVLAVGT
FT                   RMGEATTEGYTVIESPLPRQRLVHVYPDPNELGRVFAPTLGIVADPAGFAAALDALRPG
FT                   HRASRAQAVRAAHDEYLATLAPLPSPGPLNLDSAAAYVNQHIPADACITVGAGNYALYP
FT                   HRYRQFSGPGTSLAPTVGSMGYGLPAAISAKLENPARTVVCYAGDGCFQMNMQELGVAL
FT                   QYRVGVVVLVFNNGIWGTIRAHQEREFPGRAIALDFQNPDFTQFVRAYGGYGEAVERTE
FT                   DFGPAFERARAFAEREQLPALLEIRYEADGIAPGQTLTEIRQAAQAQAAGVQ"
FT   misc_feature    complement(26366..26899)
FT                   /note="HMMPfam hit to PF02775, DE Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 6.9e-30"
FT   misc_feature    complement(26921..27415)
FT                   /note="HMMPfam hit to PF00205, DE Thiamine pyrophosphate
FT                   enzyme, central domain, score 2.7e-09"
FT   misc_feature    complement(27449..27970)
FT                   /note="HMMPfam hit to PF02776, DE Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 3.9e-49"
FT   CDS_pept        complement(27985..28923)
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BB2650"
FT                   /product="citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1861"
FT                   /db_xref="GOA:A0A0H3LMQ0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ0"
FT                   /protein_id="CAE33143.1"
FT                   /translation="MTPISNPGGQRRPASLRRSWMFVPGLLEQAQAAGLASGADALVAD
FT                   LEEFTAPADRPAARRRIVALLAQCRAAGVIGAVRINKLEEDGLDDLRGIMAGAPDAIFL
FT                   PHAESAAQIAALDRAISACEAEAGLAPGSTEIVPTLESALGVTRACEILTASPRVSACL
FT                   LAAEDLTASLGAERGPDGIELHALRARFLVDCVAAGCLPIDCPFNYRDPAAQQADLLWA
FT                   RRIGLKSKCAVFAEQVPAIHAAFTPDADRVAAARDLAARFEAQRDGRDAGGARVDPPDY
FT                   NTARRLLARHAEFEQWAARAARPRESQGEQS"
FT   CDS_pept        complement(28920..30203)
FT                   /transl_table=11
FT                   /locus_tag="BB2651"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1862"
FT                   /db_xref="GOA:A0A0H3LTB9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTB9"
FT                   /protein_id="CAE33144.1"
FT                   /translation="MSTGALFLMGVFTVTVLIDMPIAFGLVLACLAYLAVYDAAPMMVA
FT                   AQQYVVGLDSFTLLAIPLFILAAQLMNGAGLTQRIVRLCAAIVGDIKGGLAVVAVLACL
FT                   MFGALSGSGVADVIAIGSLLLPAMARSGYDKGFSCALIGSAGATSTIIPPSIVLIVYGT
FT                   ITDTSVGKLFLAGIIPGILLGASLIVVAIWQARKHNWAGGQPFSWGELRAAAIDALPAL
FT                   MVPVLIIGGIRFGIFTATEAASSAIVYALLVGFFWYRTLSLKSLWESLKSTGEGSASIL
FT                   LLIGASGLFAWVLVAEQVPQALSGLLVDWTDSKIAVLLVLTVVLLLLGTFMEAIPVIII
FT                   VAPVVMPVLAHYNIDPVHFGILLSINMAIGANTPPVGVDLMAACKIGGINMMQTLRPLS
FT                   WMMLAMTAVMLLLTFVPELVLFLPRHVQ"
FT   misc_feature    complement(join(28944..29012,29070..29138,29166..29261,
FT                   29319..29378,29421..29480,29493..29561,29619..29687,
FT                   29721..29789,29817..29876,29880..29948,29991..30059,
FT                   30093..30161))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2651 by TMHMM2.0 at aa 15-37, 49-71, 86-108, 110-129,
FT                   139-161, 173-195, 215-237, 242-261, 276-295, 315-346,
FT                   356-378 and 398-420"
FT   misc_feature    complement(29328..29804)
FT                   /note="HMMPfam hit to PF00597, DE DedA family, score
FT                   1.3e-06"
FT   misc_feature    complement(30117..30203)
FT                   /note="Signal peptide predicted for BB2651 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.782) with cleavage site
FT                   probability 0.234 between residues 29 and 30"
FT   CDS_pept        complement(30207..30689)
FT                   /transl_table=11
FT                   /locus_tag="BB2652"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1863"
FT                   /db_xref="GOA:A0A0H3LNS9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNS9"
FT                   /protein_id="CAE33145.1"
FT                   /translation="MLGRISHALSGLSKAIAALAVALLAALITYVVFERFVMHTTPHWA
FT                   EELPRLVLVWAAFIGGVTCSHERTHLMAGLLPFVVRNPRALAICDRVNQALIIVGLAAL
FT                   GYAGWQLAELTMDQTLPALDVSAGTVYLALPVACAITIVVHLAQLFQPADPVAAKD"
FT   misc_feature    complement(join(30243..30311,30354..30407,30591..30647))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB2652 by TMHMM2.0 at aa 15-33, 95-112 and 127-149"
FT   misc_feature    complement(30615..30689)
FT                   /note="Signal peptide predicted for BB2652 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.895 between residues 25 and 26"
FT   CDS_pept        complement(30690..31685)
FT                   /transl_table=11
FT                   /locus_tag="BB2653"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1864"
FT                   /db_xref="GOA:A0A0H3LVU9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVU9"
FT                   /protein_id="CAE33146.1"
FT                   /translation="MKTMQLTRTLTSLFAAAGLALAIAPAAHALDIKLGHVLAPSHSWN
FT                   KAAEGFAAEVKEKTAGRVNFILFPSGQLGNEKTMLEGLQIGSQGAAIIGSGSLQPIEPK
FT                   FGIVELPYTWTTSQQAYKAYDGELGAALAKLAEKKNLVIVSWWENGFRHLTNNRGPVNT
FT                   PADLNGLKTRVTPDKMRLDTFTALGANPAPLAFGELYSALQQKVFDAQENPLSIIYTSS
FT                   FFEVQKYLSLTGHVWGPASLIVSKPIWNRISADDRKIVQAAADKWRDAQRQMITEGDLQ
FT                   FVAQLKEKGMQVNEVDKAPFAAAVAPIWKTYETAYGPELMGLLQKYREAK"
FT   misc_feature    complement(30738..31586)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 2.2e-99"
FT   misc_feature    complement(31596..31649)
FT                   /note="1 probable transmembrane helix predicted for BB2653
FT                   by TMHMM2.0 at aa 13-30"
FT   misc_feature    complement(31599..31685)
FT                   /note="Signal peptide predicted for BB2653 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 29 and 30"
FT   CDS_pept        complement(31849..32568)
FT                   /transl_table=11
FT                   /locus_tag="BB2654"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1865"
FT                   /db_xref="GOA:A0A0H3LMQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ7"
FT                   /protein_id="CAE33147.1"
FT                   /translation="MGSFQAVAPTRLYRMIADQIAGRIRAGDFPAGGRLPAERELAEQL
FT                   QVSRASVREALIALEIEGYVEVRVGTGVFVAAPRADGDYGVAPAPQPGHTDIGPFDLLD
FT                   TRLLLEPECASLAAQKASPAQIAAISSAHAAMSLSDSPGAHDQAFHGAIAAACGNAALA
FT                   AAISHIWHLSATSPVFSRLEQHFVTTKVWEAAEREHERILAAIVDRDPIRARHAMHDHL
FT                   VGILARLREDFGSGAIR"
FT   misc_feature    complement(32344..32523)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.3e-24"
FT   misc_feature    complement(32392..32466)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        complement(32685..33068)
FT                   /transl_table=11
FT                   /locus_tag="BB2655"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1867"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ4"
FT                   /protein_id="CAE33148.1"
FT                   /translation="MKPAIHLKRAYEAAAPADGRRVLIDGLWPRGLRKDALPLDDWIKD
FT                   LAPSAALRQWFGHQTPRWPAFRERYLAELRGPSHQAQLRALLAQAGAGPLTLVYGARDT
FT                   EHNNAVVLREALLALAAGGRGAA"
FT   CDS_pept        33123..33605
FT                   /transl_table=11
FT                   /locus_tag="BB2656"
FT                   /product="putative cytochrome"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1868"
FT                   /db_xref="GOA:A0A0H3LTC2"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTC2"
FT                   /protein_id="CAE33149.1"
FT                   /translation="MRRFPGRMLKWLVLACGLATAAGLLAWRLAPSSDYIAPAAGQDRL
FT                   RGQAIYQANCAACHGARLEGQPDWRQRLASGRLPAPPHDASGHTWHHPDAVLLDIIRHG
FT                   MVPGRHAPDGYHSDMPAYAGVLSDAEIALVLAYIKSTWPSQVQQDQRAATQQMTPR"
FT   misc_feature    33123..33200
FT                   /note="Signal peptide predicted for BB2656 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.304 between residues 26 and 27"
FT   misc_feature    33246..33548
FT                   /note="HMMPfam hit to PF00034, DE Cytochrome c, score
FT                   0.00056"
FT   misc_feature    33285..33302
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        complement(33618..35315)
FT                   /transl_table=11
FT                   /locus_tag="BB2657"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:Q7WJ43"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WJ43"
FT                   /protein_id="CAE33150.1"
FT                   /translation="MQAFVQFLGSNPYILLFLTIGLAVWVGKFSIKGYGLGAVAAAIVV
FT                   GCLVATVGAAYGVKFHLDEFAKSLLYYLFMYGVGLRVGPSFVNALNKESINYAILAIIA
FT                   PILGLAIVVLGTQFFGLPLGAAGGMLAGSQTMSAAIGSAEQAVSAGVLSLGSESPEQIS
FT                   AMIALSYGITYIWGTVGIILLCKYLPRIWGVDAKAAALEFEKAHGVPNVDDAGLTAFHP
FT                   FDLRAYRVENPESIGKTVQQFRTRFPQYQVVNVERGDQLLGPSAETVLQQGDVVALGGR
FT                   LEEMTANMGVLGPEVPDARALNIPLDQAEILVTNKEVTGRPLKTFRGSELAGQIQLQRV
FT                   ERSGVPLPIGLETTLQKRDVLFVTGLQPAVSKAGEIFGVIARHSSATDLLTLSFGMILG
FT                   FLIGLIEVPAFGAKVGLGNAGGLLLSGIIVSSISSRLRFFGNTPNAARNILEDLGLIGF
FT                   VAIVGINAGADLLTQLTGAIALKIFIVGFLASTIPPIIVWAIGFHIMKINPALLMGATA
FT                   GARSHSGPAREAAKEVGSSVPWLGFPVGYAVSGVLLTVFGYFAMVLAH"
FT   misc_feature    complement(join(33633..33701,33804..33872,33900..33959,
FT                   34020..34073,34083..34151,34764..34832,34959..35027,
FT                   35046..35114,35151..35219,35238..35306))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2657 by TMHMM2.0 at aa 4-26, 33-55, 68-90, 97-119,
FT                   162-184, 389-411, 415-432, 453-472, 482-504 and 539-561"
FT   CDS_pept        complement(35420..36793)
FT                   /transl_table=11
FT                   /locus_tag="BB2658"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="GOA:A0A0H3LNT3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNT3"
FT                   /protein_id="CAE33151.1"
FT                   /translation="MSKSPEQMTPYDQFNIEVPEDHFPVEGMSARAAQALVLSDEWTDT
FT                   NPMLNMSSFVTTFAEPEAVRIAEKNMYKNYIDHDMYPQLFAMEQRMVRWLHQLWNGPKD
FT                   AEPYGTATVGSSEACMLAGLAHKWNWRQRREREGKDATRPNMVTGGNVQIVWKKFLRYF
FT                   DVEPRIVPLKPGQYCLTAEDLDKYVDENTIAVVAIAGQTFTGEDDDIQGIHDWLDAYEK
FT                   KTGVSVPMHIDGASGGFVNPFLYPDYKWDFRLPRVQSINASGHKYGLTPPGLGWVIFRE
FT                   RKVFNEDLVFYVNYLGGEMPTATLNFSRNSFQVAVQYYQFLRLGFDGFKRVMQRTLDNA
FT                   IALRQHLVDSGYFTIMNDTQRIPVVAVTLDPKVKKFNEFDVSNKVRERGWVISAYTMPP
FT                   DAESVRSLRVVVRPHINRNVALLLAEDIVKACKYLEQHGGTATPPALHDTHKSSPAKC"
FT   misc_feature    complement(35678..36739)
FT                   /note="HMMPfam hit to PF00282, DE Pyridoxal-dependent
FT                   decarboxylase conserved domain, score 3.7e-50"
FT   CDS_pept        complement(37199..39052)
FT                   /transl_table=11
FT                   /locus_tag="BB2659"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LVV4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVV4"
FT                   /protein_id="CAE33152.1"
FT                   /translation="MLHQEERRRIRFYPRALDRVGAAREGTRHPTASRRAFLAPMLQAP
FT                   ASAPEDLPRASAEAAPPPSHPGVLAPFGYPAFRMIWIANLFANLGIWAQSVAAAWIVTE
FT                   AQSGPLIVAMIQVAAALPLVALSIVTGVVADNHDRRKVMLVGMGLELVVGTLITALAFL
FT                   GLLHPVSLIVAVFVVSIGSAIVTPAWQAAVSEQVPRQYVGNAVLLNSVNYNVARAIGPA
FT                   IGGVLLGALGAPWVFLLNCFCYGALIWAIWRWRRETPPRTLPPERIYEGVVAALRFTEY
FT                   SNVTRLVMMRAFSFGLSASALWALLPVLAHEHDNGSASLYGYMLGALGLGAIAGSLGIR
FT                   AVQRRLGVSRLISVAAALLALGLIALGVTENLWVVFPALLLSGSCWIAVLATYNATVQL
FT                   LVPDWVKARALALYQTAIFGGLALGSFIWGHFAGSMGTRGAMAAAGVALLFTVALLYRS
FT                   RLPDHVDDKCLSVLPRAALPAGQSDFDARHGVVLVSIEYRIAAERARAFIDAAGPLRLM
FT                   RMRNGADQWQLFRDLEDAERWSEMFVVDSWLQYLRMNDRMTLADKMAIDAAQAFHSGPN
FT                   PPQVTHAVSYISVSAAGGRGHAAPPAPAGPAQAAMGPVTAD"
FT   misc_feature    complement(join(37685..37738,37766..37834,37871..37939,
FT                   37949..38017,38036..38095,38123..38191,38297..38356,
FT                   38369..38437,38474..38542,38555..38614,38651..38719,
FT                   38747..38815))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2659 by TMHMM2.0 at aa 80-102, 112-134, 147-166, 171-193,
FT                   206-228, 233-252, 288-310, 320-339, 346-368, 372-394,
FT                   407-429 and 439-456"
FT   misc_feature    complement(37778..37825)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT   CDS_pept        39165..40667
FT                   /transl_table=11
FT                   /locus_tag="BB2660"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LMR2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR2"
FT                   /protein_id="CAE33153.1"
FT                   /translation="MVTALGIVAALGIVIAVASILAQDRQQVWEREARSARNVLQALAG
FT                   EFERTVTAYDLVIRGVIGDLAQPAVAAMGPEALHRLLFQQGARPDNLAVLLVLDERGEV
FT                   ILDSRTAVVAPRNRSRRDYFQAHVDNPQAGLFISKPYRSRNRNGELSIALSRRLAHPDG
FT                   SFAGVVVAAVSLSYFRDRVVQLNVGPRGSMTLFRDDGIVISRKPYVEAQIGVDLSESAN
FT                   VSRFRREGRGAFVGTAILDGVERLYQFERVGKLPLIMVVALSTDDMMTPWRRHAWVLAS
FT                   AVLLLCALLVALLAALERELRRRRNAEAELAQLARIDTLSGLLNRRAFAQVLALEWEAA
FT                   LRGRTPLALLLVDVDHFKAYYDCYGRSASDVLLRRVADAVRDCVPYAANVVARHGADEF
FT                   VVLLPGMGLRSAAWLAERVRARVLGLAVPHRGNRGGVVSVSIGCTAMTPLAGSEAAVLV
FT                   ERADAALYLAKSRGRNRVERIGDPSTAGQGAEREMAQEPGGP"
FT   misc_feature    39165..39230
FT                   /note="Signal peptide predicted for BB2660 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.922 between residues 22 and 23"
FT   misc_feature    join(39174..39227,39987..40055)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2660 by TMHMM2.0 at aa 4-21 and 275-297"
FT   misc_feature    40095..40589
FT                   /note="HMMPfam hit to PF00990, DE GGDEF domain, score
FT                   1.2e-43"
FT   CDS_pept        40772..41323
FT                   /transl_table=11
FT                   /locus_tag="BB2661"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /db_xref="GOA:A0A0H3LMQ9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ9"
FT                   /protein_id="CAE33154.1"
FT                   /translation="MTSDSPTFPVAAQLPALRAYARTLTRNPHDAEDLLQEALTRAYER
FT                   RHTLRADGNLRAWLMAIVHNVFASEWRRRQAAPAQAAPLHDMEDAAAVAPPQEHSVRLA
FT                   QIERAFMQLPDDQRAALHLVTIEGMAYQEAADALQIPIGTLMSRLGRARAALRRFEDGM
FT                   GEAAADRRARFRIVGGRDAA"
FT   misc_feature    40826..40993
FT                   /note="HMMPfam hit to PF00776, , score 8.2e-13"
FT   CDS_pept        41328..42119
FT                   /transl_table=11
FT                   /locus_tag="BB2662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTC5"
FT                   /protein_id="CAE33155.1"
FT                   /translation="MTEIDLNAYVDGQLDPARRIEVEDFLSRHPEEAMRVMADLRQRDA
FT                   LRWALGASQQAPADGADTPTAVHTRRLARRLERGLVRRGLGDRLRQAAAAVLLVAVGWA
FT                   GHVGYAARYPDMRHVVAATAPSFVEDAVQAHRTAKVRAAMASQPRVPHLDADELLRATG
FT                   VRVPALPASWAVRDVQVFPGRTGPSVEMEVEAAGLGRLWVFAAREPAHAAEAAPVVSRF
FT                   QDAPIAYWQQGQWAYAITGDLPDAELGRAAGQMTVAMLATP"
FT   CDS_pept        42208..42930
FT                   /transl_table=11
FT                   /locus_tag="BB2663"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNT9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNT9"
FT                   /protein_id="CAE33156.1"
FT                   /translation="MLEFFQTLSWAAVFQIILIDILLGGDNAVVIALACRNLEPKQRMQ
FT                   GILWGTAGAIGLRVVLIAFALTLLTVPYLKIVGALLLLWVGVKLLIPEDDAHGNIKGGT
FT                   SIAAAVKTIIIADFVMSLDNVIAIAGAAQGAAQEHQLGLVIFGLVVSVPIIIWGSTLVL
FT                   KLIDRFPMVVTFGAALLGWIAGGMLVTDVVVVERFGEVSGVAKIAAEVAGALLIVGLGR
FT                   WFARRKAAAAPQTARESA"
FT   misc_feature    42220..42855
FT                   /note="HMMPfam hit to PF03741, DE Integral membrane protein
FT                   TerC family, score 2.4e-44"
FT   misc_feature    join(42238..42306,42343..42411,42523..42591,42628..42696,
FT                   42724..42792,42811..42879)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2663 by TMHMM2.0 at aa 11-33, 46-68, 106-128, 141-163,
FT                   173-195 and 202-224"
FT   CDS_pept        complement(43109..44320)
FT                   /transl_table=11
FT                   /locus_tag="BB2664"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="GOA:A0A0H3LVV6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVV6"
FT                   /protein_id="CAE33157.1"
FT                   /translation="MNLPDILVVEDHPAHRLVVVHALRALGYTRILEAADGNEALRRLD
FT                   EHGQVGIAICDIKMSGMDGAQFLRVAARRQLLGAVIISSDVSSDLIAAVLDMAALIGLR
FT                   VLGDLAKPLDAQRLKALLDRHEAERQRARANAAPTASRQPPAPPAREVARALAAGQIVP
FT                   YFQPKVDLLTLRPCGAEVLARWRHPDLGVLGPASFLEALKEQDLLDRLIWHLTDAALGQ
FT                   ARLLATAGATQDLALNFETSQLGSAELLPTLAQALRKHALPASIVTIEVTENGLLDAPA
FT                   ATLENLVRLRLMGCTVSIDDFGTGFSSMQRLCHLPFNQLKIDASFVRRLPGDARSESVV
FT                   AATLAMAERLGITVVAEGIENPPQHQALLQLHCRQGQGYLFARPMSGPDYARWLDGAAS
FT                   AAAG"
FT   misc_feature    complement(43154..43879)
FT                   /note="HMMPfam hit to PF00563, DE EAL domain, score
FT                   9.3e-74"
FT   misc_feature    complement(43931..44311)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 7.3e-12"
FT   CDS_pept        44634..45143
FT                   /transl_table=11
FT                   /locus_tag="BB2665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR6"
FT                   /protein_id="CAE33158.1"
FT                   /translation="MVLRGALVAQTSALAWAREDRAALEASLPGLPRRRVLARRLDFLM
FT                   ERVQSLLRARSGGTPGPALMVDASAKSVLCVGAGGAAARAARAAIERAGGRFLHHDGEV
FT                   GDAAGLEASLVSADLVICQTGCVSHGAYWRVQDHCKRTGKQCVLVEQPAALNIVRVRRP
FT                   ADAPQD"
FT   CDS_pept        45210..46061
FT                   /transl_table=11
FT                   /locus_tag="BB2666"
FT                   /product="putative transmembrane regulator"
FT                   /db_xref="GOA:A0A0H3LMR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR4"
FT                   /protein_id="CAE33159.1"
FT                   /translation="MRYAFVHLAQSVPPGGRAPIVKGGPADPIADVELDAYIDGQLDSA
FT                   RRADVEAFLARDARAAARVSADLRLRDALRQGATRHGAGARDAHTRALADRLQAAHARR
FT                   RVARRARRLLAVAILVAAGWAGHAALTAWTPAEPAGDAGVQVFLDEAMRAHRTAQLRAG
FT                   MRSQPAAPRLDRAELARQAGVPLPAWPWDWLPRDVQVFPSRGGPAVEVALLAGRAGPIS
FT                   LYGAPGGAGPDSAPRMARGAGAEALFWWRRGAWVYAVIGALPEAALRPLAQRLADAPLV
FT                   HE"
FT   misc_feature    45546..45614
FT                   /note="1 probable transmembrane helix predicted for BB2666
FT                   by TMHMM2.0 at aa 113-135"
FT   CDS_pept        46255..46692
FT                   /transl_table=11
FT                   /locus_tag="BB2667"
FT                   /product="putative universal stress protein"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTC7"
FT                   /protein_id="CAE33160.1"
FT                   /translation="MYQHILIPIDGSDLANTAIDKGLALAKALGARVTVLTVVEPYPHM
FT                   AAEAVQLGGLRKEYEKQVHARASEWLEPAGAKAAAAGVPCELLKRDADMAFRAIVETAA
FT                   ERGCDLIAMASHGRGGVAAVLLGSQTQKVLAHSQVPVLVYR"
FT   misc_feature    46255..46686
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00582, DE Universal stress protein
FT                   family, score 7.4e-14"
FT   CDS_pept        46793..47782
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /gene_synonym="aruE"
FT                   /locus_tag="BB2668"
FT                   /product="putative succinylglutamate desuccinylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1176"
FT                   /db_xref="GOA:A0A0H3LNU4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNU4"
FT                   /protein_id="CAE33161.1"
FT                   /translation="MNTPTPVSTDYLRAHQFLGLQPGPRLLVLGAVHGNEVCGTRAIER
FT                   ILAELESGALAITRGQLTLLPVTNPLAYRKGERQGDRNLNRNLRVCATPTDYEDRIGNA
FT                   LCPLLQAHDVLLDLHSFHTGGQPFAMLGPRDNQEALEPFAHAREEARLVAHLGPRRVVE
FT                   GWMQAYERGVRRRREQNPGAPAALLDAAYGVGSTEYFRAHGGYGVTLECGQHDDPAAPE
FT                   VAYRAIRQTLALLGLADIALEPPRRDFETLCLVDVVDREADGDAFARPWASFDPVRQGE
FT                   LVGTRADGRQVLAPRDGYVVFPNPRALAGNEWFYFAVASDRLGEDAGN"
FT   CDS_pept        47866..48234
FT                   /transl_table=11
FT                   /locus_tag="BB2669"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1175"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVW1"
FT                   /protein_id="CAE33162.1"
FT                   /translation="MSKSIVLTLAAVALATQAGLAQAQYVGPSSNQQMSVKELLDTARD
FT                   DAVVTLRGKLVKQLSDDTYLLDDGTGRVQVEIDRHLFPPNQPVDANTLVEVSGEFDKEV
FT                   IGTSEVEVKALRILGAAK"
FT   misc_feature    47866..47934
FT                   /note="Signal peptide predicted for BB2669 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.656 between residues 23 and 24"
FT   CDS_pept        complement(48312..48920)
FT                   /transl_table=11
FT                   /locus_tag="BB2670"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS1"
FT                   /protein_id="CAE33163.1"
FT                   /translation="MGRRARRPGSGRRFFGHGGYDPRHGDLIRLPLHFYKFPAAELPGA
FT                   RPGPTLYRLASEHAMEIAALTWSTPLARLAPVPPRTPAAPPSHDWPHAAPSVRPHGAAG
FT                   PAAAPADLLRDLHAQARMARAVAAYQAEQAARQTAARSPCAAQDLGDIDCLMVLQAYRV
FT                   AMPNAPVQDLQGMPPAAQRGSPAVGPIARTGPADQQIRR"
FT   CDS_pept        48989..50581
FT                   /transl_table=11
FT                   /locus_tag="BB2671"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1172"
FT                   /db_xref="GOA:A0A0H3LMR9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR9"
FT                   /protein_id="CAE33164.1"
FT                   /translation="MPMPFEWMTDPTAWLGLATLIVLEIVLGIDNLVFIAILADKLPAH
FT                   QRNRARMIGLTLALLMRLGLLASIAWVVTLTAPLFTVWGAQISGRDLILILGGLFLLFK
FT                   GTMELHERVEGNAHAGGGGRTQYAAFWQVIVQIVALDAVFSLDSVITAVGMVQDLSIMM
FT                   TAVVVAMIVMMVASRPLMAFVARHPTVVILCLGLLLMIGFSLVAEGLGFDVPKGYLYAA
FT                   IGFSILVEACNQLARRNLARGAHALGRRQRAAHAVLRLLQAGREGRAHPEEVAALVADT
FT                   GEGPLFAPEESTMIERVLAMGERDVRSIMVPRADMVWLDVRDPRHVVLEKFALGHARLP
FT                   LCAGDPGNVLGVVHLRDLLPRLSAPGPVDLVDAARPAAYVSETTPIPQLLQQMRDLRQH
FT                   LLLVVDEHGVCVGLATPLDVLTAVAGELPDAGDADPPSASRLPDGGWSLDGRLAVEEVA
FT                   RLLQAPDLRRDYPDATLAGCLLRASGAIPEEGQGMDWRQWRFEVERRVGPRIERVRATR
FT                   RVEALADELAGPA"
FT   misc_feature    49016..49690
FT                   /note="HMMPfam hit to PF03741, DE Integral membrane protein
FT                   TerC family, score 2.2e-82"
FT   misc_feature    join(49031..49099,49145..49213,49226..49294,49388..49456,
FT                   49469..49537,49556..49624)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2671 by TMHMM2.0 at aa 15-37, 53-75, 80-102, 134-156,
FT                   161-183 and 190-212"
FT   misc_feature    49916..50077
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score
FT                   1.9e-05"
FT   misc_feature    50099..50260
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score
FT                   1.9e-06"
FT   misc_feature    50303..50545
FT                   /note="HMMPfam hit to PF03471, DE Transporter associated
FT                   domain, score 7.3e-11"
FT   CDS_pept        complement(50596..51174)
FT                   /transl_table=11
FT                   /locus_tag="BB2672"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1171"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="PDB:3BYQ"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTD0"
FT                   /protein_id="CAE33165.1"
FT                   /translation="MSLIEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRY
FT                   EPDLMPFMAELRSLGTLLATELVDTLGKDNIEVYSKAAIVGVDGEMEHGAVWHEAGGWA
FT                   MRSVLGEPKAMVPAVKAVATAGYRMMVPVHYIHASYVRSHFNSIEIGIQDAPRPREILF
FT                   ALVMGTGARVHARLGGLTKEAVSVHDGQR"
FT   CDS_pept        complement(51199..52152)
FT                   /transl_table=11
FT                   /locus_tag="BB2673"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1170"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNV0"
FT                   /protein_id="CAE33166.1"
FT                   /translation="MFKPLFATAALALAIGQATAAYPERPIRMVVPFPPGSITDVVARS
FT                   LGQGMAAELGQPVVVENKPGANGIIGTQDVVKAQPDGYTLVVVGVSTAASGVSLFKNLP
FT                   YDPARDLTPIGAVAETPYLLVGGQDVAGKTVADLYDYGRQHPGKLTYAYGSGSAQVFGA
FT                   KLAAMGDITVTPVPYRGGPQALTDVIGGTVDLTFTDLANGLQQARAGKVKVYGVSTPGR
FT                   FALTPDIPTLNESGAPGFDLTVWFGLMGPAGLPPAVTERLAGALDKALAAPELTQTYAR
FT                   QGLSVKTQGPAAFGAFVRSEIDKWAGIVKETGIAPQ"
FT   misc_feature    complement(51211..52029)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.7e-82"
FT   misc_feature    complement(51751..51774)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(52093..52152)
FT                   /note="Signal peptide predicted for BB2673 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.904 between residues 20 and 21"
FT   CDS_pept        complement(52192..53109)
FT                   /transl_table=11
FT                   /locus_tag="BB2674"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1169"
FT                   /db_xref="GOA:A0A0H3LVW5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVW5"
FT                   /protein_id="CAE33167.1"
FT                   /translation="MMQTLGFVGLGMMGLPMLENLAGDERWQILAYDRSPAPFERLAGH
FT                   PAWGKRLRAAAGLHELAACDAVITMLPNSAITNAVVLGGDGQPGLIDLLESGAAIVDMG
FT                   SSNPADTRRLSEQLAARGLTLIDAPVSGAVAKASTGTLAIMAGAAEADLRRVRPILERM
FT                   GAAIIHTGAVGSAHAMKALNNYVYAAGLLAVSEAMVIARRMELDLEVFTDVLNASSGRN
FT                   VASETKLRQFIIPGTYNGGFALALMAKDLGTAQSLQALTGVQADQLALCAELWRQALAQ
FT                   LPGGADNTEIHRFLAQRTPATEPA"
FT   misc_feature    complement(52585..53106)
FT                   /note="HMMPfam hit to PF03446, DE NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 4.1e-06"
FT   CDS_pept        53231..54157
FT                   /transl_table=11
FT                   /locus_tag="BB2675"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1168"
FT                   /db_xref="GOA:A0A0H3LMS6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS6"
FT                   /protein_id="CAE33168.1"
FT                   /translation="MEMRRARVRFKLRQMEAFRAVMLTGSMNGAARLLFVSQPAVSRLI
FT                   AHAEQSLGLRLFERDKGKLTPTAEAQRLFEEVGQLFDEALRIDELARDLAERPEGELKL
FT                   CSSPSLALNFLPPVIARYVNEHPRVRLKYHTTLLSDMAHELLGRKVELAVSVLPIDNPN
FT                   LVVEPFATGHMVCILPQGHALARQDSVGLAELARNRLVLYSRNIPFGQLVAAAFQRANV
FT                   PWRATVDIVRAELACALVRSGVGVAIVDEFSVAGGGWPGIEVRPLREPIPLALSLVRSR
FT                   FERPGRQAQRFVKLLKEHAQRRAAAVQ"
FT   misc_feature    53264..53443
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 4.5e-19"
FT   misc_feature    53303..53368
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1443.000, SD 4.10 at aa 25-46, sequence
FT                   GSMNGAARLLFVSQPAVSRLIA"
FT   misc_feature    53513..54133
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.1e-42"
FT   CDS_pept        complement(54165..54911)
FT                   /transl_table=11
FT                   /locus_tag="BB2676"
FT                   /product="putative adolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1167"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS5"
FT                   /protein_id="CAE33169.1"
FT                   /translation="MPPSAPTDSARSLYQDTAVAALRDDLALALRAAAHHGLGEGVCNH
FT                   FSVALPGQAGAFLLNPRGLMWSEVRAEDIVLVDAAGNKLAGRHEVEPTAMFIHAAIHQV
FT                   AGKACVLHTHMPYATALTLTEARMLDTTLSQNAMRFHGRVAADRRYNGLALDAAEGERI
FT                   ARAMDGADIAFLGNHGVVVCGERIDYAFDDLYYLERACCAQVLAESTGRPLVPVDAALA
FT                   ASVAGQARSERLQSTLFFEALRRALG"
FT   misc_feature    complement(54237..54842)
FT                   /note="HMMPfam hit to PF00596, DE Class II Aldolase and
FT                   Adducin N-terminal domain, score 1.4e-25"
FT   misc_feature    complement(54867..54896)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   CDS_pept        55238..56179
FT                   /transl_table=11
FT                   /gene="ldcA"
FT                   /locus_tag="BB2677"
FT                   /product="putative muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1166"
FT                   /db_xref="GOA:A0A0H3LTD4"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTD4"
FT                   /protein_id="CAE33170.1"
FT                   /translation="MPALRAGARIAIVAPASAIAGAADEAAEWLLERGYEPQVMPAARA
FT                   RLAPPFDYLAGDDAARLADLHAAFADPAVGAVWCLQGGFGSWRVLDQIDYGLLRRHAKP
FT                   FIGYSDVTALHLAIQRYAGFVTFHGPMLAQDLLAGRQAPTEQALLDMVSGRLGAGSWIA
FT                   APPQARLATLASGVATGRLIGGNLALLAALTGTRYAIDARDGILFFEDVNEALPRVDRM
FT                   LAQLRRAGAFDGVRGVLVGSFTRLLGVPGDGEAAQAALYPLVREHFQARGIPVLAGWPS
FT                   GHGDPNLTLPLGARVTLDAGRGALRLEQPVAV"
FT   misc_feature    55238..55303
FT                   /note="Signal peptide predicted for BB2677 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.981) with cleavage site
FT                   probability 0.671 between residues 22 and 23"
FT   misc_feature    55472..56161
FT                   /note="HMMPfam hit to PF02016, DE Uncharacterized protein
FT                   family UPF0094, score 1.5e-61"
FT   CDS_pept        complement(56255..56377)
FT                   /transl_table=11
FT                   /locus_tag="BB2678"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1165A"
FT                   /db_xref="GOA:A0A0H3LNV5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNV5"
FT                   /protein_id="CAE33171.1"
FT                   /translation="MLLTLYFLAWPVVSAAVLLVLIVTLWRDIRDARATGKSMI"
FT   misc_feature    complement(56300..56368)
FT                   /note="1 probable transmembrane helix predicted for BB2678
FT                   by TMHMM2.0 at aa 4-26"
FT   CDS_pept        complement(56406..58304)
FT                   /transl_table=11
FT                   /locus_tag="BB2679"
FT                   /product="sodium/solute symporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1165"
FT                   /db_xref="GOA:A0A0H3LVX0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVX0"
FT                   /protein_id="CAE33172.1"
FT                   /translation="MCLDACLTPGLADRDPVGRACDRAYVIDRPVFRSAMGNCRPSHFR
FT                   GNGTHAAMNGESCAQRGKRTHKMQESEFFQLSGTTAVLLLVAFYGATFLMSLMIGQKKE
FT                   NVDGYMVSNSSVGFGLSAASMIATWIWAASFYASATSGFKYGLSGPIHYGFWGALMILF
FT                   IYPFGKRFRQLAPKAHTLAEVIHARHGASSQMIMAVSNIVGSCISLMVNFTAAGALVSV
FT                   LSPLSFIQGVLIAGLGVLSYTLWSGFRASVMTDFAQLVAMILAAVIIIPLIFFNAGGPD
FT                   MLQANMWRLSSEQADFFSTTAILEQGAPYFVAVLAYAIGNQTIAQRLFAVREDLIKPTF
FT                   LTATIGYGAVVIGLGMLGLLALFVGLEPVNGNMNNIIPQMASTYLPPVGIALFFILVVG
FT                   SLSSTADSDLAALSAIVMTDIYAKNLAGGRPDPRRMLWWGRATMIVATMVGVIFASLRL
FT                   DILVMLVFVGALWGAIVFPVIASFYWDRVSNSAFFWSVISAVVLFTIVRFELVPIEGAV
FT                   AVFYEICAAIGGGVVIGLMSFAFFGRVTALTLGTLATLILLPCFVGTLREYIVLLGSLT
FT                   AYGVSTVVCVALSLRNQERFDFSLLAERVTSFHYEKARMMGAKPAAPAAQPQPARG"
FT   misc_feature    complement(join(56535..56603,56616..56669,56688..56756,
FT                   56766..56834,56853..56921,56931..56999,57111..57179,
FT                   57222..57290,57348..57416,57474..57542,57561..57629,
FT                   57645..57713,57804..57872,57900..57968,58005..58073))
FT                   /note="15 probable transmembrane helices predicted for
FT                   BB2679 by TMHMM2.0 at aa 78-100, 113-135, 145-167, 198-220,
FT                   226-248, 255-277, 297-319, 339-361, 376-398, 436-458,
FT                   462-484, 491-513, 517-539, 546-563 and 568-590"
FT   misc_feature    complement(56808..57980)
FT                   /note="HMMPfam hit to PF00474, DE Sodium:solute symporter
FT                   family, score 1.5e-06"
FT   CDS_pept        complement(58538..59992)
FT                   /transl_table=11
FT                   /locus_tag="BB2680"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1164"
FT                   /db_xref="GOA:A0A0H3LMT1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT1"
FT                   /protein_id="CAE33173.1"
FT                   /translation="MPPSRHLPPITALLSFRLNQLAQAGAGLPHPTRAIAVAAILINVF
FT                   MATLESAIANTALPAIAADLGVSEASSIWVISAYHLAMVAALLPIASLGEIIGHRRISM
FT                   AGLVLFTLASLACGLAPSLPWLIAGRLAQGVGAAGILGVALAMTRFVYPREQLGRGLGL
FT                   NALVVSLSLAAGPTAASLILSLGSWHWLFLINVPLGLLGLALGVCALPPTPRSARRYDA
FT                   VAGLLCALFLALLVYTLNAYAHDVGAGGNTAYALATLAMLALLLRRQSGRGAPMLATDL
FT                   LRRPIFALSAAATLGAFAAQTLAFVALPFMLQSLLGYTQVQTGFLITPWPALAALSAAS
FT                   AGALSDRHPPGLLGGIGMAVLAAGLLSLVALPAAPDAFDLGWRMALCGAGFGFFQAPNM
FT                   RAMLADAPPERSGGASGMTSSSIMLGQSLGAALVAGLFTLRGAAAAPAALWLGVAFAVI
FT                   AGIASLLRLRHAAAAGAGARLDLTRV"
FT   misc_feature    complement(join(58598..58666,58871..58939,58958..59026,
FT                   59069..59137,59195..59248,59261..59329,59366..59434,
FT                   59447..59515,59534..59602,59612..59680,59699..59767,
FT                   59810..59878))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2680 by TMHMM2.0 at aa 39-61, 76-98, 105-127, 131-153,
FT                   160-182, 187-209, 222-244, 249-266, 286-308, 323-345,
FT                   352-374 and 443-465"
FT   misc_feature    complement(59921..59992)
FT                   /note="Signal peptide predicted for BB2680 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.798) with cleavage site
FT                   probability 0.491 between residues 24 and 25"
FT   CDS_pept        complement(60146..60925)
FT                   /transl_table=11
FT                   /locus_tag="BB2681"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1163"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT0"
FT                   /protein_id="CAE33174.1"
FT                   /translation="MNQVATQSSLAGRTALVTGASRGIGRAIALALGRRGATVAVHYNA
FT                   AREQADEVVQAIGAAGGRAWALRADLAHPDGAGALARDLRASLREQTGDEGLDILVNNA
FT                   GVSLRARLPEVSPQDFDRIIQVNLKTPFFLIQHLLPLLRDGGRIVNVSSMGTRAAYPEM
FT                   SVYAPAKAGLEALTLLLASDLGARGITVNAVLPGATATDMNTRARDPAMADALARDIAL
FT                   GRVGQPEDIADIVAFLASDQARWITGQRIDATGGQRL"
FT   misc_feature    complement(60155..60895)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 1.2e-72"
FT   CDS_pept        complement(61050..61934)
FT                   /transl_table=11
FT                   /locus_tag="BB2682"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1162"
FT                   /db_xref="GOA:A0A0H3LTE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTE2"
FT                   /protein_id="CAE33175.1"
FT                   /translation="MFMDMRFLHSFVTVAESGSIADAARRLGLAPTTVAQQIRALEADL
FT                   GSRLLTRAGRTVRPTVAGARIVDRARELLRGERDLRSAASDTGLPAGPMRLGATPTALM
FT                   GLVPPLLRRWMRAHPDIQIYIEPGTSSVLLERVMAGQLDAAILVHPNFELHKTCAWSLI
FT                   REERLVLLAPSALRVGNALRVAAREPFIQYDRKVVAGKMADEYLRAHGVRPKVQFELDG
FT                   IEHISALVAEGFGVSVLPDWPTLGPADARVRRWPLPDPCPSRQVGMVWLRSSVRSPLAQ
FT                   AFHAYLGAAAGAP"
FT   misc_feature    complement(61059..61676)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 8.3e-40"
FT   misc_feature    complement(61743..61922)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.9e-18"
FT   misc_feature    complement(61788..61880)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(61818..61883)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1838.000, SD 5.45 at aa 18-39, sequence
FT                   GSIADAARRLGLAPTTVAQQIR"
FT   CDS_pept        62034..63158
FT                   /transl_table=11
FT                   /locus_tag="BB2683"
FT                   /product="putative racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1161"
FT                   /db_xref="GOA:A0A0H3LNV8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNV8"
FT                   /protein_id="CAE33176.1"
FT                   /translation="MAIIKSIEVCVARVPMDKVTYLSNRTVVDRHYGLVKVRSADGVEG
FT                   IGFCYVGNQAGEIFRVAVEQLLGPVLIGRDSLAVEGLWREMYQEALLQGRMGTVMRALS
FT                   ALDIALWDLNARAANLPLHKYLGAVELDSVAAYASGGYYVEGKTAGQLGEEMASYVELG
FT                   FKAVKMKTGRWSPQGEESRVRAAREAIGEDVELMLDCNNGWVDTVQAMEYLRRMEPYNP
FT                   YFIEEPFSPDDVESHARLARLTRIPVATAEIGYGRWYHKQLLDMGAAAILQTDAAVCGG
FT                   ITEWKRIAAMAAGYGIQMCPHWFHDVHAPLAAATPNARYVEFFWDDQVLNFRRLVDRQL
FT                   EHKDGRVILHQTPGLGFGFDENAVARYGRWTTVS"
FT   misc_feature    62046..62414
FT                   /note="HMMPfam hit to PF02746, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   7.6e-19"
FT   misc_feature    62250..62291
FT                   /note="PS00213 Lipocalin signature."
FT   misc_feature    62427..63137
FT                   /note="HMMPfam hit to PF01188, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   7.9e-24"
FT   misc_feature    62454..62477
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        63204..64166
FT                   /transl_table=11
FT                   /locus_tag="BB2684"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1160"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVX4"
FT                   /protein_id="CAE33177.1"
FT                   /translation="MMKLRAACALAAALACGAVLAQDLGGKPLTLVVPFAPGGNADIVA
FT                   RSYAVPMARLIGATVVVDNRGGGGGAIGTAIVAKAPADGSTLLSATPGQLGTLPHMFKT
FT                   GYKSADFVPVGVVSKTSIALVVKHDDARFKTTEEFIAYARRNPGKLNVGHAGPGSPNHL
FT                   AMLQFENATGTRFTPIAYKGSGPALIDLLSGQIDVIFDQVSSSLPHLKAGKLSALLILG
FT                   PTRDPSIGQVRTLKEAGLPEFDASTYIGVLAPKGVPAETVAKLTSVIRQVADDPAFDSK
FT                   LREIGSGAFYADPADFARILQADEDLAKAMIQQGRLIDG"
FT   misc_feature    63204..63266
FT                   /note="Signal peptide predicted for BB2684 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT   misc_feature    63219..63251
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    63333..64154
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 5.9e-69"
FT   CDS_pept        64159..65013
FT                   /transl_table=11
FT                   /locus_tag="BB2685"
FT                   /product="putative 2-pyrone-4,6-dicarboxylic acid
FT                   hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1159"
FT                   /db_xref="GOA:A0A0H3LMT6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT6"
FT                   /protein_id="CAE33178.1"
FT                   /translation="MVERARLAEGGGWDCHFHVFDASRYMLAAGSAYQPEDASLAAFRG
FT                   VCRARGIGRAVLVHPSVYGADHSSYEDALAANGDWLRGVAVVYPDEATTPDARIEHWDL
FT                   LGTAGTRINRLFPGAPQHPERIVERVKPFGWHVQVLTDIVEDIGLVRRIAARDVPVVVD
FT                   HFGHHPHAQLLRSAGWQDLLALVREGAAWVKLSAPYRVGAQGPAWPGAQALVDQLVQAN
FT                   PRQLVWGSDWPHPPDHRHPFPAPDQAAIGATIAQWLPDAQLRRQVMELNPLRLYGGTRA
FT                   AGR"
FT   CDS_pept        65119..65529
FT                   /transl_table=11
FT                   /locus_tag="BB2686"
FT                   /product="putative dioxygenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1158"
FT                   /db_xref="GOA:A0A0H3LMT3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT3"
FT                   /protein_id="CAE33179.1"
FT                   /translation="MFSHVTVGVSDLARAGRFYDALLQPLGLRQRQTQPDGGPPSLCWV
FT                   RAGTSLPRFFAYMPFNGRPPSPGNGAMVAFLAETSEQVDRAHAAGLAAGGSDEGAPGPR
FT                   ARYGPGYYGAYLRDPDGNKLHVVHRSGPAAAG"
FT   CDS_pept        complement(65558..66769)
FT                   /transl_table=11
FT                   /locus_tag="BB2687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LTE6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTE6"
FT                   /protein_id="CAE33180.1"
FT                   /translation="MTQPAAGAGPLAGYTVLELGSTIAGPFCGRLLADFGARVIKVEAT
FT                   EGDALRSMGRHKGGHSLYALSLLRNKELVSIDLRQPDGQELVRELAARADILIENFRPG
FT                   ALEKWNLGYDVLSRANPGLVMVRISGYGQDGPYSGRPGYGVIGEAHSGLRSVTGDPDRP
FT                   PSRVATSLSDYITGLYGAFGALLALESRRRTGRGQVVDTALAECAFSFMEPHVMAYDQL
FT                   REVANRAGSRLPGSAPNNLYRCADGAYVHVTTLTNALFRRLAAALDAPELADDPRFAEP
FT                   GQRARHDAELDAAIQDWFSRHDCPTVLARLTQAEIPHAKIYGVDDVFADPHFQARGALA
FT                   RLPHPQLGEVTVPNVVPRLSETPGAVRSLGKDAGADTLAVLRDELGLDATRLDALRQRG
FT                   AIRA"
FT   misc_feature    complement(65981..66550)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   1.3e-71"
FT   CDS_pept        complement(66816..67040)
FT                   /transl_table=11
FT                   /gene="madF"
FT                   /locus_tag="BB2688"
FT                   /product="biotin protein"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNW2"
FT                   /protein_id="CAE33181.1"
FT                   /translation="MKKIPVKSEVTGNVWEVLKAGDDRVEEGETLIVVESMKMEIPVDA
FT                   PAAGRLVEITVQKGDAIGEGDVVAMLEVQ"
FT   misc_feature    complement(66828..67037)
FT                   /note="HMMPfam hit to PF00364, DE Biotin-requiring enzyme,
FT                   score 1.7e-11"
FT   CDS_pept        complement(67061..68425)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /gene_synonym="fabG"
FT                   /locus_tag="BB2689"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="Similar to Escherichia coli biotin carboxylase accc
FT                   or fabg or b3256 SWALL:ACCC_ECOLI (SWALL:P24182) (449 aa)
FT                   fasta scores: E(): 4.6e-68, 47.81% id in 435 aa, and to
FT                   Ralstonia solanacearum probable biotin carboxylase protein
FT                   accc1 or rsc2787 or rs00060 SWALL:Q8XVP3 (EMBL:AL646071)
FT                   (456 aa) fasta scores: E(): 7.7e-72, 50.7% id in 428 aa"
FT                   /db_xref="GOA:A0A0H3LVX8"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVX8"
FT                   /protein_id="CAE33182.1"
FT                   /translation="MNKILIANRGAVAARVARAVHEMGLRSVVVYSEADRDLPYVQMAD
FT                   EAYCIGPAPAAQSYLDQAALLDVLARTGADAVHPGYGFLSENAGFARAVDAAGAVFIGP
FT                   AARWIEAMGHKTRARELMARHGMPMCKSSAVLGEDEAGVLAAAREVGYPVMVKPAGGGG
FT                   GIGMIAAAGEAELLAAVARARSLAARSFGNGDIYLEQLFEQPRHIEFQILADRHGNARH
FT                   LYERDCSVQRRHQKVIEEARAPRVPTAETQALGERIAALLAELGYDVIGTVEMLRDQQG
FT                   RYSFLEMNTRLQVEHAVTEAITGLDLVQAQIRLAAGERLDRVVPADLQPSGHAIELRVY
FT                   AEDPVRFIPSPGTLAVFELPQGPGVRTETGYRAGNAVSPHYDPMIAKIIVHGADRAQAI
FT                   ARAEQALADTEIAGVKTNLPFLARALAFEPWRQGRLHTGIVARTLAEPAPAALTA"
FT   misc_feature    complement(67103..67420)
FT                   /note="HMMPfam hit to PF02785, DE Biotin carboxylase
FT                   C-terminal domain, score 3.6e-46"
FT   misc_feature    complement(67439..68086)
FT                   /note="HMMPfam hit to PF02786, DE Carbamoyl-phosphate
FT                   synthase L chain, ATP binding domain, score 2e-76"
FT   misc_feature    complement(67550..67573)
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    complement(67928..67972)
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT   misc_feature    complement(68090..68425)
FT                   /note="HMMPfam hit to PF00289, DE Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain, score 3.5e-39"
FT   CDS_pept        complement(68435..69967)
FT                   /transl_table=11
FT                   /locus_tag="BB2690"
FT                   /product="putative carboxyl transferase"
FT                   /note="Similar to Sulfolobus metallicus putative carboxyl
FT                   transferase PccB SWALL:O52601 (EMBL:AF042099) (517 aa)
FT                   fasta scores: E(): 1.8e-49, 32.59% id in 497 aa, and to
FT                   Archaeoglobus fulgidus methylmalonyl-CoA decarboxylase,
FT                   subunit alpha af2217 SWALL:O28066 (EMBL:AE000952) (516 aa)
FT                   fasta scores: E(): 1.1e-54, 35.81% id in 497 aa"
FT                   /db_xref="GOA:A0A0H3LMU2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMU2"
FT                   /protein_id="CAE33183.1"
FT                   /translation="MAFETLIEELAQREARARAMGGEEKLARRRAEGVLNARERIDRLV
FT                   DADSFLESGLLAVSVRSEVRDRTPADGKIAGYAQVDGRDIALVANDFTVMGASSSSVNT
FT                   SKIGHMVKNATRRGLPMVFLGESTGARMPDTMGARGIGSGDRPTQYRRTRETPWASAVL
FT                   GHCYGSSSWYAVLADFAVMRKGAIMAVSSVKLTSMAITEAVDPEELGGWEMLTSGSGLV
FT                   DMAVDSDEEALDAVRRFLSYLPSHHMEAPPVRPVPAGSGEQGHRILDILPESRTKVYDV
FT                   RKILSLIVDNDSLFELKARYGRSVVTALARIDGHTVGIIASNPQAKGGAIDVDACNKAT
FT                   SFMVLCDSYNIPLVFMADQPGFLIGVEGERRGAVGRVMNWMNALSLVSVPKISIIMRKT
FT                   YGQAVLNMGGAGNADEVIAWATAEVNFMDPRSGVTIVHGLTAQSDPDAYAARLAEMERD
FT                   TSAWEMGGAYSAHHVINPADTRDTLIRLLRVHRLRLTNGVGEHLMRTWPTSY"
FT   misc_feature    complement(68456..69928)
FT                   /note="HMMPfam hit to PF01039, DE Carboxyl transferase
FT                   domain, score 1.1e-70"
FT   CDS_pept        complement(70020..71000)
FT                   /transl_table=11
FT                   /locus_tag="BB2691"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   ra1058 or sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 6.9e-35, 37.46% id in 323 aa, and to
FT                   Variovorax paradoxus, and Burkholderia cepacia
FT                   2,4-diphenoxyacetic acid gene cluster SWALL:Q9RHQ7
FT                   (EMBL:AB028643) (337 aa) fasta scores: E(): 7.1e-33, 36.57%
FT                   id in 309 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT9"
FT                   /protein_id="CAE33184.1"
FT                   /translation="MSDRRLARYAGTLACFLALATPTPQAAAQPRAWPAEPITLVVPYA
FT                   PGGTTDRLAREYADYLREHLKQPVLVQNRPGASTNIGSDYVVKSKPDGYTFLVGIDGLA
FT                   TNQATGPVPPFDPAMDLAPISLLTRVPCLVAAGPKFKGGDAAELIKLARTDPEKYSISS
FT                   ASLILQVGMLNRGSEMRLSHIPYKGGAQAAADAMGGQVDLVIANVPVLASFVRSGKLRA
FT                   LAVTSGKRSDAFPDTPTMLESGMSKSDFSNWYGVFGPKGTPPEVVERMAALSRDFVRDP
FT                   VINKRLSDEGYQLESSTPQALAELIVRDAHNASEFVKANPGLFKQ"
FT   misc_feature    complement(70032..70844)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-62"
FT   misc_feature    complement(70917..71000)
FT                   /note="Signal peptide predicted for BB2691 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.569 between residues 28 and 29"
FT   CDS_pept        71134..71685
FT                   /transl_table=11
FT                   /locus_tag="BB2692"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   Mlr2046 SWALL:Q98J90 (EMBL:AP002998) (151 aa) fasta scores:
FT                   E(): 0.0027, 29.56% id in 115 aa"
FT                   /db_xref="GOA:A0A0H3LTF1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTF1"
FT                   /protein_id="CAE33185.1"
FT                   /translation="MREADAGPGRGVGPGIGRRLGDNGAVAIPRIPMISKKQFATLQAS
FT                   RQRGLSRLLLLARRVFLERVAEAMAASGLQPMPDACVMILPYIDLEGTRSTVIAQRAST
FT                   TRQAVGQVVATLEAMGLVEKRPDEADKRAAVVSFTDAGVRYLIKMHDVIDRVENEFAQA
FT                   SGEGDMEIVRRTLARIAYGA"
FT   CDS_pept        complement(71777..73063)
FT                   /transl_table=11
FT                   /locus_tag="BB2693"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   oxidoreductase protein rsc3407 or rs01716 SWALL:Q8XTY8
FT                   (EMBL:AL646075) (435 aa) fasta scores: E(): 2.3e-85, 56% id
FT                   in 425 aa, and to Rhizobium loti probable oxidoreductase
FT                   mll7103 SWALL:Q987C9 (EMBL:AP003011) (427 aa) fasta scores:
FT                   E(): 2.3e-56, 44.39% id in 419 aa"
FT                   /db_xref="GOA:A0A0H3LNW8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNW8"
FT                   /protein_id="CAE33186.1"
FT                   /translation="MPPPLPYDAMRSVWTDTAAPAMATVPLAGHADCDVAIVGAGITGL
FT                   SAALHLAERGLRACVLEARDPGWGASGRNGGQVIPGIKHDPDEILARHGRERGEPLLHM
FT                   VGTAADTVFDLIDRYGLDCHPVRRGWIQPAHSRQALDAVLARARQWRARGADVAELDAG
FT                   DVARRLGTGRFLGGWIDRRAGSIQPLRYTRGLLRAALSLGAAVHGQSPVVALQREGSRW
FT                   LVRCAQGASVRAEHVLIATNAYTDDLWPGLRRTVIAANSFIVATGPLDPALAPAILPGG
FT                   EVASDSRRLLLYFRRDADRRFILGGRGRFADPVSDADWNHLVRGARLLYPQLADTPFVH
FT                   RWSGRVALTRDFVPHVHQPSPNLRIVLGYNGRGVALATQMGNYLAREISGGEPLPYPVT
FT                   PIAPIPLHGLKRLYIGLAVAYYGLCDRIS"
FT   misc_feature    complement(71885..72967)
FT                   /note="HMMPfam hit to PF01266, DE FAD dependent
FT                   oxidoreductase, score 0.00085"
FT   CDS_pept        complement(73071..75311)
FT                   /transl_table=11
FT                   /gene="dmfA2"
FT                   /locus_tag="BB2694"
FT                   /product="large subunit of N,N-dimethylformamidase"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVY3"
FT                   /protein_id="CAE33187.1"
FT                   /translation="MYEILGYPSTWTVAPGETIEFKVSCARALRYDADLVRIRSGDVSP
FT                   GAPGLKETVALAGIARGVQGRPQHTETGSRAVAPPFAEPARGARSWVLAIMPTLPQSGH
FT                   EQIILARHDGAAGTGYALGLDKAGCLFWEQAQAGKARRLTLARAVVARQWYLVAVGIDA
FT                   DSGEVTLRQVPANPLLAANSHDQASVRWSPLPAGATDALPVVFGARPSGGRAPAYLHHY
FT                   NGRIDSPTLLPCRAGDADLAQLRVEAARRRHGAPPLAAWDFGLRIDSDVIVNTAIPWAE
FT                   GRIENLPARAVPGLRWDASIMRWQDGPDHYGALHFHDDTLEDANWDTDFSLEIPANLPS
FT                   GLYAARLTGAQGEQERITFVVRPRAGAPRKRIAFLASTATYMAYSNSHYRLDEEGMEMK
FT                   SGNFMVLYPWETYLGEHRELGLSMYDTHSDGYGVYYATRRRPVFSMHLQCRTWSLNGDT
FT                   HFLDWLDEKGFEYDVITDDMLHAEGLAALQGYRAVMTGAHPEYWSTRMWQAMVAYQAQG
FT                   GRLMYMGGNGFYWRCAYHPEKPWLMELRRTETGARYSETPAGESYHSYNGEYGGTWRRI
FT                   GIAPQTLVGIGTTATGFDASSYYRRRPESHDPRVAFMFDGVSEEIIGDFGSSGGGAAGD
FT                   EIDRADFRLGTPPHALIVARSEKHTRYYNVVPEETTYHHPTINGEEAKYCYADLLFYEC
FT                   LNGGAVFSTGSITWGASLAWNGYDNNVSRITANVLSRFAHDTPFDFPTTPQA"
FT   CDS_pept        complement(75368..75676)
FT                   /transl_table=11
FT                   /gene="dmfA1"
FT                   /locus_tag="BB2695"
FT                   /product="small subunit of N,N-dimethylformamidase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMU6"
FT                   /protein_id="CAE33188.1"
FT                   /translation="MYEIQPEDAELLRHFRTTTTKTRPLKLNRLLNRLRMEPMAGKQVI
FT                   VCTRPYSEYAIGTLGERRGDPVALHAERYATLAEAQWAILKIRWAIHSPYPWPVGLD"
FT   CDS_pept        complement(75703..76494)
FT                   /transl_table=11
FT                   /locus_tag="BB2696"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="GOA:A0A0H3LMU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMU4"
FT                   /protein_id="CAE33189.1"
FT                   /translation="MKTARLLLLCLLFGFLPLPIVIVAISSFTQSGYFSVPLDALSLRW
FT                   YVEFFTDWQWISLLLVSAAVALGVALISTTAALLAALVLARRRFAGSGLLETLIMLPLV
FT                   FPNAALGVAFLGVLGLLGIGGTYLGIVLAHCIITLPFAYRPILNALRKLDPALEEASMS
FT                   LSATPLQVLRTVTLPMLRPGLITAFLFCFIVSFDEATVTIFLIAPDVNTLPVRILTQIQ
FT                   ESASPVIAAIATFLILFTLSLVLLLERTVGLELFAAPQRER"
FT   misc_feature    complement(join(75754..75822,75880..75948,76054..76122,
FT                   76135..76203,76240..76308,76408..76476))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2696 by TMHMM2.0 at aa 7-29, 63-85, 98-120, 125-147,
FT                   183-205 and 225-247"
FT   misc_feature    complement(75829..76050)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.3e-11"
FT   misc_feature    complement(76408..76494)
FT                   /note="Signal peptide predicted for BB2696 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.406 between residues 29 and 30"
FT   CDS_pept        complement(76496..77335)
FT                   /transl_table=11
FT                   /locus_tag="BB2697"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="GOA:A0A0H3LTF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTF6"
FT                   /protein_id="CAE33190.1"
FT                   /translation="MMRAIRPPLLLLAPPALLVALFVVGVGYLVVESLHTGAGWGLDNF
FT                   VRFFERPDYVAVLVRTIVIAVAVTACAALVGYPIAYVIARYRGNRNFLMMLVIMPWLVS
FT                   VVVRTYGWMVILGPRGTLNSMLLSAGVIDTPLRLIFNMTGVVIGLVHVFCPFFIVSVLA
FT                   VLLYLDRSLDEASQTLSAGPFKTFWHVTLPLSMPGVITGAMLVYLLSTGAIVTPLLLGG
FT                   VRDGMLATQIYQDVLQVFDYPKAASMAVVLLLTAFTLVIPLQWLERRVAARVSGRGA"
FT   misc_feature    complement(join(76535..76603,76709..76777,76835..76903,
FT                   76994..77062,77099..77167,77243..77311))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2697 by TMHMM2.0 at aa 9-31, 57-79, 92-114, 145-167,
FT                   187-209 and 245-267"
FT   misc_feature    complement(76637..76846)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 7e-11"
FT   misc_feature    complement(77261..77335)
FT                   /note="Signal peptide predicted for BB2697 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.967) with cleavage site
FT                   probability 0.803 between residues 25 and 26"
FT   CDS_pept        complement(77346..78398)
FT                   /transl_table=11
FT                   /locus_tag="BB2698"
FT                   /product="putative ABC transporter, periplasmic
FT                   solute-binding protein"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNX3"
FT                   /protein_id="CAE33191.1"
FT                   /translation="MNITQRFAKWALAASMLGASAAVPAQDITMATWGGGVGKAWREAY
FT                   AEPFMKASKLEVKIVEVPTPEAQVRAQKGAPKFNAVLSSLFEAAQMYEDGLLEDFDMAD
FT                   FPALKNVPDKYLLKAPNGRLIGVSTYFAYYGIAVNTDLAKPADFASWKNLADPKWAGKL
FT                   SVTRPVYSSAYDLTIMSVAEGGSERDTAKGLELLTALGKNALTMYSSMAQMNQLLQRGE
FT                   VAAAPYYSTRIWQMQRDGQRNVELVVPKEGALMLPYLVVVPKGAQGREHYMKWLEYVGQ
FT                   PEGQQRIAEIAGYMPLNSQARLSPAAEKELGQPLDKLRDQLYQPDWNLIAKTRKTRIEA
FT                   VERAMAGAAR"
FT   misc_feature    complement(77352..78299)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01547, DE Bacterial extracellular
FT                   solute-binding protein, score 2.2e-07"
FT   misc_feature    complement(78324..78398)
FT                   /note="Signal peptide predicted for BB2698 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.774 between residues 25 and 26"
FT   CDS_pept        complement(78424..79512)
FT                   /transl_table=11
FT                   /locus_tag="BB2699"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:A0A0H3LVY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVY7"
FT                   /protein_id="CAE33192.1"
FT                   /translation="MEGHSPQRGSRILEISGVTKTFGPTTALAGIDLDVREGEFLTLLG
FT                   PSGCGKTTLIRIIAGFETPTAGDVRIDGRSIVAAPPYRRPLGMVFQSLALFPHLNVAEN
FT                   IGYGLKIRRVPPARRQAKVAQALEMVGLAGYGERYIGQISGGQKQRVALARAIVTEPRV
FT                   LLLDEPLGALDMKIRRQMQTELKQIQESLGTTFIFVTHDQEEALTMSDRIAVFRNGAIE
FT                   QVDTPAAVYERPATRFVAEFVGDTNFLEGTVDRQAGGAPRVRLADWDCSLQPPAAQWAE
FT                   GARVGVSLRPQHLRIAALEQGRLRATVLRRVYAGQNTRLWLAVGQRKLLADWHGAEDGA
FT                   PPEPGATVGLTWDDRRVCVVSL"
FT   misc_feature    complement(78856..79401)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   3.8e-68"
FT   misc_feature    complement(79042..79086)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(79357..79380)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        79661..80455
FT                   /transl_table=11
FT                   /locus_tag="BB2700"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LMV3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV3"
FT                   /protein_id="CAE33193.1"
FT                   /translation="MLDYDEELASNAMFNQSFAKGLKALFAFQGHQSAMSLSELAARLD
FT                   ASISSVQRTVFTLERLGLISKSPKTRKYSLTLRVLELGCNYITADALVEAANPFLAELS
FT                   NITGETVNLTEPLEREMVYVSRVVAAKFIPIHMPIGSRIPMYCTASGRAYLSALDDARV
FT                   QAILDGSTLKRHTPWTETDPARLRALIEQARVSGVAHNKEELFLGDMTLAAPIVGGRGA
FT                   PVACVHIVAPTSRWTQEEAFARLAPPLRDCARGIANAVRAFT"
FT   misc_feature    79763..79828
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1041.000, SD 2.73 at aa 35-56, sequence
FT                   MSLSELAARLDASISSVQRTVF"
FT   misc_feature    79823..79852
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    79877..80437
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 3.5e-45"
FT   CDS_pept        complement(80466..81245)
FT                   /transl_table=11
FT                   /locus_tag="BB2701"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LMV0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV0"
FT                   /protein_id="CAE33194.1"
FT                   /translation="MTAVPSIAPVLDLSGRSAVVTGAGAGIGRAAALRLAQAGAAVAVI
FT                   DINGEAAHDTCARIAALGGAAAAYAISVTDQDALLAAARDAQERLGPCGVLVNNAGVLL
FT                   RSAFDDPRARDFWAATLDVNLNGPYLAAQAFYPQLRATRGCIVNIASIHSFVAVKNSAA
FT                   YTASKGGIKQMTQALALELGADGIRVNAVAPGLTVTDMTRATVADPEGLTRFLARVPLA
FT                   RPGSVDDVVNAICFLASDWAAYITGVTLPVDGGYVAN"
FT   misc_feature    complement(80478..81206)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 5e-73"
FT   misc_feature    complement(80709..80795)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(81257..82003)
FT                   /transl_table=11
FT                   /locus_tag="BB2702"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="GOA:A0A0H3LTG1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTG1"
FT                   /protein_id="CAE33195.1"
FT                   /translation="MTPAARALPVPPQRKGLSDMTMITLKTRDGQTFEAYHAPAPTAGA
FT                   PGLVLIQEIFGINPAMRAAADQWARLGFDVLCPDLFWRQEPGVQLDPTSEADFGQAVRL
FT                   MQAMDENQAIADLDTARAWLAERSGGKVAGLGYCLGGRLAVRLAMDTPVQCAVSYYGVM
FT                   LDQLLPTVDAQAAPTLLHVAEQDRFVPPEARAVILEAAGKLPQCEAHVYEGCDHAFARP
FT                   GGEHWDAAAAALAEERSVAFMQRHLA"
FT   misc_feature    complement(81263..81907)
FT                   /note="HMMPfam hit to PF01738, DE Dienelactone hydrolase
FT                   family, score 7.3e-58"
FT   CDS_pept        complement(82000..82743)
FT                   /transl_table=11
FT                   /locus_tag="BB2703"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LNX8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNX8"
FT                   /protein_id="CAE33196.1"
FT                   /translation="MPAMTDSDKKTPLYRRVAQDLMGDIATMPVGSILPTEVELAARLG
FT                   VSRATIRDAMEILVEHRMVERVKRLGTRILRNTPGHRYVQHMDGLAHALEFAGQSLMRI
FT                   DDTAIVEGSGGEPGLAALPNATGQWLRVTGTRRLVDDDAPSTWTRVFVPGRYQGIAPLL
FT                   HGELDSVYAVIERVYSLKVARLRHRVTAVALPGYASGALGLPAGAPVLQVSAWLHEADG
FT                   ALVEYVRSLHHPEKVSIDFSAAQSS"
FT   misc_feature    complement(82522..82695)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.4e-10"
FT   misc_feature    complement(82570..82644)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(82576..82641)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1213.000, SD 3.32 at aa 35-56, sequence
FT                   PTEVELAARLGVSRATIRDAME"
FT   CDS_pept        complement(82749..84035)
FT                   /transl_table=11
FT                   /locus_tag="BB2704"
FT                   /product="Putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LVZ2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVZ2"
FT                   /protein_id="CAE33197.1"
FT                   /translation="MIAITVVTAALLLLFLGASIWVSLSLFGAAYFLLLLFKPNLPLDV
FT                   LAGQIVWTASTSQELLSLPLFVLMGEILAKTSVGRSLFAGLAPWVGRLPGGLTHVNVLG
FT                   CTLFAAICGSSVATTQIVGRVTLPELQQRGYDARLSIGSLAGAGTLGFLIPPSLIMIVY
FT                   GVLAEQSIVELFIAGVLPGLGLAAVYMAYIALRAQRPDDAGPGYTLRERIAALAQILPV
FT                   IGLIAAIMGALYLGIAGPSEVAAVGVLGALAIGLLQRSLTRASLVAAGRSAVRTCSMIG
FT                   LILAGAALISVAMSYLGLPKYVAARIGELGLSPLLLIALLLLFYVVLGMFLDGTSIIVL
FT                   TLPIALPLVVAAGYDAIWFGIFLVVVVEMAQITPPVGFNLFVIQSITGRSLSFVARATL
FT                   PFFLLLLAWAMALAVWPEIVLWLPGTLRN"
FT   misc_feature    complement(join(82791..82859,82896..82964,82974..83027,
FT                   83040..83108,83136..83204,83265..83318,83331..83399,
FT                   83457..83525,83553..83621,83682..83750,83934..84002))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2704 by TMHMM2.0 at aa 12-34, 96-118, 139-161, 171-193,
FT                   213-235, 240-257, 278-300, 310-332, 337-354, 358-380 and
FT                   393-415"
FT   misc_feature    complement(83952..84035)
FT                   /note="Signal peptide predicted for BB2704 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.915 between residues 28 and 29"
FT   CDS_pept        complement(84055..84570)
FT                   /transl_table=11
FT                   /locus_tag="BB2705"
FT                   /product="Putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LMV8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV8"
FT                   /protein_id="CAE33198.1"
FT                   /translation="MDRLLRLIDALCAGAEHLAIALLYGIAALMLAEVGARAMGRSIPF
FT                   SWEYCAYGMAAAFFLGMGAALRHGAHIRVLFLRDALPARPARLLDIAASCAGLALSAVI
FT                   VVALARLTGKSIARGLVSNTVMQTPLAIPQAVVLAGAALLALAFVARLLRQLTGRPAET
FT                   DGGRAAGH"
FT   misc_feature    complement(join(84115..84183,84241..84309,84370..84438,
FT                   84466..84534))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2705 by TMHMM2.0 at aa 13-35, 45-67, 88-110 and 130-152"
FT   misc_feature    complement(84379..84423)
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(84581..85582)
FT                   /transl_table=11
FT                   /locus_tag="BB2706"
FT                   /product="Putative secreted protein"
FT                   /db_xref="GOA:A0A0H3LMV5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV5"
FT                   /protein_id="CAE33199.1"
FT                   /translation="MSAAVRFLLRAALGACALTAAATAHAQQRWDMSLAWPAGNFHSRN
FT                   AEAFAAKVREATGGQVLITVHAGGELNVKGPDTLMAVESGIVQLADMLVSQQAGVEPLL
FT                   GMDALPGLIAGQDDMKTFLRHARPVYDRIAAAHNQRILYAVPWPSPGLFSRKALSTPED
FT                   MKGQKLRAHDKAAYEFMAQLGAAPTQMPWGEVVPALAAGTIDGVGTSASSGVDGKFWEF
FT                   TPHFLPLNWATSLSLVTVNLDAWDKLSAAQQQAVQAAAAELEPRFWQISAAQDEKDLAI
FT                   LREHKVAIATPSEALGARVAAVGRPMWDAFARQAGPQARQLLDAYLQDRKQP"
FT   misc_feature    complement(84638..85489)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 5.6e-31"
FT   misc_feature    complement(85505..85582)
FT                   /note="Signal peptide predicted for BB2706 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.967 between residues 26 and 27"
FT   CDS_pept        complement(85694..86677)
FT                   /transl_table=11
FT                   /locus_tag="BB2707"
FT                   /product="Putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="GOA:A0A0H3LTG6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTG6"
FT                   /protein_id="CAE33200.1"
FT                   /translation="MPSPSALHDLCDTPPTFMGVPHRHAIDGARAAILGIPFDCGTHAF
FT                   RIGARQGPQSIREQSRLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQA
FT                   VGAIVDGGAVPVTMGGDGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGT
FT                   QFTHAALEGRVDTSLAFHIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDL
FT                   RARLGERPVYLCLDMDVLDPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTV
FT                   SPPHDVNGTTASLAAALMVEGLVLLCKRLGLDHPDPAPDFAAMYAR"
FT   misc_feature    complement(85748..86599)
FT                   /note="HMMPfam hit to PF00491, DE Arginase family, score
FT                   2.1e-32"
FT   misc_feature    complement(86231..86257)
FT                   /note="PS00148 Arginase family signature 2."
FT   CDS_pept        complement(86743..87738)
FT                   /transl_table=11
FT                   /locus_tag="BB2708"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNY3"
FT                   /protein_id="CAE33201.1"
FT                   /translation="MLRTMPAARRLFVQSTLAITGLLAAAAACAQPATDWPTRPIELVV
FT                   PYPAGGSSDVLGRLLAKPLGEILGQPVVVLNKSGAATAIGTTFVARAAPDGYTLLLADS
FT                   PLVVNAAVNPAVTYDPVKDFAPVGIIGTSPSFLYAPAGRVKDLDDFIAQAKAHPGRLKA
FT                   ASAGAGTSTHLLLELMQHEAGISLNHIPYRGSAPALTDTVAGIVDGSFSTYASAQPFVA
FT                   SGKLQVLAMTAPQRLPAFPGVPTFAEAGMPGLTFLTWWGILGPDGLPQPIVDKLQQALA
FT                   QVMKDPAIGEQFVRLSVVAQAGEPQAFAQTLQRDLQRWRDIARAAGVSMQ"
FT   misc_feature    complement(86755..87573)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.5e-89"
FT   misc_feature    complement(87649..87738)
FT                   /note="Signal peptide predicted for BB2708 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.790 between residues 30 and 31"
FT   misc_feature    complement(87652..87684)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        87914..88816
FT                   /transl_table=11
FT                   /locus_tag="BB2709"
FT                   /product="Putative LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LVZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVZ6"
FT                   /protein_id="CAE33202.1"
FT                   /translation="MRLRHIEVFHAVMVGGSLSAAARLLNMTQPAVSQTMNSLELQLGF
FT                   ALFQRVKGRLAPTPEAHALHAEVEKLNSQLDAVKLMAVNLRQDGPARLRILAAPALAME
FT                   VVPDALAAFMADSPNARMTVKTGYSGDILAALLLRDADIGLVYRCAPQALIRQETVGRG
FT                   MLVCVAPADRYAGRDHVTLADLRDSAVFVPERRHPMGRRLAELCAGQALDADNHVEIEQ
FT                   FHVALKLATAGLGVALVDSLTALGADLRRVRILALRPEVGFEVCVAYPEFDAHPHLSHR
FT                   FARCVREVVAARQARMAPG"
FT   misc_feature    87914..88012
FT                   /note="Signal peptide predicted for BB2709 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.821) with cleavage site
FT                   probability 0.689 between residues 33 and 34"
FT   misc_feature    87920..88099
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.1e-19"
FT   misc_feature    87959..88024
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1765.000, SD 5.20 at aa 16-37, sequence
FT                   GSLSAAARLLNMTQPAVSQTMN"
FT   misc_feature    87962..88054
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    88169..88786
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2.8e-24"
FT   CDS_pept        complement(88824..89609)
FT                   /transl_table=11
FT                   /locus_tag="BB2710"
FT                   /product="Putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW3"
FT                   /protein_id="CAE33203.1"
FT                   /translation="MTADRMRRLPGALMRLCALSCALLLAACAGAPPIPPQKDAAAGIF
FT                   PGERPKSPLAKVPAGPDVKAVAVLSENTLANAAWKRKIHDNARAMAQGKRFGDATIASA
FT                   GAELFDPDYPLAWVAASLKRYFGSVEQVSLAQLPQASGDVLAIVDVYAYPADDSVARIK
FT                   VAFFDRELRHIADASGEDAQHFNMWARTGGATAIAEGYRRENEVLMRALRKFDASLAQQ
FT                   VSGPPAQAAGGYDACLQRALAAQDPQLRVAAMAACDAAR"
FT   misc_feature    complement(89508..89576)
FT                   /note="1 probable transmembrane helix predicted for BB2710
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    complement(89523..89609)
FT                   /note="Signal peptide predicted for BB2710 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.447 between residues 29 and 30"
FT   misc_feature    complement(89526..89558)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(89606..90343)
FT                   /transl_table=11
FT                   /locus_tag="BB2711"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW0"
FT                   /protein_id="CAE33204.1"
FT                   /translation="MWTLLRNRRPALLLGFWLAAPAQAFDAFECDCAQQVGTCSATVRI
FT                   LKTGGSAPSYSAELLVQSSAPACSRVSYLIDQTPYTTVLTRRNQDTESTSGTSPIKAAN
FT                   VKVQGCAICARKSAFAASESAPAPDDSGASRAFSAGLAPGGFDPASKQAGFDAAVSGGR
FT                   ARDASFNSIISGLGAAAAITSAAAQARQAGAQQPPATPSRSGYSPQYDLRSAGPQGGGR
FT                   CPDPSAPGCPYHLGTYDPLGAPK"
FT   misc_feature    complement(90272..90343)
FT                   /note="Signal peptide predicted for BB2711 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.792 between residues 24 and 25"
FT   CDS_pept        complement(90444..91529)
FT                   /transl_table=11
FT                   /locus_tag="BB2712"
FT                   /product="Putative sugar ABC transport system,
FT                   substrate-binding protein"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTH1"
FT                   /protein_id="CAE33205.1"
FT                   /translation="MTLFGKTSRRPGLPRQAAGLALAACALASLPAQAKESDGDRLQGI
FT                   VEPIVARQPLKLGVTVVHLLDNFYKGIAYGIVDEARRSNVEVVQVAVAGAYGNVQQQFA
FT                   QLQSFKTLGVDYAVLSPAAYSGYDPVVADLARSGIKTISAGIPVNSDKIAFGVLQDDTL
FT                   IGKVLGKALCDDGAQGKQVIVVPGAAGLEWSRLRYEGFKEVASACGAKLTPAAFRGEMS
FT                   LADGMAQTQDLLMRTPDAEYVFTPVTFLGMGAVRAARQANRPVKVLTSAMVKENEAMIR
FT                   EGRLLAVASEPGVIMGRLIVQYAIREHEGLPMPPLDKPTRSVPYPHFNVPITVVDKSNV
FT                   DTHPYAFYDYPPQGWSIETAR"
FT   misc_feature    complement(90537..91370)
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   0.84"
FT   misc_feature    complement(91428..91529)
FT                   /note="Signal peptide predicted for BB2712 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 34 and 35"
FT   CDS_pept        complement(91570..92535)
FT                   /transl_table=11
FT                   /locus_tag="BB2713"
FT                   /product="Putative sugar ABC transport system, permease
FT                   protein"
FT                   /db_xref="GOA:A0A0H3LNY8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNY8"
FT                   /protein_id="CAE33206.1"
FT                   /translation="MLTKTLAVSRAARPAPAARLADAILPLIIALIALVASLIEPRFAS
FT                   LDNLTNLACQLVPLLILSVGQAFAILRGGLDLSMSSVLSLAGVAGVLAMPAWGVAAGLA
FT                   VMLAVGLAAGVVSGFIIARFRTTPLVVTLGMLSVTQAIALILSGGVPIYDVPAPYVNAV
FT                   GFGRTLGLPNMVWIAAAVTLAAAFALKRTVFGRYVYALGSSESAASKAGVNVQRYTVMV
FT                   YAASGLCAAVGAVVLTAWTSSAQPVAVPGLTLQSIAAVVLGGVALTGGSGSIVQVFLGV
FT                   LVLSVLSNAMNITGVSAYFQTLVVGVVIIIAVILDRFRRS"
FT   misc_feature    complement(join(91591..91659,91678..91767,91810..91878,
FT                   91969..92037,92080..92148,92167..92235,92245..92304,
FT                   92323..92391,92419..92478))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BB2713 by TMHMM2.0 at aa 20-39, 49-71, 78-97, 101-123,
FT                   130-152, 167-189, 220-242, 257-286 and 293-315"
FT   CDS_pept        complement(92525..94078)
FT                   /transl_table=11
FT                   /locus_tag="BB2714"
FT                   /product="Putative sugar ABC transport syste, ATP-binding
FT                   protein"
FT                   /db_xref="GOA:A0A0H3LW03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW03"
FT                   /protein_id="CAE33207.1"
FT                   /translation="MMHSEGAASAAPSPQPPPLLRLRQISKRFGATQALDDVSVSFEAG
FT                   KVHCLLGENGAGKSTIGKIVAGLFAPDSGALLLDGHEVRLADASEARRRGIAVVYQELS
FT                   LAPDLSVRANLCLGAEAGRRPWSPLRRGAETAQVGAVLARLGLDLDMEAPVRQLPAGVQ
FT                   QLVEIAKSLMSSPRIVIFDEPTAMLGAAEKQRFFEVVRGLRADGIACILVTHHMDDVEA
FT                   VGDCVTIMRNGRRVDSFDLHAGITSDAVLEKLTGRREVLAAAAEAPRRLGATRLRIALP
FT                   AGGGLAGIEARAGEVVGFYGVLGCGAGELMYGLVGLDGPPRADYYLDDAPYRPRNPAAA
FT                   LRQGVGLLPAGRQSHGVLTGRSIRENLMLTQLDRVSRWQCIDPAREAAWAREQLERAGV
FT                   KHGDPADPIESLSGGNQQKALLARALGAARRLLLLHEPTAGVDILAKQHIHELVRAAAA
FT                   QGLTVVVLSSDLPEVIALCDTVYTFFHGAAVARYAQPGPDCQPHILADVLGQRESQHAH
FT                   "
FT   misc_feature    complement(92621..93199)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.2e-11"
FT   misc_feature    complement(92804..92848)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(93380..93946)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   6.2e-48"
FT   misc_feature    complement(93902..93925)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(94118..95002)
FT                   /transl_table=11
FT                   /locus_tag="BB2715"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LMW9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW9"
FT                   /protein_id="CAE33208.1"
FT                   /translation="MKYISFELPDGRRHAGVMTGPDTLVDLTDAMDLPDLLTLLQRHGQ
FT                   LAGDVARLAAQARHTVALDAVRVLAPLPNPPRNVFCVGKNYHEHAREFARSGFDSSAAA
FT                   GAVPAAPIIFSKPPSSVSGPGDAIDTALDPCDSVDYEAELAVVIGKAGRVAPDDDPWSF
FT                   VFGYTLVNDVTSRGLQKRHSQWLLGKGIDGYCPMGPALVSADEIGDIGALEITCEVNGE
FT                   LRQSARLSDLIFDIPTLVRAIGASITLQPGDVIATGTPVGVGIGFTPPKYLRRGDVVRV
FT                   RAEPIGVLENPVI"
FT   misc_feature    complement(94199..94693)
FT                   /note="HMMPfam hit to PF01557, DE Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 4.1e-59"
FT   misc_feature    complement(94673..94720)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   CDS_pept        complement(95027..95446)
FT                   /transl_table=11
FT                   /locus_tag="BB2716"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW6"
FT                   /protein_id="CAE33209.1"
FT                   /translation="MSQAAVQYLNPEGAAPAQGLYSHATRVRAGDLYFVAGQLAVGRDG
FT                   AVAGVGDFEAQFDQVFGNLRDVLAGLGVDFNDVAKFTTYLVHSQDIPRFMRKRAELFPT
FT                   LFAGKAYAPNTLLIVDRLVKEEFLIEVEAVVRARD"
FT   misc_feature    complement(95036..95413)
FT                   /note="HMMPfam hit to PF01042, DE Endoribonuclease L-PSP,
FT                   score 5.6e-16"
FT   CDS_pept        complement(95503..96855)
FT                   /transl_table=11
FT                   /locus_tag="BB2717"
FT                   /product="Putative dipeptidase"
FT                   /db_xref="GOA:A0A0H3LTH6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTH6"
FT                   /protein_id="CAE33210.1"
FT                   /translation="MKTGYVLKGRVIDGTLGPALEQGAVVTEGERIAWVGPQSGLPAQY
FT                   AGDRHTVVDLPGRTIMPGLIDAHTHISFGESRSEEENALYTPVEFRTAKALWYARKVLQ
FT                   AGVTSAFDAATSYNIAQAVRDAIDTGMFEGPRFTVSGKQLTNHQGLEDSFPNEMAFPPG
FT                   QSAVLVKTREDLVEAIRYQVKDEVDAIKVSGSNDNLITPDALGSSAFTYEEFKIIADET
FT                   HRLGRLCSVHARSRDAALYAAQAGFDNLFHASYIDDEGIEACLKNGCVITPTLTLLVNL
FT                   VEAKQSHAGASSAQAFRQEIEAASVNLRRAYDAGVPLLAGSESGWSPVPYGHWHAREME
FT                   IFVKLLGLTPLQAIHANTLACTRLLARHGHEVGKLEAGRLADVLVLPGNPLEDITLLQR
FT                   PSRFDYIFKGGTPVDRTAPAPRVRKWYERTKIFLAGVYEYDQENACGRLVQ"
FT   CDS_pept        complement(96864..97703)
FT                   /transl_table=11
FT                   /locus_tag="BB2718"
FT                   /product="Putative hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="GOA:A0A0H3LNZ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNZ3"
FT                   /protein_id="CAE33211.1"
FT                   /translation="MSLPDGYTLSHLPFEGTQCAYLRGGSGPTLLLVHGSGPGASSLGN
FT                   WRAVLPALARRFDVVAMDLVGFGQSGRKPAAPYFDFDMWVRQVRAMMSHLGEGPIGLVG
FT                   HSLAGALALTVASGNPAVRGVVATGTMGIPFAPNDATRRTWKCPRSRPELVRALQGLIH
FT                   DHSVIDEAYLAVREPVIFAPGYADYFDAMFDAAPATYIAAATLSERTLRGIRCPVTLLH
FT                   GRDDAAFPPAASQRIAEQLADADLVLLAGCSHSVAFERPDVFLAMVHQRFGALPYFL"
FT   misc_feature    complement(96888..97535)
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 5.8e-25"
FT   CDS_pept        97863..98555
FT                   /transl_table=11
FT                   /locus_tag="BB2719"
FT                   /product="Putative regulatory protein"
FT                   /db_xref="GOA:A0A0H3LW07"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW07"
FT                   /protein_id="CAE33212.1"
FT                   /translation="MKNAKNGRTLNAEVYAQLRAQILTGQFMPRQRLKVSQLSEQHGVS
FT                   LNVVREALNRLAGEQLVELQPQFGFAVRGLSAEDLVDLFEQRGVVESLALRQSIARGDL
FT                   NWQSDVVAAHHRLGGTAVVSPDDPQKLNPEWLARHEEFNLVMMRACGSPRLLQIVRQLA
FT                   EASAIYQRALLPLAAVAAELETEHDDLLQRILDGDADGAVRVLLKHMEQTRDAMLPFLV
FT                   QQEVAGQA"
FT   misc_feature    97902..98078
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 2.6e-09"
FT   CDS_pept        complement(98602..99948)
FT                   /transl_table=11
FT                   /locus_tag="BB2720"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMX3"
FT                   /protein_id="CAE33213.1"
FT                   /translation="MKLNVFVHGTRVALLDSPDGFQHRLAYLPETDPARFASLTMPVRA
FT                   EPWRWPTLHPFFQVSLPEGFLLMLLKEQLGPQLGARQLDLLAVVGPNMIGRVQVSVGAT
FT                   LEPAMALESLDPLLHGPASQQVFLELMAQYAASGVSGVVPKFLTPATQALFRKGTIATE
FT                   RHIVKGSSEHQPFVALNEHLCMTAAQGTGIPVARTRVSDDGQVLVVERFDIDPATGRRL
FT                   GFEDFCSLLGLSADEKYDSTWERVARVASDYVRPEGRLQARTQLAITLLLSFALGNADC
FT                   HAKNLALVYDTIDDVRIAPVYDMLTILAYDRYAANPPGMALDGRKSWTMSKALWRYLQQ
FT                   HLGFAPAAQRELVDRVCSAIADTVPQLKAHIRHTPGFEPVGLRMLWEWNEGMKRLSERR
FT                   QIAVPDWVATARDEGLPRPAPAAHFAAQRIGESPLLAPRRRRQPARPPS"
FT   CDS_pept        complement(99945..100316)
FT                   /transl_table=11
FT                   /locus_tag="BB2721"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LMX1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMX1"
FT                   /protein_id="CAE33214.1"
FT                   /translation="MLIRSLLFDLCVSQHFFLGLVYFMPLAAYISMKTLPDVGARFRTL
FT                   RKQARKTQRELAAATGMRQEAISRFEAGSASDFSLNKLLTLLQALDLEFDFKPVVRRPD
FT                   LDDLLAERRGRLDDAKDPS"
FT   misc_feature    complement(100026..100193)
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   2e-09"
FT   misc_feature    complement(100101..100166)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1762.000, SD 5.19 at aa 51-72, sequence
FT                   KTQRELAAATGMRQEAISRFEA"
FT   CDS_pept        100587..101042
FT                   /transl_table=11
FT                   /locus_tag="BB2722"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LTI1"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTI1"
FT                   /protein_id="CAE33215.1"
FT                   /translation="MAFLQPSLFMNDSIPDGFAPWRPGSPFMAHLADLGTFYVREADDA
FT                   LAVRVGPPHTNMHGIAHGGLLATLADSALGYCISRRAQASVVTVQMSVEYLSAVKPGDW
FT                   LQAQVRIDKQGRRLIYATCLLQVEDRLMLKANAVFAVRAAPAPVSDG"
FT   CDS_pept        complement(101039..101776)
FT                   /transl_table=11
FT                   /locus_tag="BB2723"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1646"
FT                   /db_xref="GOA:A0A0H3LNZ9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNZ9"
FT                   /protein_id="CAE33216.1"
FT                   /translation="MVEAIETFHWGAIFQIVLIDILLGGDNAVVIALACRNLPHRQRIK
FT                   GILWGTAGAVLLRVLLIAFALVLLDIPFLKALGCLLLVWIGVKLLAPHEDAHGNITGGT
FT                   SVLAAIRTIILADFAMSLDNVIAIAGAAQNAQADHQLYYVIFGLCVSVPIIVWGSTLVL
FT                   KLIDRFPLVVTLGAGLLGWIAGGMLITDIYVVERWGEPAPMLKLAVEAAGALVVVAAGK
FT                   WLAARRRHARPAHDESASTTPGG"
FT   misc_feature    complement(join(101099..101158,101201..101269,
FT                   101288..101356,101573..101641,101678..101746))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2723 by TMHMM2.0 at aa 11-33, 46-68, 141-163, 170-192 and
FT                   207-226"
FT   misc_feature    complement(101117..101776)
FT                   /note="HMMPfam hit to PF03741, DE Integral membrane protein
FT                   TerC family, score 1.7e-43"
FT   CDS_pept        complement(101966..102724)
FT                   /transl_table=11
FT                   /locus_tag="BB2724"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1645"
FT                   /db_xref="GOA:A0A0H3LW11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW11"
FT                   /protein_id="CAE33217.1"
FT                   /translation="MGRLSGRNALITGAAVGIGAAMARRFCAEGASVLLGDIDAERGQA
FT                   LAAELAATGARARFARLDVTDEDSVRQAMELAEAEHGPLHILVNNAGGSSLNDRSVVEF
FT                   ALEEFWRAINIDLLGTVLCCRHAIPRIAAAGGGAVVNMGSIAALRGLKGRDAYTAAKGG
FT                   VHALTRSMAVEFAEQRVRCNAIAPGAVLSERMARFIDEDPRVAAAVSRHLLGLPEPDEI
FT                   AAMAVFLASEESRHVTGSIFQIDGGRAAAA"
FT   misc_feature    complement(101981..102712)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 1.9e-75"
FT   misc_feature    complement(102209..102295)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    complement(102656..102724)
FT                   /note="Signal peptide predicted for BB2724 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.819) with cleavage site
FT                   probability 0.574 between residues 23 and 24"
FT   CDS_pept        complement(102771..103760)
FT                   /transl_table=11
FT                   /locus_tag="BB2725"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1644"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMX8"
FT                   /protein_id="CAE33218.1"
FT                   /translation="MRLIRRFAHALAVVGSAGFLAAPAAASTGTYPDKPIHLLVAFSTG
FT                   GVLDTLARTMASELSTRYGQSIVVENRTGASGNIGTDLLARAKPDGYTIGMGTIATHGI
FT                   NPALYGERLPYDPVKGFTPLALLAEQTNIVLVNNDLPVTSIPTLIEYLRANPGKVAYGS
FT                   AGNGSSQHLSGQLFKLAAGVELLHVPYRGSVPALTDLVSGQVQLMFVDVPAALPFIKSG
FT                   KVRPIAVTAAHRSSAFPDLPTVAEQGLEGFNVRAWFGVLAPAGTPAPIAEKLSADMIAA
FT                   VQQPAIRERLEALGMDIKTLDGPAFGQFIQDEIARWDEIVKRSGTRLE"
FT   misc_feature    complement(102783..103610)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.1e-107"
FT   misc_feature    complement(103683..103760)
FT                   /note="Signal peptide predicted for BB2725 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.925 between residues 26 and 27"
FT   CDS_pept        complement(103942..104910)
FT                   /transl_table=11
FT                   /locus_tag="BB2726"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1643"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMX5"
FT                   /protein_id="CAE33219.1"
FT                   /translation="MRSRFAWRFCNAGLALALAALPGAARATEGALGRLVTGTTVQPNA
FT                   GVVSPQPITVLSLGQLYLDGRIGGSREVPVAGKTSLGLDAEMALTLATLMKTWDTGPGR
FT                   WNFASSLTVPYLWLKTTATLAGERGRAARESDIASNLFDLNFTPLIAGYHFSETQHLAL
FT                   SLSIWAPTGKYDADALANPSLNNWTFIPQVAYTGMFPEHGLQLDAVANVQFYTRNTATD
FT                   YRNAPIFGLELMGRKLFGNGVGAGLIVGTQQQLGPDKGPTADRLNGFEGRDWALGPILT
FT                   YDRKLADQRSLSFSLRWTPTISSTRRLDSDSTVLGTVALIF"
FT   misc_feature    complement(104830..104910)
FT                   /note="Signal peptide predicted for BB2726 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.986 between residues 27 and 28"
FT   CDS_pept        105254..106396
FT                   /transl_table=11
FT                   /locus_tag="BB2727"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1642"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTI5"
FT                   /protein_id="CAE33220.1"
FT                   /translation="MKQQLKIALAMAAIVGAAGALGAFVASTSDAPQAPAVRLGDGKAG
FT                   PAGMAWIPGHQFLMGNDHKLSQPNERPAHQVRVSGFWMDVHDVTNAQFRRFVQATGYLT
FT                   TAERKPRWEDLRPQLPPGTPRPDDSQLAPGAMVFVGTQSEVSLRDYSRWWRFVPGASWR
FT                   HPQGPGSGIDGKDDHPVVQVSYEDAQAYARWAGKRLPTEAEWEFAARGGLEQATYTWGD
FT                   ELLPQGQAMANIWDTRQQQPFPVVKDEKVQVGTTPVGSFAPNGYGLYDMAGNVWQWTAD
FT                   WYRADAFRIQAQYREPPLDPAGPADSFDPDDGNVPAAAPKRVTRGGSFLCSDTYCISYR
FT                   ASARRGTDPLNPMSHLGFRTVMTPEQWKLAQARQGRLASR"
FT   misc_feature    105254..105328
FT                   /note="Signal peptide predicted for BB2727 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.663 between residues 25 and 26"
FT   misc_feature    105386..106339
FT                   /note="HMMPfam hit to PF03781, DE Domain of unknown
FT                   function (DUF323), score 1.1e-97"
FT   CDS_pept        106452..107420
FT                   /transl_table=11
FT                   /locus_tag="BB2728"
FT                   /product="putative regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1641"
FT                   /db_xref="GOA:A0A0H3LP04"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP04"
FT                   /protein_id="CAE33221.1"
FT                   /translation="MANRDGILALEQAVSAAVLGQAAVIRHVLVALLADGHVLLESLPG
FT                   LAKTRTVKALAAHLDATMRRIQFTPDLLPSDITGADVLQQDAEGRQRIEFQQGPLFGNL
FT                   VLADEINRAPAKVQSALLEAMEERQITVGGVTRPMAPLFMVLATQNPIEQEGTYPLPEA
FT                   QMDRFLMKIRLDYPAADDESAMLALLRAAPQPGAAAATRLAQEELFACRDAAAALYVAP
FT                   AVDRYIVDLVNATRRPADYDAELGRWIQIGASPRGAIALDRAARAHGWLAGADFSSPDD
FT                   VRAVAHPVLRHRLHLSYDAVADGVTAEQVIDRLLDTVAVPA"
FT   CDS_pept        107429..108370
FT                   /transl_table=11
FT                   /locus_tag="BB2729"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1640"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW15"
FT                   /protein_id="CAE33222.1"
FT                   /translation="MPRAAHPVHPPLPELMALEAAVGGLSFVAGQPLGSVLAGLHGSRL
FT                   RGRGLDFAELRRYVPGDDLRQLDPRASLRYGKPYVRAYTEERDRPAMIVADQRMSMYFG
FT                   SVRAFKCAVAARLAALAAWTAYRGGDRVGGLVFDDDGVRAFKPLRSRDRVQALLAEVAR
FT                   ANAGLSAARPERPAGAGLNAALRGALAHAPHDCLVCIVSDFAGADAETLRTLRLLARHN
FT                   DVVAMLVFDPMAQDLPRRGRLVVTQGELQLEIAVGRQRERQPLADFFSGRLREVADLLR
FT                   RSRVPLLSIDTAEDEVVQLRRALGRLQTGARR"
FT   misc_feature    107429..107948
FT                   /note="HMMPfam hit to PF01882, DE Protein of unknown
FT                   function DUF58, score 0.0017"
FT   CDS_pept        108367..108858
FT                   /transl_table=11
FT                   /locus_tag="BB2731"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1639A"
FT                   /db_xref="GOA:A0A0H3LMY1"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY1"
FT                   /protein_id="CAE33223.1"
FT                   /translation="MSDALPGLDQLQELPLPAAVPYWPQTWGWAVLAALVLAGAAWAGY
FT                   AGWRRRRRNRYRRQALAELQRLARAAAADPLAARALPGLLKRTALAAGQPAVAPLGGQA
FT                   WLARLAQDAAGAAFPDDSARMLALLAYAPDGAVRALDAPALARLFAASRRWVESHHVAA
FT                   "
FT   misc_feature    108442..108510
FT                   /note="1 probable transmembrane helix predicted for BB2731
FT                   by TMHMM2.0 at aa 26-48"
FT   CDS_pept        108845..109855
FT                   /transl_table=11
FT                   /locus_tag="BB2732"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1639"
FT                   /db_xref="GOA:A0A0H3LMY0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY0"
FT                   /protein_id="CAE33224.1"
FT                   /translation="MWRLEYPWLLAAAPLALAAYRWLPAYVQGRQALRLPFFDAMATLT
FT                   GKSPTRPGVQRGRAQLWVNVAVWLLLALALARPQWVEPPLTHVEPMRDILLAVDISQSM
FT                   DSEDFRDAQGRPASRWQAVQAVVGDFIDKRPDDRLGLIVFGAGAYPQAPLTRDHAALRL
FT                   LLQRTAVGMAGPNTALGDAIGLGIRMLDHARERDKILILLTDGNDTASAVPPARAAELA
FT                   AQHRVVVHTIGIGDPAASGEDRVDFDALRDIARIAGGRFFRARDQASLQEVYATLDRIT
FT                   PHEVRTLRHQPKREDFWMPLGAALALLALWHGGAALAAWRSARPDRQARREDAWT"
FT   misc_feature    108845..108925
FT                   /note="Signal peptide predicted for BB2732 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.779) with cleavage site
FT                   probability 0.315 between residues 27 and 28"
FT   misc_feature    109121..109675
FT                   /note="HMMPfam hit to PF00092, DE von Willebrand factor
FT                   type A domain, score 0.00018"
FT   misc_feature    109736..109804
FT                   /note="1 probable transmembrane helix predicted for BB2732
FT                   by TMHMM2.0 at aa 298-320"
FT   CDS_pept        109846..111360
FT                   /transl_table=11
FT                   /locus_tag="BB2733"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1638"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTJ4"
FT                   /protein_id="CAE33225.1"
FT                   /translation="MDIDLSAFHFLRPWWLLAVPLAALLWWARRGERGAPGRDLRIAPA
FT                   LLPYLVLRTPGSRGPRPIDALALFLALGGVAAAGPAWQRDEPAYLDNVAPLIVALDLSA
FT                   SMDGADVPPTRLEAARRVLRDLAARRAAARTGLIAYAGSSHLVLPPTDDAGLLDLFAQA
FT                   LATGLIERPGRDADGAIALAAQALAAERAGGTLLILTDGADRARMDAVRRQAQAARDMQ
FT                   VLVMAVGVNGIDTQALQELARAAGAALGSLTGGPDDQDWIALHAQAHFRAVQDAQSGPV
FT                   HWKDAGYWLCWPLALLALLAVRRGWSVAWSAGVLVVAMAGMPQPARADALADAFLTADQ
FT                   QGRRAFEHGRYDEAARHFHDPYWKGRAAYEAGDYKAALAAFSTLPSAEGYFYVGNTQTR
FT                   LHRYDAALAAYDRALALKPGWQPAVVNRGIVARLLAAMAQTQQDQPAEPPDQTIADRTA
FT                   QAGKMSQAPVAQAGSEEAWLRNLTLSPARFLRSKFAAEDAAAGARP"
FT   misc_feature    111004..111105
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score
FT                   0.00089"
FT   CDS_pept        111357..112703
FT                   /transl_table=11
FT                   /locus_tag="BB2734"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1637"
FT                   /db_xref="GOA:A0A0H3LP09"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP09"
FT                   /protein_id="CAE33226.1"
FT                   /translation="MRRWLPLACAALLALGLAGAPRAQDAPPLRVTARLPAGAQAQAGA
FT                   TLRLELDVMTTTWFTQPPRLPALTLPGVMVTPPSGEGELVRAEHNGVAYSGLRYTYLLS
FT                   PTAAGQVQVPALAVSAEVGPGKTPASASSAPLSFTVGGAAGGQPAPHGALTVSQDFALA
FT                   PDPLVAGGRVTRSITQRAEGVQAMLLPPAPLADVPGFKRYAREPEVTTLTDGRGGFVGG
FT                   QRIDRADYVAEQAGELSLPAVTLAWRDGAGGQPRQQALPGRTFAVAAAPAVAPPFSLTD
FT                   DLARLRHGLRWVLPAAWLAWAAGGALALLALWLGWPWWRQGLCRLRAAALRRRARRRAG
FT                   EPWHWRAWRREARRDSGTLSAFYRWLALAAGAPDMRGATATLDEAAQGAAAAALRDAYG
FT                   RAPARAGWRARLGMASRQWRGNWRARRAAAPAHGLPEVLNPARAARPRS"
FT   misc_feature    111357..111425
FT                   /note="Signal peptide predicted for BB2734 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.784 between residues 23 and 24"
FT   misc_feature    111714..111737
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    112245..112313
FT                   /note="1 probable transmembrane helix predicted for BB2734
FT                   by TMHMM2.0 at aa 297-319"
FT   CDS_pept        112706..113740
FT                   /transl_table=11
FT                   /locus_tag="BB2735"
FT                   /product="putative nonspecific acid phosphatase precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1636"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW23"
FT                   /protein_id="CAE33227.1"
FT                   /translation="MNRHTTEGWRRWAARLGAAAMALLLAACAAPRQQAASVDELPSWN
FT                   DGPSRTAIVEFVRAVTRSGGPDFVAADERIAVFDNDGTLWSEQPMYFQMLFALDRVKSM
FT                   APRHPDWARRQPFKAALQDDHAALAKGGDAALMKIVGATHTDMSTDTFTRSVRYWASTA
FT                   RHPRFDRLYTELTFAPMRELLDYLRAHGFKTYIVSGGETEFMRPWTQQAYGIPPEQVIG
FT                   SSFVTTYGVRDGEPTLWRHGKLEFNDDGPGKPVAIQRYIGRRPILAFGNSDGDLQMLQW
FT                   TAAGDGKRFAGLVHHTDAQREWAYDRDSRIGRLDRALDEARRQDWTVVDMKTEWKRVYA
FT                   FEQP"
FT   misc_feature    112706..112810
FT                   /note="Signal peptide predicted for BB2735 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.702 between residues 35 and 36"
FT   misc_feature    112739..112798
FT                   /note="1 probable transmembrane helix predicted for BB2735
FT                   by TMHMM2.0 at aa 12-31"
FT   misc_feature    112757..112789
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    112922..113584
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 0.013"
FT   misc_feature    112988..113017
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        113790..115418
FT                   /transl_table=11
FT                   /locus_tag="BB2736"
FT                   /product="putative arylsulfatase protein"
FT                   /EC_number="3.1.6.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1635"
FT                   /db_xref="GOA:A0A0H3LMY5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY5"
FT                   /protein_id="CAE33228.1"
FT                   /translation="MNARRWLTAALVAAGGLAVAAGAHAQAQGDAAKPQASGKPPNILV
FT                   IFGDDIGQANISAYTRGVVGYTTPNIDRIAKEGIIFTDYYAENSCTAGRSSFITGQSPR
FT                   RTGLSKVGVPGVDVGLQDRDVTIAQALKAHGYVTAQFGKNHLGDRDEYLPTKHGFDEFF
FT                   GNLYHLNAEEEPERPYWPKDPKDPVVKAYKPRGVIKASADGKIEDTGALTSKRMETIDD
FT                   ETVGAALDYIDKHGKGDKPFFVWMNTTRMHIYTHIRPEHQGKSGMPGNDYADGMWEHDQ
FT                   DVGKLLKKLDDLGIADNTIVVYTTDNGPNQFSWPDAATTPFRNEKDSNWEGAFRVPAMV
FT                   RWPGHIPAGVTRNGMVSGLDWFPTLLAAAGEGDIKEKLLKGWAAGNGGKNYKVHLDGYN
FT                   QLEYLTGKSDKSARNDFYYFNDDGLLVAMRMENWKIVFCEQRAPGGFDVWKDPFVCLRV
FT                   PKVFNLRMDPYERADIVSDQYYDWLSKNAYLAFIGSAKASEFLETFVEWPPSQRPASFS
FT                   VDQVQEEVDRKIMQYFEEQKKKQGK"
FT   misc_feature    113790..113864
FT                   /note="Signal peptide predicted for BB2736 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.956 between residues 25 and 26"
FT   misc_feature    113910..115193
FT                   /note="HMMPfam hit to PF00884, DE Sulfatase, score 2.5e-60"
FT   CDS_pept        115497..118043
FT                   /transl_table=11
FT                   /locus_tag="BB2737"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1634"
FT                   /db_xref="GOA:A0A0H3LMY4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY4"
FT                   /protein_id="CAE33229.1"
FT                   /translation="MSSTPLRAGRAAAPPRAEARPLAGLWAPALLLALSGTAALIFQIL
FT                   WIKQLSLIVGVEVHAIALALSAFFLGLAAGGWWLGRRADRSLRPLRLYAAIEAGVAVLA
FT                   LAVTLALARAAPLFVQGEQYSPWLAWLAVLLLVGAAPFLMGGTLPVLLRAAGAGRVGRA
FT                   GATLYAANTGGAIAGALLPAFLLIPALGVQGSAWAAAGLNLLAALGACWLDHRRGAVAG
FT                   LAEQPAATPAAGEWSPGARLAIGLYSVAGAIAMGYEVLWSQMIVPFMSTRAFAFSIVLA
FT                   VYLAGLAGGAAWYARWESRLGDPWRVFGLLIAGAGLAALVEAALLGRWLVAAQSVAEAA
FT                   VVDWTASGLAGMSARFAVAAAAVVLAPTLLLGAAFPAVLRIAVPPGRRGQGAGAVLAGN
FT                   TLGGIAGTALTAFVLLPYLGTVRALALLALAACCVGALAAWRAPAPAAMARALVAALTG
FT                   AALILAWALPASHLARLLPGAQGGRLLFYEENHGGTVAVVESGQGEQRFHRLYIQGVSN
FT                   SGDAMPSLRYMRLQALLPLIVHAGEPRSALVIGYGTGITAGALSRYPGLRQRVVAELLP
FT                   GVLHAAPLFQGAYGAAGDPGLQVRLRDGRRELLASPERYDLITLEPPPPSAAGVVNLYS
FT                   RDFYALAARRLNMYGIVAQWLPLPTQNLDDTRALVASFIEVFPHATLWTTEFHEMLLVG
FT                   SLAPLPLDAARIAARYAQPGVREALSEVGVDSPAALLATWVTDRAGLARFAGQTPAVTD
FT                   DRPAIEYAGWVRPREVTRTLPALMALRGAPPLQGDGVIAAAEIARARAELDVLYRSALA
FT                   AYQGDRQAWASHAPALARASRDNPYLRWFVGGAGER"
FT   misc_feature    join(115557..115625,115668..115736,115773..115841,
FT                   115884..115952,115989..116057,116067..116135,
FT                   116223..116291,116319..116387,116406..116474,
FT                   116565..116633,116670..116738,116748..116816,
FT                   116835..116903)
FT                   /note="13 probable transmembrane helices predicted for
FT                   BB2737 by TMHMM2.0 at aa 21-43, 58-80, 93-115, 130-152,
FT                   165-187, 191-213, 243-265, 275-297, 304-326, 357-379,
FT                   392-414, 418-440 and 447-469"
FT   CDS_pept        118046..119008
FT                   /transl_table=11
FT                   /locus_tag="BB2738"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTK0"
FT                   /protein_id="CAE33230.1"
FT                   /translation="MRPAARRLGSWLMALAACAAASAAWGQQGLRLSKDDLQKRANGVL
FT                   ALMSFSIVPDITTSALNIAGGGGSTSGSTEFYMTQLGGGDTISKSVPLYLEGVLAASRY
FT                   DPTFIATQGVESRRIPAKWNSVSATGGIGWDFPLTDELKLRPIFNVALGNVTSDLRAAS
FT                   WYVGRQTGQDIDFLDRGSLNAYGLGGSLMLDYEHYRPGYEVDVELRYSDIRLRSFDSSA
FT                   AVRGQATAQSANLWARYRAPTGATLLQRPLRYVLELTHSEFLGDQRGILGFDRLTSVGA
FT                   GLELDSSAYDVFITRTRLVGRYVFGNNVSGFSVGLAVSF"
FT   misc_feature    118046..118123
FT                   /note="Signal peptide predicted for BB2738 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.609 between residues 26 and 27"
FT   misc_feature    118067..118099
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(118951..120894)
FT                   /transl_table=11
FT                   /locus_tag="BB2739"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1658"
FT                   /db_xref="GOA:A0A0H3LP14"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP14"
FT                   /protein_id="CAE33231.1"
FT                   /translation="MAERRRLARRAWALLAWLCLALPAAVLAEPRHFTAAQFLLQDEAA
FT                   AAAPDRVPALGPPGDWQSVALPHAGLQRRVVPDPQAGDAALAWYRLDLDASGVDDPVLY
FT                   LPRWQTVGRLAVYGDGKLLYRSGGSAQWSGFNRPVWLPLAAGGPPPATLLLRISSLDGA
FT                   GAGLSTAWVGAAGELRWRYELRRWLQQDLPYLASAVFLAIGLFALGVWAVRRKESIYGL
FT                   FFAASVVFYLRCLHYHAGPFQLLLDDEWFSWLTITSVGWLAIASYFFAFRLHGRAYPRS
FT                   ERAMLAGMGALTAAMLPVWQIHPHLVLLAPLAYLGITAVSLFACLLAVWGAWRAGSRDG
FT                   LALACWNLAAIPVAVHDMLLQNYRLSMEHVYLLPYTGIGMFVIFLYVAYRRYLNALAEA
FT                   AGAQATLQRRLAERERELEHSHRRLRDVERIRILASERERLMQDMHDGLGSSLVSALRM
FT                   VQHGNSSEGAVAQVLQECLDDLRLTIDSLEPAQTDLALLLATLRSRLGPRLQAAGLAID
FT                   WRVGPLPPVSWLTPPAALHVLRILQEVFTNILKHARARRLTVSTRLEPAHAVIAIIDDG
FT                   AGFCGPRQAPAASRPGRGLTGMQARARAIEARLLWREVARGSHFELHVPRGPAQKLTAR
FT                   PTENPDTLLPNT"
FT   misc_feature    complement(119014..119301)
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.3e-09"
FT   misc_feature    complement(join(119728..119787,119815..119874,
FT                   119893..119961,119989..120045,120082..120147,
FT                   120175..120243,120256..120315,120808..120861))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2739 by TMHMM2.0 at aa 12-29, 194-213, 218-240, 250-271,
FT                   284-302, 312-334, 341-360 and 370-389"
FT   misc_feature    complement(120811..120894)
FT                   /note="Signal peptide predicted for BB2739 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.983 between residues 28 and 29"
FT   CDS_pept        complement(120887..121561)
FT                   /transl_table=11
FT                   /locus_tag="BB2740"
FT                   /product="response regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1659"
FT                   /db_xref="GOA:A0A0H3LW27"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW27"
FT                   /protein_id="CAE33232.1"
FT                   /translation="MQTCTPTRPAGSLRIAIVEDDPAFRHAVVAAIAHEPGMSVLAQAQ
FT                   TCAQARAMLQGPPADVLLVDLGLPDGSGIDVIRQARRLWDDCDIMVNTMFGDEAHVMRS
FT                   IEAGACGYLLKDSEPAGIVRDIRALRDGGSPINPLIARQLLDRLRQGLPAAAPPAAMAL
FT                   SPREHQVLERITLGYTYDEIARDLEVSRHTVQTFVRRIYRKLQVHSKVDAINAARGLRP
FT                   DG"
FT   misc_feature    complement(120893..121084)
FT                   /note="HMMPfam hit to PF00196, DE Bacterial regulatory
FT                   proteins, luxR family, score 2.1e-12"
FT   misc_feature    complement(120950..121033)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(120965..121030)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1061.000, SD 2.80 at aa 178-199, sequence
FT                   YTYDEIARDLEVSRHTVQTFVR"
FT   misc_feature    complement(121160..121525)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 3.8e-23"
FT   CDS_pept        121691..124768
FT                   /transl_table=11
FT                   /gene="sphB2"
FT                   /locus_tag="BB2741"
FT                   /product="autotransporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1660"
FT                   /db_xref="GOA:A0A0H3LMZ1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ1"
FT                   /protein_id="CAE33233.1"
FT                   /translation="MKPIFRIEHPFGSLPARAARGGLLLAGALACCAAAHAELLGVDGG
FT                   GPSGGAGASGPGLAGQPGSGPAPGLGGDRTTPVPGGNGGAGGGAGAAGGSGESTHYGGG
FT                   GGGSDSGGGGGALVYEMAGGAAGGNGGGVAQALSVGADLQSSRGGAGDDGGAPSYGTEP
FT                   GGGGGGGGSGAAVLAGGGYRALGAAIVGGRGGAGGAGFESGGGGGGGHGIRVDAADVRI
FT                   DLFATQVAGGQGGDGGAGSGGSGGGGDGGHGLAGAANDLRLRVGADSSLRGGDGGATWP
FT                   VTHRAGAGGAGGAGLFVSASRWQVETAGLIQGGNGARGEASRELDGGDGGAGGAGIALA
FT                   GDTGRLVNRGEIRGGSGATGGTSERAAPGAAGAGGAGVRIAGNGNRLVNAGRIAGGLSA
FT                   DGQQADAVRIDGAGNTFELRAGSVLQGNAVATGGANVLALGGAQPGVFDVSALVAGAPA
FT                   AWSGVARYGGFTAYEKTGTGSWRLTGGNAAALSWTVRAGRLAVDAEMAGSAMTVAAGGT
FT                   LGGTGTVGDTTVRAGGALAPGNSIGTLRVAGDLVFEPGSRFEVEADPAGTASDRVTVSG
FT                   TADIRGGTVLHVGPEGGFEARQRYVILTAGRRLGQFDAVGSGYAYLAPALSYDATSVAL
FT                   TLQRRGAAGSGELAFADLADTANQRATARAAETLPAAHPVYRAIETLPEGAPPAAFDAL
FT                   SGEVHASTRSALLTGARQAQQVNLGRLRDHLGLAWQAGAPMAASGSAPGAAALPGALSP
FT                   AWAEVVGAWQRLDGDGNAAQVRQHVGGLFVGADTALANGWRVGGSLGFTDGRIEVDARA
FT                   SQTDVASYTAALYGGRAWDTGAGRLNLLAGAAYTWHDIASERRVDVGDLRQELTADYGA
FT                   STTQLFTELSYAMPLGMTAELEPFAGLAWNQLRVRGFTETGGSAALSGASSRDDMATTT
FT                   LGARVAVPLGAGATLRAMAGWRHAFGDRTPQSTLAFGQGSAFEVAGAPIARDAALLGVG
FT                   AGIEVAHNAFLDVAYAGEFGGGNRQHTANAVLRWRF"
FT   misc_feature    121691..121801
FT                   /note="Signal peptide predicted for BB2741 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.993 between residues 37 and 38"
FT   misc_feature    121751..121783
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    123770..123856
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    123902..124762
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 2.3e-32"
FT   CDS_pept        complement(124782..125081)
FT                   /transl_table=11
FT                   /locus_tag="BB2742"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1662"
FT                   /db_xref="GOA:A0A0H3LMY9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY9"
FT                   /protein_id="CAE33234.1"
FT                   /translation="MKKDNTVFNDLQASLKQAVAIRQGKMPPSRVFKVETVDVKATREK
FT                   THMSQTEFAKAIHVSVRTLQNWEQGHRNPTGPAVALLKIVASAPDIAVRALRTA"
FT   misc_feature    complement(124794..124967)
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   3.5e-08"
FT   misc_feature    complement(124875..124940)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2270.000, SD 6.92 at aa 48-69, sequence
FT                   MSQTEFAKAIHVSVRTLQNWEQ"
FT   CDS_pept        complement(125084..125395)
FT                   /transl_table=11
FT                   /locus_tag="BB2743"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1663"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTK6"
FT                   /protein_id="CAE33235.1"
FT                   /translation="MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGI
FT                   RKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAYAKSKKINLTPDEIAALRELVKEL"
FT   CDS_pept        complement(125509..126132)
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BB2744"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1664"
FT                   /db_xref="GOA:A0A0H3LP20"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP20"
FT                   /protein_id="CAE33236.1"
FT                   /translation="MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDY
FT                   LRVNPKGRVPALATEHGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLAS
FT                   TAHVAHAHKRRGARWADDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALGERFSVVDG
FT                   YLYTVGSWMEGDSVDMTRFPKLADYLARVGARPAVQRALAEMNG"
FT   misc_feature    complement(125905..126132)
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 6.8e-12"
FT   CDS_pept        complement(126251..127204)
FT                   /transl_table=11
FT                   /locus_tag="BB2745"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1674"
FT                   /db_xref="GOA:A0A0H3LW32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW32"
FT                   /protein_id="CAE33237.1"
FT                   /translation="MVQRSRAALSHLKFRHIALIQYLLQEGTLRKAARRLSISQPAATA
FT                   MLSDIENLLGVQLFTRSRQGVAPTAQTLALAPRLRILMNDFDELGAMLDRLDTGEHEVL
FT                   RVGVVPQAFTVLLPRAIEGFRQTGGCHLHTVEGSAQDLLARLLAGELDCVLGRLPPDVA
FT                   KLGRDIASLTFVNLYEDDVCVVCGPDHPAARLKKPGYARLAQCDWVLQRISSSVRQALT
FT                   EAFLRQGLLLPHPVVETPTYTQALDIVAATRLLTAAPRHTAMAHARSGRVKVLDIALGV
FT                   APMQVCLILRKSAETHPQIVRFRSVFEAMPMRFPGA"
FT   misc_feature    complement(126272..126916)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2.3e-31"
FT   misc_feature    complement(126986..127165)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.7e-11"
FT   misc_feature    complement(127031..127123)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(127061..127126)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1335.000, SD 3.73 at aa 27-48, sequence
FT                   GTLRKAARRLSISQPAATAMLS"
FT   CDS_pept        127320..128282
FT                   /transl_table=11
FT                   /locus_tag="BB2746"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1675"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ6"
FT                   /protein_id="CAE33238.1"
FT                   /translation="MKTVLRILLLGAGLLGAAAASAEWPADQPIKIIVPQAAGGTNDTV
FT                   ARLMGVELGKALGQTVVVENRPGASGAIGMQLASRSPADGYTLAIASDTASILSATRKM
FT                   DWRLDHDMAGVAMVGDQPIGVAVSMRAPYASLDELLAAARKEPGTIAFGTSGLGTSQHI
FT                   VGEWLTHLAGVQMIHVPYKGGGQAVTDLVSGTTPAAVLGFAPLLGQARSGGIRIVAVTT
FT                   AERNPAMPEVPTLTELGYPQITRSQWVGVVAPRDTPPAIVKRLSDAMAAIGAQPAIQDK
FT                   LREIGLTPKSMDAAQFDAFIHKDVADWGRLVTELNIKLD"
FT   misc_feature    127320..127385
FT                   /note="Signal peptide predicted for BB2746 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.850 between residues 22 and 23"
FT   misc_feature    127452..128270
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.4e-77"
FT   CDS_pept        128297..129691
FT                   /transl_table=11
FT                   /locus_tag="BB2747"
FT                   /product="probable sulfatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1676"
FT                   /db_xref="GOA:A0A0H3LMZ3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ3"
FT                   /protein_id="CAE33239.1"
FT                   /translation="MSQVTQHPNVVLILADNLGWGELGCYGGGAIRGAPTPRIDALAAQ
FT                   GTQFLNFNVESDCVPTRSALMTGRHPVRTGAMQSVPAGLPQGLVPWERTLAQAFSEQGY
FT                   ATAMYGKWHLGDKEGRYPKDRGFDEWYGIPRTTNESMFMEAVGFDPDVVEVPYVMEGRK
FT                   GSPAERRERYDLEMRRRIDEVLTQRSCEFIGRHAGKAPFFLYVPLTQLHFPTIPHREFE
FT                   GRTGKGDFADSLVEMDARIGQILDAVDQHGIADDTVFIFASDNGPEYRRPWRGSAGMWT
FT                   GTYHTAMEGALRVPLIVRWPGKVPAGRQTNEIVHVVDLFPTLAGIAGLQVPQDRPIDGV
FT                   DQSAFLLGREEKSAREGFVYYIKNELRAAKWRDWKMHFVWEVEPNAGPNHLETPYVFNL
FT                   MQDPKEETDVNTMQGWVRGPIRRMVNAFQASLKSYPPIPPGAPDDYAPSYDMTPPAATD
FT                   GGQEAP"
FT   misc_feature    128318..129505
FT                   /note="HMMPfam hit to PF00884, DE Sulfatase, score 5.8e-88"
FT   CDS_pept        129688..130275
FT                   /transl_table=11
FT                   /locus_tag="BB2748"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1677"
FT                   /db_xref="GOA:A0A0H3LTK9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTK9"
FT                   /protein_id="CAE33240.1"
FT                   /translation="MSDAQAEWAAHICPDAGAALAALPPACRIVYLADGQAPALGRAVR
FT                   ALAADLVVGLSLDYPPGLDPRERGAAAPDTELEDALLARLAGFAAIARRWDRPLRTVGC
FT                   HGALALDVADDERTTQVVARMLQRYDPALSMAVPAGRRGIAVAHHCGIAVVREAWARAP
FT                   SSGAADMSSVRVDRYRLCLDAGGAGQGAGTAP"
FT   CDS_pept        complement(130291..131262)
FT                   /transl_table=11
FT                   /locus_tag="BB2749"
FT                   /product="probable monooxygenase"
FT                   /note="Similar to Brucella melitensis alkanal monooxygenase
FT                   alpha chain bmei0894 SWALL:Q8YHA8 (EMBL:AE009530) (327 aa)
FT                   fasta scores: E(): 4.5e-57, 51.52% id in 328 aa, and to
FT                   Escherichia coli hypothetical protein yhbw or b3160
FT                   SWALL:YHBW_ECOLI (SWALL:P45529) (335 aa) fasta scores: E():
FT                   1.1e-53, 50.31% id in 318 aa"
FT                   /db_xref="GOA:A0A0H3LP26"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP26"
FT                   /protein_id="CAE33241.1"
FT                   /translation="MTALSVLDLVMIGEDKDLATAIEESRQLARHVDRHGYTRYWIAEH
FT                   HDMPGIGSAATSLIIDQIAAATSRIRVGAGGIMLPNHAPLAIAEQFGTLNALYPGRIDL
FT                   GMGRAPGSAGAAVRALRRGAAESDFAADVTEVMDYLANNGRQPARGVPGRHDVPVWILG
FT                   SSMYGAQLAAALGLPYAFASHFAPRFLDQAVDHYRRNFRPSRWLASPYVMVGANIFAAD
FT                   SNEQAEFLASSHRQWMLDLHMGRLGLLPRPVHGYVEGLPDNERRVLDEVLAMTVAGDKA
FT                   KVRAWIHSVVERTGADELMIDSRIYDPHERARSHEYVAQALQ"
FT   misc_feature    complement(130297..131259)
FT                   /note="HMMPfam hit to PF00296, DE Luciferase-like
FT                   monooxygenase, score 2.9e-25"
FT   CDS_pept        complement(131315..132412)
FT                   /transl_table=11
FT                   /locus_tag="BB2750"
FT                   /product="putative NADH:flavin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Escherichia coli N-ethylmaleimide
FT                   reductase NemA or b1650 SWALL:NEMA_ECOLI (SWALL:P77258)
FT                   (365 aa) fasta scores: E(): 2.2e-53, 43.83% id in 365 aa,
FT                   and to Yersinia pestis morphinone reductase MorB
FT                   SWALL:Q93AB5 (EMBL:AF426171) (369 aa) fasta scores: E():
FT                   6.9e-72, 52.17% id in 368 aa"
FT                   /db_xref="GOA:A0A0H3LW37"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW37"
FT                   /protein_id="CAE33242.1"
FT                   /translation="MTMASIFSPYELGELILPNRVVMAPMTRARTLDTVPAQSMALYYA
FT                   QRASAGLIVTESAQVSAQGRGYLCTPGIHTPEQVAAWRNVTDAVHRAGGRIFIQLWHVG
FT                   RLSHTSLLPDGGSPVGPVSVAAAHTLVQAYGHDGRPAQVPASPPAALDIAGIRRIVADF
FT                   RAAAENAARAGFDGVEIHAGNGFLFEQFINAGLNTREDQYGGPSIANRLRLLLETVDAV
FT                   SAVIGRQRVGVRISPFAHAGDLHEFDSEKASWLGLAGALCQRRIAYLHASHLGQAGFQR
FT                   DMRKAFGGTFMLAGGFTAQTAQAALDAGEADLVVFGRPFIANPDLVERMRHGWPLAEAG
FT                   KHAFYGGDDRGYTDYPRYAAAQPAA"
FT   misc_feature    complement(131402..132400)
FT                   /note="HMMPfam hit to PF00724, DE NADH:flavin
FT                   oxidoreductase / NADH oxidase family, score 2.2e-75"
FT   CDS_pept        complement(132420..133436)
FT                   /transl_table=11
FT                   /locus_tag="BB2751"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsp0908 or rs01680 SWALL:Q8XRE6 (EMBL:AL646081)
FT                   (319 aa) fasta scores: E(): 2e-44, 44.65% id in 318 aa, and
FT                   to Pseudomonas aeruginosa hypothetical protein Pa1186
FT                   SWALL:Q9I4F2 (EMBL:AE004549) (339 aa) fasta scores: E():
FT                   4.6e-42, 43.51% id in 324 aa"
FT                   /db_xref="GOA:A0A0H3LN01"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN01"
FT                   /protein_id="CAE33243.1"
FT                   /translation="MDTPNSAPLDRPSFEPPCAGLGSHAGFGRLFRPAALSIGLILPLE
FT                   THPDRPAPTMARHVEMAQRAEALGFGALWLRDVPFHDPAYGDVAQIFEPLVYIGYLAAA
FT                   TRRIALGTTGIVLPTHEPMYLAKQAASLDQLSGGRFVLGLSSGDRLSDYPMLGIDYDSR
FT                   GERYRDAYGVLRTLTEQRFPSFRSARFGGSDGKLDLVPKPLHGRVPAIAVGAAQQTLAW
FT                   LARNMDGLLTGAPMPQRLSRLAQEWRDHVARLAGPAHFKPLGLGGYLDLSANPDEPFQR
FT                   IPGGFRAGRNGLRAYLELARAAGVAHVALNPKVSRQPYAEILDELAQYVLPEFPSHS"
FT   misc_feature    complement(132435..133331)
FT                   /note="HMMPfam hit to PF00296, DE Luciferase-like
FT                   monooxygenase, score 3.3e-08"
FT   CDS_pept        complement(133553..134479)
FT                   /transl_table=11
FT                   /locus_tag="BB2752"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator mlr2579 SWALL:Q98I42 (EMBL:AP003000) (304 aa)
FT                   fasta scores: E(): 3.7e-37, 40.26% id in 303 aa, and to
FT                   Yersinia pestis putative transcriptional regulator mlr2579
FT                   SWALL:Q93AB4 (EMBL:AF426171) (303 aa) fasta scores: E():
FT                   3.4e-35, 37.37% id in 297 aa"
FT                   /db_xref="GOA:A0A0H3LMZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ7"
FT                   /protein_id="CAE33244.1"
FT                   /translation="MEPNRFGDILAFVSAVKAGSFTSAAATLGVTRSAVGKSVARLEAR
FT                   LGVRLLHRTTRKLNVTGEGLVVFERWSQILEDLEEVDATMAQRRGKPAGILRLTAPLSF
FT                   GQRHILPILNAYVTNWPEIQADVWFTDHYVDLIEEGIDVAVRIGGVKDDARILSRTIGG
FT                   QQFVTCAAPGYLAKKGVPSTPADLAGHDTIFFLSGQRPMPWRLGQGDAIEVCDGPGRMN
FT                   IDSSEALREAALSGFGLIHLPTYITGKDLQRGDLVEVLEAYRPPADPIRLIYPSKRHLS
FT                   PRTRAFIDLLIERWRDGVPWERLEPAS"
FT   misc_feature    complement(133592..134215)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 5.2e-42"
FT   misc_feature    complement(134285..134464)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.5e-14"
FT   misc_feature    complement(134330..134422)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(134360..134425)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1273.000, SD 3.52 at aa 76-97, sequence
FT                   GSFTSAAATLGVTRSAVGKSVA"
FT   CDS_pept        complement(134656..135864)
FT                   /transl_table=11
FT                   /locus_tag="BB2753"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 42.8
FT                   kDa protein SWALL:Q9RBG0 (EMBL:AF130250) (401 aa) fasta
FT                   scores: E(): 1.2e-45, 40.81% id in 370 aa, and to Ralstonia
FT                   solanacearum putative salicylate hydroxylase oxidoreductase
FT                   protein rsp0911 or rs01683 SWALL:Q8XRE3 (EMBL:AL646081)
FT                   (397 aa) fasta scores: E(): 2.9e-44, 38.77% id in 374 aa"
FT                   /db_xref="GOA:A0A0H3LTL5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTL5"
FT                   /protein_id="CAE33245.1"
FT                   /translation="MRKAAVIGGSLGGLFAANLLLRAGWDVHVHERVHDELDGRGAGIV
FT                   THPELLDVLRRIGVAPTESIGIEVARRVTLDLDGSVLASRALPQLLTAWGRLFSILRTR
FT                   FPAERYHRGQALESLEQDERRALLRFADGARAEVDLVVAADGLRSTLRQALLPQARPAY
FT                   AGYVAWRGLVDEASLSERTRRELCPYFAFGLPAHEQMIAYPVAGTGSGAQDAARRFNFV
FT                   WYRPADEHTTFRDMVTDAQGQAWMDGIPPPLIRPEIVAQARQAAAQVLAPQFGEVVAKT
FT                   ANLFFQPIFDLESPRLALGRVALLGDAAFVARPHCGMGVTKAAGDARALAYALAGTPDI
FT                   GAALQAYEDERLPFGKFIVGHARDLGRYMQAQLRDDAEREMAERYRTPEAIMRETAVAP
FT                   AWR"
FT   misc_feature    complement(134776..135456)
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   5.2e-11"
FT   misc_feature    complement(135817..135864)
FT                   /note="Signal peptide predicted for BB2753 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.947) with cleavage site
FT                   probability 0.634 between residues 16 and 17"
FT   CDS_pept        complement(135857..136342)
FT                   /transl_table=11
FT                   /locus_tag="BB2754"
FT                   /product="putative dioxygenase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc2017 or rs03585 SWALL:Q8XXU6 (EMBL:AL646067)
FT                   (134 aa) fasta scores: E(): 0.00069, 33.84% id in 130 aa,
FT                   and to Arabidopsis thaliana at2g28420/t1b3.6 SWALL:Q941C8
FT                   (EMBL:AY052254) (184 aa) fasta scores: E(): 0.013, 31.54%
FT                   id in 168 aa"
FT                   /db_xref="GOA:A0A0H3LP31"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP31"
FT                   /protein_id="CAE33246.1"
FT                   /translation="MPVRKLAHYSVRTASLDASRRFYTEILGFKEGYRPAFKFPGVWLY
FT                   QGGDEADYGVVHLIGVDRDDPQGLADYLGDKDAASLHGSAAIDHLAFLATDLADMRARL
FT                   ANAGLDFRERTVPDLGLHQVFVEDPSGVTIELNYPAAQAMGADAATPHNGDQHATRA"
FT   misc_feature    complement(135908..136309)
FT                   /note="HMMPfam hit to PF00903, DE Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily, score 1.3e-09"
FT   CDS_pept        136539..137744
FT                   /transl_table=11
FT                   /locus_tag="BB2755"
FT                   /product="putative substrate-binding periplasmic protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   substrate-binding periplasmic rsc3342 or rs02578
FT                   SWALL:Q8XU51 (EMBL:AL646074) (402 aa) fasta scores: E():
FT                   7.2e-29, 31.13% id in 395 aa, and to Brucella melitensis
FT                   branched-chain amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein bmeii0344 SWALL:Q8YD33
FT                   (EMBL:AE009671) (401 aa) fasta scores: E(): 3.3e-21, 26.75%
FT                   id in 385 aa"
FT                   /db_xref="GOA:A0A0H3LW41"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW41"
FT                   /protein_id="CAE33247.1"
FT                   /translation="MSMRTPWRASGLLAAALWCAASAAQAQTIKIGLPVPLSGPYGAEA
FT                   QDQVRNAELAVKQFNDAGGLDGRKAQLLVRDDRLNPAEAATRALELIEKDGVNFIVGGL
FT                   SAATQLSINNVTRQRKKLYISISQSDAINEAADASPYTFHEALNPHMTTQAVGKYVFKP
FT                   GMRVAFLTADYAYGHEMTRGFTEVARQQGAEVVGEVKHPLGASDYSAFLPRLKALNPDV
FT                   LVFNNFGADNRISIKQAADFGMKRNIRFVTPILTYTARVSGGAATYQDVVGGTQYYWAI
FT                   QDSVPSAKAFNAAFQAENNGRFPSDYGAMAYSAVKSLLLAVRDAGSTDTDEVAAALRKL
FT                   KYDTYKGAQYYRGCDQQSVQSVLVIQSVGKDNAHPDEVFKLLHTEAPSEQILRSCQALG
FT                   FK"
FT   misc_feature    136539..136616
FT                   /note="Signal peptide predicted for BB2755 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.939 between residues 26 and 27"
FT   CDS_pept        137796..138671
FT                   /transl_table=11
FT                   /locus_tag="BB2756"
FT                   /product="permease component of ABC transporter protein"
FT                   /note="Similar to Rhizobium meliloti putative permease ABC
FT                   transporter protein r02975 or smc03118 SWALL:Q92LQ5
FT                   (EMBL:AL591792) (295 aa) fasta scores: E(): 6.5e-47, 50.17%
FT                   id in 281 aa, and to Agrobacterium tumefaciens ABC
FT                   transporter, membrane spanning protein atu4126 or
FT                   agr_l_1455 SWALL:Q8U8G6 (EMBL:AE009343) (295 aa) fasta
FT                   scores: E(): 6.5e-47, 48.44% id in 289 aa"
FT                   /db_xref="GOA:A0A0H3LN05"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN05"
FT                   /protein_id="CAE33248.1"
FT                   /translation="MTVDLVLLQLFTGLALGAIYVLLAVGLSLIFGMLTVVNFAHGAFF
FT                   MLGAYAGVVVLGLTQNFWAAMLLAPLAVAAVGMVCERWLIRPLYGRGIDYPLLLTFGLA
FT                   YMLVEAVRMLFGRAGLPFDTPEALAGFTNLGFADFPTYRLFIIAVTIVLLLALWLLIEK
FT                   TAFGLIVRAGARDPVIVRVLGIDVSRVWLLVFGLGTGIAALAGVLAAPLQGVSPEMGTS
FT                   VLIVAFVVTVVGGMGSLMGAVVAGLLVGVAESMSVLFFPEAAKVSMFVIMAAVLLWRPQ
FT                   GLFGRSGLLA"
FT   misc_feature    137796..137948
FT                   /note="Signal peptide predicted for BB2756 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.915) with cleavage site
FT                   probability 0.856 between residues 51 and 52"
FT   misc_feature    137811..138659
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 1.1e-44"
FT   misc_feature    join(137823..137891,137904..137972,137982..138050,
FT                   138084..138152,138210..138278,138363..138431,
FT                   138474..138542,138561..138629)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2756 by TMHMM2.0 at aa 10-32, 37-59, 63-85, 97-119,
FT                   139-161, 190-212, 227-249 and 256-278"
FT   CDS_pept        138683..139672
FT                   /transl_table=11
FT                   /locus_tag="BB2757"
FT                   /product="permease component of ABC transporter protein"
FT                   /note="Similar to Agrobacterium tumefaciens ABC
FT                   transporter, membrane spanning protein atu4127 or
FT                   agr_l_1453 SWALL:Q8U8G5 (EMBL:AE009343) (335 aa) fasta
FT                   scores: E(): 3.7e-37, 40.82% id in 316 aa, and to Ralstonia
FT                   solanacearum probable transmembrane ABC transporter protein
FT                   rsc3340 or rs02575 SWALL:Q8XU53 (EMBL:AL646074) (328 aa)
FT                   fasta scores: E(): 6e-36, 42.12% id in 311 aa"
FT                   /db_xref="GOA:A0A0H3LN02"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN02"
FT                   /protein_id="CAE33249.1"
FT                   /translation="MRSLSFAAGARPSGATVLRGLVARHRVLAAIAFFCVFPWIMPYQS
FT                   VAINVLIFGLYAVGFNLLFGYMGLLSFGHAAFLGTGAYTAGILISQHGAAWWWAVPAAI
FT                   AMSALVALAMGLLAIRTRGIYFAMVTLALSQCVYFLVYQLPASGGENGLRGVNVAEVSL
FT                   LGLRLDLLDPMQKYYFILGFVALAMAVLSRILSSPFGGVVEAIRENESRARACGFDVDR
FT                   SKLLTFVLSAAFCGLAGALNAIHLSSVAIETLAYTTSGMVVMLCLLGGMGTYFGPFVGA
FT                   ALFLFIQDVASEYTENWQLYVGAVFVIFVLFFPKGVWGTVLERIDHER"
FT   misc_feature    join(138743..138811,138821..138880,138884..138952,
FT                   138965..139033,139052..139120,139220..139288,
FT                   139349..139417,139475..139543,139580..139648)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BB2757 by TMHMM2.0 at aa 21-43, 47-66, 68-90, 95-117,
FT                   124-146, 180-202, 223-245, 265-287 and 300-322"
FT   misc_feature    138800..139648
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 1.7e-15"
FT   CDS_pept        139662..140414
FT                   /transl_table=11
FT                   /locus_tag="BB2758"
FT                   /product="ATP-binding component of ABC transporter protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   ATP-binding ABC transporter protein rsc3344 or rs02581
FT                   SWALL:Q8XU49 (EMBL:AL646074) (256 aa) fasta scores: E():
FT                   2.5e-35, 46.15% id in 247 aa, and to Deinococcus
FT                   radiodurans branched-chain amino acid ABC transporter,
FT                   ATP-binding protein dr0283 SWALL:Q9RXM7 (EMBL:AE001889)
FT                   (290 aa) fasta scores: E(): 4.3e-33, 44.96% id in 258 aa"
FT                   /db_xref="GOA:A0A0H3LTM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTM1"
FT                   /protein_id="CAE33250.1"
FT                   /translation="MSADPIIETRAVTKRFGDFVALRNVSVRIPRGRLTSIIGPNGAGK
FT                   STYFNLLSGAFAPSEGSVLFEGRDITGLPEHRYAHTGIAKSFQITNLFPSFSVLENVRI
FT                   ALQAQVSRYNLWSRRSDLPELRERAMALLQTVGLADKSRVRARELAHGQQRALEIAVAL
FT                   AADPGLLLMDEPTAGMSPEETRAMMDLIRRLVEARSVILVEHKMKLVMGISDRIVVLHH
FT                   GELLAEGSPDDIRNNDQVRRVYLGQGKH"
FT   misc_feature    139755..140330
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   9.8e-50"
FT   misc_feature    139776..139799
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    140106..140150
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        140423..141127
FT                   /transl_table=11
FT                   /locus_tag="BB2759"
FT                   /product="ATP-binding component of ABC transporter protein"
FT                   /note="Similar to Thermotoga maritima branched chain amino
FT                   acid ABC transporter, ATP-binding protein tm1139
FT                   SWALL:Q9X0M3 (EMBL:AE001771) (239 aa) fasta scores: E():
FT                   1.4e-32, 47.05% id in 238 aa, and to Deinococcus
FT                   radiodurans branched-chain amino acid ABC transporter,
FT                   ATP-binding protein dr1034 SWALL:Q9RVJ4 (EMBL:AE001955)
FT                   (252 aa) fasta scores: E(): 5.8e-32, 46.12% id in 232 aa"
FT                   /db_xref="GOA:A0A0H3LP36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP36"
FT                   /protein_id="CAE33251.1"
FT                   /translation="MLKIQDLHAWYGSSHILQGVSLDVERGELVCLVGRNGAGKTTTVK
FT                   SVAGLIPKARGTIRFDGRDILGLPAHARYAMGLAYVPEERRIVPGLTVRENIQLGLLRS
FT                   PLHRREKEVIDEIAETFPRLKERLDQQAVTMSGGEQQMLAIARAAASKPKFIMLDEPSE
FT                   GIMPVLVDEMFRYFETLKAAGVTMLLIEQNVELALAIADRAYILDQGEVVYSGGAQAML
FT                   ADEVMQERYCSV"
FT   misc_feature    140501..141052
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2e-52"
FT   misc_feature    140522..140545
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    140825..140869
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        141284..141874
FT                   /transl_table=11
FT                   /locus_tag="BB2760"
FT                   /product="TetR-family transcriptional regulator"
FT                   /note="Similar to Thermotoga maritima transcriptional
FT                   regulator, TetR family tm1030 SWALL:Q9X0C0 (EMBL:AE001764)
FT                   (200 aa) fasta scores: E(): 0.032, 22.88% id in 201 aa, and
FT                   to Clostridium acetobutylicum transcriptional regulator,
FT                   AcRR family cac3271 SWALL:Q97E45 (EMBL:AE007822) (205 aa)
FT                   fasta scores: E(): 0.0027, 20.94% id in 191 aa"
FT                   /db_xref="GOA:A0A0H3LW45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW45"
FT                   /protein_id="CAE33252.1"
FT                   /translation="MEKAIEHFTKNGFEGSTRELAKQIGVTQPLLYRYFSSKEALIERV
FT                   YAEVFQWRRDWEAQIKDRKVPLRDRLHAFYMDYSSVILREEWIRIFIFAGLTRDGINNR
FT                   YLTRLRTHVFLPVLAELRAEFGLDEPRDRAEVEAEIEMIWSLHAAIFYLGVRKWIYGLK
FT                   VPTDLDRVVRQKVDMFLHGAPPAMRALRAGRPA"
FT   misc_feature    141284..141418
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 3.3e-09"
FT   misc_feature    141317..141406
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT   misc_feature    141326..141391
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2009.000, SD 6.03 at aa 15-36, sequence
FT                   GSTRELAKQIGVTQPLLYRYFS"
FT   CDS_pept        complement(141888..142715)
FT                   /transl_table=11
FT                   /locus_tag="BB2761"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /db_xref="GOA:A0A0H3LN09"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN09"
FT                   /protein_id="CAE33253.1"
FT                   /translation="MGTMAKTDNTLGTVARVVALLRILAERSNRVTLSDLAAELALAPS
FT                   TIHRLLALLKDEGLVARDPVTKMYYCDVEFVRIASLVVDSSQIKDLAAPLLQSLVERFN
FT                   ETTLLCLYLAQQRRYTIVSVHHGTELLRYDVKENTPLQMAWGATARSILAFLPQDDIDR
FT                   ILAEAGPSVTGAGVADKTVHKDLAQIRKRGYAVTKGQRIAGSIGLGAPFFGVDGNVLGS
FT                   LCLTIPQGRFNARREAEYTQALIEHAARLSHSLGYVAPSEAKPRKPAAAARRA"
FT   misc_feature    complement(141954..142511)
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 3.4e-08"
FT   misc_feature    complement(142560..142625)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1606.000, SD 4.66 at aa 31-52, sequence
FT                   VTLSDLAAELALAPSTIHRLLA"
FT   CDS_pept        complement(142867..144093)
FT                   /transl_table=11
FT                   /locus_tag="BB2762"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LN07"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN07"
FT                   /protein_id="CAE33254.1"
FT                   /translation="MHEVQQQSPAPAAKPLAGYRVLDLTTFLSGPFCTQILADLGAEVI
FT                   KVEAPDGDSSRHIPPHFVDGDSAYYLGINRDKKSLAVDMKQPEGLALVKSLIARSHVVV
FT                   ENYRPGVAARIGLDIAALMAQHPSLVWASISGFGQVGPLRDRPAYDMIVQAMSGVMSLT
FT                   GEAGRPAVRLGIPAGDLAAGMYAAIAVNAALADAARGGRGRHIDISMLDCQLAMLSYQS
FT                   TYALVAGVTPQRQAARHDSIPTYRSFLAGDGRELVVTANTERMWKGLCEALGLRELAQD
FT                   ARFCDAEMRLQNREPLWDLLEAAFLARPAAEWIEPLAANGVPVALIKTVPEALSEARAS
FT                   GRGMVMPLRRPGGPEIEVVGNPIKFLGEAEPPARYPPRLGEDAPAILAQWLGWSEQEIQ
FT                   AMQARKVVM"
FT   misc_feature    complement(143287..143856)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   2e-54"
FT   CDS_pept        complement(144131..145273)
FT                   /transl_table=11
FT                   /locus_tag="BB2763"
FT                   /product="Putative thiolase"
FT                   /db_xref="GOA:A0A0H3LTM6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTM6"
FT                   /protein_id="CAE33255.1"
FT                   /translation="MSKVYIAGAAMIPMGRHRQSSYSGLAVPAVLNALRSAGIAPRDVE
FT                   AVVCGHAFGGMLTGQRIVKEMGIGAVPVFNVDNACSGGASALHLAYKDIQAGIRDIVLV
FT                   IGVDKLTQFGGGTLPLVAEDPEVRLGIVMPAVYAMRAQRYLYERDATVADLAQVSVKAR
FT                   RHGARNPYAQFRSEVTVDEVLDSRPICDPLTLLQCCPTGDGAAAVIMVSEAGRRKLAAP
FT                   AVRVAASVVHSGQVTAGYRDMLNPEISTDSARDAYEAAGFGPQDLDVVELHDAFSIAEL
FT                   VYYEALGLCPRGESAAFLRCGQSTYGGQVVVNPSGGLLSKGHPVGASGVAQAVEVYWHL
FT                   TGQAGERQVPGARRALSHVTGGGIAGLDHGACTVHLYEAV"
FT   misc_feature    complement(144164..144610)
FT                   /note="HMMPfam hit to PF02803, DE Thiolase, C-terminal
FT                   domain, score 1.1e-18"
FT   misc_feature    complement(144287..144337)
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    complement(144632..145273)
FT                   /note="HMMPfam hit to PF00108, DE Thiolase, N-terminal
FT                   domain, score 5.3e-08"
FT   CDS_pept        complement(145293..145712)
FT                   /transl_table=11
FT                   /locus_tag="BB2764"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP41"
FT                   /protein_id="CAE33256.1"
FT                   /translation="MQETSPATGGQQYADDALPIKDLKEAPLPPFEVKDAVVYLRGSRS
FT                   RSSGSMAFPEREVCLQTGARDMEPFLFGPDATLYSYTTVHVSSARPVPYTLGYVDFPNG
FT                   VRVLAHVLADPAQPLHCGQSVRLRADGERWFVTPA"
FT   CDS_pept        complement(145792..146808)
FT                   /transl_table=11
FT                   /locus_tag="BB2765"
FT                   /product="Putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW50"
FT                   /protein_id="CAE33257.1"
FT                   /translation="MPDHHPEDVAAPRRRALKTLAAACSLTLAPLAALSPAHAADAFPA
FT                   KPITLVAPFAAGGSTDMLARVVAKALAAELGQSVIVENKGGAGGTIGAAYVARAAADGY
FT                   TLLLSNVTLTSAPALYKNMSYDFSKDMSAISLLGQVPCVLEINKDLPVKDGKAFLDYLR
FT                   ANDGKLYYGSSGVGAALHMATASFLSAAGLSAIHVPYKGTGPMMVDLIAGNVQFAIDTS
FT                   GSASAQVRGGNVRGVAVTSRERDPAWPGVPTLRELGVPFEMTIWYGISAPAGVPEPVRR
FT                   KLHAAIEKATRTDEVRTAYQSMGMQVDTRGGKEFEQVIAEDTARWITLVKDAGINPS"
FT   misc_feature    complement(145804..146622)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.2e-94"
FT   misc_feature    complement(146692..146808)
FT                   /note="Signal peptide predicted for BB2765 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.992 between residues 39 and 40"
FT   CDS_pept        complement(146953..147891)
FT                   /transl_table=11
FT                   /locus_tag="BB2766"
FT                   /product="Putative short chain dehydrogenase"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN15"
FT                   /protein_id="CAE33258.1"
FT                   /translation="MLPRPIEYTNFRCNEFISVKRKYRAPLYLQRGPAGSIGKRKTMPS
FT                   NVLENKIAIVVGAGQTPGSTMGNGRATAIAFARAGASVVAVDRDMASAGETAGLILAEG
FT                   GQAMAVQADITSEAAIVAMVRQVMETHGRIDILHNNVGIAGAGGDAPVEDISVEAFDLL
FT                   ANLNLKGMMLTCKHVLPAMRAQRSGCVLNVASTAAYALYPNVAYKATKMGVLGLTQHIA
FT                   MTYAEHGVRANAILPGLIDTPMAIEARVRLTGKPREQIVAERNAMVPLRGRMGTSWDVA
FT                   HAAVFLASDQAGFITGVQLPVDGGALARLGP"
FT   misc_feature    complement(146974..147747)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 2.7e-58"
FT   CDS_pept        complement(147982..148863)
FT                   /transl_table=11
FT                   /locus_tag="BB2767"
FT                   /product="Putative LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LN13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN13"
FT                   /protein_id="CAE33259.1"
FT                   /translation="MRYFVAVAEERSFSRAAERLHISQPPLSQQIKALEEELNAPLFHR
FT                   LPRGVSLTAAGAALLKSSRAILANVRLAAQETTQIAAGMLGTVRMGTVSSALAHLVPYI
FT                   LTQVKRSMPGSKVELTEMSSREQTLAVLRDELDIGLVHTPIDTADLRTRQILREPFYAA
FT                   VPSQHPLASREAVPVAELASEEFVFFPRTLASGLFDKMVSLCMNAGFSPKIHHTARHQS
FT                   TMLQMVAMGLGVTIVPRSLQRIYKGSAVFLPLTGTPHYLELSLIWRESTANGLVERLIG
FT                   GLEPLRDFDSLP"
FT   misc_feature    complement(148000..148623)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 3.7e-42"
FT   misc_feature    complement(148093..148110)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   misc_feature    complement(148693..148863)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.2e-28"
FT   misc_feature    complement(148738..148830)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(148768..148833)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1853.000, SD 5.50 at aa 11-32, sequence
FT                   RSFSRAAERLHISQPPLSQQIK"
FT   CDS_pept        149025..149996
FT                   /transl_table=11
FT                   /locus_tag="BB2768"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTN1"
FT                   /protein_id="CAE33260.1"
FT                   /translation="MNRRDALGALAALASTTWLGRAAAAKPYPQRPVTLIVPYSPGGAT
FT                   DNVARVIAEHLQARLGQPVIIDNRAGANGRIGTLAVARAAPDGYVLLLGGIGPITIAPH
FT                   LEKVPYDPFKDFAPVSLLVKNDVVLLVNPAVPARKPEELIALLKAEPGKFNYASSGTGG
FT                   PFHLSGELFKSMAGVEMTHVPYKGDGPALVDLMAGNVQVMFTTISASAAHIQAGKAIAL
FT                   ASAGEVRSSQMPDLPTLAESALPGFASETWQALFAPGGTPAPTIDALQAGLAGAMRDAR
FT                   LRQALQAQGNSVVASDVPACAQFVRDEYEKWGNVVRKSGLAA"
FT   misc_feature    149025..149099
FT                   /note="Signal peptide predicted for BB2768 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.502 between residues 25 and 26"
FT   misc_feature    149166..149987
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.6e-100"
FT   CDS_pept        149993..151240
FT                   /transl_table=11
FT                   /locus_tag="BB2769"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LP46"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP46"
FT                   /protein_id="CAE33261.1"
FT                   /translation="MTQEGAKMSGGGASKPMPMDGIRVLDLSRVLAGPWCTQMLADFGA
FT                   DVIKIERPGQGDDSRAWGPPFYESADGHERVSAYFCAANRGKRSVCLDLESEADRQALR
FT                   ELALRSDVLVENFKAGSLARHGLDYATLSALNPRLVYCSITGYGQTGPYAARPGYDSII
FT                   QAVGGMMSVTGLPDDAAGGGPQKTGIPIIDLMTGVYACCGVLMALREREASGQGQHLDL
FT                   SLMDVQVSALSTLAANFLACGQAPQRNGNEHPTVVPGDAVQCLDGPLMLMVGNDRQFQR
FT                   LCRHLDRESLARDPRYATNELRVQGKNALMAQLREAFRGQTRQYWLERLLAEGIPCGPI
FT                   QTVAEVLADPHVRHRALVAAAPDPVFGEIRAMGSALRMSRTPARHGRAPTVLGEHTEAV
FT                   LSSLASSRLQSNPQAK"
FT   misc_feature    150260..150841
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   1.3e-66"
FT   CDS_pept        151237..151995
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="BB2770"
FT                   /product="Putative carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="GOA:A0A0H3LW54"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW54"
FT                   /protein_id="CAE33262.1"
FT                   /translation="MNTSPTVRFETREQIAIITLNRPDKRNAINLEMRQALIAAWERFE
FT                   NDAALRVAILTGAGERSFSAGRDLSENTDLSQKTFLPILGDNVQASKPVIAAVNGAALG
FT                   GGWFFTQMCDLVVAADHAVFGMPESKVGRAPAWAVWLQGVIPQKLVLELLLTGNPIGAQ
FT                   RAAEIGFVNHVVPAAQLMDKAMELARAIVATAPLSAAACKEMVYAAAEMGRGAALRTAF
FT                   HILEPLYRSEDAREGALAFREKRAPRWSGR"
FT   misc_feature    151282..151764
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 4.4e-44"
FT   misc_feature    151531..151566
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        152024..152824
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BB2771"
FT                   /product="Putative enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="GOA:A0A0H3LN19"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN19"
FT                   /protein_id="CAE33263.1"
FT                   /translation="MTRFLEVERRGRVCIVRMNRPEARNALTDAEQFQEFEDLVRELNA
FT                   DLDVRAAILTGNGPSFCAGGNVKKMLADYGPDSGPAARIPAKYSTGIQRIPMALAQLDV
FT                   PLIAAVNGAAIGAGCDLACMCDIRIAADDARFAESFVKLGIIPGDGGSWFLPRIIGLAR
FT                   TYEMAFTGDTLDAATALQWNLVSSVVPAAQLMDAACQLAERIAVNPPQQVRFAKRLIRE
FT                   GLHQRLEAMLEFSRLYQTLSHRTADHQEGIAALLEKRPPVFHGR"
FT   misc_feature    152063..152593
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 1e-47"
FT   CDS_pept        152855..153829
FT                   /transl_table=11
FT                   /locus_tag="BB2772"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN16"
FT                   /protein_id="CAE33264.1"
FT                   /translation="MRKKHFVLSFLLGAASLAASGAALAQQAFPTHPIRLIVPFAPGSG
FT                   TDNTARHLAREMEAEFGSPVVVENHPGANSFIAAKMVAAAAPDGYTLLISGSSAMTVNA
FT                   AIFKALPYDPLKDFAPVARLAKGAMGLAVNAQSPYRSVDDLVQAMRQQPGTLNYGSGSA
FT                   AYQITTELFLSMAQAKASHIPYKGAAQALTDLAGRQVDFAFADYAALVPFLRSGKLRLL
FT                   AVSSAERLESEPATPTVAQAGYPGFDMVNWTSAFAPAGTPAPIVDTLSKAIVAIYEREQ
FT                   TRAFLAGTNWESFPVGPAELRRYQVDEIAKWSRAAEIAGIEKQ"
FT   misc_feature    152855..152929
FT                   /note="Signal peptide predicted for BB2772 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 25 and 26"
FT   misc_feature    152999..153817
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.1e-71"
FT   CDS_pept        153840..155924
FT                   /transl_table=11
FT                   /locus_tag="BB2773"
FT                   /product="Putative enoyl-CoA isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="GOA:A0A0H3LTN5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTN5"
FT                   /protein_id="CAE33265.1"
FT                   /translation="MSVAIAMRGDIGVVTLDSAPVNALGRTLRHGLAQCLEQVYARPDV
FT                   RALLLVSARPGIFSAGADIKEFDQAGSDQDAGLAELIDRIENAPVPVVALLDGAALGGA
FT                   LELALGCHYRLASPRASLGLPEIKLGLLPGAGGTQRLPRLVGARQAVEMVLGGEPVGGE
FT                   TALRYKLADALLSADDTLEQALAWMRNAPGGLARRRVASLPALAPASIAEAARAAAIRP
FT                   VGSAAAREAALACLAAAQGPFDAGRALERESFARLRDGAEARALRYAFFAERPRPPAGD
FT                   VSARRIEQVAVVGAGTMGTGIVICLADAGLPVIWHDVDADRLAQGRAQVCQHFERLAAR
FT                   KRLTSRQAEQRVAAVATTGEMAGIAQADLAIEAVFEDMAVKCAVFRELDRVLKPGAILG
FT                   TNTSTLDVDRIAHSTRRPQDVVGLHFFSPAPVMPLLEIVRGAATHADVVAAAQGLARRL
FT                   RKTAVVAGVCDGFIGNRMWHQYLRQAALMVHEGAMPMEVDAALRDWGFAMGPFQVADLA
FT                   GLDVGDSIRLRQRSEMPHRPWPDWLDRVSAAGRLGLKGGSGIHAYPDGGRQPRRDAEVE
FT                   AMIAAASREAGVSRRAIAADEIVERCLHALVVEAARLLEEGIAASATDVDAVFLAGYGF
FT                   PRWRGGPCHSADAMGLPAVVAGLRRRAATAEPEFWQPPGLLVRLAAQGGRLQDHGQEGA
FT                   "
FT   misc_feature    153873..154367
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 6.5e-49"
FT   misc_feature    154116..154178
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   misc_feature    154689..155243
FT                   /note="HMMPfam hit to PF02737, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain, score 1.1e-59"
FT   misc_feature    155247..155525
FT                   /note="HMMPfam hit to PF00725, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 3.1e-27"
FT   misc_feature    155631..155918
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00725, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 0.00017"
FT   CDS_pept        155921..157105
FT                   /transl_table=11
FT                   /locus_tag="BB2774"
FT                   /product="Putative ketoacyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="GOA:A0A0H3LP51"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP51"
FT                   /protein_id="CAE33266.1"
FT                   /translation="MSDDIVIVSTARTPIGKAYRGAFNNTHGATLGGHAVEHAVRRAGI
FT                   EPAEVDDLIMGCGRPEGTAGENIARQAALRAGLPVEVPGVTVNRLCSSGLQAIAMGAQS
FT                   ILCGSADIVVAGGLDSISCVQNEHMNHHMEQDPWLARHLPEIFLPMIDTAEVVARRYGI
FT                   SRQRQDEYAARSQQRAAQARAAGRMRDEIAPMRVSHLAADPHGAPPVETEMLVAEDEGV
FT                   RPGTTSEKLAALKSVREGGCITAGNASQLSDGASACVLMRAAAARARGLRPLGRFRGFA
FT                   VAGCRPDEMGIGPVQAVPRLLARAGLAIGDIGLWELNEAFAVQVIYCRDRLGLPDERLN
FT                   VNGGAIALGHPYGMSGARLVGHALLEGRARGVRYVVVTMCVGGGMGAAGLFEVL"
FT   misc_feature    155924..156712
FT                   /note="HMMPfam hit to PF00108, DE Thiolase, N-terminal
FT                   domain, score 2e-84"
FT   misc_feature    156179..156235
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   misc_feature    156725..157099
FT                   /note="HMMPfam hit to PF02803, DE Thiolase, C-terminal
FT                   domain, score 3.5e-54"
FT   misc_feature    156938..156988
FT                   /note="PS00737 Thiolases signature 2."
FT   CDS_pept        157102..158256
FT                   /transl_table=11
FT                   /locus_tag="BB2775"
FT                   /product="Putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="GOA:A0A0H3LW60"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW60"
FT                   /protein_id="CAE33267.1"
FT                   /translation="MNGFEFRTHARTLAGEGASQRLGEAVAAQWGPCRILVVTDEQLVR
FT                   LGLVAALAQSLRDAGHTVQVYDGVLADPPEAVVSQAIARGRETDVQCVIGFGGGSSMDI
FT                   AKLVAAFAGSAADFRDSYGIDRVATARLPLVQVPTTAGTGSEATPIAIVTREDASKAGI
FT                   VSPVLYCDIAVLDAALTRGLPPAVTAATGIDAIVHAVEAYTSRLRKNPISDGLAREALR
FT                   LLCRSIGPACRDGADMAARHDMLLGAMLAGQAFANAPVAAVHALAYPLGGVFHVPHGLS
FT                   NALMFGAVLRFNLPQAGAAYAQLAQIACPQVDGPQQARAEGFVQEMAGLGPRLGLPRRL
FT                   AEVGVAERDLPMLAQQAMQQQRLLVNNPRELGYDDALRLYREAL"
FT   misc_feature    157129..158229
FT                   /note="HMMPfam hit to PF00465, DE Iron-containing alcohol
FT                   dehydrogenase, score 2.7e-84"
FT   misc_feature    157618..157704
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   CDS_pept        158253..158720
FT                   /transl_table=11
FT                   /locus_tag="BB2776"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN22"
FT                   /protein_id="CAE33268.1"
FT                   /translation="MNDSAGQAPRPQRWQRAGFGHFEAMPVRWMDCDMYGHVNNVVYYA
FT                   YFDTAVNRYLASAGQLDPQAGAVIGLVVETHCNFHAPAEFPETLQIGLRVAHVGRSSVR
FT                   YELGVFRPGDELCAAQGHFVHVYVDRASRRPVALPAGLRACLGRLAAAGRA"
FT   misc_feature    158355..158696
FT                   /note="HMMPfam hit to PF03061, DE 4-hydroxybenzoyl-CoA
FT                   thioesterase, score 9.6e-27"
FT   CDS_pept        complement(158751..159962)
FT                   /transl_table=11
FT                   /gene="dadA3"
FT                   /locus_tag="BB2777"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="GOA:A0A0H3LN21"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN21"
FT                   /protein_id="CAE33269.1"
FT                   /translation="MSRIAVIGAGITGVTTAYALALRDHQVTVFDRHRYSAMETSFANG
FT                   GQLSASNAEVWNSRSTLFKGLRWMLRRDAPLLLNPRPSWHKYSWLGEFLRQIPRYEANT
FT                   IETVRLAIAARQHLFDIAARERIDFDHERRGILHFYASRREYDSALRVNALLRAGGLER
FT                   RPVSPEEMRAIEPALQGDFYGGFFTESDSTGDIHKFTTGLARAAARHGALFRYETPVSG
FT                   IDHRGGAIAITTAEDVERYDKVVICAGVGSRRFASMVGDRVNIYPVKGYSITVSLDDEA
FT                   SQAGAPWTSLLDDRAKIVTSRLGAGRFRVAGTAEFNGFNRDIRADRVEPLVAWVRRYFP
FT                   QVSTSRVVPWAGLRPMLPSMLPRVGPGKRPGVFYNTGHGHLGWTLSAATAQLVAEAVTA
FT                   GAGT"
FT   misc_feature    complement(158769..159959)
FT                   /note="HMMPfam hit to PF01266, DE FAD dependent
FT                   oxidoreductase, score 1.5e-05"
FT   misc_feature    complement(159906..159962)
FT                   /note="Signal peptide predicted for BB2777 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.969) with cleavage site
FT                   probability 0.771 between residues 19 and 20"
FT   CDS_pept        complement(160306..161511)
FT                   /transl_table=11
FT                   /locus_tag="BB2778"
FT                   /product="putative monooxygenase"
FT                   /db_xref="GOA:A0A0H3LTN8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTN8"
FT                   /protein_id="CAE33270.1"
FT                   /translation="MPDTSSPRILIAGAGLGGLTAALALQARGFQVRVLEQAAQLRELG
FT                   AGIQLSANANRVLYRLGLGAALEQVASPASGKRIRLWNTGQTWPLFDLGAQSVERYGYP
FT                   YLTIYRADLHRVLAEAVLARDPQAIELGARVESVAQDDAAASVTLADGSTRQADILVGA
FT                   DGVHSRVRAALHGQDQARFSGALAWRGVIPAHKLPPHLREPYAVNWVGPGAHVIHYPLR
FT                   RGELVNFVGILERDDWQVESWTQQGTIAECARDFAGWHEDVQTLIHALDTPFKWAMMLR
FT                   EPLARWTSGRITLLGDACHPTLPMLASGAAMAIEDGYVLARCLDGMRADARQALVRYQD
FT                   LRVERTARVVRGSAENARRFHNPELAHAAGAAAYVEQQWSEARVRERYEWLFTYDVDAE
FT                   PV"
FT   misc_feature    complement(160450..161046)
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   2.1e-38"
FT   misc_feature    complement(161431..161511)
FT                   /note="Signal peptide predicted for BB2778 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.975) with cleavage site
FT                   probability 0.617 between residues 27 and 28"
FT   CDS_pept        complement(161551..162546)
FT                   /transl_table=11
FT                   /locus_tag="BB2779"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP58"
FT                   /protein_id="CAE33271.1"
FT                   /translation="MTSSPALTMTLRAVLALAATASLALGPAAPAAAETFPAKPVTLVV
FT                   PFPPGGPTDTSARLFGAVMADKLGQPVIVENRAGAGGSVGTTVVTRAKPDGYTLLWGGT
FT                   SSIVVAPALYTNLQYDPIKSFTPIGMAVRGPLILVSRPDLGPKDIGQLRDYAKNHDLSV
FT                   ASAGTGSIGHLTAEMFKSEAGARMLHVPYRGGAPALTDVMGGQVDLFFDTVTLLTPQIR
FT                   AGKLRAYAVTGSQRYSGLPEVPTVAETIGKPFEAYSWFGLLAPAGTPAPAVQALTDALA
FT                   AAAKDPEVIKQLSALGLEPVGDTPQEFAQAIRADLDKWTGVVRSAGVKPQ"
FT   misc_feature    complement(161563..162381)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.3e-111"
FT   misc_feature    complement(162448..162546)
FT                   /note="Signal peptide predicted for BB2779 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.866 between residues 33 and 34"
FT   CDS_pept        162704..163606
FT                   /transl_table=11
FT                   /locus_tag="BB2780"
FT                   /product="Putative LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1679"
FT                   /db_xref="GOA:A0A0H3LW65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW65"
FT                   /protein_id="CAE33272.1"
FT                   /translation="MNFSFRQMRAFLAVARHASFTKAAEQLHISQAGLSAMVRDLETQL
FT                   GSRLFERTTRAVRLTPAGQSLLPVAQRAVQDLGAAVAQLGALGAGGRDRLRIGVTPLIA
FT                   CSVIPDVLKRFQALAPQVRVEVMDLDRSLIAARVESGDLDAGFGAFFTRAAGIRRQTVF
FT                   PARLALAVPRVEGERRRSVRWPQIDRDGLIALPDENPIQRLVNRHLGVQGDAPARVVTH
FT                   LETVLAMVEAGLGQAVVPSFAAVARRRWRVSLVPVAPRVAVDYYCIMRAGQGDGERIDA
FT                   FAQCFGSVAAEHMGATAAR"
FT   misc_feature    162704..162772
FT                   /note="Signal peptide predicted for BB2780 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.802) with cleavage site
FT                   probability 0.666 between residues 23 and 24"
FT   misc_feature    162716..162895
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 6.7e-26"
FT   misc_feature    162755..162820
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1328.000, SD 3.71 at aa 18-39, sequence
FT                   ASFTKAAEQLHISQAGLSAMVR"
FT   misc_feature    162758..162850
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    162965..163576
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 3.8e-26"
FT   CDS_pept        complement(163603..164325)
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="BB2781"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1680"
FT                   /db_xref="GOA:A0A0H3LN27"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN27"
FT                   /protein_id="CAE33273.1"
FT                   /translation="MSEVLADLPNIDPSRFKQPSAAELFPPGRATHAPRFLLLYGSLRE
FT                   RSYSRLVAEEAARLLRALGGETRLFNPSGLPLVDDASEDHPKVRELHELVRWAEGMIWS
FT                   SPERHGAMSGLMKTQIDWIPLSMGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAYQEFDEAGRMQPSPYYDRVVDVAEELMKFTLLTRDASPYLVDRYS
FT                   ERKEAAEALSRRTAQARI"
FT   misc_feature    complement(163699..164226)
FT                   /note="HMMPfam hit to PF03358, DE NADPH-dependent FMN
FT                   reductase, score 7.9e-57"
FT   CDS_pept        complement(164318..164761)
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="BB2782"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1681"
FT                   /db_xref="GOA:A0A0H3LN25"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN25"
FT                   /protein_id="CAE33274.1"
FT                   /translation="MHQQRCVMTSITIYHNPACATSRNVLGLIRNSGEEPAIIEYLKTP
FT                   PDAATLRSLIVAMGMPVRDLLRQKGTPYDELGLSDPKWTDEQLIDFMLQYPILINRPIV
FT                   TTPLGTRLCRPSETVLDLLSRPQRGAFDKEDGQPVIDADGNRV"
FT   misc_feature    complement(164402..164686)
FT                   /note="HMMPfam hit to PF03960, DE ArsC family, score 3e-28"
FT   CDS_pept        complement(164764..165951)
FT                   /transl_table=11
FT                   /locus_tag="BB2783"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1682"
FT                   /db_xref="GOA:A0A0H3LTP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTP1"
FT                   /protein_id="CAE33275.1"
FT                   /translation="MPGAPVRVVGILGTAQTLAWASSYYLPAMLADPMARDLGVSTPTV
FT                   YAEFSAALVASALIGPWTGLAIDRHGGRMVLAGTSLLFALGLGMLGAAQGLWTMVAAWL
FT                   VMGVAMGAGLYEAAFSSLVRLYGHHARGAITGITLIAGFASTVGWPLSAWMETLFGWRG
FT                   ACLGWAALHLMIGLPLNAWLPKAVAAETPSPDAPAAQEGTLPAARPGPQGLATALLAFV
FT                   FAATWFISTAMATHLPRMLQATGATLAAAVAVGALIGPAQVAGRLLEFGLLRHVHPLLS
FT                   ARLAALAHPAGVAVLLAAGPALAPLFAILHGAGNGILTIAKGTLPLALFGPRGYGARQG
FT                   WLMMPARVAQALAPFLFGLALDAWRANALWLSGGIGLAACAALLVLRARPDPIKP"
FT   misc_feature    complement(join(164794..164862,164944..165012,
FT                   165031..165099,165157..165225,165262..165315,
FT                   165490..165558,165595..165663,165673..165741,
FT                   165754..165822,165865..165933))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2783 by TMHMM2.0 at aa 7-29, 44-66, 71-93, 97-119,
FT                   132-154, 213-230, 243-265, 285-307, 314-336 and 364-386"
FT   CDS_pept        complement(165955..166335)
FT                   /transl_table=11
FT                   /locus_tag="BB2784"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1683"
FT                   /db_xref="GOA:A0A0H3LP63"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP63"
FT                   /protein_id="CAE33276.1"
FT                   /translation="MIQESLYYFGMNAEQAVSSLGALAHAQRLSVFRALVVAGPAGLTP
FT                   SVMADGLGIARNALSFHLKELAHAGLVSVEQQGRNLIYRADFFRMNALLGYLTEHCCQG
FT                   ATCEVSDSRKNTAGCDAGARRA"
FT   misc_feature    complement(166144..166209)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1018.000, SD 2.65 at aa 43-64, sequence
FT                   LTPSVMADGLGIARNALSFHLK"
FT   CDS_pept        166553..168292
FT                   /transl_table=11
FT                   /locus_tag="BB2785"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1684"
FT                   /db_xref="GOA:A0A0H3LW70"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW70"
FT                   /protein_id="CAE33277.1"
FT                   /translation="MHDEQALDLVIRGGLLMDGHGGAPRVADIGVRGALIAEIGDIAPG
FT                   AAAEIDARGKIVTPGFVDIHTHYDGQIIWNSRLAPSSWHGVTTVVMGNCGVGFAPVRAA
FT                   DRGNLIELMEGVEDIPGIALHEGLDWAWETFPDFLRATERIEHDIDFCAQLPHAALRVY
FT                   VMGERALRLEMATPEDIARMRSLAAEAMRHGAIGFSTSRSINHRSVTGDPMPSLRAAEE
FT                   ELTGIAMGLADAGGGVLEIIIDFDDPDMLEAEFGMMRRLVEKSGRPLSFSLMQKHGNKD
FT                   GWRRLLALTAQAAADGLPIRAQVAPRGVGVLLGLQGSRNVFSDCASYKAIAQLALDERV
FT                   RRMRDPALRAQLLRELRESQDTPLGKRLNEFDNIFPLGNPPCYDPGPERSIAALARRAG
FT                   ADPAELAYDCLLEEDGKALLFSPFANYADQNLDACAQMLADPNTVIGLGDGGAHVALIS
FT                   DASFPTFLLKHWGGGAGRPAFDLPWLVKRQTADTARAVGLHDRGVLEVGKKADINVIDP
FT                   ATIDPGVPVMNMDLPAGKGRYLQKPSGYVATIVSGVVVYRDAAATGALPGRLVRMAAEP
FT                   AAA"
FT   CDS_pept        168353..169324
FT                   /transl_table=11
FT                   /locus_tag="BB2786"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1685"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN32"
FT                   /protein_id="CAE33278.1"
FT                   /translation="MMKGICAAFAFAALAASWQGPAQAAFPDQPIKLVVPFAPGATIGP
FT                   LAQLVSEQLSSDLGTPVYTEFKTGAGGNIGADIVAKSPGDGYTLLLGTISILTINPSLY
FT                   PDLPFDPVKDFKPVSMLVTTQNILVVNPESKIQSVADLADYARQHPGQATFGSSGTGST
FT                   MHLAGELFSTTAQVKMTHVPYRGGGPARSDLLGGRLTLMFSDLSAVPMVQAGKLRALAV
FT                   TGSQRDGRIPDIPTMQESGMKGFDVEPWYGLVAPAGTPDAVIARLNASVRKVFDKQQVR
FT                   DALQNIGLRPASDLSVAYMAGKIDSDLGKWAPIVKSVDMKTN"
FT   misc_feature    168353..168424
FT                   /note="Signal peptide predicted for BB2786 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.975 between residues 24 and 25"
FT   misc_feature    168488..169312
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2.4e-95"
FT   CDS_pept        169338..170051
FT                   /transl_table=11
FT                   /locus_tag="BB2787"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1686"
FT                   /db_xref="GOA:A0A0H3LN30"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN30"
FT                   /protein_id="CAE33279.1"
FT                   /translation="MKTQATAGDGAAVVAIAGGMGALGRALAQRFKQRGDQVVVLDQAT
FT                   GAAGLPQAGADLALLDVDLNDVASTRHAFDTIARRFGRLDALVSVAGGFHHETLAEGKV
FT                   EAWDRMYALNLRTAVVACQAALPLMLARGAGHVVCIGSDAIGRAHAGLGAYAASKAGVA
FT                   ELVRTLAAETRDQGIAANAVLPGTLDTPGNRRAMPDADFSRWVSLDAAAALILFLASPL
FT                   AAQINGACIPIVNRC"
FT   misc_feature    169338..169421
FT                   /note="Signal peptide predicted for BB2787 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.625) with cleavage site
FT                   probability 0.538 between residues 28 and 29"
FT   misc_feature    169365..170045
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 7.8e-31"
FT   misc_feature    169761..169847
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(170056..170973)
FT                   /transl_table=11
FT                   /locus_tag="BB2788"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1687"
FT                   /db_xref="GOA:A0A0H3LTP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTP5"
FT                   /protein_id="CAE33280.1"
FT                   /translation="MGPTDMRVSTRQLQAFLLVAEVRSFTRAAETLHVTQAGLSSMINE
FT                   LETQVGIRLFERSNRATALTQAGTQFLPYARQAVESLNKGMLELSALNRRQQGGIRVGV
FT                   SPLIASTVLPAVMREFQQCTGRSCEVVDAELEVLHDMVETGRLDATYGTYMRRASRLKS
FT                   EYIFGMALRLAGPGRLIPPGLEIAGVEDWARQHDIVLWALPDSNAVQQVVDRYLLEVGA
FT                   HALRRQEVCHVATVASLISAGMGMGFVPTFLADFYDRDTVGQIALPQGAPAVDFYCTSD
FT                   ASNPASSSIHVFSRLLAAHCSAAA"
FT   misc_feature    complement(170068..170697)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.7e-11"
FT   misc_feature    complement(170767..170946)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.2e-20"
FT   misc_feature    complement(170812..170904)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(170842..170907)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1391.000, SD 3.92 at aa 23-44, sequence
FT                   RSFTRAAETLHVTQAGLSSMIN"
FT   CDS_pept        171080..171376
FT                   /transl_table=11
FT                   /locus_tag="BB2789"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1688"
FT                   /db_xref="GOA:A0A0H3LP66"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP66"
FT                   /protein_id="CAE33281.1"
FT                   /translation="MSLYYRISFVLSVLALAAWAIAVTLYKAPRYGDGYGPDPLGVLLF
FT                   LALWPVGLLLAHSGLLACLVRGQRPASILQGRYGVAIHLALGAGFLAYALYRV"
FT   misc_feature    171080..171139
FT                   /note="Signal peptide predicted for BB2789 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.637 between residues 20 and 21"
FT   misc_feature    join(171098..171157,171194..171262,171299..171367)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB2789 by TMHMM2.0 at aa 7-26, 39-61 and 74-96"
FT   CDS_pept        complement(171537..172484)
FT                   /transl_table=11
FT                   /locus_tag="BB2790"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW75"
FT                   /protein_id="CAE33282.1"
FT                   /translation="MPDASTLFNDSAVYRTLLESTKAIPWKIDWATMKFTYIGPQIEAL
FT                   LGWSADSWVSVEDWAMRMHPEDREYVVNYCVSQSQAGQDHEADYRALTKDNGYVWIRDV
FT                   VHVVRNDKGEAEALIGFMFDITERKKTEEKLLLLQKELEVLSFKDGLTNIANRRRFDSS
FT                   FDLEWERARHERQPLSMLLFDVDYFKQYNDLYGHTQGDECLVEIAQTLSLALDGPRDLV
FT                   ARYGGEEFVVLLPEADAEVARKVAERCQRLIEKKSIVHALSPHGRRVTVSIGAGTVVPG
FT                   GQTAPAGFIKAVDQQLYAAKKNGRHRIEHVRLET"
FT   misc_feature    complement(171564..172061)
FT                   /note="HMMPfam hit to PF00990, DE GGDEF domain, score
FT                   2.1e-65"
FT   misc_feature    complement(172101..172229)
FT                   /note="HMMPfam hit to PF00785, DE PAC motif, score 1.4e-09"
FT   CDS_pept        172705..173868
FT                   /transl_table=11
FT                   /locus_tag="BB2791"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /note="Similar to Alcaligenes eutrophus maleylacetate
FT                   reductase I TfdfI or TfdF SWALL:TFF1_ALCEU (SWALL:P27137)
FT                   (354 aa) fasta scores: E(): 1e-15, 27.71% id in 368 aa, and
FT                   to Sulfolobus solfataricus maleylacetate reductase ClcE or
FT                   sso2490 SWALL:Q97VW4 (EMBL:AE006847) (327 aa) fasta scores:
FT                   E(): 5.2e-18, 28.74% id in 334 aa"
FT                   /db_xref="GOA:A0A0H3LN36"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN36"
FT                   /protein_id="CAE33283.1"
FT                   /translation="MRGRYEFLAQDRVIYGEPAAAAVLDMATQMGANRVFLVSSATLSR
FT                   KTDEIEAIKAALGGRYCGIFDECVAHVPRDSVLEAAGRVRQARPDLIVTIGGGTPIDTA
FT                   KILLICLAEDIRTADELGAYRIQVLEDGSKRIPAVKEPPIRQIVVPTTLSGAEFSNLGG
FT                   CSDPLRQVKDLYTGRLIGAQAVILDPRLTVHTPEWLWLSTGMRAIDHAVETICSRNPQP
FT                   FTDATCLHGLKMLFDGLRQTRRAPDDLDARLQSQLGVWLASTGLGRIEWGASHGIGHQL
FT                   GAVAAVPHGHTSCVMLHNVMRHNLSHTAERQALISATLGQPGVPAADLIEALARELGMP
FT                   TRLRDVGVERAHFEAIAAGGMQNMMVRSNPRPIASPADIVAILEQAY"
FT   misc_feature    172735..173841
FT                   /note="HMMPfam hit to PF00465, DE Iron-containing alcohol
FT                   dehydrogenase, score 6.8e-16"
FT   misc_feature    173002..173031
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   misc_feature    173518..173580
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   CDS_pept        173928..175469
FT                   /transl_table=11
FT                   /locus_tag="BB2792"
FT                   /product="Putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LN33"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN33"
FT                   /protein_id="CAE33284.1"
FT                   /translation="MKRNYARKRSTLDPTRRARRPPSSAHRDLGDTRMHARVPRLVADL
FT                   LHLLRLLGCLAALLLPAAWDGARAADSAAPAPRTAVVLSLDGIVGPASADYVARGLAGA
FT                   AAQHALVVLRIDTPGGLDASMREIIRAILASPVPVLAYVAPGGARAASAGTYILYASHV
FT                   AAMAPATNLGAATPVSLGGGFTPSDDKTEPDKTDAKAPADGGKPATPRNAAEYKAINDA
FT                   VAYIRALADLRGRNADWAEQAVREAASLSASQALARNVIDIVAEDTPALLAQADGRTVR
FT                   VGAANVVLHTSGLALVERGPDWRTRLLGVITNPNLALILLMVGVYGLIFEFMSPGALFP
FT                   GVLGAICLLLGLYALSVLPLSYAGAGLVALGAALMVAEIFTPSLGALGVGGALSFVLGA
FT                   TMLVDADTPAYAVSLPLVGGVAVASLGLTFLIARLALRSRRAPQVSGAQGLVGRRGRVL
FT                   SWEHDQGYVAADGERWRARGPAGLAAGDAVTIHAVQGVTLHVAPEPPAPQAPSRP"
FT   misc_feature    174069..175433
FT                   /note="HMMPfam hit to PF01957, DE Protein of unknown
FT                   function DUF107, score 7.8e-149"
FT   misc_feature    join(174849..174917,174945..175013,175026..175094,
FT                   175152..175220)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2792 by TMHMM2.0 at aa 308-330, 340-362, 367-389 and
FT                   409-431"
FT   CDS_pept        175511..176272
FT                   /transl_table=11
FT                   /locus_tag="BB2793"
FT                   /product="Putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LTP9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTP9"
FT                   /protein_id="CAE33285.1"
FT                   /translation="MFMNLAFYLPILVLLLALIALAVRILREYERGVIFTLGRFTGVKG
FT                   PGLILIIPVVQQMVRVDQRTSVFDVPSQDVISRDNVSVKVNAVIYFRVIDPERSVIQVE
FT                   NFRQATSELAQTTLRSVLGKHDLDEMLSERDKLNIDIQEILDAQTDAWGIKVANVEIKH
FT                   IDLNESMVRVIARQAEAERERRAKVINAEGEEQAAQKLLDAARTLAQQPEAMQLRYLST
FT                   LAVIGAQNNSTVVFPFPTDLAGALGRWAQKQ"
FT   misc_feature    175511..175576
FT                   /note="Signal peptide predicted for BB2793 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.989 between residues 22 and 23"
FT   misc_feature    join(175520..175588,175607..175675)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2793 by TMHMM2.0 at aa 4-26 and 33-55"
FT   misc_feature    175574..176095
FT                   /note="HMMPfam hit to PF01145, DE SPFH domain / Band 7
FT                   family, score 7.4e-74"
FT   CDS_pept        complement(176282..176902)
FT                   /transl_table=11
FT                   /locus_tag="BB2794"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   rb0633 rb0633 or smb21054 SWALL:Q92VR6 (EMBL:AL603644) (205
FT                   aa) fasta scores: E(): 1.1e-07, 28.23% id in 209 aa"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP69"
FT                   /protein_id="CAE33286.1"
FT                   /translation="MKKGRYAAKRLLFRISPAWAARRGVAFTLQAPSRQFLEAEVFSYI
FT                   NARAASLAHPAACLFIGVDKHNWHYPRLLSPAFHSIDCDPAHAVYGQPGLHVVGSALEL
FT                   DRHYRSAMFDFVIANGLLGFGIDTRGDCDRLLAQAHGVLAPGGLLVLGYNDTPERVPFR
FT                   VEDTDGHALFEPHVPAIDGVHGCTHTVPDEFRHRYLFLRRPRN"
FT   CDS_pept        complement(177057..177809)
FT                   /transl_table=11
FT                   /locus_tag="BB2795"
FT                   /product="putative ABC-transporter ATP-binding protein"
FT                   /note="Similar to Salmonella typhi putative ABC-transport
FT                   ATP-binding protein sty2159 SWALL:Q8Z5T0 (EMBL:AL627272)
FT                   (250 aa) fasta scores: E(): 3.1e-43, 56.62% id in 249 aa,
FT                   and to Streptomyces coelicolor ATP-binding protein atrc or
FT                   sco5258 or 2sc7g11.20C SWALL:Q9F3K7 (EMBL:AL391763) (253
FT                   aa) fasta scores: E(): 6.7e-43, 55.6% id in 250 aa"
FT                   /db_xref="GOA:A0A0H3LW80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW80"
FT                   /protein_id="CAE33287.1"
FT                   /translation="MIDARGIVKAFHGLRVLDGVSLTLRKGEVVAVIGPSGSGKSTFLR
FT                   CLNHLEIIDEGSIEVEGEALARAVPGGKSQYAADADVRRLCRKMGMVFQSFNLFPHMTV
FT                   LQNVIEAPVTVKGLRRDAVIPKAEELLRKVGLLAKRDNYPGRLSGGQKQRVAIARALAM
FT                   EPDIMLFDEPTSALDPELTGEVLRTMRQLADEHMTMLVVTHEMGFAREAAHRVVFMDEG
FT                   RILEEAASDRFFDAPQHPRTREFLAHML"
FT   misc_feature    complement(177144..177731)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.6e-64"
FT   misc_feature    complement(177327..177371)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(177687..177710)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(177835..178488)
FT                   /transl_table=11
FT                   /locus_tag="BB2796"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Similar to Escherichia coli O157:H7 putative
FT                   transport system permease protein YecS or z3006 or ecs2656
FT                   SWALL:Q8XBC8 (EMBL:AE005414) (222 aa) fasta scores: E():
FT                   1.6e-23, 40.27% id in 221 aa, and to Listeria innocua
FT                   hypothetical protein Lin1851 lin1851 SWALL:Q92AR8
FT                   (EMBL:AL596170) (213 aa) fasta scores: E(): 7.1e-40, 50.23%
FT                   id in 215 aa"
FT                   /db_xref="GOA:A0A0H3LN41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN41"
FT                   /protein_id="CAE33288.1"
FT                   /translation="MDYVISLLGPMAQGAQVTLTLFFITLALAVPLGLVLALARISRWR
FT                   LLSRLVNGYIWLMRGTPLMLQLLFIYFALPFVPVVGIRLPDFPAAVVAFALNYAAYFAE
FT                   IFRAGIQSVDRGQYEGSKVLGMTYLQTMRRIVLPQMVQRVLPPMSNETITLVKDTSLIY
FT                   VLALNDILRTARGIVQRDFTTTPFLVAAAFYLIMTLILTWFFQHMEKRYAKYDQ"
FT   misc_feature    complement(join(177877..177945,178171..178230,
FT                   178273..178341,178378..178446))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2796 by TMHMM2.0 at aa 15-37, 50-72, 87-106 and 182-204"
FT   misc_feature    complement(177931..178164)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 4.1e-18"
FT   misc_feature    complement(178075..178161)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(178583..179374)
FT                   /transl_table=11
FT                   /locus_tag="BB2797"
FT                   /product="putative amino acid ABC transporter
FT                   solute-binding protein"
FT                   /note="Similar to Clostridium perfringens probable amino
FT                   acid ABC transporter cpe1324 SWALL:Q8XKS0 (EMBL:AP003190)
FT                   (262 aa) fasta scores: E(): 2.5e-36, 41.79% id in 268 aa,
FT                   and to Streptococcus pneumoniae R6 ABC transporter
FT                   substrate-binding protein-glutamine transport glnH
FT                   SWALL:AAL00157 (EMBL:AE008505) (278 aa) fasta scores: E():
FT                   8.9e-29, 34.81% id in 270 aa"
FT                   /db_xref="GOA:A0A0H3LN39"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN39"
FT                   /protein_id="CAE33289.1"
FT                   /translation="MKKITAVLLFSATALLSACGQGDDASSTASAPAASRKVVVGLDDN
FT                   FPPMGFRDEKNELVGFDIDMAKEASRRLGMQVEFKPIDWSAKEAELNGKRVDVLWNGLT
FT                   ITEERKKNISFTAPYMANHQIIIVGSASPIKTKADLAGKVVGAQEGSSAVDAIKKDAPV
FT                   AASLKEIKTFADNVTALMDLAAGRLDAIVVDEVVGRYLASKREGQYRVLEENFGTEDYG
FT                   VGVRKDDTELLAKLDKTLASMKEDGTAGRIATQWFGANIIK"
FT   misc_feature    complement(178598..179263)
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 1.7e-74"
FT   misc_feature    complement(179309..179374)
FT                   /note="Signal peptide predicted for BB2797 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.501 between residues 22 and 23"
FT   misc_feature    complement(179318..179350)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        179672..179830
FT                   /transl_table=11
FT                   /gene="napE"
FT                   /locus_tag="BB2798"
FT                   /product="component of of periplasmic nitrate reductase
FT                   system"
FT                   /note="Similar to Paracoccus pantotrophus NapE protein napE
FT                   SWALL:NAPE_PARPN (SWALL:Q56348) (59 aa) fasta scores: E():
FT                   1.7e-05, 43.75% id in 48 aa, and to Pseudomonas sp. G-179
FT                   NapE napE SWALL:Q9Z3W7 (EMBL:AF083948) (71 aa) fasta
FT                   scores: E(): 2.9e-05, 50% id in 42 aa"
FT                   /db_xref="GOA:A0A0H3LTQ3"
FT                   /db_xref="InterPro:IPR004448"
FT                   /db_xref="InterPro:IPR010649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTQ3"
FT                   /protein_id="CAE33290.1"
FT                   /translation="MANDPSTYTKRQELNSFLLLAAVMAPVITGIIIVTYGFAVWFYQL
FT                   LAGPPGS"
FT   misc_feature    179720..179788
FT                   /note="1 probable transmembrane helix predicted for BB2798
FT                   by TMHMM2.0 at aa 17-39"
FT   CDS_pept        179830..180165
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="BB2799"
FT                   /product="component of of periplasmic nitrate reductase
FT                   system"
FT                   /note="Similar to Rhodobacter sphaeroides f. sp.
FT                   denitrificans NapD precursor SWALL:O88156 (EMBL:AF069545)
FT                   (88 aa) fasta scores: E(): 0.0007, 33.33% id in 84 aa, and
FT                   to Agrobacterium tumefaciens periplasmic nitrate reductase,
FT                   napd protein napd or atu4407 or agr_l_919 SWALL:Q8U7P2
FT                   (EMBL:AE009369) (95 aa) fasta scores: E(): 0.00016, 30.33%
FT                   id in 89 aa"
FT                   /db_xref="GOA:A0A0H3LP74"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP74"
FT                   /protein_id="CAE33291.1"
FT                   /translation="MAQPPMSALPSRALAPPPVAELHITSMVVHALPGRAQALGAAIAA
FT                   LPGAEIHAVSDTGKLVVTLEAHSTGEMLERIAAVQGQDGVLASAMVYQHIDTLDSMNEE
FT                   IDDVNGS"
FT   misc_feature    179887..180123
FT                   /note="HMMPfam hit to PF03927, DE NapD protein, score
FT                   7.7e-22"
FT   CDS_pept        180155..182644
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="BB2800"
FT                   /product="periplasmic nitrate reductase precursor"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="GOA:Q7WIQ1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIQ1"
FT                   /protein_id="CAE33292.1"
FT                   /translation="MARRDFIKQTAAAAAATVAGVPLTGYTQNIVTESEAAKLKWSKAP
FT                   CRFCGTGCGVNVAVKDNQVVATHGDFNAEVNKGLNCVKGYFLSKIMYGSDRLTQPLLRM
FT                   KDGKYAKDGEFAPVSWDQAFDVMAEQFKRVLKDKGPEAVGMFGSGQWTVWEGYAALKLM
FT                   KAGFRTNNLDPNARHCMASAAVGFMRTFGADEPMGCYDDIENADAFVLWGSNMAEMHPI
FT                   LWTRVTDRRLSAPATKVAVLSTFEHRSYELADLTLTFEPQSDLAILNYIANHIIRTKRV
FT                   NRDFVDKHTVFREGNADIGYGLRPEHPLQQAARNAGDAGGSKPITFDDFARFVSKYDLE
FT                   YTAKLSGVPKNRLEELAELYADPKVRVTSFWTMGFNQHTRGVWCNNMVYNIHLLTGKIS
FT                   TPGNSPFSLTGQPSACGTAREVGTFSHRLPADLVVTNPEHRRHAEEIWKLPDGTIPSKV
FT                   GAHAVLQNRMLKDGKINAYWVMVNNNMQAAANLMNEGLPGYRNPENFIVVSDAYPTVTT
FT                   LSADLILPAAMWVEKEGAYGNAERRTQFWHQLVDAPGQARSDLWQLVEFSKRFKVEEVW
FT                   PADLLAKKPEYRGKTLYDVLFANGKVNQFPNTELDAEYANQEAQAFGFYLQKGLFEEYA
FT                   EFGRGHGHDLAPFDVYHKARGLRWPVVDGKETLWRYREGSDPYVKPGTGFQFYGNPDGK
FT                   AVIFALPYEPPPEAPDKEYPFWLSTGRVLEHWHSGSMTRRVPELYKAFPEAVCFMHPDD
FT                   AQALGVRRGVEVEVVSRRGRMRTRVETRGRDKPPRGLVFVPWFDAGQLINKVTLDATDP
FT                   ISFQTDFKKCAVKIVKV"
FT   misc_feature    180155..180229
FT                   /note="Signal peptide predicted for BB2800 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.964) with cleavage site
FT                   probability 0.672 between residues 25 and 26"
FT   misc_feature    180269..182125
FT                   /note="HMMPfam hit to PF00384, DE Molybdopterin
FT                   oxidoreductase, score 5.8e-214"
FT   misc_feature    180284..180340
FT                   /note="PS00551 Prokaryotic molybdopterin oxidoreductases
FT                   signature 1."
FT   misc_feature    181040..181075
FT                   /note="PS00192 Cytochrome b/b6 heme-ligand signature."
FT   misc_feature    182297..182623
FT                   /note="HMMPfam hit to PF01568, DE Molydopterin dinucleotide
FT                   binding domain, score 4.2e-41"
FT   CDS_pept        182664..183140
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="BB2801"
FT                   /product="diheme cytochrome C precursor"
FT                   /db_xref="GOA:A0A0H3LW85"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW85"
FT                   /protein_id="CAE33293.1"
FT                   /translation="MSLRTAAIVLSVALGAAAWAAPPLPLQDPMRGPTPVADETNPPLM
FT                   SPVENKDIRRVRTYSMQPPTIPHKIDGYQIDKNFNRCLACHARVNTEETQAPPLSVTHY
FT                   MDRDSNVLAEVSPRRYFCVQCHVPQAEARPLVSNTFQDIDVILKRLTAPKPDQK"
FT   misc_feature    182664..182723
FT                   /note="Signal peptide predicted for BB2801 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   misc_feature    182679..183104
FT                   /note="HMMPfam hit to PF03892, DE Nitrate reductase
FT                   cytochrome c-type subunit (NapB), score 1.9e-50"
FT   misc_feature    182907..182924
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    183027..183044
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        183148..183810
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="BB2802"
FT                   /product="cytochrome C-type protein"
FT                   /db_xref="GOA:A0A0H3LN45"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN45"
FT                   /protein_id="CAE33294.1"
FT                   /translation="MPAMRELIKRYWDIIRRPSVHFSLGFLTVGGFVGGILFWGAFNTA
FT                   MELTNTEQFCTGCHEMRDNVYAELKGTIHYTNRSGVRAICSDCHVPHNWTDKIARKMQA
FT                   SKEVWGKIFGTINTREKFVEKRLELAQHEWARLKANDSLECRNCHNYESMDFTRQSVRA
FT                   QNMHSTYLADKSKTCIDCHKGIAHTLPRMPPDQTSLAPPAAGPARELARADTGHAKR"
FT   misc_feature    183196..183723
FT                   /note="HMMPfam hit to PF03264, DE NapC/NirT cytochrome c
FT                   family, N-terminal region, score 1.1e-111"
FT   misc_feature    183205..183273
FT                   /note="1 probable transmembrane helix predicted for BB2802
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    183310..183327
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    183400..183417
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    183580..183597
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    183679..183696
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        183797..184471
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="BB2803"
FT                   /product="Putative heme export protein"
FT                   /db_xref="GOA:Q7WIP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIP8"
FT                   /protein_id="CAE33295.1"
FT                   /translation="MQNAEAAPALLAAHGLVGRRGGRRPLDLNLRPGQLVHVRGANGSG
FT                   KTSLLRTLAGLLRPRRGEVRWNGADIHADLPGYYLHMAYLGHDNGCSDALTARENLRYA
FT                   LHVAGAPRAEPELERALRDWGLAAGADAPAARLSQGQGRRLALARVMLSRKRLWLLDEP
FT                   DAGLDAASLQRLHGMLDAHLAGGGAAVLASHRGGGAWAGCTQTLELDEYAHAEVVGADC
FT                   LA"
FT   misc_feature    183893..184432
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.1e-33"
FT   misc_feature    183914..183937
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        184527..185102
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="BB2804"
FT                   /product="Heme exporter protein B"
FT                   /db_xref="GOA:A0A0H3LN44"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN44"
FT                   /protein_id="CAE33296.1"
FT                   /translation="MVAGTLFPLALGPDPQLLAAIGPGVLWVSALLAILLSLQQPFVHD
FT                   HGSGALEQLLVSPHPLPVLVGLKLAAHWLATCAPLILASPFLALQFGLSAQAVGVLALS
FT                   LLLGTPTLALIGGLGAALTLGLRGGALLPLVVLPLYVPVLIFGSGAVAATASGLGAWPQ
FT                   LSLLGACLCLAILLCPWSASAALRVALE"
FT   misc_feature    184527..185090
FT                   /note="HMMPfam hit to PF03379, DE CcmB protein, score
FT                   5.2e-48"
FT   misc_feature    join(184575..184643,184731..184799,184818..184886,
FT                   184914..184982,185016..185084)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2804 by TMHMM2.0 at aa 17-39, 69-91, 98-120, 130-152 and
FT                   164-186"
FT   CDS_pept        185110..185895
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="BB2805"
FT                   /product="Putative heme export protein"
FT                   /db_xref="GOA:A0A0H3LTQ9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTQ9"
FT                   /protein_id="CAE33297.1"
FT                   /translation="MSKSSAALPVRDRPAGGRGWLRYASPAVFYPMAGRWAPRLGALAA
FT                   LLAAAGLYLGLAVAPVDSQQGEVYRILFVHVAAAWMSMFLYLVMAGYAALGLVYNTRLS
FT                   FMMMRALAPTGALFTAATLWTGALWGKPTWGAWWVWDARLTSELILLFLYLGFMALQAA
FT                   AGDTRRADRGGAILLLVGVINIPIIYFSVTWWNTLHQGASISLTAAPSMARIMVAATLL
FT                   MVAAFWAYSAAVALARVRVVIAGREPAAAAGGPLSREGS"
FT   misc_feature    join(185224..185292,185335..185403,185440..185493,
FT                   185521..185589,185626..185694,185752..185820)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2805 by TMHMM2.0 at aa 39-61, 76-98, 111-128, 138-160,
FT                   173-195 and 215-237"
FT   misc_feature    185224..185847
FT                   /note="HMMPfam hit to PF01578, DE Cytochrome C assembly
FT                   protein, score 2.1e-32"
FT   CDS_pept        185892..186044
FT                   /transl_table=11
FT                   /locus_tag="BB2806"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LP77"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP77"
FT                   /protein_id="CAE33298.1"
FT                   /translation="MSWDALFSLQGHSPYILAAYGGAALLIAVELAVLWRAARRPPTGG
FT                   DDGDA"
FT   misc_feature    185934..186002
FT                   /note="1 probable transmembrane helix predicted for BB2806
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS_pept        186031..186492
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /gene_synonym="cycJ"
FT                   /locus_tag="BB2807"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /db_xref="GOA:Q7WIP4"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIP4"
FT                   /protein_id="CAE33299.1"
FT                   /translation="MATRRGRRALLIAGGVGLLALAAALVLNALRSNLVFFFSPTQVHA
FT                   HEAPSSGSFRVGGLVRAGSVERAADGLTLRFVVTDTVREVPVAYTGLLPALFREGKGVV
FT                   VAGNMGADGVFRATEVLAKHDENYMPPQAADALRQAGALPSATLQTEAR"
FT   misc_feature    186031..186165
FT                   /note="Signal peptide predicted for BB2807 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.957 between residues 45 and 46"
FT   misc_feature    186034..186426
FT                   /note="HMMPfam hit to PF03100, DE CcmE, score 2.6e-57"
FT   misc_feature    186055..186123
FT                   /note="1 probable transmembrane helix predicted for BB2807
FT                   by TMHMM2.0 at aa 9-31"
FT   CDS_pept        186489..188483
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /gene_synonym="cycK"
FT                   /locus_tag="BB2808"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /db_xref="GOA:A0A0H3LW90"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW90"
FT                   /protein_id="CAE33300.1"
FT                   /translation="MIPEIGLFSLILALLVAIVQGVLPLVGASTGWQAGLRVARPAAVT
FT                   QFCLVTVAMGCLAWSFLDNDFSVLYVAGNSHADLPAAYRFAALWGGHEGSLLLWLYLLT
FT                   AWTLAVALHSRALPPAFAARVLAVMAWISIGFLLFLLFLSNPFERLMPPAQAGRDLNPL
FT                   LQDPGMIVHPPMLYMGYVGFSVAFAFAIAALLSGELDAIWARWVRPWTLLAWMFLTIGI
FT                   LLGSAWAYYVLGWGGWWFWDPVENASFMPWLAGTALIHSLIVTERRGAFRSWTVLLAIA
FT                   AFSLSILGTFLVRSGVLTSVHAFAVDPGRGLYILGFMTLIVGGSLALYAWRAPTVGLGG
FT                   GFALLSRESLLLSNNVVLAAATGAVLLGTLYPVALDVLDWGKISIGPPYFEAVFVPLMT
FT                   PAIFLMGVGPMARWKHSAVPDLAQRLRIAFGVSLATALAVPLAWPGARAWPGSPLIVLG
FT                   LWLAAWSVASAAAHAWQRLADGEGSWARRLRRQPRAWYGMLLAHAGVGVFIAGVTLANG
FT                   YEDKQELRMDIGATQAAGGYQFTFAGIAPAAGPNYQAERARFVVTRDGRPVVTLHPEKR
FT                   HYTVQGMPLSHAAIDTRFTRDLFVALGEPVGERAWTVRLQVKPFMAWIWSGCVLMALGG
FT                   LMAATDRRYRQWRAAEARQAVAAVAREAG"
FT   misc_feature    186489..186569
FT                   /note="Signal peptide predicted for BB2808 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.895) with cleavage site
FT                   probability 0.357 between residues 27 and 28"
FT   misc_feature    join(186501..186569,186606..186674,186771..186830,
FT                   186849..186917,187011..187079,187116..187184,
FT                   187227..187280,187314..187382,187425..187481,
FT                   187542..187610,187653..187721,187758..187826,
FT                   187839..187907,187968..188036,188346..188405)
FT                   /note="15 probable transmembrane helices predicted for
FT                   BB2808 by TMHMM2.0 at aa 5-27, 40-62, 95-114, 121-143,
FT                   175-197, 210-232, 247-264, 276-298, 313-331, 352-374,
FT                   389-411, 424-446, 451-473, 494-516 and 620-639"
FT   misc_feature    187191..187847
FT                   /note="HMMPfam hit to PF01578, DE Cytochrome C assembly
FT                   protein, score 2.8e-37"
FT   CDS_pept        188483..189004
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /gene_synonym="dsbE"
FT                   /gene_synonym="cycY"
FT                   /locus_tag="BB2809"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /db_xref="GOA:A0A0H3LN50"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN50"
FT                   /protein_id="CAE33301.1"
FT                   /translation="MLRYLLPLAAFLAMAAFLALGLGRDPRALPSAMLDKPAPPIGLPL
FT                   LQGDGRRLEVAQLRGRVWVLNVWASWCAPCREELPLLQEVGPRDAVPIYGLNYKDKPED
FT                   ARAWLARHGNPYVASASDVDGRVGIEYGVYGVPETFVIDGAGRIRYRQLGVLTPQIWRE
FT                   RLLPVIEGLR"
FT   misc_feature    188483..188545
FT                   /note="Signal peptide predicted for BB2809 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.464 between residues 21 and 22"
FT   misc_feature    188492..188551
FT                   /note="1 probable transmembrane helix predicted for BB2809
FT                   by TMHMM2.0 at aa 4-23"
FT   misc_feature    188672..188728
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        189001..189423
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /gene_synonym="nrfF"
FT                   /gene_synonym="cycL"
FT                   /locus_tag="BB2810"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /db_xref="GOA:A0A0H3LN52"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN52"
FT                   /protein_id="CAE33302.1"
FT                   /translation="MRRAAVLLGLWLLLGAPAAADIAQRELRLAHSLRCLVCQNQTLAE
FT                   SNAPLAHDMRALIRQQLADGRSDEEVMQFFEDRYGDFVRYEPPFKPATWLLWLGPFALL
FT                   LAGFVVLWRALARRPGAAPLTDAQRARAERFLDEES"
FT   misc_feature    189001..189060
FT                   /note="Signal peptide predicted for BB2810 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.977 between residues 20 and 21"
FT   misc_feature    189016..189411
FT                   /note="HMMPfam hit to PF03918, DE Cytochrome C biogenesis
FT                   protein, score 6.5e-34"
FT   misc_feature    join(189019..189072,189277..189345)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2810 by TMHMM2.0 at aa 7-24 and 93-115"
FT   CDS_pept        189420..190649
FT                   /transl_table=11
FT                   /gene="cycH"
FT                   /locus_tag="BB2811"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTR5"
FT                   /protein_id="CAE33303.1"
FT                   /translation="MTALWLIVLLLLLATLAALILPMLRRERAAGPADAAATVRAFYQA
FT                   QRAQLQRELREGALTAQAHARAEEELQRELLQALDARRDTAPAPARRASLAAACALSVA
FT                   VPVAAMLLYQHLGDPRAAASMMLAAPQDAHAEDAAQDMTQAIGALAERLRRQPDDAEGW
FT                   YMLARSYETLGRYDDAVAAYMETVRLVPDQPALLADLADALLSANGGAPDAKSERVIAQ
FT                   ALALQPDQPKALALAGMAALRRGDAAQALAHWQRLKTLLPPDSPAAAQIDNNIAQARAM
FT                   ATGAPPAPAPQAAAPDSLAGHASIAAALRAQVADTDTVFILARPAGGGRMPLAILRKQV
FT                   RELPLDFTLDRAQAMSPAATLAQASTVDVEIRVSRAGAAEARPGDLVGVLRGVAVGSRG
FT                   LRLVADTVVR"
FT   misc_feature    189420..189524
FT                   /note="Signal peptide predicted for BB2811 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.602 between residues 35 and 36"
FT   misc_feature    join(189429..189482,189702..189770)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2811 by TMHMM2.0 at aa 4-21 and 95-117"
FT   misc_feature    189897..189998
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 5e-05"
FT   misc_feature    190110..190211
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 8.5"
FT   CDS_pept        190728..191141
FT                   /transl_table=11
FT                   /locus_tag="BB2812"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR031948"
FT                   /db_xref="InterPro:IPR038643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP82"
FT                   /protein_id="CAE33304.1"
FT                   /translation="MPSCRPRLALACLAVLLAVPAAPVLAAPSGAAPCPPAAQAVSAPL
FT                   PGGGAVVVSNGACEPASIGSYVVNRYDDLDAGAFRAGLAIARDGVLVEWALDERQGKRV
FT                   LRLVSETAGSGAYRNTQYIELTGDGGLRLLDRP"
FT   misc_feature    190728..190805
FT                   /note="Signal peptide predicted for BB2812 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 26 and 27"
FT   CDS_pept        191255..191677
FT                   /transl_table=11
FT                   /locus_tag="BB2813"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW94"
FT                   /protein_id="CAE33305.1"
FT                   /translation="MSAITRIASPLPLPFSRATIAGGFLFLSGQIPMDANGQVVRGDIR
FT                   AQTDAAIARIRETLALAGAGLQDVVKVTVWLSDLALFADFNDAYKQHFQDGFPCRSTVE
FT                   AKLAMEVDVEIEVQAWIGDKTPRGGASYTPGPVSEA"
FT   misc_feature    191276..191617
FT                   /note="HMMPfam hit to PF01042, DE Endoribonuclease L-PSP,
FT                   score 3.3e-30"
FT   CDS_pept        complement(191838..192755)
FT                   /transl_table=11
FT                   /locus_tag="BB2814"
FT                   /product="putative ketopantoate reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1360"
FT                   /db_xref="GOA:A0A0H3LN56"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN56"
FT                   /protein_id="CAE33306.1"
FT                   /translation="MKIAIMGCGAMGSVYAGLLAANGHEVIAVDRWAEHVQAMSEQGLR
FT                   VEGASGDRVARLRAYREAPAEPVDLIIIAVKAAQAGSAAAQARAMLGPDTLVLTIQNGL
FT                   GSADSVAEAIGAERLAVGIAAAFGASLSGPGHVHHNGMSAVRMGAYAGLGAEKLDGIAE
FT                   VWRGAGFNAQAVDNLPAMQWEKLICNVAYSAPCTLTGLTIGEVLDAPHASAVSQAAATE
FT                   AWNVARALGVPVAVEDPVAHVRAFGERIRGAKPSVMLDHEQRRVSEIDYINGAIPRQAA
FT                   RAGIQAPVNQTLTALVKQREEAWK"
FT   misc_feature    complement(191850..192623)
FT                   /note="HMMPfam hit to PF02558, DE Ketopantoate reductase
FT                   PanE/ApbA, score 9.3e-29"
FT   misc_feature    complement(192390..192752)
FT                   /note="HMMPfam hit to PF02254, DE TrkA-N domain, score
FT                   0.00059"
FT   misc_feature    complement(192708..192755)
FT                   /note="Signal peptide predicted for BB2814 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.962) with cleavage site
FT                   probability 0.386 between residues 16 and 17"
FT   CDS_pept        complement(192766..193944)
FT                   /transl_table=11
FT                   /locus_tag="BB2815"
FT                   /product="putative mandelate racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1359"
FT                   /db_xref="GOA:A0A0H3LN58"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034611"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN58"
FT                   /protein_id="CAE33307.1"
FT                   /translation="MRITAIREIAVPLQGNISNSLVSFAEHTVSLVALVSDVVRDGRPL
FT                   IGYAFDSIGRYAQPGLMRERFIPRLLQAAPHELLDDGGQAFDPARASAIMLRNEKPGGH
FT                   GDRAAAVGALELAFWDLNAKLRDEPAYCTIARHVGRPAQAGATQVYAAGGYYYDSGDPL
FT                   QRLRDEFRGYLDQGFVKFKMKIGGASLADDLARIEAALGVAGEGANLAVDANGRFDLDT
FT                   ALAYARALEPYGLRWYEEIGDPLDYHLNSLVAQAYAGTIATGENLFSLPDVRNLLHFAG
FT                   VRPGRDILQMDPGLSYGLTEYLRMMAAVEAAGFGRSCLHPHGGHLINLHIAAGLGLGGC
FT                   EAYPGVFQPFGGYPAACALGAGQVRPTDAPGFGLEQKQELAPYISVLAHGKA"
FT   misc_feature    complement(192793..193518)
FT                   /note="HMMPfam hit to PF01188, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   0.00014"
FT   CDS_pept        complement(193964..194959)
FT                   /transl_table=11
FT                   /locus_tag="BB2816"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1358"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTS1"
FT                   /protein_id="CAE33308.1"
FT                   /translation="MNSIKRVRGKTAALFAALGLWAAAVPAAGAATPYPERPIRLIVPF
FT                   GAGGTTDILGRVLGQQLGEALKQTVIVENRPGANGNIGSDAVAKAAPDGYTLLFAADAT
FT                   LVINPTLYSQLPFKPESDFAPISRIAVVPLVLVANPAVKADTLPELVKLGGKPDARLDF
FT                   GSAGAGSMGHLVGERLNRATGMSMTHIPYKSGAQAISDVVSGQIPLLITGLAVAEPFLR
FT                   DGKLKAIAVTSGQRFPGAPKVPTIAEGGVKDFDSPSWYGLLAPAGTPAPVLEKIHAALA
FT                   SALQTEDMKKRMVELGAWPVVDTQAAFAELIKADTQRWSQIIQAAGITVQ"
FT   misc_feature    complement(193976..194800)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.7e-96"
FT   misc_feature    complement(194870..194959)
FT                   /note="Signal peptide predicted for BB2816 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.593 between residues 30 and 31"
FT   CDS_pept        195129..196556
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BB2817"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1357"
FT                   /db_xref="GOA:A0A0H3LP86"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP86"
FT                   /protein_id="CAE33309.1"
FT                   /translation="MTPSTPSGAASAPPRTLFDRLWDSHHVADLPDGRSLIHIDRHLLH
FT                   DLSSPQAFSALRAQGRTVHSPARNVAIADHIVSTAPGRRGEHVDGSQAMIDALAANAAR
FT                   TGIRHYGPDDPDQGIVHVIAPELGLVLPGMTVACGDSHTSTLGALGAWAWGIGTSEAEH
FT                   VLATQTLAMRRPRAMRLTLQGALPAGLSAKDLTLHVLRQLGVRGAAVGFLELAGEPVAA
FT                   LSMEERLTLCNMAIEAGARAALIAPDDVTLDYLRRHAPAVRGDEAALAAFRALRSDAGA
FT                   RYESERAITLGLQAPQMTWGVNPAQVVDVHEPLPDPAAADAGERAAMQQAYDYMGLRAG
FT                   RPLAGVPVQWAFIGSCTNGRLSDLQAAAAVARGRRVAAGVRALVVPGSQRVKRAAEALG
FT                   LDRVFLDAGFEWREPGCSMCVGMNADKVPAGQRCVSTSNRNFEGRQGPGARTHLASPAS
FT                   AAAAAIAGAIVDHRDLV"
FT   misc_feature    195174..196526
FT                   /note="HMMPfam hit to PF00330, DE Aconitase family
FT                   (aconitate hydratase), score 1.4e-164"
FT   misc_feature    196170..196220
FT                   /note="PS00450 Aconitase family signature 1."
FT   misc_feature    196350..196391
FT                   /note="PS01244 Aconitase family signature 2."
FT   CDS_pept        196558..197166
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BB2818"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1356"
FT                   /db_xref="GOA:Q7WIN3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIN3"
FT                   /protein_id="CAE33310.1"
FT                   /translation="MQAFIRAHGIILPMNQDHVDTDAIIPQRWLVTVERDGLADGFMGA
FT                   WRYDEHGQPRPECVLNQPAYQGAAIVLARENYGCGSSREHAVWAHQGYGIRAIVAASYG
FT                   PIFHENCLKNGLLPVTLPAADVATLMAQALADPGCACEVDLVSQRVIGPDGRAYPFEID
FT                   AGRRQLLLEGVDDIDLALARAADIAAFQRRQQQDQPWLA"
FT   misc_feature    196558..197064
FT                   /note="HMMPfam hit to PF00694, DE Aconitase C-terminal
FT                   domain, score 1.5e-41"
FT   CDS_pept        197154..198194
FT                   /transl_table=11
FT                   /locus_tag="BB2819"
FT                   /product="probable LacI-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1355"
FT                   /db_xref="GOA:A0A0H3LW99"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW99"
FT                   /protein_id="CAE33311.1"
FT                   /translation="MAGIAARTNVTIKDIATRLKLSHATVSRALADHPKISAATKASVR
FT                   EAAQAMGYVPNGTAQNMRTAHSPVIGLIVPDIQNDFYAAVAKIVADAAVARGFQLALSI
FT                   TEDNPEREFNDLRAFVVSRAAGVIITPTIKPKPETIALLKGVRAIQLIRQHAAVAAEAV
FT                   VIDERAATRAAAEHLIHYGHRRIAYVGTTTDLSLGEDRLSGFSSAMSKAGLDASLTAVG
FT                   PPRVEFAHRAVHGLMSGPKPPTALIIGSSRLTVGALKALRGLGLSCPADVSVVGYGDPD
FT                   WFELVGDGLTTVSPPVYPLGAYAINLLLARIQGEAVPAAADPAHATASRFPATLAIRGS
FT                   TRPLAR"
FT   misc_feature    197175..197258
FT                   /note="HMMPfam hit to PF00356, DE Bacterial regulatory
FT                   proteins, lacI family, score 6.5e-06"
FT   misc_feature    197352..198170
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   4.6e-08"
FT   CDS_pept        complement(198212..199174)
FT                   /transl_table=11
FT                   /locus_tag="BB2820"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1354"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN62"
FT                   /protein_id="CAE33312.1"
FT                   /translation="MKPNILQWALGAAFACVAAASTAQDYPARPVHLIVPYPPGGGTDV
FT                   VARAVAQRLQAELGQPVVVESKPGASEIIGTGSVARAAPDGYTIGLVTSTYSINWVLDA
FT                   SLPYKPAQFAAVAPLVGVPMLALVPAGSPVQDMAGLVAASRQAPGRMNYASLGPNSLQA
FT                   MSTEWLKHLSGADLTAVAYKGAAPALVALSTGEVDFTFAGLGASRPMLDAGKVRALAIS
FT                   TAQAFPPMPTLPPVAQAAPGYDVQIWYGLIAPAGVPPAILDRLNAALARVMDDAALRRQ
FT                   FSDLGYVPTVMDRKAFEQFLQRDTLQWREMIGAAGIRAQ"
FT   misc_feature    complement(198224..199039)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-67"
FT   misc_feature    complement(199106..199174)
FT                   /note="Signal peptide predicted for BB2820 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.969 between residues 23 and 24"
FT   misc_feature    complement(199127..199159)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(199171..200364)
FT                   /transl_table=11
FT                   /locus_tag="BB2821"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1353"
FT                   /db_xref="GOA:A0A0H3LN64"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN64"
FT                   /protein_id="CAE33313.1"
FT                   /translation="MKLLSHIRVLDLGRFITAPLAGQLLGELGADVVKVESRDAIDPFR
FT                   AFEGGLYGPHFQSHNRNKRSLALEFATPEGQAALRRLIAGADVVLLNMRPGAEHKLGLD
FT                   YESLRALNPGLVYCSITGFGASGPYAHRPAFDNVGQALSGWLSMFHQGSDPRVPGPPVS
FT                   DSLTGLYAAMGVLAALLERARSGQGRKVEVSMLESLIAFSNEPLGQLSAKGARPAHYGR
FT                   ASLSQSYILTCADGLRIGLHLSSPEKFWRSLVEAIERPDLLARFPDRASRVDGYEALAR
FT                   ELAAVFAQRERADWMRVLEAHDVPAAPERLLDELADDAQVRHLEVFQQLRHPRHGPVTA
FT                   ANRAIRFDGDNHSAFAPPPAFGEHTLEVLVQAGFGAEDIERLHACGAIAATGHGAHA"
FT   misc_feature    complement(199606..200169)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   4.3e-51"
FT   CDS_pept        complement(200361..201158)
FT                   /transl_table=11
FT                   /locus_tag="BB2822"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1352"
FT                   /db_xref="GOA:A0A0H3LTS6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTS6"
FT                   /protein_id="CAE33314.1"
FT                   /translation="MNALTSDMGWSDARTIVVRGHDLNHEIIGHLNLGDFAFLEITGRK
FT                   PDPQESTLFNALLAVLVEHGMTPTAMVARLTYLGAPESMQAAIAAGLCGMGTKFVGTAE
FT                   GAARLLQEALPLGSEQALDIDATAQRIVAEQRAARQMLPGIGHPVHKPVDPRTTALFAL
FT                   AERTGFHGRYVALMQALSAQAEKALGKPGVLPVNATGALAALASELGIAWQLCRGIAVI
FT                   GRAVGLVGHIAEELRNPIAERLWVRTDAEVSAHLKPAPQEPRP"
FT   CDS_pept        complement(201184..202170)
FT                   /transl_table=11
FT                   /locus_tag="BB2823"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1351"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP90"
FT                   /protein_id="CAE33315.1"
FT                   /translation="MTMKRITTLLRVLALAGAIAPMWAQAADFPSKPVRVVVPYSPGGP
FT                   ADALMRAVGQKLSDKWGQPVIVENRPGANEIIGADTVIKAAPDGYTLLLGSEAAFSLNP
FT                   QLYAKLSYKPADLAPVSRLVTAQLMLVTRPDFPADDVAGLIKHLKANPGKYTYGITGIG
FT                   GVLHLAGAWFNQLYGVQTSEVPYKGLPLAMQDVMAGRVDMLFAIAGGPMPHVATGKLKA
FT                   IALAGPHRVAIAPDVPTFAQAGYPEFDASVYFALAAPAGTPEDVRRKVADDVGAVVSDA
FT                   DFVARNLTAIGFEPVRETPQAFAAFLELDRGVAAQRVQAAGVKLDQP"
FT   misc_feature    complement(201202..202026)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-75"
FT   misc_feature    complement(202093..202170)
FT                   /note="Signal peptide predicted for BB2823 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 26 and 27"
FT   CDS_pept        complement(202189..204228)
FT                   /transl_table=11
FT                   /locus_tag="BB2824"
FT                   /product="putative acetyl-CoA synthetase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1350"
FT                   /db_xref="GOA:A0A0H3LWA3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWA3"
FT                   /protein_id="CAE33316.1"
FT                   /translation="MNAVQRIGKLLNPRSIAIVGASPAPNKLAGQLIPALREGGYEGAI
FT                   YPVNPRYQEVAGLRCFASVGDIPDEVDHCVIVVGKERVPQVLRDCCAKQVPGASIYTSG
FT                   YAEASGDGREAQRALEEAASALTFIGPNCMGFSNLTARVMAAPSAVLKRAEGVGDVALV
FT                   SQSGGLAYATMAYYAQRDGLGFSHIVNTGNSAGVSYSDLIEYMFQDPATRVVLAVAEAE
FT                   RAACEVIDAVHRLGLRKPVVLLKLGRGQTGTRMALSHTGSLAGDYRLVRDVAEQHGIAC
FT                   ADDVDQALGLCELLRHGFGAEHAEGIASLCISGGNITLFADQADAHGLGFAELDAATEA
FT                   RLAAVLPDYISVHNPIDITALGYENPALHADVLDVLLTDAAVRTVVPILTTVDDYTEVC
FT                   RLLADVRARTRCAMIALWNGGSYETRSREILREAAIPVFHSAALLAACLQRLRRAAGRR
FT                   APMQAASAAPVADGALRALRESEAMQWLAGHGVAVPPLRACARAGLAEAAREVGYPLVI
FT                   KADSADTHISDQDSVILNIRNDGELAQALERVAGWPDERVLAMRYLPGQELVAGVLAHP
FT                   QLGQVLMVGSGGQWVELLKDVRFAALPASRDELADALAGTLVGRALHARFRGAAGFDEA
FT                   VGLLAALAEAAVRAGPQVAQIELNPVTVGRHGAVAVDAAVYLRA"
FT   misc_feature    complement(203863..204201)
FT                   /note="HMMPfam hit to PF02629, DE CoA binding domain, score
FT                   3e-13"
FT   CDS_pept        204430..205110
FT                   /transl_table=11
FT                   /locus_tag="BB2825"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1349"
FT                   /db_xref="GOA:A0A0H3LN67"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN67"
FT                   /protein_id="CAE33317.1"
FT                   /translation="MTGTSKPNATSGSTLEYVVDTLRQGILSGRLVPGQRLVEADLTRQ
FT                   LGVSRGPVRESFRRLSAEGLVESIPNQTTMVRRYSKAEMLELFEIRAELEALAARRAAE
FT                   CMDDPAAKARFLQAIGPIWDEHSLAAAPSYFDENRRFHQAIADLSANTQLAELIRKLQL
FT                   PLIMFQLGGAITPQAIQASIDEHRRIAQAIVDGNGRKAAAEVKAHLKRACEMVERMPPD
FT                   IFRP"
FT   misc_feature    204481..204657
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.2e-10"
FT   misc_feature    204535..204609
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        complement(205124..206035)
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BB2826"
FT                   /product="putative citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1348"
FT                   /db_xref="GOA:A0A0H3LN69"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN69"
FT                   /protein_id="CAE33318.1"
FT                   /translation="MIPDPATAPSMNPTQTTNPMRPFRSVLYTPGANARALARARELDA
FT                   DALILDLEDAVAVSAKEEARVQVTHALREGGFGRRSVIVRVNGLDTPWGEDDVRALAPL
FT                   GPHAMLLPKVEHPAQLARAAALAAEAGAPGLAWWAMIETPLAILNIGAIAAAGAPLRAL
FT                   VAGTSDLVKALHARHTPARAEVQAALSMTVLAARAHGLLALDGVHLDLADAEGLRHACR
FT                   QGRDLGFDGKTLIHPRQIDSANAAFGPSEAEVVRAHAIMAAWQDAQARGAGVTVVDGML
FT                   VEALHVEDAQRVLALAQAIAAD"
FT   CDS_pept        complement(206032..206610)
FT                   /transl_table=11
FT                   /locus_tag="BB2827"
FT                   /product="putative reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1347"
FT                   /db_xref="GOA:A0A0H3LTT3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTT3"
FT                   /protein_id="CAE33319.1"
FT                   /translation="MARLHIIICSTRPGRVGPAVADWFHAQALAHGGFEVALVDLAQVG
FT                   LPLYDEPRHPMLQQYEHAHTRAWSRSVASADAFVFVTPEYNYGPPPALVNALNYVYKEW
FT                   NYKPAAFVSYGGVSGGMRAVQAEKQTLTTLRMVPIFEYVAIPMVAERLDAAGRFQPQPI
FT                   HDSMAQGLLTELRRFSDALQVLREPASTP"
FT   misc_feature    complement(206080..206607)
FT                   /note="HMMPfam hit to PF03358, DE NADPH-dependent FMN
FT                   reductase, score 3e-35"
FT   CDS_pept        206749..207654
FT                   /transl_table=11
FT                   /locus_tag="BB2828"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1346"
FT                   /db_xref="GOA:A0A0H3LP95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LP95"
FT                   /protein_id="CAE33320.1"
FT                   /translation="MQDLNDLYYFVQTVDHRGFAPAGRALGMPKSKLSRRIAVLEERLG
FT                   VRLIQRSTRHFSVTDIGQTYYEHCKAMLVEAEAAQEAIDAAQVEPRGVVRLSCPVALLH
FT                   THVGAMLGEFMLRYPRVTLHLDASNRRVDVLGEGVDVAIRVRPPPLENSDLVMRPFADR
FT                   GQCLVASPALLARHGAPALPADLAAWPSLALGLPNQPHSWLLTGPQGAQATVPLAPRMV
FT                   TTDMLALRSAAVAGVGVVQLPSMMVRGQLADGTLVRLLPEWAPCRELIHAVFPSRRGLL
FT                   SSVRTLVDFLAERFAALQED"
FT   misc_feature    206758..206937
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.7e-13"
FT   misc_feature    207007..207636
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2.9e-43"
FT   CDS_pept        207662..211081
FT                   /transl_table=11
FT                   /locus_tag="BB2829"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1345"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWA7"
FT                   /protein_id="CAE33321.1"
FT                   /translation="MQQLGATRRYAASDLVGFLACEHLTQLDLRALDAGQAPAAADDEQ
FT                   MALVQAKGQAHEQAWLERLRARHPDLADVTRAGPDLAARLAATRAAMAAGAPVIYQAAL
FT                   CHGPYVGHADFLLRTECPSALGDYGYEALDTKLARSPRASFVLQLSFYAWLLEHAQGVA
FT                   PRSMHVVLGSGRELALRVADYAHYLRQVLRRFEAAIAAEPAPPTYPEPCEHCPQCRWRV
FT                   ACEARRVADDHLSLVAGMSRQQARRLNAQGVATLAQLGALPEHAQVAGIEAGTLQRLRA
FT                   QAALQWRARVDGARHYELLAAQDEGPRGLARLPRPDPGDMFFDMEGDPLEDGGLEYLFG
FT                   LYVIDDGAERFVPFWAHDRRQEKQAFEAFMDFVAERLRRHPDAHIYHYAPYEATALKKL
FT                   MSLHGTREAEVDHLLRAGKLVDLYRVVREGLRISEPSYSIKYVERFYLPRRAGEVTNAG
FT                   ASIVYYERWKATGEPRLLQDIADYNRDDVISTWRLRDWLCGIRPAALPWHNEAGQQDLD
FT                   AARAVIGEMTEAERRLLPYRAALADDLPADEAAWSPRDAFRALAWHLLDFHRREQKPAW
FT                   WAWFARAEATDGELIEDAECLGGLARDDAAPPVRQAQSLRYTYRYPAQETKLRTGARCT
FT                   DVRTGASLANLVVDPHARLASFTCSARKPAPPPRMALGPAAPVNNKELVNAVFRYGDAV
FT                   CRAPDGMSTPMRAVDALLRREPPRIRGLARGAPLVAPHAELLPQVLDVVARMDETTLFL
FT                   QGPPGAGKTYTGSRVLLQLLRAGRRVAVSSNSHHAINNLLRGLERLAQREGFALRGAKK
FT                   STSAGDDSCLGGAQIEDVFDNKDVDPARHQLVAGTAWLFARPEFEQAFDYLFVDEAGQV
FT                   SLANLVAMGQCARNIVLLGDQMQLGQPSQGTHPGRSGESALEYLLDGQATIAASQGVFL
FT                   DTSYRMHPEICGFISEAIYDGRLRAAPATAAHRLLLDEAAGRELPAHGIRYVPVPHDGN
FT                   TQSSREEAARVAELCALLLRQRHVDEAGAPAPLTLDDILFVAPYNVQVNTLRAALPDGA
FT                   RVGTVDKFQGQEAQVVIVSMATSSGDYLPRDLEFLFSRNRLNVAISRARTLAILVASPA
FT                   LTAVRCRSAEQMALVNTLCWVAETGSASPYQV"
FT   misc_feature    209924..209947
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(211069..213618)
FT                   /transl_table=11
FT                   /locus_tag="BB2830"
FT                   /product="putative autotransporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1344"
FT                   /db_xref="GOA:A0A0H3LN72"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN72"
FT                   /protein_id="CAE33322.1"
FT                   /translation="MLAAAGLLQSLGATPAAAACAPTLAPASGQSVQCDGAVVNQSVEA
FT                   AAGSQNVTITVAPGALFSTNATRALSVDDRSRIVNEGTIQMAGGAGASRGAMVGFGDNN
FT                   QLINRGSITTSGSGVRGISVPNVGSTGTLVDNSGSIRTQGASAHGIAINGPGNRVQNSG
FT                   AITVNGTDAKGVYLQGGSPAANVLVNSGTIHARGASSNGIFGPDGVHVNTTNANGFHAR
FT                   VENLPGGRILSDHSYALRGQNGNDTFINAGYLQGHGGAGRDTAVYMGPQGTGTLILRTG
FT                   SAIAGLADGGGAASHAYLEGSGTVDNRFANFRTLTMRGADWRWTSDAAFTESVDLRTGT
FT                   FFLAGTLASPANRLAAGAVLAGTGTLAGALRNAGEIRPGPNDGSGYGALTVRGDYTGAG
FT                   GALRVNTVLAGDGAASDRLVIDGGHAGGSTPVTVANRGGQGALTAADGILVVQAINGAS
FT                   SDAGAFSLAAPLNAGAYEYRLYRGDATGAAPDSWYLRSRAYLVEDQLAGSLAEAEAIAD
FT                   DIGRRTGERPSIEDTPLYRPEVALYSSIPMLARRMGLAQLGTFHERQGNQALLARDGER
FT                   VAAWARAYGGNSKQALDGDAQPGIDARLAGVQLGQDLYSSVRPDGGQHRFGLFGGYGHA
FT                   RGDTHGSAGGERDAATGRLTIDGYSVGGYWTYVGPRGWYVDTVLANTWMDIDTDSKAGR
FT                   DADTRGQALTASLESGYPLALSERWTLEPQAQLIYQHTRVDDFSDAVSEVRIRDDNALT
FT                   ARLGARLQGEYAAAAQVWRPYAALNFWRTFSGENTVVLGEDSIDTRRGATSLELAAGAS
FT                   VTLARSLALYGRLAYATSIDSQYLRGASAQLGMRYTW"
FT   misc_feature    complement(211075..211935)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 1.3e-36"
FT   misc_feature    complement(213559..213591)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(213562..213618)
FT                   /note="Signal peptide predicted for BB2830 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.988) with cleavage site
FT                   probability 0.665 between residues 19 and 20"
FT   CDS_pept        complement(213831..214631)
FT                   /transl_table=11
FT                   /gene="mxcB"
FT                   /locus_tag="BB2831"
FT                   /product="iron utilization protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1343"
FT                   /db_xref="GOA:A0A0H3LN75"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN75"
FT                   /protein_id="CAE33323.1"
FT                   /translation="MLPTELNVQRVRHPLKMRLLEVKRVTRPTPHLARITLAGDALRDF
FT                   VSASFDDHVKVFFPPPGAARPVLPELGPDGLVFAEGEPRPPMRDYTPRRHDARAGELDL
FT                   EFVLHGEGPAASWAARAQPGQQLGVAGPRGSFVVPLEYDWHLLVGDESALPAIARRLEE
FT                   LPPGKPVIALIEVADPAARLALSTRAQASVQWLLREPAGSRLPEAVRALRLPPGEGYAW
FT                   AAAEAAVARAVRQALVDTHGLDKSRIRAASYWKRGEAAVHETHD"
FT   CDS_pept        complement(214657..215289)
FT                   /transl_table=11
FT                   /locus_tag="BB2832"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1342"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTT8"
FT                   /protein_id="CAE33324.1"
FT                   /translation="MHPFHVFAMSAHGGRGGGHAGGRHGGGHGAGGDGPDWRRGRKFSA
FT                   DDLQLMILALLDEGPSHGYELIKALGARSRGFYTPSPGMVYPTLTWLEEAGHATVSQDG
FT                   ARKHYHLAEPGRAHLQANRERVTLLMAQLAHVGRKMEWMRRAWAGQPIETGSEGEDLAT
FT                   GWLPEYVQARMALKQALARHADATPARQRQLAAILARAAAELDDLSS"
FT   misc_feature    complement(214906..215136)
FT                   /note="HMMPfam hit to PF03551, DE Transcriptional regulator
FT                   PadR-like family, score 4e-15"
FT   CDS_pept        complement(215397..215609)
FT                   /transl_table=11
FT                   /locus_tag="BB2833"
FT                   /product="Hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPA3"
FT                   /protein_id="CAE33325.1"
FT                   /translation="MVRARPKETTMSATLRCHVPPKPDPIPPDSPPGDLPVDPDTDDPD
FT                   IDLPPPDAPGDPARRLAASVRFLLS"
FT   CDS_pept        215703..216461
FT                   /transl_table=11
FT                   /locus_tag="BB2834"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1340"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB1"
FT                   /protein_id="CAE33326.1"
FT                   /translation="MPPEPIRLRILTVNAHKGFTSFNRRFILHELREALREARPDLVFL
FT                   QEVLGEHQRHAARHARWPAVSQYEFLADTLWSAYAYGRNAVYPDGHHGNAVLSKYPIVS
FT                   HRNEDLSVGAAHEPRGMLHCVLDVRDAPAPLHALCVHLGLREAHRQEQLRRLCQYLRQH
FT                   VPAQAAALLAGDFNDWRQRADATLARCGLADVHRLALGHAARTFPAACPLLRLDRIYVR
FT                   NVAGSEPRRLSRRPWSRLSDHVPLAAEVTL"
FT   misc_feature    215724..216452
FT                   /note="HMMPfam hit to PF03372, DE
FT                   Endonuclease/Exonuclease/phosphatase family, score 1.2e-19"
FT   CDS_pept        216458..217660
FT                   /transl_table=11
FT                   /locus_tag="BB2835"
FT                   /product="probable phospholipase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1339"
FT                   /db_xref="GOA:A0A0H3LN77"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN77"
FT                   /protein_id="CAE33327.1"
FT                   /translation="MSTPWRDGNRFAILENGASYFPRVYTAIGKAREEILIETFILFDD
FT                   AVGRELREALMAAARRGVRIDVTVDGYGSDSLPPDFIAGLVELGVGFHVFDPRPRLLGM
FT                   RTNLFRRLHRKIVAIDGTLAYVGGLNFSADHLDDYGPQSKQDYAIEIAGPLAADIRDFA
FT                   RAALAAVPRRRWRRARPAAPPQAAGPARARLVVRDNDQHTNDIEQSYRVAIRAARRDIV
FT                   IANAYFFPGYRLLRDLRAAAARGVRVRLILQGEPDMPIAQLGARLLYDALAEAGVEILE
FT                   YCERPLHGKVASIDDEWATVGSSNLDPFSLALNLEANVEVRDSAFASGLRERLERLAID
FT                   HCRPAPQSDGAGRQLRRLFAGALVYHFLRRFPAWAGSLPAHKPRIQTLRPDGQGQPDEA
FT                   T"
FT   misc_feature    216779..216862
FT                   /note="HMMPfam hit to PF00614, DE Phospholipase D. Active
FT                   site motif, score 3.9e-05"
FT   misc_feature    217304..217387
FT                   /note="HMMPfam hit to PF00614, DE Phospholipase D. Active
FT                   site motif, score 2.4"
FT   CDS_pept        217657..218604
FT                   /transl_table=11
FT                   /locus_tag="BB2836"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1338"
FT                   /db_xref="GOA:A0A0H3LN81"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN81"
FT                   /protein_id="CAE33328.1"
FT                   /translation="MKHAHHHGHRRRRLGAWLAGIVGLAVVGVLLYQARRIDWHAVARA
FT                   AHDIPGPAVALAAALALAGYLAYAGFDILARRYAGHRLPAWQVAAIAMTSYALNLNLGV
FT                   LLGGVAVRLRLYGRHGLRTACGLRVVAFATATNWVGYAWLAGALLLAGQMPTPAGWHLG
FT                   AGLLRTVGAALLAGALAYLYLCRYARRRAYTLRGHRWVLPDLPTALRQMGLAGVSWAIM
FT                   GGIIYVLLQGRAPYPEVLAILLFSSIAALLAHIPGGLGVIEALFAAALATRMPASESLG
FT                   AVLMYRLLYAWIPLCVALPAYLGAEWRHRRAAAG"
FT   misc_feature    join(217699..217752,217813..217881,217909..217977,
FT                   218038..218106,218149..218217,218278..218346,
FT                   218374..218442,218503..218571)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2836 by TMHMM2.0 at aa 15-32, 53-75, 85-107, 128-150,
FT                   165-187, 208-230, 240-262 and 283-305"
FT   CDS_pept        218658..219803
FT                   /transl_table=11
FT                   /locus_tag="BB2837"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1335"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTU4"
FT                   /protein_id="CAE33329.1"
FT                   /translation="MNPAAAVPRRPVDLVVAHPGRRDAPRHERASLRALGRDIAELLGC
FT                   EYADALPAAARDPRLRVYYVPARTLLDGRALALGIQGPDDLFGGVAPHGFVATKAITHA
FT                   LPHDGCAAPAAWSRELGARLSDCVLPGCTVFALDEARQAGVRMLRTGALRVKPVRATAG
FT                   RGQRKVADAAALDQALAEQDAGEVRRYGLVLEEHLEDISTYSVGVAQVGVHLASYIGTQ
FT                   SLTLDHAGLEVYGGSDLWFVPGPLPALLQLELDAPRRAALEHAMRYDEQAFACYPRLYA
FT                   SRRNYDVARGRDAQGRWRTGVLEQSWRAGGASLAEIAALRAFAQDGGLRRAHAATSEHY
FT                   GPDPAHPPGTRIVFHAHDAEVGFISKAGGMTQDNGTDDDDT"
FT   CDS_pept        219823..220545
FT                   /transl_table=11
FT                   /locus_tag="BB2838"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1334"
FT                   /db_xref="GOA:A0A0H3LPB2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPB2"
FT                   /protein_id="CAE33330.1"
FT                   /translation="MFDTQVAGTLLTPRAKLPGVLFVHGWGGSQRFDLSRARDIAGLGC
FT                   ICLTFDLRGHAATEAQRRQVTREDSLRDIMAAYDALIAHPAVDTSAIAVVGSSYGGYLA
FT                   AILTTLRAVRWLALHVPALYRDDEWAQPKLQLDRAAISAYRHATVAPEGNRALSACSSF
FT                   RGDVLIVEAEHDDYIPHSTIMSYRGAFLHSHSLTHRIVDGADHALSDKRCQQAYSSILL
FT                   NWATEMVVGARVGAGRPA"
FT   misc_feature    220039..220131
FT                   /note="PS00708 Prolyl endopeptidase family serine active
FT                   site."
FT   CDS_pept        220662..220841
FT                   /transl_table=11
FT                   /locus_tag="BB2839"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB8"
FT                   /protein_id="CAE33331.1"
FT                   /translation="MKPTPTSQDRKQDDDTQREAQRSHGSQQARTKKDGHVSQIGSNQD
FT                   QSSQRNRGQGARRS"
FT   CDS_pept        220838..221863
FT                   /transl_table=11
FT                   /locus_tag="BB2840"
FT                   /product="Conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1332A"
FT                   /db_xref="GOA:A0A0H3LN84"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN84"
FT                   /protein_id="CAE33332.1"
FT                   /translation="MSPAAPAALRYVDDSRPGLARRRLPGGKFAYYDANGRRVRDPATL
FT                   ARIAALAIPPAYREVWICARADGHLQATGRDARGRKQYRYHPDWRAWRDAAKYGQLREF
FT                   GRALPRIRRRVARDLSSRGLAPDKVAATVVRLLETTLARVGSRAYARENGSFGLTTVTR
FT                   RHAWLQGSRLRLRFTGKSGVAHDVTVRDRRIARVVKRCLDLPGQQLFHYLDEDGEPRPV
FT                   DSELINAYLREAGGGDFTAKHYRTWAASALALALLVRWPATDAAARRAAVVEVVKLVAA
FT                   RLANTPAVCRACYIHPGIVQAYLDGALPARGAAPAGPRGLAADERRLLAFVAAWPHSED
FT                   R"
FT   CDS_pept        complement(221849..222148)
FT                   /transl_table=11
FT                   /locus_tag="BB2841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN87"
FT                   /protein_id="CAE33333.1"
FT                   /translation="MAARRAAHYHALYAISCARCKMSKPKPARGADAHDDPSLDQAKVL
FT                   PPRGPVLVPNLPPKPPARAQADKHGPAVDNQTESNWADGAAPQPRARNARSSIF"
FT   CDS_pept        222239..222571
FT                   /transl_table=11
FT                   /locus_tag="BB2842"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTU9"
FT                   /protein_id="CAE33334.1"
FT                   /translation="MLNTHVVECLQACGRCAAACDYCASSCLREGHGADMARCIALDLD
FT                   CAAACRLCAAMMARESEFSTDMCTLCARICEVCGDECARHEPRHCQECATACHACASAC
FT                   RAMARP"
FT   CDS_pept        222632..222955
FT                   /transl_table=11
FT                   /locus_tag="BB2843"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LPC9"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPC9"
FT                   /protein_id="CAE33335.1"
FT                   /translation="MPTSKRPANFPADPTAPMSAGARQRWLDEIHATLDDPQYADIEEL
FT                   KARLRQQLDAAREAWSQLADTTSSLASEAADCADEFVHARPWQAVGVAAGVGMLVGVLL
FT                   CRR"
FT   CDS_pept        223005..223931
FT                   /transl_table=11
FT                   /locus_tag="BB2844"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LWC3"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWC3"
FT                   /protein_id="CAE33336.1"
FT                   /translation="MMARIVWKGAIAFGLVHVPIVVHAASRPSRLDFDWIDRRDNAPVG
FT                   YQRINKRTGRAIDGEHIVKGYEYEKGEYVYMNDEDFARANVAATQTVEILDFVKAEEVP
FT                   LYYFDTPYYLAPDRRGGPGYALLHRALRDSGRIGIAQVVLHTRQHLAAVMPVGEVLMLV
FT                   TMRYADEIVPAEEFGLDDAATHDRPGARELRMAMRLLDDMTCKWDPAQYRDAYRDDLLA
FT                   AIDRKVRAGKTHELAEPGEAAPRASAKVIDLAAMLQQSLERGKRRAGAPAPPAKKAAPA
FT                   RKATAKGAAAKRARKTPARRAPARKAA"
FT   misc_feature    223005..223076
FT                   /note="Signal peptide predicted for BB2844 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.644) with cleavage site
FT                   probability 0.643 between residues 24 and 25"
FT   misc_feature    223035..223610
FT                   /note="HMMPfam hit to PF02735, DE Ku70/Ku80 beta-barrel
FT                   domain, score 1.2e-45"
FT   CDS_pept        223950..226412
FT                   /transl_table=11
FT                   /locus_tag="BB2845"
FT                   /product="Putative ATP-dependent DNA-ligase"
FT                   /db_xref="GOA:A0A0H3LN90"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN90"
FT                   /protein_id="CAE33337.1"
FT                   /translation="MTQPLRQYREKRDFRATAEPAGAARRPRAAARASEGLSFVIQRHQ
FT                   ARRLHYDFRLEIDGVLVSWAVPKGPSRDPSVKRLAVHVEDHPLEYGGFSGDIPKGQYGA
FT                   GHVDIWDSGVWIPRGDPRQGLRRGKLHFALRGRRLAGDWVLVRMSGEQDQWLLRKEDDE
FT                   AAVPGDDAERAPATPPPAPEHAPAATPRGRRAAMPHTLAPQLATLVDSPPHGPGWSYEV
FT                   KYDGYRILAACSAGGVRLVSRGNEDWQARMAPLARALGALKLGRGWLDGEVVVLDERGV
FT                   ADFQLLQNALDGQAEGLVFVAFDLPFWNGEDLRALPLQARQERLEDLLREVPEDAPLML
FT                   TQRLPVADDTEGKAAWNEACRLSLEGLICKRLDAPYRSGRSQGWLKLKCRPRQEFVIGG
FT                   YTEPAGARRHLGALLVGLRQGRQLRYAGRVGTGFGAATLRTLGQRLAALRQDAKPFSGD
FT                   VPRGRGDAAIHWVSPELVAEVNYAGITRDGLLRQASFAGLRADKPASEVRGEVAARPPA
FT                   AKAATPSRRAGDGRAEVAGVRISHPDRLAYREPDYTKLQLAEYYAAIGPHILPHLRQRR
FT                   VALLRCPDGAGTTCFFQKHLSQSLPAGVRRDGGHLVIESLPGLIALVQYGAIEFHTWGA
FT                   DTRHPDTPDRITLDLDPGPGVAWPAIVEGAQMARLLMQEVGLEPFLKTTGGKGLHLVAP
FT                   LRPTQPWDTVKDFARALARQLAVALPDRFTANMAKARRERRIFVDYLRNGNGATAVAAF
FT                   SARARDGAPVSMPLSWDALDAGDDLRGARWNIANALEQARRKPDPWADYAASRRTLGSR
FT                   MQARLPRD"
FT   misc_feature    224547..225113
FT                   /note="HMMPfam hit to PF01068, DE ATP dependent DNA ligase
FT                   domain, score 3.9e-23"
FT   misc_feature    224610..224636
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT   CDS_pept        226483..227490
FT                   /transl_table=11
FT                   /locus_tag="BB2846"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LN93"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN93"
FT                   /protein_id="CAE33338.1"
FT                   /translation="MPKTPSDASPKARQAADRTAERQRAIQREQDQRDQRKPAAGRPGE
FT                   APRTGARDHPEPPMPRQHLAKPGNEADMALQPQFLAPAYRGSGKLEGLAALVTGGDSGI
FT                   GRAVAVLYAREGADVAIVYLQEHDDARETARHVQAEGRRCLLIAGDVRDPVFCEEAVAR
FT                   TLREFGKLDILVNNAAYQEHASSLQDITDERLDETFRTNIYGYFHMARAALPHLKEGAS
FT                   IVNTGSVTGLRGHPTLLDYSSTKGAIHAFTWSLAANVAERGIRVNAVAPGPVWTPLNPA
FT                   DQAPGQIKDFGARTALKRAAQPEELSPAYVFLASPACASYITGIVLPVTGTPGE"
FT   misc_feature    226753..227481
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 2.5e-64"
FT   misc_feature    227164..227250
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    227461..227478
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   CDS_pept        complement(227495..227968)
FT                   /transl_table=11
FT                   /locus_tag="BB2847"
FT                   /product="Hypothetical protein"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTV5"
FT                   /protein_id="CAE33339.1"
FT                   /translation="MARQHGASGDVQAYARQAAARLQDLGRELADVAHAQAVTLPAGPD
FT                   VTQRTHLQELAQQREAAFDRMYLHWAGVALGEETLRHYRQAADEAQAAPVREFAVHTLP
FT                   MLQNLLQDARRLARPSPQAEPRKLPPGGPGEPAPPSPASPSAPPSIDATRPGR"
FT   CDS_pept        complement(228100..228759)
FT                   /transl_table=11
FT                   /locus_tag="BB2848"
FT                   /product="Putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LPE5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPE5"
FT                   /protein_id="CAE33340.1"
FT                   /translation="MSTAGMPLAGLAAPDTGGRTMSMIVAARFMTFDAAAAAAGRLQAA
FT                   GVSQEDIHTFYVNSAGAHDRYPLGGDRRADPDAGPAQYGAITGAAVGGLALGAIAGVVA
FT                   SALAATSLALVAAVGVGAYVGALFGALWVAGRGRRPLRPATASPAASPPGADEHAPVRH
FT                   AGVMLALHVDGVQAERTLALLRDAGGQDLERAQGRWVDGKWEDFDPLQPPQLAAGG"
FT   misc_feature    complement(join(228358..228426,228445..228513))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2848 by TMHMM2.0 at aa 83-105 and 112-134"
FT   misc_feature    complement(228628..228759)
FT                   /note="Signal peptide predicted for BB2848 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.823) with cleavage site
FT                   probability 0.358 between residues 44 and 45"
FT   CDS_pept        complement(228756..229496)
FT                   /transl_table=11
FT                   /locus_tag="BB2849"
FT                   /product="Hypothetical protein"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE7"
FT                   /protein_id="CAE33341.1"
FT                   /translation="MDHGAGWRRLVGPDPGTAMAQRLLVVSPHFDDAVFSCGGLLAATP
FT                   GATVLTVFSGVPSVAAALPDWDRRCGFERADQAMQARQAEDRNALAELGASGLGLDLLD
FT                   SQYPGSEAMLARLPTVLAAAVQSIRPGALLIPLGLFDEDHVRVADAALAVRGLFDSCDW
FT                   LAYEEVLYRRRRGAVQARLTQLHGRKVYATPVALPGDARGASKTRAVAAYHSQLEPLGL
FT                   VPGHGDDAAPERYWRLTWPRPDAG"
FT   CDS_pept        229580..229999
FT                   /transl_table=11
FT                   /locus_tag="BB2850"
FT                   /product="Hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB2"
FT                   /protein_id="CAE33342.1"
FT                   /translation="MIAAPERVRRPQTPCPWRPREPAGAAAPQARRLQGMRHPPLRRAI
FT                   VPKRSLWPVSPPDAEPRPGLGPSDSSDSASDLPDAAAETDSDTGGTGERPGVEYDRQPP
FT                   DGADIAPDTQTDAGHAGVSRHRPDSVRNGGPPDQP"
FT   CDS_pept        230051..230539
FT                   /transl_table=11
FT                   /locus_tag="BB2851"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNB4"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB4"
FT                   /protein_id="CAE33343.1"
FT                   /translation="MDVDWNGVFALTVPPLELFLRGTLIYWFLLALLRLAGRRDIGSLG
FT                   VADMLVLVLIADAAQNAMAGEYKSVTDGAILLLTIVGWTVAIDRASYFLPAVGRVLAPS
FT                   TVCLVRDGELQRRNMRREYITEAELMSELRLKGYDSLDDVHRAYMEPDGNISALRRHG"
FT   misc_feature    230069..230137
FT                   /note="1 probable transmembrane helix predicted for BB2851
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(230590..231033)
FT                   /transl_table=11
FT                   /locus_tag="BB2852"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTY7"
FT                   /protein_id="CAE33344.1"
FT                   /translation="MDISSRQAPLAAAAAASGPTRIVGRAKFSAVGPGPQIMAADTLEG
FT                   NRVLNPQGEHLGSVQHIMIDVPQGRVAYAVLSFGGVLGMGDKLFALPWSALVLDTDHKC
FT                   FVLDIPKDHLRQAGGFDKNDWPGMADKRWAEELYDYYDQRPYW"
FT   CDS_pept        complement(231048..231791)
FT                   /transl_table=11
FT                   /locus_tag="BB2853"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPT6"
FT                   /protein_id="CAE33345.1"
FT                   /translation="MRNDNRRQPPYGDDDFGPHDEFERDFRLGGRDVRQGRPSWHGNDR
FT                   PEAQDYSRGSGRWGAEEPDYGRPYGERPNRATGGQPNRRGPQYEQGGPYPGTRRAQWNE
FT                   PITSRSADPGQSSYGGFRDEDPRWQRQQFHDGPLAGDYGGYHGDGGEWAGLAGAGHRAG
FT                   SRRILPKGYTRSDERLREDVCERLAHSGLDVSDVSVSVTDGQVELSGTVARRRDKYAIE
FT                   NCADDCLGVADIDNRIRVVAPTNAP"
FT   CDS_pept        complement(231980..232324)
FT                   /transl_table=11
FT                   /locus_tag="BB2854"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LWF1"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWF1"
FT                   /protein_id="CAE33346.1"
FT                   /translation="MHAHTEDRARMRESKQQVKSGLHELIAGAEALLRSTASYGGSELE
FT                   SVRDRLKHQLEAARDQAGGWERSAVERYQRASRVADGYVHENSWKLIGVAIVLGALLGA
FT                   CAMSDRGRRR"
FT   CDS_pept        complement(232430..232663)
FT                   /transl_table=11
FT                   /locus_tag="BB2855"
FT                   /product="Hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB5"
FT                   /protein_id="CAE33347.1"
FT                   /translation="MKASNDTPSSKPSAPRRDETPAPRKPRPRVEQADGSPGESGAIAN
FT                   PMPGLSPQNTPGMDRWSDNDFEAVWRRATREL"
FT   CDS_pept        complement(232712..234478)
FT                   /transl_table=11
FT                   /locus_tag="BB2856"
FT                   /product="Putative pyruvate dehyrdogenase"
FT                   /db_xref="GOA:A0A0H3LNB8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB8"
FT                   /protein_id="CAE33348.1"
FT                   /translation="METVSDFVLERLAQWGIRRIFGYPGDGINGLMGAFGRTRQPLEFV
FT                   QARHEEMAAFMACAHAKFTGQVGVCMATSGPGAIHLLNGLYDAKLDHQPVLALVGQQAR
FT                   RALGGDFQQEVDLVSLFKDVAHDFVQQAASAEQARHLIDRALRIALERRCVTCVILPND
FT                   VQDLPAVRELPREHGSVPTGIGVTSHAGVPPDTALRNAADILNRGERVAILAGAGALEA
FT                   AEPLRAVAERLGAGVAKALLGKAALPDALPYVTGAIGLLGTQPSWEMMNECDTLLMVGT
FT                   AFPYSEFLPREGQARAVQIDRDGRNLNLRYPVEVGLAGDSRQTLQALLPLLENKPRARW
FT                   RERIEASVARWWRTVEARAMVDASPVNPQRVFWELSQRLPDRSIVTADSGSAANWYARD
FT                   VKLREGMMASLSGGLATMGCAVPYALAAKLAYPERPVVALAGDGAMQMNGINELITIAD
FT                   RWRAWADPTLVVLVLNNGDLNLVTWEQRVMGGDPRFEDSQRLPPFAYADYARMLGLHGL
FT                   RVERAQDLGAAWGEALTAGRPAVLEVMTDPEMPPLPPHIPARQVRAYVQALRADPAGGA
FT                   ALRATLKQWWAG"
FT   misc_feature    complement(232850..233395)
FT                   /note="HMMPfam hit to PF02775, DE Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 1.8e-29"
FT   misc_feature    complement(233147..233206)
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT   misc_feature    complement(233447..233899)
FT                   /note="HMMPfam hit to PF00205, DE Thiamine pyrophosphate
FT                   enzyme, central domain, score 1.5e-18"
FT   misc_feature    complement(233960..234478)
FT                   /note="HMMPfam hit to PF02776, DE Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 3.4e-45"
FT   CDS_pept        complement(234554..235942)
FT                   /transl_table=11
FT                   /gene="zraR"
FT                   /gene_synonym="hydG"
FT                   /locus_tag="BB2857"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /db_xref="GOA:A0A0H3LTZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTZ1"
FT                   /protein_id="CAE33349.1"
FT                   /translation="MPHLLIVDDDDAVRESLVEIGREHGYTVAQAATVRDALIQVERQL
FT                   PDLVLTDVRLPGATGMDLFSRISHAGVEVVVITGYGSMENAIEALRAGATDYLVKPICM
FT                   ERLEQILARVASAGQDGDWDPSQPFQQDGRFGRLVGASAPMQALYRQISRVAPTEVTTL
FT                   LIGESGTGKELAAHAVHELSARRAGPFVAVNCGAISPNLIESELFGHERGSFTGAERQH
FT                   KGYFERADNGTLFLDEVTEMPLDLQVKLLRVLETGAFMRVGTNREISCSVRVVAATNRS
FT                   PEQAVRDGRLREDLYYRLSVFPIELPPLRERGDDLAMLAERFLDGLNREYGKSKRFAPQ
FT                   ALQSMAEYAWPGNVRELKNFVRRAFILAESDTLDASALTPQISPSDAAGGGQVIVPVGS
FT                   TLAEADRRLILATLQRCGGVKKQTAAMLGISAKTLYNRLEEYGEAGPPDAAANEEGAAP
FT                   RAQH"
FT   misc_feature    complement(234620..234742)
FT                   /note="HMMPfam hit to PF02954, DE Bacterial regulatory
FT                   protein, Fis family, score 2e-13"
FT   misc_feature    complement(234866..234895)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    complement(234869..235531)
FT                   /note="HMMPfam hit to PF00158, DE Sigma-54 interaction
FT                   domain, score 4.3e-126"
FT   misc_feature    complement(235226..235273)
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    complement(235586..235939)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 1.8e-29"
FT   CDS_pept        236262..237200
FT                   /transl_table=11
FT                   /locus_tag="BB2858"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /db_xref="GOA:A0A0H3LPU1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPU1"
FT                   /protein_id="CAE33350.1"
FT                   /translation="MRKLAASIERAADSDATVLLVGESGTGKDVLARAIHDLGARRDAP
FT                   FMAINCGAISPTLAHAQLFGHEKGSFTGALSHNAGYFENASGGTLFLDEITEMPPDMQV
FT                   HFLRVLETGAYRRVGGVELLHANVRIIGATNRDPHAAVAEGRLREDLLHRLLVLPLRVP
FT                   PLRERPQDIRFLAQRFLDELNARHGTAKRFSGAMLDALAAHDWPGNARELRNAVQRAYI
FT                   LQDGPIGPQALADTVLRRPARQDADTLAFPVGTPLECVQRELILATLARAGGDKRRAAR
FT                   TLAISLKTLYNRLNAYGVGAGADPEKNTATL"
FT   misc_feature    236262..236903
FT                   /note="HMMPfam hit to PF00158, DE Sigma-54 interaction
FT                   domain, score 2.2e-103"
FT   misc_feature    236313..236354
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   misc_feature    236499..236546
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    237030..237152
FT                   /note="HMMPfam hit to PF02954, DE Bacterial regulatory
FT                   protein, Fis family, score 2.5e-08"
FT   CDS_pept        237283..238731
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="BB2859"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="GOA:A0A0H3LWF6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWF6"
FT                   /protein_id="CAE33351.1"
FT                   /translation="MFPRPGASLSEENLSHVLQDLRLRQQTTLAPRLQQSIHLLQMSAL
FT                   EFTTTVQQALATNPFLEDADETEAQDDAPAPPAASEPPATSEPPPEPPSYAGDYPTRSA
FT                   AAQPGVASDAAAWVPATLSLHERLSQALGAYVLSERDRALAEFIVDGLDDDGYLRQELA
FT                   QLAGVADFDPPPEASEWQAALHLVQQLDAPGLAARDLPECLALQIRACSRLDPAVRDAA
FT                   LAIVAAHLPRLARSDYPGMRRALRCSEPVLRQACGVIRGLDPKPGRRYAHEPPSYVVPD
FT                   VVVSKQRQQWLVVPNRGAMPHARLHQAYADLFRRARMDERSPMAQELQEARWLVRNVEQ
FT                   RYATIRRVAEAIVQRQQMFFEFGQIALRPLMLREVADELEMHESTVSRATANKYMSTPR
FT                   GVFEFRHFFSRELSTESGGTCSAAAVRALIREYIDAEDPRMPLSDVTLAERLAGDGIVV
FT                   ARRTVSKYRLQLRLPAADARRQYY"
FT   misc_feature    237322..238722
FT                   /note="HMMPfam hit to PF00309, DE Sigma-54 factors family,
FT                   score 6.2e-158"
FT   misc_feature    238387..238446
FT                   /note="PS00717 Sigma-54 factors family signature 1."
FT   CDS_pept        complement(238760..239176)
FT                   /transl_table=11
FT                   /locus_tag="BB2860"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNB9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB9"
FT                   /protein_id="CAE33352.1"
FT                   /translation="MADRHAACEMEGPYLEDIDMKQRSLIYLVAGAMAALLAHGGALAQ
FT                   SGTAPTTPSTTPNDSTAVPPNRPVPPGQVPPAPGTTTHDGMPKTPQQHMNEQRGNDTRG
FT                   DMPRRQPDINDNPPATPAQGASPPPGYPNTGGSK"
FT   misc_feature    complement(239048..239107)
FT                   /note="1 probable transmembrane helix predicted for BB2860
FT                   by TMHMM2.0 at aa 24-43"
FT   CDS_pept        239434..240966
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="BB2861"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="GOA:Q7WIJ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIJ0"
FT                   /protein_id="CAE33353.1"
FT                   /translation="MTTIRTLVVAAEAFPLAKTGGLGDAVAGMVQALGHRPGGVDVQCE
FT                   LLMPAYRGTLDRLYRPRTVARLGGLPGGPASLVRGHCPGSGLSVLLLRNDALYDRPGIY
FT                   VDDSGQGYPDNARRYAALAHAAARLAQGLPGLRPPHVVHAHDWHAALAPLLIHAAGLHY
FT                   VKTLLTIHNLAFQGTFPAELASALGIPLACRHDDGALSDDRVNFLKAGIRYATRVTTVS
FT                   RAYAREILTPAFGCGLHGLLRARGADLSPVPNGIDTALWNPAADPHLGGLRFDALDMRN
FT                   KACCKAALQAELGLQLRADATVLAMGSRLTGQKMADVAIAALPALLEAHEHLQFALIGR
FT                   GEPDLEAALRALAARYPGRCAVHIGYDEPLAHRLHAGADLLLHGSRFEPFGLTPLYAMR
FT                   YGTLPVASRVGGMVDTIRDPGPAIEESCAGQGTGFLFDGSEPADMRQAVTRALRALAKP
FT                   AVRDAMRRNAMQADFSWRTSAQAYAGLYANLASGPQRGRVPAPTLPLLANAA"
FT   misc_feature    240220..240249
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    240292..240846
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 1.5e-12"
FT   CDS_pept        240978..244166
FT                   /transl_table=11
FT                   /locus_tag="BB2862"
FT                   /product="putative alpha-amylase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1330"
FT                   /db_xref="GOA:A0A0H3LNC2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC2"
FT                   /protein_id="CAE33354.1"
FT                   /translation="MVRRAAARLDRDAELLAFHAAAIALARGARASPYAAWQALCTRLR
FT                   RCGFNAVCLTPPWQCRDDIQGAPADVDHADARWGGGAMDATLARLAREAAAQGLTLLLD
FT                   LEPDRVARDAAPRTAQAQWLESPADEPAGDPRQPAARHGVRYVRGRPAPAAFLQAWQSR
FT                   LAGWLDAGVAGFRCTAPQRLDPSDWRALFEPLRASRPALRLLAWTAGLTPAQSAALAGA
FT                   GFDGVFGSIPWWSPDAAWLDAESQRLREIAPLLAAPLAPAGGAPLAPASAAAHAALRAL
FT                   WVAALWGDGLLVGSELQRMMPAVARALRWRRQAAPRGRPVLLCGRDGWATLIIRPGPPG
FT                   TSHVLALDPQAAHEPRVDWSAGAALLPAGVPRHLADPVEHCALYRVAAERPVRATAGAL
FT                   LPGPPSACDRDARVVFEHVAPSVAHGSLAAKALAHVPVEVGVDLISDGHEQLAGELQWR
FT                   AVDQAGWHGVPLAPGDNDRWHARFAPRRVGLHEFRVCAWRDTWLTFCRELRLKHEADQD
FT                   IALDLAEGAAHLRAALARRQARGDARRAPIEAALSMLNGGPAPADAVAALLRDGLAQAM
FT                   RALAARPFMHTSASRPLWVDRAAAGHGSWYELFPRSQAVPAGAHGTFDDVIARLPALRA
FT                   MGFDVLYLPPIHPIGQSQRKGRNNALQAAADDPGSPYAIGSPDGGHDAIHPQLGTRADF
FT                   ARLVQAAAAHGMEVALDFAIQCSPDHPWLQRHPDWFEHRADGSIRHAENPPKRYEDIVN
FT                   VSFYDQASGRPRRALWRALRDVLLYWIDAGVRIFRVDNPHTKPLPFWQWLIADVHARHP
FT                   DVVFLSEAFTRPRMMYRLAKLGFTQSYTYFTWRNTRHELDSYLRELSRPPVCEWFRPNF
FT                   FVNTPDINPYFLQASGRAGFLIRAALATAGSGLWGMYSGFELCEAQPVPGKEEYLDSEK
FT                   YQLRQRDWHAPGNVTAEIAALNRIRRANPALHSHLGYVPLQCANEQVLTFCKATPNRAS
FT                   VVLVAISLDPWAPQSVRVALPRWLFGLDDSADLHGEDLLDGARASWREAALDLELTPQR
FT                   PYRLWRLWSRPLSS"
FT   misc_feature    242799..243842
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 3.9e-06"
FT   misc_feature    243486..243515
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT   CDS_pept        244178..247519
FT                   /transl_table=11
FT                   /locus_tag="BB2863"
FT                   /product="alpha-glucosidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1329"
FT                   /db_xref="GOA:A0A0H3LTZ6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LTZ6"
FT                   /protein_id="CAE33355.1"
FT                   /translation="MPATHPAPDPLWYKDAVIYQLHVKSFFDANDDGVGDFAGLLAKLD
FT                   YIVELGVNTIWLLPFYPSPRRDDGYDIADYRGVHPDYGSLADARRLVRAAHARGLRVIT
FT                   ELVINHTSDQHPWFQRARAARPGSAHRAYYVWSDDDKAYAGTRIIFCDTEKSNWTWDPV
FT                   AGAYFWHRFYSHQPDLNYDNPQVLREVLGAMRYWLDMGVDGLRLDAVPYLVEREGTNNE
FT                   NLPETHAILRRIRRVIDSEYPGRMLLAEANQWPEDAQEYFGAGDECHMAFHFPLMPRMY
FT                   MAIAQEDRLPVTDIIRQTPSIAPQCQWAIFLRNHDELTLEMVTSRERDYLWNVYAAEPR
FT                   ARINLGIRRRLAPLLERDRRRIELMNSLLLSMPGTPVLYYGDELGMGDNIHLGDRDGVR
FT                   TPMQWSPDRNGGFSRADPERLPLPLLMGPLYGYEAVNVEAQQRDPHSLLNWTRRMLAKR
FT                   RQSHVFGRGELSFLYPGNRKILAYLRTWEDTVVLCVANLSQAAQPVELHLSEYAGRVPV
FT                   EMLGGTAFPQIGELPYLLTLPPFGFYWLDLSAGAAPPAWHSELPPQMPESITLVSRGAG
FT                   AALRLTEASRRQLEADVLPAYLQRQRWYAARRKPGVMRLAYSVPLNDDVESYYEAEIEV
FT                   SDDGPPRRFHTPVALAWQDDTAAQYPLARVRRGAQLGTLTDASLQPGYARVLLAALTAG
FT                   RDIQAGGEPAVRLRFLPEPGLADLALRDDSEVRALSADQSNSSLLVGERVVFKLLRELH
FT                   AGPHPEAEMTRYLTQAGYAHTPALLGEVVRVQGDQAPHTLALAHAYVVNEGDAWNWTVA
FT                   YLKRTVDAAMLTGASADDYQQELAGYEVLAGTIGQRLAQMHSVLARAGELPGFAPRPAS
FT                   ERDAALAGEHAVAQLDRALQALRACESGLAPASHACAQWLFEHRDRLAAHIMTLAQAET
FT                   GALRIRVHGDFHLGQILVAQTDAYLIDFEGEPARPMAERRQLSSPFKDVAGILRSFDYA
FT                   VAELSRDDPLGGAPRDFNTGVAEPADPASAPRETREALLARFRQRAGAALLASYGNAID
FT                   PVLALPPERAQALTCLYLLEKAAYEICYESAYRPERLPVPIHGLAETARAALLAAAVDH
FT                   DEGPAP"
FT   misc_feature    244238..245434
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 3.1e-65"
FT   CDS_pept        247516..249711
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="BB2864"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1328"
FT                   /db_xref="GOA:Q7WII7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WII7"
FT                   /protein_id="CAE33356.1"
FT                   /translation="MMRDSPSIQGTLDAATQHALLAGRHADPFSVLGPHQAGAHTVVRV
FT                   LAPGARTVMAVLPGGQRTPLLPMQPGLFENTVPGLQPGAPAAYRLCIEWEGGIQHTADP
FT                   YAFGPVLDAAQLDHCAAGGWRYLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFN
FT                   GWDGRRHAMRLRYPAGVWELFLPDVGPGARYKFQVLGADGHTVLKADPLARQAEAPPAT
FT                   ASIVPDERPFAWTDEAWMEQRAARQRCDAPISIYEVHAGSWFDDAGAPRWQSLAARLPE
FT                   YARSLGFTHIELLPVMAHPFGGSWGYQPLGLFAPAAAHGAPADFAHFVDRCHEAGLGVI
FT                   LDWVPAHFPDDAHGLARLDGTPLYEHADPREGRHPDWNTLIYNYGRREVRAFLIASAIH
FT                   WLRHYHVDGLRVDAVASMLYRDYSRPAGQWIPNRHGGRENLEAIDFLRELNAAVGVQCP
FT                   GAITVAEESTAWPGVTAPVANGGLGFDYKWNMGWMHDTLRYMRRDPIHRRHHHHDLSFG
FT                   MVYAYAERFVLPLSHDEVVHGKGSLLGKMPGERAAQLAQLRLYYAFMWAHPGKKLLFMG
FT                   GEFGQQGEWNHDAMLQWSLLDDPAHRGLQRLIADLNHVYATLPELHCRDADPSGFAWIV
FT                   GDDADNSVLAFARVDASHCLVAVCNFTPVPRPGYRFGVPHAGDWRVRVDTGATRYGGAG
FT                   GGPPICLRSEPIPAHGHPQSLVLDLPGFTALYLRHSE"
FT   misc_feature    247600..247854
FT                   /note="HMMPfam hit to PF02922, DE Isoamylase N-terminal
FT                   domain, score 0.0054"
FT   misc_feature    247897..248175
FT                   /note="HMMPfam hit to PF02922, DE Isoamylase N-terminal
FT                   domain, score 5.8e-32"
FT   misc_feature    248281..249339
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 6.1e-08"
FT   CDS_pept        249716..251836
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BB2865"
FT                   /product="probable glycosyl hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1327"
FT                   /db_xref="GOA:A0A0H3LPU5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPU5"
FT                   /protein_id="CAE33357.1"
FT                   /translation="MYPSLPDRLLPGLPAPLGATSDGLGVNFAVFSANAARIELCLFDA
FT                   RGRKELARLPMPECTDEVWHGYLPDAQPGLVYGYRAHGPYNPRAGHRFNPHKLLLDPYA
FT                   TALTGALRWSDALFGYRMQHPRADLSMDRRDSAAGVPKAVVTEPAFHWGATRRPATAWA
FT                   HTVIYEAHVRGVSMLRSDLREPIRGTCAALADPRFIDHLHRLGVTALELMPVHAFLQDR
FT                   TLVERGLRNYWGYNTLAYFAPEPAYLADGQPHDLRRAIRRLHAAGIEVILDVVYNHTCE
FT                   GNELGPTLSWRGLDNASYYRLVPGDERRYIDDTGTGNTLNLSHPRVLQMVMDSLRHWTT
FT                   HYRVDGFRFDLGVTLGREGTGFDAGSGFFDALLQDPVLARVKLISEPWDVGPDGYQLGR
FT                   HPPGMAEWNDQFRDTARRFWRGDPGMAGALATRLTASRDVFDHRHRRPWSSINFAAAHD
FT                   GFTLQDVVSFAERHNEANGEDGADGHGENYSSNWGVEGAASSAVIRETRARVQRALLAT
FT                   VMLADGTPMLLAGDEFGNSQGGNNNAYCQDGPMGWLDWAVAQSTPGRALTAYAARLAGL
FT                   RRAHPSLRATRYGDPAHQWQEGLGAIDWFNGRGAPMTSADWDAPEGRLLVLRRALPDPA
FT                   QPGRVDVTLLLCNAAAEPRPCVLPAPTLAWTLALDSASPEAPAAPCDGGEAIVGARAVL
FT                   LLTASVDGAHAP"
FT   misc_feature    249755..250048
FT                   /note="HMMPfam hit to PF02922, DE Isoamylase N-terminal
FT                   domain, score 1.4e-25"
FT   misc_feature    250277..251446
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 2.8e-09"
FT   CDS_pept        251833..253587
FT                   /transl_table=11
FT                   /locus_tag="BB2866"
FT                   /product="probable alpha amylase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1326"
FT                   /db_xref="GOA:A0A0H3LWG1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWG1"
FT                   /protein_id="CAE33358.1"
FT                   /translation="MNEPAPHGATVCAPGKIRFRLWAPSAPPALALEIEGRAPIALRPG
FT                   PDGYAQAIVDGAPGLRYRYRLAADCAVPDPASRLQDGDVHGHSVVVGPDRYPWRHTGWR
FT                   GRPWQDSVIYEAHAGLCGGYAGLRRRLPEVARLGVTLLELMPIADFPGPRNWGYDGVLP
FT                   YAPDTAYGTPDELKALIDAAHGLQMGVMLDVVYNHFGPDGNYLHRYAADFFDARADTPW
FT                   GAAIDYRQQAVQRYFIDNALYWLREYRFDGLRLDAVHAMGRTDWLAGLAREARAACPDR
FT                   RVHLVVENDANQASLLAQGFDAQWNDDAHHVLHHLLTGERQGYYADYAQAPAALLARAL
FT                   GEGYVYQGQAAPTRGGRARGEPSAHLPPWAFVLFLHNHDQVGNRADGLRLTSLLAPGSP
FT                   ALRAAIALQLLAPHIPLLFMGEEYGSTAPFFYFTSHGPELAAAVRAGRAREFAASMHDC
FT                   DPPPDPNDPDTYRRSCPWPPPGAERQAWFEYYRELLRLRARLLGGRLTGARADGAAALG
FT                   PAAVRAAWRLGDGARLTLYANLLPGSVIVPAPPAGQLAYATLAGAGQDLAAGVLRGGCA
FT                   LALWEPAP"
FT   misc_feature    251842..252084
FT                   /note="HMMPfam hit to PF02922, DE Isoamylase N-terminal
FT                   domain, score 0.2"
FT   misc_feature    252166..253323
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 7.1e-12"
FT   CDS_pept        253584..255602
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /gene_synonym="malA"
FT                   /locus_tag="BB2867"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1324"
FT                   /db_xref="GOA:A0A0H3LNC3"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC3"
FT                   /protein_id="CAE33359.1"
FT                   /translation="MSENQALARLCALAGVSPRWTDVWGRTRDVAPPVLRAVLAALDLP
FT                   AATPAQTADTLARWRARPPAMLTARAGGMLRVPGDTATRYAIELDDGQVAHGLAEPDGA
FT                   GGLALRAPRQPGYHTLRLGSASIALAVAPPRAPTLARLLASPRPRRWGVAAQIYSLRGT
FT                   ADPDGGHGDFGALAELAVAAAGHGADAVALSPAHALFAAAPRRCSPYSPSTRLFLNILY
FT                   ADPLDTFSDAECAAARRPSSGADGPLIDWPQAAGARLAMLRRLHRGLAADDPRAAELAR
FT                   FRAEGGQALRDHALFEALHAANGATDWRGWPAAWRRPAAALAAGCAREHAREMDFHVFA
FT                   QWLARRSLAHAQAAARAAGMGVGLIADLAVGVDPAGSQTWAQPDAMLGGLNVGAAPDLR
FT                   HPGGQDWRLTACSPATLATQGYAAYIDMLRRALASAGGVRIDHVLGLARLWVIPEGAPP
FT                   DQGAYLAFPVEDLLRLAALEAWRHRAVLIGENLGTVPRDFNARLRAHGVLGMDVLWLQR
FT                   ETGPGGAGRFRPPGRWPASAVAMTSTHDLPTLRGWWQARDLDWCVPAHEADAQRRQRDQ
FT                   DRRALWRQAAPPGLAATAPPAEPPCAALLSHVARSRAPLMLVPLEDLAGLAEQPNVPGC
FT                   PDHPNWRRRMPATAAAMLAQPAARLALAAIAAHRGRP"
FT   misc_feature    254046..255581
FT                   /note="HMMPfam hit to PF02446, DE
FT                   4-alpha-glucanotransferase, score 1.9e-62"
FT   CDS_pept        255599..258142
FT                   /transl_table=11
FT                   /locus_tag="BB2868"
FT                   /product="probable alpha amylase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1323"
FT                   /db_xref="GOA:A0A0H3LNC5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC5"
FT                   /protein_id="CAE33360.1"
FT                   /translation="MIRATVRLQLHAGFTLDAAAAQLDYYDALGISHLYLSPVARARRG
FT                   STHGYDVIDHAQVNPELGGLAALRRLAGAARARGMGLILDIVPNHMAAHPDNRWWREVL
FT                   RDGPASAYADWFDIDWRPPGRTLRGRVLLPVLTCGARAALASGEIGLRAGSDGTPALHA
FT                   NGLDLPLAPASLPMAALLLHHGGTPAQWHALLRAQAYRLAWWRSAAQAINWRRFFEIGD
FT                   LVGVRVERPEVFDAVHALPLALYRAGLIDGLRIDHVDGLAEPGAYCRRLRAELAQAGQA
FT                   RAARGLSAEPYVVVEKILGDKETLRADWPVQGTTGYDFMNEASAWLHDARGAAPLAAFW
FT                   RDNAGTWPHWREQLRRIRLRLLRRHFGAERRALARSLADLPELRASAAAIDPVLTQWLA
FT                   CFPVYRTYAEGGAGQAADQAWRQTAQTRANAHLDPAQQALLAALCLALDGRMADAPHRL
FT                   ALRRLQQLTPPLAAKALEDTWFYRDGTLLSRNEVGAAPAQFALGGGALRRSVAARARRH
FT                   PQALLATASHDHKRGEDVRARLAVLSEMPQQWCDWARQWLADAGGSAAPPAWADRYMLL
FT                   QTLVGAWPADLAPDDQAGMAALLRRVAAWQAKALREARQRSSWTCPDLAYETLCARYLR
FT                   ALADDGAALPAVAALARRLAPAGLVNSLAQTALRLGLPGVPDLYQGCEMWDLSLVDPDN
FT                   RRAVDYAARRGALASLGNGALALPELWRDGRAKQALVARALQWRREQPALFEHGACRWL
FT                   RVSGARARHVLACLRTRGPQQALIVVPRASALALAGQTGPDRDAAAHWRDTCVHLPADA
FT                   PPWRDILTHAGHQGRALALSELLARWPVTLCRVQS"
FT   misc_feature    255623..256891
FT                   /note="HMMPfam hit to PF00128, DE Alpha amylase, catalytic
FT                   domain, score 2.6e-07"
FT   CDS_pept        complement(258133..261105)
FT                   /transl_table=11
FT                   /locus_tag="BB2869"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1322"
FT                   /db_xref="GOA:A0A0H3LU01"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU01"
FT                   /protein_id="CAE33361.1"
FT                   /translation="MLRKGDRVSSPWTNTLARLEDERVMLQRIAAGVPLTDVLLHVMQA
FT                   VEAQSSVELLTSIAFVDDSGMRLRHVATPSLPAAYVQATDGAAIGPGVASWGAAAFLGT
FT                   PVYVEDLTVHPNWPPWREAATQHGLRACWSTPIKATDGRTLGVFSNYYRQPRLPTREDI
FT                   EAIALVTRTAALAIERHLTEQALRNSSVRWRGMFERMQEGFFLAEAQRDSTGSVDDFTL
FT                   LEINPAFETQSGLAVGQTLGPMLRVMSPAAADSIMRIFVGVIESGEPAQFEVEAPGPPQ
FT                   ACYECRAGKEGHDRVAALFLNVTARKLAESELWERQYRKNFLLTLGDRMREIHQQDQIE
FT                   QMVCEELGRHLELGAVAVMESVPQRGDRIAASWGPRPPYDGRSMLESAPLTPDYYEAVR
FT                   KGRTAYLSPYLAGPAGNQQPSAIVVPLRRWGRADGTLLVRPDPTHPLKGTDIAFIEEAA
FT                   ERMCEAIERSQYARVLEQRVEHAIAERDRIWRLSPELLAVADHGGRLVSVNPAVRAILG
FT                   WSPEQFLAMGLDEGVHPEDLASMQATLEAEPAEGMQPVRHLESRLLHKDGSYHWITWSL
FT                   SRAEGNVYLAGRDDTDLKAQAEVLRQTEDALRQSQKLEAVGRLTGGIAHDFNNMLQGIS
FT                   GALYLIDRKLRRGKPEEVGKYVRTAQESTDRAARLTQRLLTFSRQQAIDPQVFDPGDIL
FT                   RSMDELFRRYTGEQVRLTLKLPAQSWRVRCDMNQFENAVLNLVINACDAMPAGGDLEIE
FT                   VAHRELDAAAVQTNPCAEAGEFVEVCVSDMGCGMAPDVLARVFEPFFTTKPMGQGTGLG
FT                   LSMIYGFAQQAGGMVTIASVQAEGTAVRLFLPRHVGEPVALPAPESSEPPAAPAHAAVV
FT                   ALVEDDEHVRDMVRAALEELNLTVLTAADGDAGHRLLQSDARIDLLLSDVGLPGMNGHA
FT                   LAQAARALRPALRIILMTGYADERENGWARQERDISLIRKPFSPGELTARVCRLLAASQ
FT                   D"
FT   misc_feature    complement(258139..258501)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 2.9e-17"
FT   misc_feature    complement(258568..258936)
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 2.5e-28"
FT   misc_feature    complement(259057..259263)
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 9e-09"
FT   misc_feature    complement(259465..259659)
FT                   /note="HMMPfam hit to PF00989, DE PAS domain, score 3e-07"
FT   misc_feature    complement(260575..260979)
FT                   /note="HMMPfam hit to PF01590, DE GAF domain, score 0.0019"
FT   CDS_pept        complement(261206..262060)
FT                   /transl_table=11
FT                   /gene="pdxK"
FT                   /locus_tag="BB2870"
FT                   /product="pyridoxine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1321"
FT                   /db_xref="GOA:Q7WII1"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023479"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WII1"
FT                   /protein_id="CAE33362.1"
FT                   /translation="MMKLAAPNPQALAPLPIDVVSIQSQVVYGQVGNSVAVPVFNGFGL
FT                   RVAAVPTVVLSNTPHYPSMHGGAVPLDWFEGYLADLGARGALAGVRVVQLGYLGGPAQA
FT                   EALGRWIAGLVAVRPDLRVHIDPVIGDHDSGVYVAPGMVAAYRDHLLPLAQGLTPNGFE
FT                   LECLTGLPTGTMEQTIAAARTLLGGRARWVIVTSAAPATWPPGRVRVAVVTHDDAQVLE
FT                   HAHVDTAPKGTGDMFGAALTGHLLAGQPVAEAARRAALQVIEALERTREAGCGELLLAG
FT                   PLR"
FT   CDS_pept        complement(262057..262872)
FT                   /transl_table=11
FT                   /locus_tag="BB2871"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1320"
FT                   /db_xref="GOA:A0A0H3LPV3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPV3"
FT                   /protein_id="CAE33363.1"
FT                   /translation="MHADTAQDAPDAAARYPRADSVADFEHNLAAVRARMAAACQRAGR
FT                   DPAGVRLLPVSKTVDEARIRMSYAAGCRELGENKVQEAYRKWEAMADLADLRWSVIGHL
FT                   QTNKAKLVARFAAEFQALDSVRLAEALERRLQAEGRALDVYVQVNTSGEASKYGLHPDE
FT                   AAAFIRQLPSYGALRVRGLMTLAVLSADAARVRQCFVLLRTLRDRLRQEAPAGVSLDEL
FT                   SMGMSGDYEIAIEEGATVVRVGQAIYGARALPNDYYWPDSGAADRAEDE"
FT   misc_feature    complement(262117..262794)
FT                   /note="HMMPfam hit to PF01168, DE Uncharacterized protein
FT                   family UPF0001, score 1.4e-53"
FT   CDS_pept        262932..264263
FT                   /transl_table=11
FT                   /locus_tag="BB2872"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1319"
FT                   /db_xref="GOA:A0A0H3LWG4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWG4"
FT                   /protein_id="CAE33364.1"
FT                   /translation="MSITGASAAEIFDSVRQLAQARRLLPGQALPPVRELAQTLGVNRN
FT                   TVAAAYKRLVGAGLALSQGRRGTIIRGPSEPGEQDGAHPGSPLIDLASGNPDPARLPDP
FT                   LAIMAGRASPPRLYGEATVDPRLQAYASQWYAGDCPAAFEVDLTHGAIDAIERLLGANL
FT                   AAGDTVAVEAPGFLGSINALRALGLRAEGVALDAAGMLPDALERALADGAQAVLLTPRA
FT                   QNPTGASLTRARARALRQVLQRYPHVMVIADDHFAHLSASPYHSPIPAAALRWALVRSV
FT                   SKALGPDLRLAFVASDPDTSRRLRLRLASGTTWVSHLLQDVVAGCLASAPVQARMAQAR
FT                   RAYAQRRAWLADALRAEGIAAQWPADGLNLWVPLAQDSPALLLELAHRGWRLRNGRSFG
FT                   VRQDVHGLRITIATLEHATARRLARDLRLCLDARDGLKKYPTLL"
FT   misc_feature    262962..263140
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 4.9e-13"
FT   misc_feature    263019..263093
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        264302..264808
FT                   /transl_table=11
FT                   /locus_tag="BB2873"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1318"
FT                   /db_xref="GOA:A0A0H3LNC7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC7"
FT                   /protein_id="CAE33365.1"
FT                   /translation="MGRLFSERPQMSRTSLSSLAPRPHRLLSLAWAATVLSLRVGMGIS
FT                   GLFCAWRYLVDLRPVRPLFDGVAAGATPLALYAAFEAGCAVLLMAGASTRIAAAGMTAA
FT                   HIAGVALALPAHGLWIPLPSALWLACLALLWCHGPGPCSVDACLHPAAIAPLSPPPDDP
FT                   AQRPI"
FT   misc_feature    join(264404..264463,264506..264574,264593..264661)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB2873 by TMHMM2.0 at aa 35-54, 69-91 and 98-120"
FT   CDS_pept        264849..265403
FT                   /transl_table=11
FT                   /locus_tag="BB2874"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1316"
FT                   /db_xref="GOA:A0A0H3LNC9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC9"
FT                   /protein_id="CAE33366.1"
FT                   /translation="MRAMSKFSRIGLAGVVGAALHAILANHLAPAVQQRLPIGRVSLTF
FT                   FLALLSALAAGAVLARLAPRARVAALAVAALAFLLLAAATTWLQQCTPAQLAAIDAATP
FT                   LGCNLGLYNRARAHLPPDGRPAELAPGVWFDRHGLSYACLPPEAQATHLRVALADYALA
FT                   LVGMSLGALLGARQRRRRDQD"
FT   misc_feature    264849..264914
FT                   /note="Signal peptide predicted for BB2874 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.919) with cleavage site
FT                   probability 0.361 between residues 22 and 23"
FT   misc_feature    join(264867..264935,264963..265031,265050..265118,
FT                   265305..265373)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2874 by TMHMM2.0 at aa 7-29, 39-61, 68-90 and 153-175"
FT   CDS_pept        265475..265900
FT                   /transl_table=11
FT                   /locus_tag="BB2875"
FT                   /product="universal stress family protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1315"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU06"
FT                   /protein_id="CAE33367.1"
FT                   /translation="MLKILVPVDGSECAVRAVREAIKVANDSKGAQLHLLNVQLPLISG
FT                   HAKMFLRHNELQSYYQAEGEAALATVLPVVAESGIPFESEMRTGQYGETIANYAKEKQC
FT                   DRIVMGTRGLGAVGGLLLGSVARKVIHLADVPITLVK"
FT   misc_feature    265475..265894
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00582, DE Universal stress protein
FT                   family, score 1.7e-08"
FT   CDS_pept        265933..266820
FT                   /transl_table=11
FT                   /locus_tag="BB2876"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1314"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPV5"
FT                   /protein_id="CAE33368.1"
FT                   /translation="MSRARFLRLAGAAALGLAAPRVPAAPSLLTRPVPADGSPLPVIGC
FT                   GTYIGFDVARPSAEYDALGEVVRTLFAAGGTVLDSSPMYGRAEAVTGRLLAEAGLRQRA
FT                   FVATKVWTSGRAAGLAQMQASLRQLGGERIDLMQIHNLLDWRTHLPVLREWQAAGRIRY
FT                   VGISHYTASAYDEVEAVLRAERLDFLQINYALDDRQAAQRLLPLAADRGVAVLVNRPFG
FT                   GGGLLRRLAGRPLPSWAADIGATSWAQVLLKFVLSHPAVTCAIPGTGRAAHMRDNLAAG
FT                   MAAPPPLSFWNDKA"
FT   misc_feature    265933..266004
FT                   /note="Signal peptide predicted for BB2876 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.792 between residues 24 and 25"
FT   misc_feature    266032..266799
FT                   /note="HMMPfam hit to PF00248, DE Aldo/keto reductase
FT                   family, score 1.1e-09"
FT   CDS_pept        complement(266823..267146)
FT                   /transl_table=11
FT                   /locus_tag="BB2877"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWG9"
FT                   /protein_id="CAE33369.1"
FT                   /translation="MIALPSLEQAAEVRVSRQGGVAFVPALVRTRRFELGACSATLRAQ
FT                   IDAALHSAAGQARDACGQGDQRYFRVEVHFGAGSRAEPLRFDVPEELAPHDLVWLWRSA
FT                   PAR"
FT   CDS_pept        complement(267143..268180)
FT                   /transl_table=11
FT                   /locus_tag="BB2878"
FT                   /product="putative metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1312"
FT                   /db_xref="GOA:A0A0H3LND4"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND4"
FT                   /protein_id="CAE33370.1"
FT                   /translation="MKRPTSKAARPSVVPPYLLDRLAQAADARLSARAVNTLRIDTSQR
FT                   AVRLAAPPAPASARPPGQVDRQVHDAGGGLQLPGALVRSEGQPAHADVAVNEAYDHLGA
FT                   TYALFWQAYGRHSLDGAGRALVASVHYGEEYDNAFWNGAQMVFGDGDGDVFNRFTIAVD
FT                   IVAHELTHGVIDHEGGLRYEGQSGALNESLCDVFGSLAKQHVAGQRADQADWLIGAGLF
FT                   TAKVRARALRSMAQPGSAYDDPLLGRDPQPGHMRDFVQTGEDNGGVHINSGIPNRAFHL
FT                   AATALGGHAWEVAGRIWYDTLRLPALTPQADFALFARLSVEQAGRHGAAQAAVRQAWTD
FT                   VGVLT"
FT   misc_feature    complement(267152..267649)
FT                   /note="HMMPfam hit to PF02868, DE Thermolysin
FT                   metallopeptidase, alpha-helical domain, score 2.7e-27"
FT   misc_feature    complement(267653..268180)
FT                   /note="HMMPfam hit to PF01447, DE Thermolysin
FT                   metallopeptidase, catalytic domain, score 3.6e-17"
FT   misc_feature    complement(267662..267691)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        268385..268789
FT                   /transl_table=11
FT                   /locus_tag="BB2879"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1311"
FT                   /db_xref="GOA:A0A0H3LND3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND3"
FT                   /protein_id="CAE33371.1"
FT                   /translation="MIKSDDAGKLILRLALGILVIMHGLAKLSSGVGGIAGMLSSHGLP
FT                   GFLAYFAYVGEIVGPLLIILGIYCRLGALLVVLNMVVAILLAHMGQLFSISNTGGWALE
FT                   LQGMFLFGALALAFMGAGRFSLAGSGGRWN"
FT   misc_feature    join(268403..268462,268520..268588,268601..268669,
FT                   268697..268765)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2879 by TMHMM2.0 at aa 7-26, 46-68, 73-95 and 105-127"
FT   CDS_pept        268971..270200
FT                   /transl_table=11
FT                   /locus_tag="BB2880"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1310"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU12"
FT                   /protein_id="CAE33372.1"
FT                   /translation="MHTAKAPLAALALALGVSTPPALAQVGYDPEPAYDEPAGADPAAA
FT                   NLAPVEVAREAPPPLPVYQQPPVPGDGYIWVPGYWALNALGFYWVPGVWMLAPYPGALW
FT                   TPGYWAYDAGYYRWRRGYWGRHIGFYGGINYGYGYIGFGYVGGYWNRDRFYYNRAVTNV
FT                   NITRVTHVYERRVVVQHIDRSRVGYHGGPRGIQRRADPREMAAARERHTPPTDMQRDHA
FT                   RQAGRDRAQFDGGARRGPARTALEHPLSERSRDQAAPAPGARGPAGQGRPGQDRAAGQG
FT                   GPRADDVSAPRRDARPSPDSVPRQAGARQENTRQENVRRNQSTPRQESAPRQHNAPRPE
FT                   RARPAEPRRDAGSPPERSSRPAPAPRAESRPQAERAASQPRAPGRQDGGGKAERGPGER
FT                   GNGGGRGRDG"
FT   misc_feature    268971..269042
FT                   /note="Signal peptide predicted for BB2880 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   misc_feature    join(269223..269291,269349..269417)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2880 by TMHMM2.0 at aa 85-107 and 127-149"
FT   CDS_pept        270293..270832
FT                   /transl_table=11
FT                   /locus_tag="BB2881"
FT                   /product="putative bacterioferritin comigratory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1307"
FT                   /db_xref="GOA:A0A0H3LPV9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPV9"
FT                   /protein_id="CAE33373.1"
FT                   /translation="MSRPALLLAALLSIAAPAAHAALPVGAPAPDFSAQASQGGNTFTF
FT                   ELAQALRQGPVVLYFYPAAFTQGCTIEARNFAEAIDQYRALGATVIGVSGDDIETLRKF
FT                   SVSECRGKFPVAADADGAIMKAYDAVHDRRPEYAQRISYVISPQGRIVYEFTDMSPDRH
FT                   VANTLQALRDWQARKK"
FT   misc_feature    270293..270355
FT                   /note="Signal peptide predicted for BB2881 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT   misc_feature    270365..270802
FT                   /note="HMMPfam hit to PF00578, DE AhpC/TSA family, score
FT                   2.2e-14"
FT   CDS_pept        complement(270939..271283)
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /gene_synonym="arsG"
FT                   /locus_tag="BB2882"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1306"
FT                   /db_xref="GOA:A0A0H3LWH4"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWH4"
FT                   /protein_id="CAE33374.1"
FT                   /translation="MSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAG
FT                   LIQQSGLSVREAVRAKEPIYQELGLDGVDDEGLLDAMVDNPILINRPFVVTERGARLCR
FT                   PAESVREILP"
FT   misc_feature    complement(270954..271232)
FT                   /note="HMMPfam hit to PF03960, DE ArsC family, score
FT                   6.2e-28"
FT   CDS_pept        complement(271341..272789)
FT                   /transl_table=11
FT                   /locus_tag="BB2883"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1305"
FT                   /db_xref="GOA:A0A0H3LND8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND8"
FT                   /protein_id="CAE33375.1"
FT                   /translation="MGNLKDLHPPVARGQAHTAKGARVALQNLWGAAGLPDEALDHVEL
FT                   HGAEPVLPSSFAVGTAAQASIAAAALAAAEIWHLRGGQRQRVAVDMRHAAQECRSYFKI
FT                   NGVTPNIWDKITGVYPCGDGGWVRIHANFPHHRDGALALLGCPPGEAATREMVERALAR
FT                   WRAGDFEQVAADAGMVVAAMRSFDQWDRHPQGLATASQPVVRIERIDNADPRPLPKYGH
FT                   EATPLQDIRVLDLTRIIAGPVCGRALAAYGADVMLINSPHLPNIDNIIDTSRGKLSVHA
FT                   DLETADGRIALGNLLRSAHVFVQGYRPGGLQALGFGPEDAARIRPGIVYVSLSAYGDSG
FT                   PWAGRRGFDSLVQTATGFNHAEAQAAGQEAPKAMPVQILDHASGYLMAFGALAALARQR
FT                   IEGGSWHVRVSLASTARWLRELGRVPDGLACPMPPIEELLYAEESGFGELTAVRHAAQF
FT                   SLTPARWTRPAMPPGSHPTVWPFR"
FT   misc_feature    complement(271443..271955)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   4.7e-09"
FT   CDS_pept        complement(272977..273312)
FT                   /transl_table=11
FT                   /locus_tag="BB2884"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1304"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND7"
FT                   /protein_id="CAE33376.1"
FT                   /translation="MQAMTERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAA
FT                   LDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAR
FT                   EDAQHGG"
FT   misc_feature    complement(273055..273156)
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 13"
FT   misc_feature    complement(273127..273150)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(273157..273258)
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 0.83"
FT   CDS_pept        273488..275080
FT                   /transl_table=11
FT                   /locus_tag="BB2885"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1303"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU17"
FT                   /protein_id="CAE33377.1"
FT                   /translation="MQEPTVPSIVLFPSWMKVWRRLACAALLAGAAASAPAAPAAAQAA
FT                   PAGPQRLAAQVDRVSWGVTPAELARAQRLSWTVYLQEQLRPRPAALPPAVQARIDALSI
FT                   TRVPARDALLAQRARTAKIRQIEDPARKLAASRENRMVSRQRANETMQRAVWLALYSPN
FT                   QLQEQMTWFWMNHFSVYAGKANVGTVLDAYEDQAIRPHALGKFRDLLAATARSPAMLIY
FT                   LDNIRNSAGHINENYARELLELHTLGVQGGYSQRDVQELARVLTGVGLNQTGEAPRVKP
FT                   AQREQLVEDGLFLFDPGRHDHGDKTVLGHTIRGGRGLAELDEALDLLARHPATARHVSR
FT                   KLAQYFVADQPPDALVQRMARAFQGSDGDIAATLAAMFESPEFEASLARGKFKDPAHYL
FT                   YSALRLAYDGREPLRNPDAALDWLKRMGQPLYQRLTPDGYPMNESDWAGSGQMTTRFEA
FT                   ARAIAAAPATFYRADRDDRPRVPPLPPLVQAYGAGAGPFSALSPATRRAIESAPNVRDA
FT                   NTYLLASPEFMRR"
FT   misc_feature    273488..273619
FT                   /note="Signal peptide predicted for BB2885 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.612 between residues 44 and 45"
FT   CDS_pept        275104..276282
FT                   /transl_table=11
FT                   /locus_tag="BB2886"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1302"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPW5"
FT                   /protein_id="CAE33378.1"
FT                   /translation="MHRRQLLKLAAAAPLTLYGTRLLAAGPPDTRLLVVFMRGAYDAAS
FT                   LLVPTTSEFYYESRPHIAIARDAAAALSDGWALHPAVKDSLLPFYQRGELAFVPFAGTD
FT                   DASRSHFETQNRIELGRAGGSGAAPASGFLNRLAAQLDGKAGRPAAFTEDVPQIFRGQA
FT                   RVPNIDLGGAKRKSRLTADSSSAIAQMYQGTGLDASVNEGLAAMGQARAALEAEMREAN
FT                   GGAGSTEKLEQEARRIGTFMAERYNLGFVDVGGWDTHVGQGAANGVLATKLGQLGRALA
FT                   AYAQAMGPAWRHTTVVVISEFGRTLRENGNKGTDHGHGSVYWVLGGGVRGGRIAGEQVA
FT                   VKRDTLFQDRDYPVLTDYRALFAGLFGRLYGLDAQRLQAVFPGARPLDLKLV"
FT   misc_feature    275104..275175
FT                   /note="Signal peptide predicted for BB2886 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.971 between residues 24 and 25"
FT   CDS_pept        276365..276865
FT                   /transl_table=11
FT                   /locus_tag="BB2887"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1301"
FT                   /db_xref="GOA:A0A0H3LWH9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWH9"
FT                   /protein_id="CAE33379.1"
FT                   /translation="MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGL
FT                   EELYRSYRNEGFVVLGFPCNQFGRQEPDDEAAIAQFCETQYAISFPLFAKIDVNGAHAH
FT                   PLYRWLKARKPGLLGTRAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPG
FT                   PTP"
FT   misc_feature    276371..276697
FT                   /note="HMMPfam hit to PF00255, DE Glutathione peroxidase,
FT                   score 2.4e-54"
FT   misc_feature    276542..276565
FT                   /note="PS00763 Glutathione peroxidases signature 2."
FT   CDS_pept        276891..277676
FT                   /transl_table=11
FT                   /locus_tag="BB2888"
FT                   /product="putative glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1300"
FT                   /db_xref="GOA:A0A0H3LNE3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE3"
FT                   /protein_id="CAE33380.1"
FT                   /translation="MDMARPRGATRYHDGCPPAPPGIRSGRAMIDLYYWTTPNGHKITL
FT                   FLEETGLPYRIHPVNISKGEQFQPEFLAIAPNNRIPAIVDQAPADGGAPIPLFESGAIL
FT                   LYLAEKTGQFIPADLRGRADVLQWLFWQMGGLGPMAGQNHHFSAYAPERIPYAIERYVK
FT                   ETNRLYGVLDRQLAQREFVAGDYSIADMAAYPWIVPHERQGQDLNEFPNLKRWFEAIGA
FT                   RPATQRAYALADRINTKPSVDTEESRRVLFGQTAANVRR"
FT   misc_feature    276975..277217
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 1.2e-14"
FT   misc_feature    277236..277562
FT                   /note="HMMPfam hit to PF00043, DE Glutathione
FT                   S-transferase, C-terminal domain, score 4.7e-10"
FT   CDS_pept        277688..278152
FT                   /transl_table=11
FT                   /locus_tag="BB2889"
FT                   /product="putative acetyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1299"
FT                   /db_xref="GOA:A0A0H3LNE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE1"
FT                   /protein_id="CAE33381.1"
FT                   /translation="MTATLSFRRAAATDLPAIIALLADDALGQQREDRTMPPQPAYLAA
FT                   FGAIDRDPNQFLAVVERAGQIIGCLQLSFIPGLSRRGLWRGQIESVRVAASERGAGTGR
FT                   ALFEWAIAQCRDKGCGLVQLTTDKQRADARRFYESLGFKATHEGMKLDLA"
FT   misc_feature    277859..278116
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 1.6e-18"
FT   CDS_pept        278149..278442
FT                   /transl_table=11
FT                   /locus_tag="BB2890"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU21"
FT                   /protein_id="CAE33382.1"
FT                   /translation="MKGIPAMHGEYKVPGGKLVVIDLEVAQGRLRQVRLSGDFFLEPPE
FT                   ALEAINRGLDGLPADAGAEGIAQAVRAALPAEAELFGFSPEAVAVVVQRALS"
FT   CDS_pept        278439..279215
FT                   /transl_table=11
FT                   /locus_tag="BB2891"
FT                   /product="putative lipoate-protein ligase A"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1297"
FT                   /db_xref="GOA:A0A0H3LPW9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPW9"
FT                   /protein_id="CAE33383.1"
FT                   /translation="MNRTAWTDYDWQLIHPGPLPPALHMALDAAITDEVGAGQRPPTLR
FT                   IWEWSQPAVIIGRFQSLRNEVDPDGARRHGVTVVRRVSGGGAMFVEPGNTITYSLSVPQ
FT                   ALVAGMSFQESYAFLDAWVIRALHELGIKAWYQPLNDIASDAGKIGGAAQARRAGAVLH
FT                   HVTMSYDIDADKMVEVLRIGREKLSDKGTTSARKRVDPLRSQTGLARDTIIERMLQTFA
FT                   GMCRLTPAEIGAATLQAAQRQAEEKFSSPEWTALVP"
FT   misc_feature    278592..278963
FT                   /note="HMMPfam hit to PF03099, DE Biotin/lipoate A/B
FT                   protein ligase family, score 2e-28"
FT   CDS_pept        279244..280071
FT                   /transl_table=11
FT                   /locus_tag="BB2892"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1296"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWI4"
FT                   /protein_id="CAE33384.1"
FT                   /translation="MKYRATALPPPRLKLLCAAGALALLAACGSAPPADITLAGAAPAA
FT                   AGAEPATIGDVRTERIQWASAKPGCTGECPRVEIDSVSFPGIPALSELVDRQLAAMTGV
FT                   DQNLRGRYQTLSEYTQYFWKTAQARDATYFKASVKDVVGDIVAVELGTTQFLTGAAHGI
FT                   PATHYLNWQRSQGRPLTLDEVLIPSRKAEYVVAMREAHQRWLAANEDAQRDRAAYDRMW
FT                   PFQETTNFALTRQGLVVKYDAYTIAPYSHGQPEILIPYERLRGVLRPEFIPAG"
FT   misc_feature    279244..279381
FT                   /note="Signal peptide predicted for BB2892 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.346 between residues 46 and 47"
FT   misc_feature    279295..279327
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        280197..280667
FT                   /transl_table=11
FT                   /locus_tag="BB2893"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE6"
FT                   /protein_id="CAE33385.1"
FT                   /translation="MTESARPTPATILLYTEEQRGNQWVESIVVGMLSDISGADKLVVI
FT                   KDPHSGIKFVYRVEHDCNNLDAAAITELDETHFDGKRTTAINGMNYRMGNPDSAMKLLR
FT                   AKPRWIQDKGAVLSVLLRNAAARSTSFVSRRIDRERLTRVPADVPVERLPQP"
FT   CDS_pept        280794..281687
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BB2894"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1294"
FT                   /db_xref="GOA:Q7WIF7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WIF7"
FT                   /protein_id="CAE33386.1"
FT                   /translation="MPFKDQLFLASQYLAPHHLVSRLMGRAADCRAPEIKNRMIARFVR
FT                   RYNVDMSEALVEDPLAYASFNDFFTRALKPDARPLDDEPGAALCPADGAISQIGAIDNG
FT                   RIFQAKGHSFGLTDLLGGDAERAAPFAGGQFATIYLSPRDYHRVHMPLAGTLREMVHVP
FT                   GRLFSVNPLTARSVPELFARNERVACLFDTEHGPMALVLVGAMIVASIETVWAGLVTPH
FT                   KRQVRSVRYDAAARAPIHLDKGAEMGRFKLGSTVIVLFGPKRLRWLDLPSVRGPVRMGE
FT                   TLALPASTAISFPESE"
FT   misc_feature    280986..281648
FT                   /note="HMMPfam hit to PF02666, DE Phosphatidylserine
FT                   decarboxylase, score 5.4e-80"
FT   CDS_pept        281772..282980
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /gene_synonym="lctD"
FT                   /locus_tag="BB2895"
FT                   /product="putative L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1293"
FT                   /db_xref="GOA:A0A0H3LNE5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNE5"
FT                   /protein_id="CAE33387.1"
FT                   /translation="MSSSALPLSAASAARAAAVPASLRKLLSLNDFEAAARRRLPRPIF
FT                   GYVAGAAEDNQAHDDNRRAFAEYGFLPRVLVDVSARHTRTELFGQEWAAPFGVAPMGIS
FT                   ALSAYRGDIVLARAARAAGIPAIMSGSSLIPLEEVARQAPGTWFQAYLPGDPARIDALV
FT                   ERVARAGYRTLVLTVDIPVSANRENNVRTGFSTPLKPGLRLAWDGLSRPRWLAGTFLRT
FT                   LLAHGMPRFENSFATRGAPILSANVLRDFSARDHLDWSHVQRIRRSWRGELVIKGIMHP
FT                   RDAALARAHGADGIIVSNHGGRQLDGACAPLRVLPDIAEAAGAMAVMMDSGIRRGGDVL
FT                   KALALGARFVFLGRPFNYAAAVGGEAGVAHAIGLLREEIDRNMAMLGVTRCTAMAPGLL
FT                   RRL"
FT   misc_feature    281772..281825
FT                   /note="Signal peptide predicted for BB2895 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.559 between residues 18 and 19"
FT   misc_feature    281877..282974
FT                   /note="HMMPfam hit to PF01070, DE FMN-dependent
FT                   dehydrogenase, score 3.8e-120"
FT   misc_feature    282663..282683
FT                   /note="PS00557 FMN-dependent alpha-hydroxy acid
FT                   dehydrogenases active site."
FT   CDS_pept        complement(282993..283808)
FT                   /transl_table=11
FT                   /locus_tag="BB2896"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1292"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU24"
FT                   /protein_id="CAE33388.1"
FT                   /translation="MRIRSGWMQWLGALALWCAVAGAGAAQQAPLRIGVIASVANEATE
FT                   IAIAQARAQGLEVKLIEFNDWVMPNIAAAEGSIDANFFQHEPFLQLFNRSRGTHLTPIA
FT                   YGYSTTIGLFSKKLKKGDAIPQGATIAVPNDPVNTGRALQLLASIGLIGLKPGAGHQAT
FT                   LQDVTDNPRRIKLVQLEGSQSARTFDDVTASVTYTTFAKHAGIDEKDGLAFDNTDPETV
FT                   RRYAIRWVATPERAQDPRLLAFIRIYQSSPEVKATLRRLYGELIDFPWE"
FT   misc_feature    complement(282999..283721)
FT                   /note="HMMPfam hit to PF03180, DE NLPA lipoprotein, score
FT                   2.2e-69"
FT   misc_feature    complement(283725..283808)
FT                   /note="Signal peptide predicted for BB2896 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.625 between residues 28 and 29"
FT   CDS_pept        complement(283942..284463)
FT                   /transl_table=11
FT                   /locus_tag="BB2897"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1291"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPX4"
FT                   /protein_id="CAE33389.1"
FT                   /translation="MSHVSLWRIATTAGKYRADDLSGAGAAAVGGRYNSPGTAVVYTSS
FT                   CVALAVLETVVHFAAPATAQANRYLIEIVVPRAVYEARQVLEVDALHKRHPFWDAVPFA
FT                   EVSQRIGDAWVRGNGSALLQLPSAIVPCRGVPDCNLLINPQHRDAASVRVARREKFIYD
FT                   PRLAPGGPRQ"
FT   CDS_pept        complement(284460..284957)
FT                   /transl_table=11
FT                   /locus_tag="BB2898"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1290"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWI9"
FT                   /protein_id="CAE33390.1"
FT                   /translation="MSIAIAEKSPARGAPKRRAPAARKRALEEEARVDSFADLVDSPLI
FT                   AMAHGVQRGLSPRLLDDAADYLQVPKSEIMAITEVKAASLSRWMRDGQALPLGESDRLA
FT                   RVARVTKVARQVLGGDAEAVQWLNTPVPALGNVKPLSLLTSDASSRIVEDTLARAAAGV
FT                   YA"
FT   CDS_pept        285105..285482
FT                   /transl_table=11
FT                   /locus_tag="BB2899"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1289"
FT                   /db_xref="GOA:A0A0H3LNF0"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF0"
FT                   /protein_id="CAE33391.1"
FT                   /translation="MTDRQLIVLAALNIMVAVGAGAFGAHGLRRVVDPTLLAIWHTGVL
FT                   YHLIHALGLFVVALLGARFGSPLLSMAGLVMFIGILLFCGSLYVLVLTGTRWLGAVTPL
FT                   GGVAFLAAWAMVAWAAWRAPA"
FT   misc_feature    285105..285164
FT                   /note="Signal peptide predicted for BB2899 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.888) with cleavage site
FT                   probability 0.250 between residues 20 and 21"
FT   misc_feature    join(285123..285191,285219..285287,285306..285374,
FT                   285402..285470)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2899 by TMHMM2.0 at aa 7-29, 39-61, 68-90 and 100-122"
FT   CDS_pept        285479..286363
FT                   /transl_table=11
FT                   /locus_tag="BB2900"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248)
FT                   BP1288+BP1269"
FT                   /db_xref="GOA:A0A0H3LNF3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF3"
FT                   /protein_id="CAE33392.1"
FT                   /translation="MIATANTRAASPLIGIACVAVGIFCLTLSDAQAKWLGERYSPVQI
FT                   LFLRALIAMPVVLALTASLGGRRALRTQYPLVHLVRGAINVISATFFYLGLQALPLAEN
FT                   AAIAFAAPLFVTALSVLVLKERVDAARWLAVAAGFAGVLVIVRPGSASFQAAALWPLAT
FT                   ALLYAVMMLTARAIGRGESMLTTMFYIVAGQLVCSAVAVAWFWTTPVWADLPFFAGVAL
FT                   FSTLGLTLITQGFRIGPASVVAPFDYTGLLWATLLGWLFWHETPDLLDCVGAAFIAGSG
FT                   LYIAWRATSRRRS"
FT   misc_feature    285479..285577
FT                   /note="Signal peptide predicted for BB2900 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.894) with cleavage site
FT                   probability 0.681 between residues 33 and 34"
FT   misc_feature    join(285497..285565,285608..285676,285713..285781,
FT                   285791..285844,285863..285931,285941..286009,
FT                   286028..286096,286124..286183,286196..286264,
FT                   286292..286345)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB2900 by TMHMM2.0 at aa 7-29, 44-66, 79-101, 105-122,
FT                   129-151, 155-177, 184-206, 216-235, 240-262 and 272-289"
FT   misc_feature    285548..285919
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 9.2e-17"
FT   misc_feature    285971..286336
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 2e-06"
FT   CDS_pept        complement(286376..287014)
FT                   /transl_table=11
FT                   /locus_tag="BB2901"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1270"
FT                   /db_xref="GOA:A0A0H3LU31"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU31"
FT                   /protein_id="CAE33393.1"
FT                   /translation="MSTYELIGSRGCGSAIVEMALALANVPYTLTDLPYLKPGPGRDRL
FT                   LSLNVTGQVPTLVLPDGEVMTESAAIVMHLHDVAPAAGLAPPPGSAERARFWNTLVRLV
FT                   AGVYATFTYGDDPAKWTLPGDAAELLRTRVHDRRAQLWQEIERGAGAPHVLGRRFSALD
FT                   LYVVVMTRWRPGPPWFQSVCPRLAAAARRAAEEPNVAQVLRRHFDPPLE"
FT   misc_feature    complement(286784..287014)
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 1.5e-08"
FT   CDS_pept        complement(287011..288183)
FT                   /transl_table=11
FT                   /locus_tag="BB2902"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1271"
FT                   /db_xref="GOA:A0A0H3LPX9"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPX9"
FT                   /protein_id="CAE33394.1"
FT                   /translation="MLRVLAATIMRHGVLPALLAALAAPATAAQVASEPTRADARVTEV
FT                   ADGLEHPWSLAFLPDGGMLITERPGRLRHLAPGGALSAPLQGVPKVAAQGQGGLLDVAL
FT                   SPDFARDRLVYLSYAEAGEDRSGTAVGRGRLSADLTRLDDFTVIFRQQPKLSRGQHYGA
FT                   RLVFDRQGFLFVALGENNDRPTAQDLDKLQGKVVRLHADGSVPADNPFVGHAGARPEIW
FT                   SYGHRNPQGMALNPWNGQLWEHEHGPRGGDEINVVVRGANYGWPLATHGINYSGLPIPE
FT                   AKGDTLPGGQEPRYWWRRSPAISGMAFYTSDRYPQWRGSLFIGALGSEELIRLQLDGER
FT                   VVAEERLLGERKARIRDVRQGPDGGIYVLTDAAKGALWRVAPAAVSGGGS"
FT   misc_feature    complement(288100..288183)
FT                   /note="Signal peptide predicted for BB2902 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.746 between residues 28 and 29"
FT   CDS_pept        288308..288922
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BB2903"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="GOA:A0A0H3LWJ2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWJ2"
FT                   /protein_id="CAE33395.1"
FT                   /translation="MKLYYMAGACSLAAHIVLEWIGKPYETHALSREALKEPAFLKINP
FT                   LGAVPALTEGDWALTQNAAILEYLAEQAPQLNLLGDGTARSRAEVRRWLGFINSDVHKT
FT                   FSAVFGPQRFVADAAAQEEVRASAAAMLRGLFGQLDTHLQGRSFLAGARPSIADAYLYV
FT                   VLRWAHGKQIDLSGQDNLAAFFERMQADPAVQAALKAEGLS"
FT   misc_feature    288308..288520
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 2e-09"
FT   misc_feature    288545..288883
FT                   /note="HMMPfam hit to PF00043, DE Glutathione
FT                   S-transferase, C-terminal domain, score 1.4e-08"
FT   CDS_pept        289039..289782
FT                   /transl_table=11
FT                   /locus_tag="BB2904"
FT                   /product="putative aspartate racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1272"
FT                   /db_xref="GOA:A0A0H3LNF5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF5"
FT                   /protein_id="CAE33396.1"
FT                   /translation="MTAPTQSCYLGVLGGMGPMAGAAFALRLAALTPAQSDQQHIPTLL
FT                   LNDPRIPDRSNARTQGGEDPLPAMIAGMRFLREAGARLIAIPCNTAHLWYEPLAAVAGC
FT                   TVLHIIEAVAQDLRRQGLHGGRIGLMGTSATLALGLYQQTLQRQGYSCIIPEPDEVERY
FT                   CMGSIRAVKANRLDLAYEPAAECIARLKARGADAVVLGCTELPLAVPHALRPGLGIRLT
FT                   DSIDALALAAIEHYEADQQAQKLVA"
FT   misc_feature    289039..289113
FT                   /note="Signal peptide predicted for BB2904 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.927) with cleavage site
FT                   probability 0.718 between residues 25 and 26"
FT   misc_feature    289057..289125
FT                   /note="1 probable transmembrane helix predicted for BB2904
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    289072..289749
FT                   /note="HMMPfam hit to PF01177, DE Asp/Glu/Hydontoin
FT                   racemase, score 8.5e-07"
FT   misc_feature    289291..289317
FT                   /note="PS00923 Aspartate and glutamate racemases signature
FT                   1."
FT   CDS_pept        complement(289900..290601)
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BB2905"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1273"
FT                   /db_xref="GOA:A0A0H3LNF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNF6"
FT                   /protein_id="CAE33397.1"
FT                   /translation="MLKLENIHTYYGAIQALNGVSVEVKQGEIVTLIGANGAGKTTLLM
FT                   TVCGNPRAREGVITFEGKDITHAETHHIMRSGIAISPEGRRVFKDLTVAENLMMGGFFS
FT                   RREEVDAGLEHVYTLFPRLKERAGQRAGTMSGGEQQMLAIGRALMTQPRLLLLDEPTLG
FT                   LAPLIIAQIFDIIRTIREQGVTVFLVEQNANKALQVADRGYVLENGRVVLHDTGANLLV
FT                   NDQVRKAYLGG"
FT   misc_feature    complement(289975..290523)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   6.1e-56"
FT   misc_feature    complement(290158..290202)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(290479..290502)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(290602..291369)
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="BB2906"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1274"
FT                   /db_xref="GOA:A0A0H3LU37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU37"
FT                   /protein_id="CAE33398.1"
FT                   /translation="MSETLLKVSGLTMRFGGLLAVDSVAFEVRRDEVFAIIGPNGAGKT
FT                   TVFNCVGGFYKPTAGEIVMDGKPITGMPSHKVARHGLVRTFQNVRLFKQLTVLENLLVA
FT                   QHTQVEARLLPGLLKLKSYRQAEAEALTRAAQWLDFMGLREFANREAGNLAYGHQRRLE
FT                   IARCMITKPRLLMLDEPAAGLNPQEKRDLQSLIDQLRREFGVAVLLIEHDMSLIMGISD
FT                   RILVMEHGKPITTGIPDEVRNDPRVIKAYLGEE"
FT   misc_feature    complement(290680..291279)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   4.5e-59"
FT   misc_feature    complement(291235..291258)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(291366..292604)
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="BB2907"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1275"
FT                   /db_xref="GOA:A0A0H3LPY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPY3"
FT                   /protein_id="CAE33399.1"
FT                   /translation="MTQQSPLKNATIAAVMTAVIVTPIFGLQLVRQGARTLMEPRWDLV
FT                   ALACALVFAFQLLRPWISKPFKALKTGLPTLPSAPARGHKWLVVLLIAVAVIWPFFSGR
FT                   SSVDIATLVLIYVMLGLGLNIVVGFAGLLDLGFVGFYAVGAYTYALLYHWGGWSFWEAL
FT                   PFSGAVAALFGFVLGFPVLRLRGDYLAIVTLGFGEIIRLLLINLNMLTGGPDGISGLPK
FT                   PSVLGMEMARRASTEGGQTFHEIMGWTFQNQHMVIYLYLMALALALATLFVSTRLIRMP
FT                   VGRAWEALREDEIACRSLGLNPTRIKLSAFTLGAMFAGFGGAFFAARQGMVNPESFTFI
FT                   ESALILAIVVLGGMGSQIGVILAAILLTVLPELAREFAEYRMLMFGLVMVLMMMWRPQG
FT                   LLPMKRPHVELRK"
FT   misc_feature    complement(291390..292409)
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 4.6e-56"
FT   misc_feature    complement(join(291420..291476,291510..291578,
FT                   291621..291689,291771..291839,291990..292043,
FT                   292062..292121,292134..292202,292206..292274,
FT                   292302..292355,292416..292475,292518..292586))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB2907 by TMHMM2.0 at aa 7-29, 44-63, 84-101, 111-133,
FT                   135-157, 162-181, 188-205, 256-278, 306-328, 343-365 and
FT                   377-395"
FT   CDS_pept        complement(292604..293530)
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="BB2908"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1276"
FT                   /db_xref="GOA:A0A0H3LWJ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWJ7"
FT                   /protein_id="CAE33400.1"
FT                   /translation="MSDLIPQLTQQFFNGLSLGAIYALIAIGYTMVYGIIGMINFAHGE
FT                   IYMIGAYVGLVTLTAIGTNSGLPLPFIIAAMLVVAIFVTGVYGYSVERVAYRPVRGSPR
FT                   LVALISAIGMSIFLQNWVALGQGARDMAVPALVSGAVQFHMGSSFDVTVPYSRIMIIVV
FT                   TVVLMVALTLFIKYSRMGRASRACSQDMHMANLLGIDTNRVISFTFVLGAMLAAVGGVL
FT                   IAITIGKLNPFIGFLAGIKAFTAAVLGGIGSIPGAMLGGVLLGLAETFAAAYISSQYKD
FT                   IVAFALLVLILLFRPTGLLGKPEVEKV"
FT   misc_feature    complement(292619..293509)
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 2.9e-69"
FT   misc_feature    complement(join(292634..292687,292736..292804,
FT                   292847..292915,293006..293074,293162..293230,
FT                   293264..293332,293342..293401,293420..293488))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB2908 by TMHMM2.0 at aa 15-37, 44-63, 67-89, 101-123,
FT                   153-175, 206-228, 243-265 and 282-299"
FT   CDS_pept        complement(293633..294748)
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="BB2909"
FT                   /product="leu/ile/val-binding protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1277"
FT                   /db_xref="GOA:A0A0H3LNG0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG0"
FT                   /protein_id="CAE33401.1"
FT                   /translation="MKFSQRFTPLAVALGALAFAGAVHAADTIKIGIPQPMTGPNTQYG
FT                   DQIQAGALTAIETINAKGGVKGKKLEPILIDDGCEPKQAVPAANRVVNSGAKFAVAHAC
FT                   SGVTVAAVNVYEQEGIVAITPGATSPLVTDTIKPHFFFRTIGRDDQQGPFAARYIANTI
FT                   KPKKVAVLHDKQTYGSGVATQVKDTLERNKVNVALFEGINVGDSDYSAIITKLKSAGVD
FT                   FVYFGGYHPELGLLLRQAREQGLNVQFMGPEGTANQDLVAIAGPAIDGLLVTLPSDFTK
FT                   LPGNEGVVKAFQDAKRDPDGAFQMPAYAAVQLLAESINAVGEDPAKVADHLHKNTFNTA
FT                   IGKVEYDAKGDLKDFEFAVFKWDKNGKKTQL"
FT   misc_feature    complement(293639..294685)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01094, DE Receptor family ligand
FT                   binding region, score 2.4e-27"
FT   misc_feature    complement(294662..294730)
FT                   /note="1 probable transmembrane helix predicted for BB2909
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(294674..294748)
FT                   /note="Signal peptide predicted for BB2909 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   CDS_pept        complement(295019..295600)
FT                   /transl_table=11
FT                   /locus_tag="BB2910"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1279"
FT                   /db_xref="GOA:A0A0H3LNG2"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG2"
FT                   /protein_id="CAE33402.1"
FT                   /translation="MSSASRRYEPLRSGPFLLAVFCMGLVVVGSNILVQVPLNDWLTWG
FT                   GLSYPVAFLVTDVLNRRYGPDAARRVAWFGFAAALAVSVWVASPRIALASGLAYLCAQL
FT                   IDIRVFDRLRDQRWWRAPLISGVIGAVADTAVFFSVAFAGSDTPWVTWMLGDLAIKLAV
FT                   NISMLAPFRALMWNLARPAEARPAQASTGR"
FT   misc_feature    complement(295064..295570)
FT                   /note="HMMPfam hit to PF02592, DE Uncharacterized ACR, YhhQ
FT                   family COG1738, score 5.8e-06"
FT   misc_feature    complement(join(295088..295156,295169..295237,
FT                   295322..295390,295496..295564))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2910 by TMHMM2.0 at aa 13-35, 71-93, 122-144 and 149-171"
FT   misc_feature    complement(295514..295600)
FT                   /note="Signal peptide predicted for BB2910 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.617) with cleavage site
FT                   probability 0.287 between residues 29 and 30"
FT   CDS_pept        complement(295597..296430)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BB2911"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1280"
FT                   /db_xref="GOA:A0A0H3LU43"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU43"
FT                   /protein_id="CAE33403.1"
FT                   /translation="MKNDLSIAFIGGGNMAAALASGLAGKVCPAANIHVVDINADSHAG
FT                   WRARGMSAAAAPDATLAGCRVWVYAVKPQHMREAVAGTRPWLRPDTLIVSVAAGIRADT
FT                   LAGWLGEPGQPWQRLVRCMPNTPALVGAGMTGLAALPGVTPQDRELAGQLLTSVGEVVW
FT                   VDGDAGLDAVTALSGSGPAYVFLFIEALIAGGRAVGLTDEQARQLALGTLAGATRLAAQ
FT                   SDEPPAVLRERVTSKGGTTAAALDVYAQGDFAGLVERAMQAAARRSRELAEEFGR"
FT   misc_feature    complement(295663..296418)
FT                   /note="HMMPfam hit to PF01089, DE Delta
FT                   1-pyrroline-5-carboxylate reductase, score 2.1e-76"
FT   misc_feature    complement(296371..296430)
FT                   /note="Signal peptide predicted for BB2911 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.967 between residues 20 and 21"
FT   CDS_pept        296641..297954
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="BB2912"
FT                   /product="glycerol-3-phosphate-binding periplasmic protein
FT                   precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1281"
FT                   /db_xref="GOA:A0A0H3LPY8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPY8"
FT                   /protein_id="CAE33404.1"
FT                   /translation="MRSQRLALTFAAVMAAFAGASAHAATEIQFWHSMEGALGDRVNGL
FT                   VEEFNKQNADYQIKAVYKGNYGESMNAGIAAFRAGNAPDILQVFEVGTATMMYAKGAIK
FT                   PVQQMSEEVGDPIDPKQFIGAVAGYYSSPEGKLVSMPFNSSTVVFYYNKDAFKKAGLDA
FT                   DKPPKTWEELAAAGQKLKAAGQECGYTTSWPSWVQLETFSAWHNVPYATKDNGFAGLDA
FT                   RLAVDTPLHVRHLDNLAKLAKEGIFMYGGRGDEPNSLFISGKCAMITGSSGLRANIAKN
FT                   AKFEFGTSTLPYYSDVQGAPQNTIIGGASLWVFANKKPETYKGVTKFFKFLASPEIAAR
FT                   WHQQTGYVPVTKAAYELTQKQGFYDKNPGTDVGVKQLNVETTAQSRGLRLGYLPQIREI
FT                   EDAEIERIVAGKVPAKDGLQSIVKRGNELLEKFEKSVK"
FT   misc_feature    296641..296712
FT                   /note="Signal peptide predicted for BB2912 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 24 and 25"
FT   misc_feature    296740..297897
FT                   /note="HMMPfam hit to PF01547, DE Bacterial extracellular
FT                   solute-binding protein, score 2.5e-46"
FT   misc_feature    297061..297114
FT                   /note="PS01037 Bacterial extracellular solute-binding
FT                   proteins, family 1 signature."
FT   misc_feature    297232..297261
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT   CDS_pept        298131..299012
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="BB2913"
FT                   /product="sn-glycerol-3-phosphate transport system,
FT                   permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1282"
FT                   /db_xref="GOA:A0A0H3LWK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWK2"
FT                   /protein_id="CAE33405.1"
FT                   /translation="MEKRVVFGHKTLPYLLLAPQIIITIVFFFLPAGQAMWQSLRLEDA
FT                   FGLSSEFVGLANFADLFSQQSYLDSFRVTAVFSALVAFVGLAVSLLLAVMADRVLRGAG
FT                   LYKTLLIWPYAVAPAVVGVLWLFLFSPSVGILAVALNGMGVNWNPRLDGDQALILVLIA
FT                   AVWKQISYNFLFFLAGLQSIPRSLIEAAAIDGASPARRFWTIVFPLLSPTTFFLLVVNI
FT                   IYAFFDTFAVIDTTTQGGPGTATSILVYKVYSDGFRGLDLGSSAAQSVVLMAIVVALTV
FT                   LQFRYIDRKVQY"
FT   misc_feature    join(298164..298232,298350..298418,298455..298550,
FT                   298593..298661,298743..298811,298923..298991)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2913 by TMHMM2.0 at aa 12-34, 74-96, 109-140, 155-177,
FT                   205-227 and 265-287"
FT   misc_feature    298665..298892
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 4.4e-17"
FT   misc_feature    298668..298754
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        299032..299883
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="BB2914"
FT                   /product="sn-glycerol-3-phosphate transport system permease
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1283"
FT                   /db_xref="GOA:A0A0H3LNG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG6"
FT                   /protein_id="CAE33406.1"
FT                   /translation="MVERRPWLDILAHFILLCGVALVAFPIYVTFVASTQTAQEVASAP
FT                   MSLIPGKHFVDNYMQALFAGSGGGSYGAPVGRMMYVSLIMALAISLGKIAISLLSAFAV
FT                   VYFRFPGRMFFFWMIFVTLMLPVEVRIAPTYKVVADLGLLNSYAGLTLPLIASATATFL
FT                   FRQFFLTVPDELVEAARIDGAGPMRFFRDVLLPLSRTSIAALFVIQFIYGWNQYLWPLL
FT                   ITTQEDMYPVVIGIKRMISGGDSVTEWNITMATAILAMIPPALVVILMQKWFVKGLVDT
FT                   EK"
FT   misc_feature    299032..299145
FT                   /note="Signal peptide predicted for BB2914 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.750) with cleavage site
FT                   probability 0.409 between residues 38 and 39"
FT   misc_feature    join(299050..299118,299281..299349,299368..299427,
FT                   299470..299538,299599..299667,299770..299838)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB2914 by TMHMM2.0 at aa 7-29, 84-106, 113-132, 147-169,
FT                   190-212 and 247-269"
FT   misc_feature    299530..299766
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.8e-17"
FT   misc_feature    299533..299619
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        299936..301024
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="BB2915"
FT                   /product="sn-glycerol-3-phosphate transport ATP-binding
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1284"
FT                   /db_xref="GOA:Q7WID6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WID6"
FT                   /protein_id="CAE33407.1"
FT                   /translation="MATLSFRNVKKTYAGNVPVIHGIDMDVADGEFIVIVGPSGCGKST
FT                   LMRMVAGLETVTEGEILIDDKVVNTLEPAERDIAMVFQNYALYPHMSVFDNMAYGLKIR
FT                   RLPKDEIRKRVEAAAQILELGKLLDRRPRALSGGQRQRVAMGRAIVREPKVFLFDEPLS
FT                   NLDAKLRVAMRLEILKLHRRLNTTSLYVTHDQVEAMTLAHRMVVMYQGVPEQIGTPMEV
FT                   FEKPASTFVAGFIGSPPMNLLEVAVGGDGIVHTSDGIALDISPLAVPQQVRGRKVVMGL
FT                   RPEHMLLNAQGLAAEIEMIETLGSEQLVHGRCGKHMVVVRCSTRQFSETPARVGDTLTI
FT                   GPDGRHPLHWFEADTGRRVEGL"
FT   misc_feature    300023..300568
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   4.5e-66"
FT   misc_feature    300044..300067
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    300338..300382
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(301180..302307)
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="BB2916"
FT                   /product="leu/ile/val-binding protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1285"
FT                   /db_xref="GOA:A0A0H3LNG7"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNG7"
FT                   /protein_id="CAE33408.1"
FT                   /translation="MNKAFRFTPVIAALGMAAGIAMSAGAHAQTIKIAVVGPTTGQVTQ
FT                   YGDMVREGVDTAIERINATGGVNGKKLEAVVIDDGCEPKQGPVAANRVVNDKIGFVVGH
FT                   VCSGATIAATEIYNNEGVVMVTPSATSPAVTDGKNYEFIFRTIGRDDQQGPAAAKFILE
FT                   KIKPKTVAVIHDKQSYGQGIATAVKDTLEKNGTKVVIFEGINAGDSDYSAVITKLKAAK
FT                   VDFVYYGGYHPEMGLLLRQGAEQGLDAKFMGPEGVGNPDINAIAGPAVEGMLLTLPADF
FT                   TLNPANAEIVKAFKDKKRDASGAFQLTAYAATQVIADGIKGAGSEDPTKVAQYLHANSF
FT                   QTPIGKTSWNKQGDLNAFEFEVFTWHKDGSKTSYK"
FT   misc_feature    complement(301186..302232)
FT                   /note="HMMPfam hit to PF01094, DE Receptor family ligand
FT                   binding region, score 4.9e-28"
FT   misc_feature    complement(302224..302307)
FT                   /note="Signal peptide predicted for BB2916 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 28 and 29"
FT   CDS_pept        302542..303153
FT                   /transl_table=11
FT                   /locus_tag="BB2917"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1286"
FT                   /db_xref="GOA:A0A0H3LU52"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU52"
FT                   /protein_id="CAE33409.1"
FT                   /translation="MRLQPIIVPGWQGSGPGHWQTHWSRTLPHAVRLQQRDWHQPQRAE
FT                   WVAALAAAVDAAPTPVLLVAHSLGCLVSAALPIALRAKVAGALLVAPADVERPGAPAAI
FT                   AAFGPVPRQSLPYQSVVIASDDDPYCRLERARQFAQDWGSRLVVLQGAGHINADSQLGA
FT                   WPQGLKQLAALRRRACWRISPPAEKIPPVPAGIMVPPRYG"
FT   CDS_pept        303704..311287
FT                   /transl_table=11
FT                   /gene="wcbR"
FT                   /locus_tag="BB2918"
FT                   /product="putative type I polyketide synthase"
FT                   /db_xref="GOA:A0A0H3LPZ5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPZ5"
FT                   /protein_id="CAE33410.1"
FT                   /translation="MAKRIAVIGLSFRFPRTNTADYWRDLLQGKDLVSQVDESRWSSDA
FT                   YFHPQRDHPGTAYTRSAGSLGDISGFDADFFGISPREAALMDPQQRLLLELCWEGFENA
FT                   GLRPSRVRGSDCGVYIGIASADYAYRLADDLEVVDASIATGNTSSIAANRLSYVFDLRG
FT                   PSMAVDTACSSSLVAFHQACRAIAAGDATMAVAGGVSLHLHPYGFVTFSKASMLSPRGR
FT                   CRVFDASADGYVRAEGGGLFILKDYDAALADGDPILAVVAGTAVNTDGRKSGLTVPSAD
FT                   AQARLLSQAYAQAGIDPRQIDYLEAHGTGTPVGDPIETRAIGMALGRQRAAHAPLPIGS
FT                   VKSNQGHLEAASGVAGLVKALYCLRHREVPATIGVDEINPNIDCAAWNIDIVRQRRALP
FT                   ERGTLTVGVNSFGFGGANAHVILQTPPDEPHAPLATLATTSAIPLVISGKQPAALKAAA
FT                   RDMARHLRSQPSRALYDIAYQAALRRDWHEERAVVYGATSEAIAQALTALADESGPRRL
FT                   VASGRAVPAAQGPVFVYSGNGSQWAGMGERLMHNPVFAEAVHEIDAYFHPLAGYLLGDA
FT                   LRAAPGDCRYDSTEYAQPALFAMQVGMTRMLNQRGIVAHAVAGHSVGEVAAAWASGALT
FT                   LADAVQVIFHRSRLQGLTRGRGAMTAVGVDGGAALALIAELGLSRVLCVAGHNSSRGAT
FT                   IAGNPDALAVLENALRERRAFQRRLDLDYAFHSPAMDGISGALHEALAGLTPGEAEIPF
FT                   YSTVAGACMAGAALDANYWWRNVRQPVRFDQAMAALIEQGENIFVEIGPHPVVRGYIND
FT                   ALKQANVEGRVIVTATRGEDDPQRVHDAAGQVVASGAAPQWQTLFPWPGRHVELPAYAW
FT                   QRERHWHPLTPSGIGLLERRRVHPLLGYPLRQHESTWENQLDCSTHPALADHVVGQAVV
FT                   FPGAGFAEMALAAAQARHEDGEYVELEDLEIHAPLLLAAGAAKVTRCAVDPQDGRWHVR
FT                   ARDQGSDGAWTTHATARILSEPGAALLGERAPALPERPADFDAASHLALTESVGLSYGP
FT                   AFRAVERGWLQDDGDIVAQLRMPEPIATELAAHHLHPAVFDSVLQLIIHWFRDDAQRDS
FT                   GLTYVPARIGRLAWRRAAGPVHSARVRLLRRNPHSLMAEFALFDARGKQIAHAREARFR
FT                   SIRLRKGAGEALDFLHYVGVPRPHPHTDAPPPLQVADGERAILQAIDADSLKRYAYEVD
FT                   PLLDSLCRQFTCEALHALADDDGLLSAATVTRCREAADGGAPLLEQLLRQAQEDGQLDA
FT                   TPSGWRLRAADPQEPRATDIWNALVREYPEHFRVAQAVGRVGLSLPALLRGERTLDEVH
FT                   PPALTPGSLTAQLLPAGQQRRLGQHIAGWLATAVAQLRGDARLRVLECGADGPAFGLDY
FT                   YQALDDDRIDCVYRSSRSAAIDEAERLRERCPDLSVQAIDHTEPPAGRFDLAILHANWP
FT                   TLDEARQALGHVRHCLAPGGVLLLLANQPTAWLDFIFGARGQWWSASVAGEATPALQPA
FT                   AFWRRELQALGCACEPAADFLPDTRSGPYLLAATVATVADGDSGDTVDAPPARRWLLLA
FT                   DAADAAVARPLAAQLRAAGQQVITAGDAPEDDAGLALWLQEAAKSGPVDGVIHAAGLAA
FT                   TAHIDAAAMLRHQVRRCALAAATLQAGPPLADAPLWLLTRGAAQHLAGDDAVAPAADSA
FT                   LWGYGRTLMNESNAVRMLDLPRNMADLPLDALTRELLWPDTEQELVLAAGGSRYAPRLR
FT                   LAQPPAPRADCPAQAPQDAAAVQLGFELPGQLRALAWRHAPLPAPAGGQLEVAVAATGL
FT                   NFRDVMYALGMLSDEAIENGFAGPTLGLEFAGTVTRAGAQVQGYAAGDAVVGFGPASFG
FT                   DRVLTTPAAVARVPAGMSLEAAATIPSTFFTAYYALHHLAQLEPGEKVLIHGAAGGVGI
FT                   AAIQYAQWRGAEIHASAGTPDKRDFLRLLGVQHVYDSRTLSYADEVLANTGGAGVDVVL
FT                   NSLAGEAIHRNLVVLKPFGRFLELGKRDFYENTRIGLRPFRNNISYFGIDADQLMARRP
FT                   ALTQRLFADMMALFEAGALHPLPYTVFHADQVVDAFRHMQQARQIGKIVVAGMDEVRPA
FT                   PATAARPDAALALDPRASYLVTGGLGGFGLRTAQWLADKGARHLVLASRRGATEPDTLA
FT                   ALAALRRQGVAVHAVACDVTDRAALAALLAGIAAETPLRGIVHAAMVIDDALVRNTDAA
FT                   RIERVLAPKLLGAQHLDALTAGLALDFFVCFSSATTLFGNPGQSNYVAANAWLEAFCRA
FT                   RRERGLPATCVAWGALDDVGYLARNVKVKDALAGRMGGQALRSDVALQALEDILLADRS
FT                   DLGVLELDWNALARFLPSAASPKFGDVARRRAQAGGPDLNDEDIRHLAATLDDAALQAR
FT                   LVEILKAEVGEILRVPMDRLDASRSVYDMGLDSLMGVELMVALENRCGLKLPVMALSES
FT                   PTIEQLAERLVALLRGESDMPADATAAQVRQVAAQHAADVPADSLAEFAADLDATAPRQ
FT                   KMIH"
FT   misc_feature    303704..333455
FT                   /note="locus encoding proteins involved in the biosynthesis
FT                   and export of capsular polysaccharide"
FT   misc_feature    303707..304450
FT                   /note="HMMPfam hit to PF00109, DE Beta-ketoacyl synthase,
FT                   N-terminal domain, score 5.7e-107"
FT   misc_feature    304190..304240
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT   misc_feature    304475..304981
FT                   /note="HMMPfam hit to PF02801, DE Beta-ketoacyl synthase,
FT                   C-terminal domain, score 9.6e-75"
FT   misc_feature    305291..306256
FT                   /note="HMMPfam hit to PF00698, DE Acyl transferase domain,
FT                   score 3e-79"
FT   misc_feature    307406..307426
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   misc_feature    309056..310012
FT                   /note="HMMPfam hit to PF00107, DE Zinc-binding
FT                   dehydrogenase, score 1.7e-66"
FT   misc_feature    310925..311125
FT                   /note="HMMPfam hit to PF00550, DE Phosphopantetheine
FT                   attachment site, score 1.1e-13"
FT   CDS_pept        311284..312636
FT                   /transl_table=11
FT                   /gene="wcbT"
FT                   /locus_tag="BB2919"
FT                   /product="putative polyketide synthase"
FT                   /db_xref="GOA:A0A0H3LWK8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWK8"
FT                   /protein_id="CAE33411.1"
FT                   /translation="MNPMTHSKTLPGLAAGIKQKLIQQALQRKLRNAAPATASPLAAGA
FT                   RVAVGDAHCRFDQHPAYQQLRIINDGAARLGIDSPFFKLHEGSAGATTRIDGQPYLNFA
FT                   SYNYLGLSGDARVNEAAKQAIDRYGTSVSASRVVSGERPVHRELERELARLYEVDDAVV
FT                   FVSGHATNVSTIGHLFGANDLVLHDEYIHNSVLQGIQLAGARRLSFPHNDWAALDALLN
FT                   EQRGHFERVLIVLEGIYSMDGDYPDLPRFIEVKRRHRAFLMVDEAHSLGVMGARGRGIR
FT                   EHFDLAGNDVDIWMGTLSKTLAGCGGYIAGEHALVEHLKFLAPGFLYSVGMPPAVAAAA
FT                   LAALARMREMPERVATLQARGRDFLRQARARGIDTGSSSGLAVIPAIVGNSIKAARLSA
FT                   ALFARGINVQPILYPAVPEQSARLRFFMSAQHSEADIRQAVDTLAEEIDRA"
FT   misc_feature    311689..312612
FT                   /note="HMMPfam hit to PF00155, DE Aminotransferase class I
FT                   and II, score 9.8e-17"
FT   CDS_pept        complement(312633..314189)
FT                   /transl_table=11
FT                   /gene="wcbQ"
FT                   /locus_tag="BB2920"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1654"
FT                   /db_xref="GOA:A0A0H3LNH2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH2"
FT                   /protein_id="CAE33412.1"
FT                   /translation="MAETFWLALAPAWAGGLVLSWALEALLRPPVQPPWRRPAWTLLLH
FT                   AGVWTLLFALELALFRRPYFGAINVLAIEAVLVLVSAAKARVLREPFVYSDFEYFTDAL
FT                   RHPRLYLPFLGWPAALLLACGYGLALWAGLALEPSATGARTAAWAAHAAPAPFWGATLA
FT                   LAAAGAALAVLAGHRDAGLTYEADQDLRRLGLVATLWLYGRAERQPWTPAMRSGPFGAA
FT                   PAAAGAGPLPHLVSVQSESFFDARRVFGTLKPEVLAGLDALRAEALEHGQLEVAAWGAN
FT                   TVRTEFAFLTGLAASALGVHRYNPYRRLRQPQPSLASHLRQRGYRTVCVHPFHASFYGR
FT                   DRVMPWLGFDEFVHLDAFADAPRAGPYVADAALARYVAERLAGQGSQPLYVHVITMENH
FT                   GPLHWESVDAADAAAVLDGPLAPGCADLVAYARHLRNADAMFTGLAAAMRGLSRPAGLC
FT                   VYGDHVPIMAEVYRRLGEPDGRTDYLIWQAGGQGGAAPGLRRVDELAQVFLRHMGLAPP
FT                   G"
FT   misc_feature    complement(join(313659..313727,313785..313853,
FT                   313929..313997,314010..314078,314121..314177))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB2920 by TMHMM2.0 at aa 5-23, 38-60, 65-87, 113-135 and
FT                   155-177"
FT   misc_feature    complement(314124..314189)
FT                   /note="Signal peptide predicted for BB2920 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.701) with cleavage site
FT                   probability 0.627 between residues 22 and 23"
FT   CDS_pept        complement(314182..314955)
FT                   /transl_table=11
FT                   /gene="wcbP"
FT                   /locus_tag="BB2921"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1655"
FT                   /db_xref="GOA:A0A0H3LNH0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH0"
FT                   /protein_id="CAE33413.1"
FT                   /translation="MRSNWPACVLLTGASGEIGRALALEYAAPGVRLILQGRRLGRLDE
FT                   LAGLCRERGATLSVAAFDIRATERLLAWLEEVNATHPPDLAIINAGVNIDIGPDRAGER
FT                   WEDVCMVMDTNLRAAQATVHGLLPAMRARGQGQIALMSSLAAWRGLPDTPSYSASKAAV
FT                   KAYGEALRDWLAPQGVRVNVIMPGYVASPMCAAMPGPKPFLWPPGKAARAIRRGLAANR
FT                   ARISFPFPLNLGCWFLGLAHPAVSSRLLRWLGYGG"
FT   misc_feature    complement(314188..314943)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 3.4e-23"
FT   misc_feature    complement(314443..314529)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    complement(314887..314955)
FT                   /note="Signal peptide predicted for BB2921 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.970) with cleavage site
FT                   probability 0.957 between residues 23 and 24"
FT   CDS_pept        complement(314952..316172)
FT                   /transl_table=11
FT                   /gene="wcbO"
FT                   /gene_synonym="kpsS"
FT                   /locus_tag="BB2922"
FT                   /product="capsular polysaccharide export protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1632"
FT                   /db_xref="GOA:A0A0H3LU59"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU59"
FT                   /protein_id="CAE33414.1"
FT                   /translation="MSASFLFLQGVCSPFFDRLGRALRERGHAVRRVNYTVGDAAYWRG
FT                   GQAYAYRGAAQACGDFYAELLERHAVSDIVLFGDRRPVHRPAVALARASGVRVHVFEEG
FT                   YFRPHWVTLERGGVNAHSSLPRDPAWYRASAARVPQASPRAFRSPFWLRAWHDVAYHAC
FT                   NAWNPLLFPRYRTHAPHGAAREYAAYVRRALRLRARRAEDARAMADLAARRARFFLLPL
FT                   QLDSDAQIRDHSPYGDMREVQDAVMASFARHAPPDCLLVVKNHPLDPGFVDQRRVTAET
FT                   ARRHGLQRRVRYLETGHLPGLLAHAAGVVTVNSTVGSAALAAGCATLALSQPIYAMPGL
FT                   TCQHTLDDFWRDPTPPQAALFAAFQAVVIHATQVNGGFYCAPGIDLAVANAVGRLTAPR
FT                   SALEELL"
FT   misc_feature    complement(315198..315230)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(316186..318243)
FT                   /transl_table=11
FT                   /gene="wcbA"
FT                   /gene_synonym="kpsC"
FT                   /gene_synonym="lipA"
FT                   /locus_tag="BB2923"
FT                   /product="capsular polysaccharide export protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1631"
FT                   /db_xref="GOA:A0A0H3LPZ8"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LPZ8"
FT                   /protein_id="CAE33415.1"
FT                   /translation="MIELHSSGIARIPYLTELLGAPVTRYRRFWPPGGAAPRAVAGWGA
FT                   RPSAAPARRRARSLGVPYIALEDGFLRSFGTGRHFPPLSLVVDRLGIYYDATRESELEC
FT                   LLASSRTLLDGIEDAVPEAMELVRERRLSKYNQGGFLATGVPADGRRRVLVVDQTEGDM
FT                   SVTLGCAEAATFEAMLAAARAENPGALICVKTHPEVAAGDKSGYLSRVTDDADTVALRH
FT                   DMNPLALLEQMDRVYVVSSQMGFEALMLDKPVTCFGMPWYAGWGVTDDRQRCERRGRAR
FT                   SVEELFAGAYFHYTRYLDPVLHRRGTIFDVIDWLTRQRDMAQRLPSRVIGVGMRRWKAA
FT                   ALAPILALKPGQAVFAADAARARDLRPAAGDALVHWGARAPAGVAELAEQSGCAVLAVE
FT                   DGFLRSVGLGSDLIRPLSLALDGRGIYFDPRQPSDLEHELNRGGFSPGELASAARIRAL
FT                   VVAHGITKYNVAQPQPADWPARGREIVLVPGQVEDDASVRLGCDEVRTNLDLLAAARAA
FT                   HPDAYIVYKPHPDVVSRNRRGRVALREARRHADHVESALSVVSCIQACDVVHTMTSLTG
FT                   FDALLRGKRVVTYGKPFYAGWGLTEDRAADWPRGRRTRRLSLDELVAGTLLRYPLYWDW
FT                   ELRGYTTCEAVLTHIFETRERLQREGRLQGLRAGYARRQVRKLQTLWLAR"
FT   CDS_pept        complement(318240..319265)
FT                   /transl_table=11
FT                   /gene="wbpP"
FT                   /gene_synonym="vipB"
FT                   /gene_synonym="tviC"
FT                   /locus_tag="BB2924"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1630"
FT                   /db_xref="GOA:A0A0H3LWL2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWL2"
FT                   /protein_id="CAE33416.1"
FT                   /translation="MTTRYEDLRATLPRAPEKWLVTGCAGFIGSNLLETLLGLDQAVVG
FT                   LDNFATGHQHNLDEVRAAVTPEQWARFTFIEGDIRDLAACQRAVQGVDRVLHQAALGSV
FT                   PRSLKDPITTNEVNIGGFLNMLVAARDAQVQAFVYAASSSTYGDHPDLPKVEDRIGNPL
FT                   SPYAVTKYVNELYADVFARSYGFSSVGLRYFNVFGKRQDPDGAYAAVIPKWTAAMIKGE
FT                   DVVINGDGQTSRDFCFVENAVQANLLAAMAAPEGANQVYNVAYNARTTLTELFEHLRRA
FT                   LAGQGVSYEKAPVYAEFRAGDVRHSQADIGKAGKLLGYEPAYDILRGLEAAMPWYKQFL
FT                   R"
FT   misc_feature    complement(318246..319211)
FT                   /note="HMMPfam hit to PF01370, DE NAD dependent
FT                   epimerase/dehydratase family, score 5.7e-116"
FT   CDS_pept        complement(319279..320568)
FT                   /transl_table=11
FT                   /gene="wbpO"
FT                   /locus_tag="BB2925"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1629"
FT                   /db_xref="GOA:A0A0H3LNH6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH6"
FT                   /protein_id="CAE33417.1"
FT                   /translation="MPKKFSNPADVHLAVVGLGYVGLPLAVEFGKKRPVIGFDINERRI
FT                   AALKAGHDHTLEVEDDELAQAGQLSYTAEREELGKANVFIVTVPTPIDEYKQPDLTPLV
FT                   KASETIGAVLKRGDIVIYESTVYPGATEEDCVPVLERVSGLKFNQDFYAGYSPERINPG
FT                   DKAHRVNTIKKVTSGSTPEVAELVDQLYNEIITAGTHKASSIRVAEAAKVIENTQRDVN
FT                   IALINELALIFNKMGIDTEAVLQAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQAIG
FT                   YHPEIILAGRRLNDSMGGYVVSQLVKAMAKRRIHVEGARVLLMGLTFKENCPDLRNTRV
FT                   VDIVRELGEYHVDVDVYDPWVDPAEAEHEYGITPVAKPAAGAYDAVILAVSHHQFVEMG
FT                   AEAIRKFGKAEHILYDLKYVLPPEQADLRL"
FT   misc_feature    complement(319321..319605)
FT                   /note="HMMPfam hit to PF03720, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain, score 2.8e-31"
FT   misc_feature    complement(319672..319956)
FT                   /note="HMMPfam hit to PF00984, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, central domain, score 2e-43"
FT   misc_feature    complement(319981..320538)
FT                   /note="HMMPfam hit to PF03721, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, NAD binding domain, score 2.8e-71"
FT   CDS_pept        complement(320591..321688)
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /gene_synonym="wcbC"
FT                   /locus_tag="BB2926"
FT                   /product="putative capsular polysaccharide export protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1628"
FT                   /db_xref="GOA:A0A0H3LNH7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNH7"
FT                   /protein_id="CAE33418.1"
FT                   /translation="MNHRLIRCLSIALLALLSGCSILSGSGPTRSAIMDGGSTDATGAK
FT                   PGSYDLVDLRADTIAPYVLVKAVSKDGATSDGYVGNMRVMPGDVLRILVADSMETGLFA
FT                   PLAAGGTVFEAVRVAADGSISLPYAGRLKVQGKSLAQIEQLVKGSLRNTAAVQPQVMVD
FT                   LADDRSNSVLVAGAVPRPGRFGGNKGPLTALDAITQAGGSTLPAYQADVVIRTGSKVQR
FT                   IPYQQLLNGRNVAVEPRSELVVEPNLKRFVAMGALTKPGLHELPSNQTNLLDALGVAGG
FT                   LNDRAADATGVFVFRLDGRNADGRPRPTVFRLNMRNPESMFLAKQFELLPEDVVYVSNA
FT                   PMYEWEKIITPIVQVLIVGQRVGTY"
FT   misc_feature    complement(320597..321685)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02563, DE Polysaccharide
FT                   biosynthesis/export protein, score 7.6e-06"
FT   misc_feature    complement(321404..321433)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   misc_feature    complement(321596..321688)
FT                   /note="Signal peptide predicted for BB2926 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.533 between residues 31 and 32"
FT   misc_feature    complement(321608..321676)
FT                   /note="1 probable transmembrane helix predicted for BB2926
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(321629..321661)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(321685..322575)
FT                   /transl_table=11
FT                   /gene="vipC"
FT                   /locus_tag="BB2927"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU64"
FT                   /protein_id="CAE33419.1"
FT                   /translation="MTMPPKLFVLGSCRVHRPARLLHDGGLVQPLTAGISGYIHSTREA
FT                   VQRVQWLADRTRPDSQLLPFMFPAGRTPVVTPARADELAQADAVLVEAASERSVSVNGV
FT                   FLQKNLVVKHLVRELGDEGRNWWRSLVRAGEVAPEAYEAVAGLYRDQAEETVLAGGLRV
FT                   LREARCAEDSEAVVRADLMYLALRLGKPVLVVTHVDAERADGRRIAARVRHVARIKAAA
FT                   RGLHQVHVIDPLDAAPDWPSARLLASDGADMNHYSPEFEPVLAGYMHTRIRAALAASSG
FT                   ALAPSQFLPEYQDGP"
FT   CDS_pept        complement(322572..324656)
FT                   /transl_table=11
FT                   /gene="wbpT"
FT                   /locus_tag="BB2928"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1626"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQ02"
FT                   /protein_id="CAE33420.1"
FT                   /translation="MFSFLSRIRKPRRADTAAGPTGGPASGPTILDLLEAALAEPGESE
FT                   EAGRELLQQARQVLERHAAVHKPAAALPELLDYVRRYPHTELFQVLVARALEAAHRSDE
FT                   GLAVWRGIHQRFPDSSEAFILMLRGVKRQQGIEAGRAEIELYFSGGSSSAREILLEAKS
FT                   WDEIGQSEQADACFERLSRQHPEFENGYVGWAQSLTRRGALWRARDVLQAGLDAIGDGA
FT                   RKLTRRLVDLNADLAALRRLGVEGDGRDVPVSILVLEKMLQEIGRRRNAEYDAGPESFV
FT                   GPVLMINGSLGAGGAERQFVNTAVALQSAIQQGQSIAGYGVLGPVQVVCRSLRSREGAD
FT                   FFAATLHDAGIPVSVYSDMQAWGGCEFSSLLAPYREYLRFLPKQIIEGTTKLTDVMRSS
FT                   VPSVVHIWQDGSIFACALAALLAGVPRIVLSVRTMPPVDRPDRYRVEYDIIYSELLKMR
FT                   GVALSSNSQFAAHRYADWLGVDERRIPVVYNGLAPLKSVQDDACTAMMAQFDARTSDAR
FT                   FTVGTVMRVDDNKRPFLWVEAAQRFAASHPHVRFIMVGGGPLLESVREFAQRLGMGERI
FT                   LFTGLSRRVGYWLTQFNAFLLLSRFEGLPNVLIEAQFSGVPVVTTLAGGAGEAVQEGVT
FT                   GLTLPADTVTAPDVAEALARIHDMCAADPGIARKAADWASARFSLNQMIASTVRCYQMP
FT                   "
FT   misc_feature    complement(322638..323147)
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 8.3e-19"
FT   CDS_pept        complement(324688..325857)
FT                   /transl_table=11
FT                   /gene="wcbD"
FT                   /gene_synonym="kpsE"
FT                   /locus_tag="BB2929"
FT                   /product="capsule polysaccharide export inner-membrane
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1625"
FT                   /db_xref="GOA:A0A0H3LWL5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWL5"
FT                   /protein_id="CAE33421.1"
FT                   /translation="MTSTEKTYTGPRLPGMTPGKPANYLRWSAIALIGIPGVLLALYLF
FT                   FIASDQYVSEARFGLRAGSQMQQASANRDGHSSMGSGAMATELFVDSFAVVDYVKSRQI
FT                   VQELDKELNLREMWSKPMIDFWYGMNQDETEEGLWRQWNRMVDIEFDMSTGAIILRVRA
FT                   FSPEESLQLAQAILQASEKLVNQMSAKSREDSVDFARVEVGIAEKRLAQARVQVQDLRA
FT                   RTGVLDPVKEAEANLQLAAKVRGDVATAAAELDAMGRGGLRSGPAYERVKARHEALMRQ
FT                   LKDLNDHQISGGRSENGNTLSKLLREYESAETERQFAEAYYTGALKTLEDARGLAARQV
FT                   LYTVIASQPQLADESLYPRRFTDTALGLLGLFILWIVAVLVVYAVKDHA"
FT   misc_feature    complement(join(324703..324762,325717..325785))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB2929 by TMHMM2.0 at aa 25-47 and 366-385"
FT   CDS_pept        complement(325899..326636)
FT                   /transl_table=11
FT                   /gene="kpsT"
FT                   /locus_tag="BB2930"
FT                   /product="polysialic acid transport ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1624"
FT                   /db_xref="GOA:A0A0H3LNI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI1"
FT                   /protein_id="CAE33422.1"
FT                   /translation="MMETAMDQDTIISLRNVCKGYRSKKGIRRILDDVSFDFRGGENLA
FT                   ILGGNGSGKSVLLRMICGMELPDSGTVQRAVSISYPLGFAGGISSNMTGRDNVRFIARI
FT                   YGCDVPDVERFVYDFSELGRSFDLPVVTYANSMRARLSYGISMALRCDVYVVDEMAAVG
FT                   DVNFKRKCLEVFAERSRGATIIMAANAPTTVRRFCSHGVIMQHGAMAHYGPLDETIARY
FT                   TQSAPAPAAEAEPAVDTVDAEQS"
FT   misc_feature    complement(326016..326516)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.5e-10"
FT   misc_feature    complement(326472..326495)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(326633..327403)
FT                   /transl_table=11
FT                   /gene="kpsM"
FT                   /locus_tag="BB2931"
FT                   /product="putative polysialic acid transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1623"
FT                   /db_xref="GOA:A0A0H3LNI2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI2"
FT                   /protein_id="CAE33423.1"
FT                   /translation="MSSALTVQARVIGSLIFRETRVRFGGTRLGYLWALIEPILHVAVL
FT                   STIYVVWGRQAPVGNLQMFFITGIMPFFLFSHTSSRLARSISSNASLLRLPPITNMDIV
FT                   FAKALLQALTWVAVFAILLFLVMLGGKLILPQRLEECAAAALFTFLLGFGVGLINAVLN
FT                   MLFKSWEHLYSALTRPLYLLSGVFYLVDALPEQARRVLVWNPLVHAIEWFRAGYFTHFS
FT                   SLTLDRGYLIKWAVGSVVLGLCLERAMRRRLHTR"
FT   misc_feature    complement(326642..327400)
FT                   /note="HMMPfam hit to PF01061, DE ABC-2 type transporter,
FT                   score 3.7e-38"
FT   misc_feature    complement(326762..326875)
FT                   /note="PS00890 ABC-2 type transport system integral
FT                   membrane proteins signature."
FT   misc_feature    complement(join(326915..326983,327026..327094,
FT                   327155..327223,327251..327319))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB2931 by TMHMM2.0 at aa 29-51, 61-83, 104-126 and 141-163"
FT   CDS_pept        327728..329041
FT                   /transl_table=11
FT                   /locus_tag="BB2932"
FT                   /product="putative glycosyl transferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1620"
FT                   /db_xref="GOA:A0A0H3LU70"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU70"
FT                   /protein_id="CAE33424.1"
FT                   /translation="MLRTALLNIYQKRVQALTSRLPLAQLLARAADNPALLNRLGLFQS
FT                   AAAVPARGAEQGLCRARAALECSHAARRPDPARLRARVSDHARRQYALTLARHDPESAR
FT                   QWLAPTDWELDLALDLAAGRADLALHKARKSASNISKSKNLHEILAAAHTCLGDFSAAR
FT                   NNLSQLLTDSRISVPPGDTPLRPADFIGLAPISPRPVAAGAPLISVIICARDAAPYINN
FT                   ALQSIQAQTYPNIEIIAIDDGSTDNTFQHLSAAAAQNPRINIARTKNHGVYAARNMALQ
FT                   RAKGEFITFLDADDIMLATRLQDQAALLQASGACAAVSRLLRLTADGQLAAPRVFPFVR
FT                   HNPCSLMIRRDALAVIGQFEEMRFGADEEYEHRMQVLLGFHSIARSRAVQTVALHRPQS
FT                   LTQHGATGLGSDQGRQRRIAYRETWMRRHASLAPLRTP"
FT   misc_feature    327728..327817
FT                   /note="Signal peptide predicted for BB2932 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.691) with cleavage site
FT                   probability 0.670 between residues 30 and 31"
FT   misc_feature    328349..328798
FT                   /note="HMMPfam hit to PF00535, DE Glycosyl transferase,
FT                   score 3.6e-33"
FT   misc_feature    328640..328672
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        329068..331152
FT                   /transl_table=11
FT                   /locus_tag="BB2933"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQ06"
FT                   /protein_id="CAE33425.1"
FT                   /translation="MEHDNNTVRHMPAPAARRAAAPDRLRQLTQENELAYSRLEQERAA
FT                   RVQAEKDLAGVKALLRETNQQLAKQRRTLTWQFGEAVTRARTLKDYVLLPYRLIKLSED
FT                   HRRQSRHAPVVRKHASAALPAETASAIKEALEYVKRVRSPEVILWIGRQPWPAEVRAKV
FT                   FCEVAKWARTSYPQIAEQIVQQLLGLDPAAPHVRQLAFSLYDAGIVDASAQLLRAARTA
FT                   GATFSTAERLRAERIEHAQGILAQSIEPAARGDYTFDFDAQGPIVILSPVSILQGRNAA
FT                   SNALHRFALSMQARYGDTMVISLAAQHAESADAAPGQQADAALHARTGLVVDGVAYRHA
FT                   PAISRQTPSFQDVCAAMAETVLAATVRQQPRAVLAWDDAYCALGASAAAQTLRVPYGLV
FT                   LQSLDFFQKTAANHLLSERARVDLNLLTLAARQADLLALGSPALQGALENLLDGSRPVA
FT                   LVPPLPLPPMNHRKEAPPDLAATLRRLEGKRVFAVTEDEPAVATARALIDLYAEISFVQ
FT                   PDAVLLVMSNGKAAAAMRHHAVAIGLQEGQVVFAPPASDAISREQLLRRVEIALFPYVD
FT                   NRAEVSLVPSAAALLECMALGVCPAVGPAPAYAAHVEAGRNGVPIDLNAPAAETAAHLQ
FT                   QVLGEAGELGKRARESVQRDLPWHDYDEAIGALLLQAATPQPHIPGRRAEPQLLHLKVS
FT                   "
FT   CDS_pept        331290..333458
FT                   /transl_table=11
FT                   /gene="tviD"
FT                   /locus_tag="BB2934"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248)
FT                   BP1618+BP1617"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWL9"
FT                   /protein_id="CAE33426.1"
FT                   /translation="MIISTIGSCRVAGPVTKLQAQRSFVLDNRLLYGFTHNTKETIQAI
FT                   RFMRGELRLPESLWPFISDQPFRNGNSTPPPQGAHYVVEISSVKVLELDGLYLQLVRFK
FT                   EALSVCPDLRKIFFDHPGADQRGQRLQLLQATPSFARLATHIQHALTHTVVRSQTAAEI
FT                   EEDLHAIAQLLGPKLVLVTHCNAKNATGELIAERAKMVARVAQAAARLGLVSVDPGALL
FT                   AGFGQERGMPDEGLDTAHYTPAFAKLVGKEISDKLLGPAITDDAADSLHNLDFRACMER
FT                   SKQSAQAHEWDLALLFANRAIELKPGSGSAYVLRARAVTALDQTEDMLEAWSLALATDS
FT                   NRTPYVLRQAAEAAFYMRDHERAREWAEASLQKEDDDKTALLLGRIYTRLGMNTQAEQV
FT                   FRRCAASDPARSLRFAARAHTPLADAASMVNALTTTPAADPGSVDGVRQTVLKRATREV
FT                   RHAGRAGALLPSLGAFYAVRTLPSEHGAAHDADLINQAYRRLLRAYEDTPEYQNSDEAI
FT                   ALLADLAALPEVDPRYIQRAAKMLHAHGRKQAAAKCWEHLAGAELPAGRDTVALAASKL
FT                   SQLEAHRTAASVYRRLANSGAMDTATAQEYIDKCLRALARSVRACITEERLRDAEQALA
FT                   SIREIDPGYAGLTSLQRSLSEAHKREFRSQRAQEATPADLMASAQRIIEASPLDRDANI
FT                   ELAVQNLRTGNLSESRRILERFLQSAPA"
FT   CDS_pept        complement(333597..334097)
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="BB2935"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1616"
FT                   /db_xref="GOA:A0A0H3LNI6"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI6"
FT                   /protein_id="CAE33427.1"
FT                   /translation="MAKPTKNSSAAPRINIGISDKDRAAITGELSKLLADSYTLYLMTH
FT                   NFHWNVTGPLFNTLHNMFMAQYTEEWNALDSIAERIRALGHYAPGTYREYAKLSSIAEP
FT                   DSVPDALEMVRMLVKGNEAVAKTARAAFDKADAANDQPTADLLTQRLDVHEKNAWMLRS
FT                   LLQ"
FT   misc_feature    complement(333603..334031)
FT                   /note="HMMPfam hit to PF00210, DE Ferritin-like domain,
FT                   score 8.9e-29"
FT   misc_feature    complement(333834..333878)
FT                   /note="PS00819 Dps protein family signature 2."
FT   CDS_pept        complement(334196..335710)
FT                   /transl_table=11
FT                   /locus_tag="BB2936"
FT                   /product="probable probable aldehyde dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1615"
FT                   /db_xref="GOA:A0A0H3LNI7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNI7"
FT                   /protein_id="CAE33428.1"
FT                   /translation="MANQTAQVAHWIGGQAAYGAEHGLQDIHDPATGEVAAQVGLGGGD
FT                   TVAQAVAAARAAQPAWAAKSPLHRARVLNRFLALLEDNKETLARMISREHGKVISDARG
FT                   EVMRGIEVVEFACGAPELMKGAMSINVGGGIDNWVQREPLGVVAGITPFNFPVMVPLWM
FT                   MPMALATGNAFVLKPSPLDASPSLALAEMLGQAGLPAGVASVVQGGVQAVNALIDHPDV
FT                   KAVSFVGSTAVARQIYERSAREGKRVQALGGAKNHLVVMPDADPEGAADALVGAAFGSA
FT                   GERCMAISVAVFVGGAAEAVMPHILRKARALKVRRGMQEDAEMGAIVSAAARDRIAAYI
FT                   ASGVDEGASLLLDGREIAAADCGEGCGNGYWLGPTVFDRVQPSMRIYREEIFGPVLACV
FT                   HVETLEQAIDLINGHDFANGVSLYTDSGTAARAFVQGIEVGMVGVNVPIPVPAAWQGFG
FT                   GWKQSLFGDLHVYGEEGVRFYTRQKSVMQRWAAKAAGMSFAMPRSG"
FT   misc_feature    complement(334244..335662)
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 3.3e-147"
FT   misc_feature    complement(334844..334879)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        335848..336735
FT                   /transl_table=11
FT                   /locus_tag="BB2937"
FT                   /product="probable LysR family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1614"
FT                   /db_xref="GOA:A0A0H3LU75"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU75"
FT                   /protein_id="CAE33429.1"
FT                   /translation="MLAVLADTRSFTAAAQRLGVSKSLISLRMKALEQELGVSLLLRTT
FT                   RSVHPTEAGALLVERARPALDTLEDSLGEVRNLARAPRGRLRLTAPVALGRQHLGIWLA
FT                   RLGQHFPDIALEVYLSDRFVNLRQEGYDFALRHADQVSDAYVSKRLCATRAHLVASPAY
FT                   LARHGRPAHPSELARHRCLLYRGDERSPQWSFAPRQGRGAAVHVKPVDCLSVNNSELLR
FT                   ESAAHGLGIAMVPDFSLGDCADLEPVLPQWDCYAGFGRSLYLLKPFSATPTEAHRVVEQ
FT                   ALAEHFRPGFATPA"
FT   misc_feature    335848..336012
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.5e-14"
FT   misc_feature    336082..336711
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2e-34"
FT   CDS_pept        complement(336750..337703)
FT                   /transl_table=11
FT                   /locus_tag="BB2938"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1613"
FT                   /db_xref="GOA:A0A0H3LQ07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQ07"
FT                   /protein_id="CAE33430.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIRKLEDELGV
FT                   TLFERGGTEVGVTPIGQRIVAQAQKVLEESASIKEIARQGHDPLAGPLRVGVIHTIGPY
FT                   LLPRLVPEQIARTPQMPLLLQENFTVRLVELLRQGEIDCAIMALPLPEAGLVMQPLYDE
FT                   PFVVAVPHDHEWAQRKAIDAQDLKQQTMLLLGSGHCFRDQVLEVCPELSRFSASSDGIQ
FT                   RTFEGSSLETIRHMVAAGIGVTVLPFTAVPNPPQPKSLLRYLPFDGETPERRVVLAWRR
FT                   SFPRLAAIEALAQAVYACGLPGVRMLDEEAASAQVD"
FT   misc_feature    complement(336810..337448)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.1e-52"
FT   misc_feature    complement(337518..337697)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.6e-24"
FT   misc_feature    complement(337563..337655)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        complement(337755..339746)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BB2939"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1612"
FT                   /db_xref="GOA:A0A0H3LWM2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWM2"
FT                   /protein_id="CAE33431.1"
FT                   /translation="MVVPEDFVLHLPLRYEDETRVTPVSSLRPGFAAQVEGEILRSEVL
FT                   YRPRRQLTAVLADDSGELQLRWLNFYPSQQKQLTVGRRLRARGEVRGGLFGREMVHPRM
FT                   SSADQPLPASLTPVYPSTDGLPQPTLRKAIGQALARADLSDTLPEEARRRYGLAEFAPA
FT                   VRLLHAPPPDAAEHELMERIHPAWRRIKFDELLAQQLSLAAARAARRVKRAEPLPASQD
FT                   EDGLVARLYEALPFALTGAQQRVVAEIAADLAQPYPMHRLLQGDVGSGKTVVAAIAAAQ
FT                   AIACGAQVALMAPTEILAEQHFRKLVGWLEPLGVAVAWLSGSLSAKARREAAAAVADGS
FT                   VQLVVGTQALIQDHVMFQRLGLSIVDEQHRFGVGQRLALSRKGETGRGVIVPHQLNMSA
FT                   TPIPRTLAMTFFADLDVSVIDELPPGRTPVVTKLVADARREEVIGHIAHAARQGRQAYW
FT                   VCPLVEESEALELQTAVDTHEAMRAALPDLRIGLVHGRLPQAEKAEVMRAFREGEIDLL
FT                   VATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGRVGRGTAESICVLLYQAPLSQVA
FT                   RQRLRAMFETSDGFEIARRDLEQRGPGEFLGTRQSGLALLRFADLEADVAIAEQAREAA
FT                   VWLRAKHPEAVAAHLARWMRGREDFLRT"
FT   misc_feature    complement(338070..338288)
FT                   /note="HMMPfam hit to PF00271, DE Helicase conserved
FT                   C-terminal domain, score 2.3e-21"
FT   misc_feature    complement(338457..339065)
FT                   /note="HMMPfam hit to PF00270, DE DEAD/DEAH box helicase,
FT                   score 5.1e-21"
FT   misc_feature    complement(338931..338954)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(339861..340247)
FT                   /transl_table=11
FT                   /locus_tag="BB2940"
FT                   /product="putative translational inhibitor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1611"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ1"
FT                   /protein_id="CAE33432.1"
FT                   /translation="MSKQIIHTDAAPAAVGPYSQAVAATGAKTVYLSGQIGLEPGTGDL
FT                   VSENFDAQVRQAFANMQAVIKEAGGTLDDIVKLTLFLTDLNKFAAANAIMAELIPQPFP
FT                   ARSTVGVASLPKGAQFEVEAVLVL"
FT   misc_feature    complement(339867..340226)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01042, DE Endoribonuclease L-PSP,
FT                   score 3.4e-49"
FT   misc_feature    complement(340179..340247)
FT                   /note="Signal peptide predicted for BB2940 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.839) with cleavage site
FT                   probability 0.637 between residues 23 and 24"
FT   CDS_pept        complement(340424..343237)
FT                   /transl_table=11
FT                   /locus_tag="BB2941"
FT                   /product="putative autotransporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1610"
FT                   /db_xref="GOA:A0A0H3LNJ2"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ2"
FT                   /protein_id="CAE33433.1"
FT                   /translation="MLRSVSPLFSLPVSGRRQPVRMVASAARPVLAVALGGAMIGAPLA
FT                   RAEHWSGATIKKTGQGEIGIEVPDKTAALHTGPWVARKMTVETTGARGVGVLLDKTGVS
FT                   LTLEEAAITSSGDLGLDSSYQPRGTVMVRAGALTARGTTIRNRYGSSAGDWSRRPLALR
FT                   VAGPDASLILSDSTVEGEQGMQLVSRARADIVRSTVRGLHATGLSIKYAAKASLADSEV
FT                   LGERAARVDGDGELAARNTRFSGRSGLLLSSGGRADLSGGSLAASNGSALDLYGGVEGQ
FT                   LRDVEVSAQGAPAIDLVSTLAGDSAGDSPARRDPVLRVVGGSISVAGAHAPALSLGGGQ
FT                   ARLDTVDVRTAGSPAVELVAGALGVAGGTVNAGQAPVFVTGAYDAVLAAANVFLRPAKA
FT                   APQDGMPAVTVTLSGAKVGGAQLLRQTTPVPVRLVLRGAAVAQGDVVRAPETAPEKDGF
FT                   GTPVRPGLRVGLDQAPLELDVADGAQWHGATQSLDRLALGAGGQWRMSAASSVGELSME
FT                   PGAAVVFGDAAGPGFQTLTVRTLAGAGSFEMRADAALEHADQLVVTDQAEGRHRVWLRA
FT                   PAGAEPSKAQAVLVRAPADGKASFELDGSDGRADFGTYRYGLAQQPGGAWGLVRTGYSS
FT                   TAAAALDTGGLGAVQGLWYAESNALGKRMGELRLNPDAGGAWGRAFSQRQRISPRAGRH
FT                   FQQGVSGIELGADRAWPVAGGRWHAGGLLGYTRASRGFSGQGKGHTDSVHVGGYATYIG
FT                   ANGVYADATLRASRFENSFDVPGWAGRTVSGSYRANGVGVTLEAGRRLALDRHWFVEPQ
FT                   AELAWFRAGGGTYTASNGLRIEDDGGTSLQARVGAQAGRRFDLRGGAVVQPYAQLSWVQ
FT                   ELKGVSTVRTNGIAHRTDLGAGRVELGLGVAAALGKGHNLYASYEYAHGPRLSLPWTVQ
FT                   LGYRYAW"
FT   misc_feature    complement(340430..341260)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 3.3e-84"
FT   misc_feature    complement(340811..340861)
FT                   /note="PS00237 G-protein coupled receptors signature."
FT   misc_feature    complement(341348..341707)
FT                   /note="HMMPfam hit to PF03212, DE Pertactin, score 8.2e-26"
FT   CDS_pept        complement(343401..344204)
FT                   /transl_table=11
FT                   /locus_tag="BB2942"
FT                   /product="probable aldehyde reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1609"
FT                   /db_xref="GOA:A0A0H3LU80"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LU80"
FT                   /protein_id="CAE33434.1"
FT                   /translation="MTIPSFGVGTFRLTGQTVIDSVRNAIDLGYRAVDTAQIYGNETEV
FT                   GQAIAESGVARSELFVTTKIWTDNYARAKLLPSLRASLEKLRTDYVDLTLIHWPAPGNG
FT                   VALPEYMEALAEAKALGLTRRIGISNFNIALTRQAIAAVGQGEIATNQIELSPYLQSAR
FT                   LTAFLREQGIAVTSYMTLAYGKVLKDPVLARIADKHRSTVAQVALAWALQQGYAVIPSS
FT                   TKRENLASNLLARGLALDADDMARIAALERNGREVDPEGLAPAWD"
FT   misc_feature    complement(343443..344204)
FT                   /note="HMMPfam hit to PF00248, DE Aldo/keto reductase
FT                   family, score 5.9e-86"
FT   misc_feature    complement(343812..343865)
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT   misc_feature    complement(344067..344120)
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT   CDS_pept        complement(344276..345439)
FT                   /transl_table=11
FT                   /locus_tag="BB2943"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1608"
FT                   /db_xref="GOA:A0A0H3LQ11"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQ11"
FT                   /protein_id="CAE33435.1"
FT                   /translation="MKSSAALFALATGAFAIGTTEFTPMGLLPVIADGVQVSIPSAGML
FT                   ISAYAVGVMLGAPVMTLLFARFGKRAALMSLMLIFTVGNLLSAFAPSYSTLLLSRLITS
FT                   LNHGAFFGIGAVVAASLVPREKQASAIAAMFMGLTLANIGGVPVATWIGQQVGWRLAFG
FT                   GTAALGLVTIAALWLALPKGEPGKRPDVRRELGVLTRPEVLLAMGTTVLGAGAMFALYT
FT                   YVAPVLADLTHASPNFVAFALVLIGIGFTLGNTLGGRLADWSLDGATKLILGLLAVIMA
FT                   VLPLLLTTHAGAAIGLVVWAAAAFGIVPPVQMRVMQAAAQAPGLASSVNVGAFNLGNAL
FT                   GAALGGAAIGQGLGYASVPLVGAALAAGGLGLVWLGNAGRRRVAQGA"
FT   misc_feature    complement(344282..345427)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00083, DE Sugar (and other)
FT                   transporter, score 0.0035"
FT   misc_feature    complement(join(344312..344380,344390..344458,
FT                   344495..344563,344573..344641,344660..344728,
FT                   344771..344839,344900..344968,344981..345049,
FT                   345074..345142,345170..345229,345248..345316,
FT                   345359..345427))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB2943 by TMHMM2.0 at aa 5-27, 42-64, 71-90, 100-122,
FT                   131-153, 158-180, 201-223, 238-260, 267-289, 293-315,
FT                   328-350 and 354-376"
FT   misc_feature    complement(345392..345439)
FT                   /note="Signal peptide predicted for BB2943 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.772 between residues 16 and 17"
FT   CDS_pept        345541..346443
FT                   /transl_table=11
FT                   /locus_tag="BB2944"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1607"
FT                   /db_xref="GOA:A0A0H3LWM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWM4"
FT                   /protein_id="CAE33436.1"
FT                   /translation="MKTTLDELQAFVAVVDTGSITAAAEQLGLTVSAASRTLGRLEEKL
FT                   QTTLVRRTTRRLELTEEGAAFLQHARAILASVDEAEEQMAARRMRPAGRLRVDAATPFM
FT                   LHVLVPLIAGFHARYPEVELELNSNEGIVDLIEKRTDVAFRIGVLKDSTLHARAVGTSR
FT                   LRVLASPAYLERRGAPTRTAQLAQHALLGFTQPETLNDWPLRDADGAVLRIRPTIASSS
FT                   GETLRHMALAGLGIVCLSDFMTGEDRRAGALVQLFARQTLDVRQPVNAVYYRNTALAAR
FT                   ITCFVDHVIETLGARPFDA"
FT   misc_feature    345553..345732
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 7.9e-23"
FT   misc_feature    345595..345687
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    345802..346422
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.9e-42"
FT   CDS_pept        complement(346508..347284)
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="BB2945"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1606"
FT                   /db_xref="GOA:A0A0H3LNJ5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ5"
FT                   /protein_id="CAE33437.1"
FT                   /translation="MAAFNTERVLSVRHWNDTLFSFTTTRDAALRFHNGHFVMIGLEIE
FT                   GKPLMRAYSIASANYEENLEFLSIKVQNGPLTSRLQHLKEGDTILVSRKPVGTLVVDDL
FT                   KPGKHLYLFGTGTGLAPFMSIIKDPEVYERFEKVVLVHGVRWASELAYADFIEKELPGN
FT                   EFFGDIVRDKLVYYPTVTREPFRNQGRITQLVDSGKLCADIGLPQLDPAVDRAMICGSP
FT                   HMLADIRAMLDKRGFEVSPGVGEPGDYVFERAFVDK"
FT   misc_feature    complement(346592..346966)
FT                   /note="HMMPfam hit to PF00175, DE Oxidoreductase
FT                   NAD-binding domain, score 0.0016"
FT   misc_feature    complement(346982..347269)
FT                   /note="HMMPfam hit to PF00970, DE Oxidoreductase
FT                   FAD-binding domain, score 0.00038"
FT   CDS_pept        347606..348655
FT                   /transl_table=11
FT                   /locus_tag="BB2946"
FT                   /product="putative iron binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1605"
FT                   /db_xref="GOA:A0A0H3LNJ6"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNJ6"
FT                   /protein_id="CAE33438.1"
FT                   /translation="MPSTKRSSLIPLLRALALAGVATFSAQALAADEVSLYTTREPKLI
FT                   QPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQK
FT                   IQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYEDLADPKWKGKVCIR
FT                   SGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLA
FT                   NAYYVGHMKNAEPGTDARKWGDAIKVVRPTFATAKDGGTHVNISGAAVAAHAPNKANAV
FT                   KLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASE
FT                   LVDKVGFDN"
FT   misc_feature    347606..347695
FT                   /note="Signal peptide predicted for BB2946 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.988 between residues 30 and 31"
FT   misc_feature    347714..348649
FT                   /note="HMMPfam hit to PF01547, DE Bacterial extracellular
FT                   solute-binding protein, score 0.00084"
XX
SQ   Sequence 348706 BP; 52000 A; 122031 C; 122239 G; 52436 T; 0 other;
     tgtaaaaaat tccaaccagg taccgggagg cttgtgccca agcgagtaca atcgccccct        60
     aataagtcac cccaaggggc ggtccaaggc cagtttggtc agcgcagttg agctgcattg       120
     accaaactcg ctttcattcc attgtaaaag gtgacttcaa tgtcgtatgt ggtttcgttc       180
     gagcagctcc gcatgacgga cgtggactcg gtaggaggca agaacgcatc attaggtgaa       240
     atgatcagtc agctggccgg cgcgggggta cgcgtgcccg gcggctttgc cacgaccgcc       300
     caggccttcc gggacttcct gcaggcttcc ggtctggaca agcgcatcgc tgaccgtctc       360
     gccaccctca accccgaaga cgtacgcgag ctggccagcg ccggcgcgga gatccgtcaa       420
     tgggtgatcg atgcgccttt ctcgcctgaa ttcgaacagg cgatccgcac cgcattcgcc       480
     gagctcgacg ccgacggcaa gggctcgttc gcggtgcgct cctcggcgac cgccgaagac       540
     ctgcccgacg cttcgttcgc cggccagcag gagaccttcc tcaacgtggt gggcgtcgac       600
     gacgtgctcg acaagatccg ccacgttttc gcctcgctgt acaacgaccg cgccatttcg       660
     tatcgcgtgc acaagggcta cgcccacgcc gaggtcgcgc tgtcggccgg catccagcgc       720
     atggtccgtt ccgacaaggg cagcgccggc gtgatgttca ccatcgacac cgagtcgggc       780
     ttccaggacg tggtgttcat cacctcgtcg tacggcctgg gcgagacggt ggtgcagggc       840
     gccgtcaacc cggacgagtt ctacgtcttc aagccgtcgc tcgaacgcgg caactatccc       900
     atcgtcagcc gccgcatcgg ctccaagctg atcaagatgg aattcgaccc cgagcgtccc       960
     gaaggccgcg ccgtgcgcac cgtcgatgtg ccggtgtccg aacgcaaccg ctattcgctg      1020
     accgacgacg aagtcatcga gctggcgcgc tacgcggtca tcatcgagaa gcactaccag      1080
     cgtccgatgg acatcgagtg gggccgcgat ggcgtggatg gcaagatcta catcctgcag      1140
     gcgcgtccgg aaacggtgaa atcgcagcag ggcgtcaatg acgtgcagca gcgctaccgc      1200
     ctcaaggcca ccggccaggt gctggtgacc ggccgcgcca tcggccagaa gatcggcgca      1260
     ggcaaggtgc gcgtggtggc cgatatctcc gaaatggaca aggtccaggc cggcgacgtg      1320
     ctggtcaccg acatgaccga tcccaactgg gagccggtca tgaagcgtgc ctcggcgatc      1380
     atcaccaacc gcggcggacg cacctgccac gcagccatca tcgcgcgcga actgggcatt      1440
     ccggccgtgg tcggctgcgg cgacgcgacc gacctgctca aggacggcca ggccgtgacg      1500
     gcctcgtgcg ccgagggcga cgaaggccgt atctacgacg gcctgatcga gaccgaggtc      1560
     gaggaagtgc gccgcggcga gatgcctccg atcgacgtca agatcatgat gaacgtgggc      1620
     aatccgcagc tggcgttcga cttcgcgcag atccccaacg ccggcgtggg cctggcccgc      1680
     ctggaattca tcatcaacaa caacatcggc atccacccca aggcggtgct ggattatccg      1740
     aacgtcgacg gcgagctgaa gaaggcggtc gagtcggccg cccgcggcca cgccagcccg      1800
     cgcgccttct tcgtcgagaa gctggccgaa ggcgtggcga ccatcggcgc ggcgttctgg      1860
     cccaagccgg tgatcgtgcg catgtcggac ttcaagtcca acgagtaccg caagctggtg      1920
     ggcggttcgc gctacgagcc cgaggaagag aaccccatgc tgggctttcg cggggcgtcg      1980
     cgctatatcg ccgccgattt cgaggagtgc ttccgcatgg aatgcgaggc gctcaagaaa      2040
     gtgcgcgacg aaatgggcct gaccaacgtc gagatcatgg tgccgttcgt gcgcaccctg      2100
     ggccaggcca ggaaggtcgt cgagctgctg gccgcccacg gcctggcgcg cggcgagaac      2160
     ggcctgaagc tgatcatgat gtgcgaggtg ccgtccaacg ccatcctggc cgaacagttc      2220
     ctcgagtact tcgacggctt ctccatcggt tcgaacgaca tgacccagct gacgctggga      2280
     ctggaccgcg actccggcat ggagctgctg gcggccgact tcgacgaacg cgacgatgcg      2340
     gtgaagttca tgctgcgccg cgcgatcaag gcgtgcctgg cggccaacaa gtacgtcggt      2400
     atctgcgggc aggggcccag cgaccacccc gatttcgcgc agtggctcaa ggacgagggc      2460
     atcctgtcca tgtccctgaa cccggatacg gtggtggaga cctggcagca actggccaag      2520
     taagcgcccg gcagcaggaa aaagcctcgc ccttgcggcg aggctttttt tcgccggacg      2580
     gcgcgggcgg ctaggcgcag caggccagga agcggcgcac cagcgaggcg gcaagcggcg      2640
     tggggccggc cgcgcgcgcc aggcgttcga cgtccagccc gtgggcggcg tagagcgccg      2700
     cgtggtggcg cagatgggcg gcgacgaacc cgggcgtgaa ctcggggtgg aactgggctg      2760
     tatagatgcg cggggccagg cgcagcatct ggtgcgcgtc ctgggccgag cgcgccagca      2820
     cggcggcgcc cggcggcgcg gcgagcacgg cctgctcgtg catcatctgg gcgtcgaagg      2880
     cggccggcag gccggccagc aaggggtccg tggcggccgc gggcagcaat tcgaccggca      2940
     gggtgcccag ttcgcggccg gccgggttgt cgcccaccac gccgcccagc gcgtgggcca      3000
     gcagctggtg cccgtagcag atgccgaaca tgggcaggcc ggcgccggcg gcctggcgca      3060
     gccagtcggc ggccgcctcg ctccagggcg cgcggtcggt caccatggcc ggcgagccgg      3120
     tgatcagcgc ggcccggtac gcgccgggcg cgcgcggcgc ctcgtccttg taggaggcca      3180
     ccacgtgcgt gccggcggca tccagcccgg cggcctggcg cagcatctcg gcgtagctgc      3240
     cgtgcgcggc gcgcagggcg gcggcgggat tgccggtatg caggatcaga acaggcaggg      3300
     cggcggtcat ggcgggggat cgggccggtg gcgggagagg gggaacgcca tgataaaggc      3360
     acggcatgac aggcgcgagt ggcgggaaat acgtacaatc gttgccatat attgaaactc      3420
     gggacggaac gctatgtgga tttggttcgg tttggccgcc gttgccctga tcggcgaggt      3480
     gggctccggt acgttttacc tgctgctggt ggcgctgggc ctggccgccg gcggtatcgc      3540
     ggcctggctg ggggcggacc tggcctggca actggtggcg tgcggcctgg tggcgctgct      3600
     ggggctgctg gcgctgcgcc gcaccggcgt gctgaaaaag cgcgaggtca acgccgcgcg      3660
     caacgccgac gtcaacctgg atatcggcca gtccgtcatg gtggatgcgt ggtccgacgc      3720
     gggcacgacc caggtgtatt accggggcgc gcaatggcag gccgagctcg cccacggcca      3780
     gccgcgccag gccggccgcc acatcatcgc cgaaatacgc ggcacgcgcc tggtgctggc      3840
     gcccgcgccg gccgcgtaac catgaccttg cccgccggcg acggcaggct tcactagcag      3900
     agggtattta tcatgatcga cgtttccact gtggtcctga ttgtcatcgt catcctggcg      3960
     ctgatgatcg tggtcaaggc catcgccatc gtgccgcagc agcatgcctg ggtggtggag      4020
     cggctgggca agttcgaccg cgtgctgtcg ccgggcgccg gcttcgtgat tcccttcatc      4080
     gaacgggtgt cgtacaagca ttcgctcaag gaaatcccgc tcgacgtgcc gagccaggtc      4140
     tgcatcacgc gcgacaacac gcagttgcag gtcgacggcg tgctgtactt ccaggtcacc      4200
     gatccgatgc gcgcttcgta cggctcgtcg aactacattt ccgccatcac ccagctggcg      4260
     cagacgacgc tgcgctcggt gatcggcaag ctggagctgg accgcacgtt cgaggagcgc      4320
     gagttcatca acagcaccat cgtcgcgtcg ctggacgagg ccgcgctgaa ctggggcgtg      4380
     aaggtgctgc gctacgagat caaggatttg acgccgccca acgagatcct gcgcgcgatg      4440
     caggcgcaga ttaccgccga gcgcgagaag cgcgccctga tcgcggcttc cgaggggcgc      4500
     cgccaggagc agatcaacat cgccaccggc gagcgcgagg ccgccatcgc gcgctccgaa      4560
     ggcgagaagc aggcgcagat caaccaggcc cagggcgagg ccgcggccgt gctggccatc      4620
     gccgaggcga ccgccaaggc gatcgagcag gtgggcgagg ccgtgcgcca gcccggcggc      4680
     atggaagccg tcaacctcaa ggtcgccgaa cgctacgtgg atgccttcag caatgtggcc      4740
     aaggagggca atacgctcat cctgccgtcc aacctgtccg atgtgggcgg gctcatcgcc      4800
     tcggccatga cgatcgtcaa gtcgaccaag agcgcgtgag gttcgacccg ggcgcgccgg      4860
     ccgcggcgcg tcctttcgcg tccgcgccat agcgtcccgc cctcatgctg gctccggtca      4920
     ccctgctggt gatttccacc ctgtcgagcc tggtgacgct gggagtcctg ggttcgctgc      4980
     tgcgcagcgg catcgcgggc atccgcgagc tgatgtgggc caacgtgctg gtgctgtgct      5040
     cgctgctgct gttcacgctg caggccaacc ccgccatgcc gccgtggctg gcgattcagg      5100
     cgcccaacgt gctgatctcg tccggcgtcg tgctgttttg cgccggcgtc ttccgcttca      5160
     tgcaacagcg cccgccgtgg cgcctgctgc tgctgggact ggcgctgtcg atcggcgcca      5220
     acatctggtt ccactatgtc gacccctcgg tcaacgcccg ggtggtcgcg gcctcgggcc      5280
     tgcatgcgct gctgtggggc ggcagcgcat ggaccatcta tcgcaacatg ccgctgcggc      5340
     ggtcgcgcta cagctactgg ttcgccgggg tgaccgccac cgtggccgcc ctgggccatg      5400
     ccttgcgcac ggccgtctac ggcctgcaga tcgagcagac ccaggggctg ttgcagtcat      5460
     cggtatggaa cgtggccttc ctggcgatcg gcgtgctggt catgcccagc atgacgctgg      5520
     gcatgatcat gatgatccac gaccgcatgc tggccgagcg cgagcgcgag gccaaccagg      5580
     acttcctgac cggcctgctg tcgcgcaagg catggtggcg cgagggcgag cgcctgtgcg      5640
     cgcgcgcgtt gcgcacgggc cggccgctga ccctgctggc gctggacatc gaccgcttca      5700
     agcaggtcaa tgaccagcac ggccacgccg ccggcgatgt ggtgctgcgg catttcggtt      5760
     cgctggccac cgcgctgctg cgcagcggcg atgtcatcgg ccggctgggc ggcgaggaat      5820
     tcgtggcctt gttgcccgat accgacggcg acacgggcgt gagcgtggcc gagcgcttgc      5880
     tggccagtgt gcgcgccacg ccgtgctcgc acggcggcaa ggcgctgacc tacacgttca      5940
     gtggcggggt ggcgcaatac cgcgcgggcg atacgctgcc ggtgctggtg gagcgggcgg      6000
     acgcggcgtt gtacgcggcc aagcaggccg gccgcgaccg catcaggaat cgcgctggtt      6060
     gacgcgcgtg tcgtgcttca ggacacgttc cttttcgcgc tgccagtcct tttcgcgggc      6120
     ggtgtcgcgc ttgtcgtaca gcttcttgcc ccggcccagc gcgaagtcca gcttgatgcg      6180
     gccgttcttg tagtgcaggt tgagcggaac cagcgtgtag ccgcgctgtt cgaccttgcc      6240
     gatcagcttg cggatttcct cggccttgag cagcagcttg cgggtgcgcg tggcgtcggg      6300
     gcggatgtgg gtggacgcgg taggcagcgg gctgacgtgc atgcccagca ggtagatttc      6360
     gccatcgcgc acgatgacgt agctttcctt caattgcacg cggccgtcac ggatagcctt      6420
     cacttcccat ccttccagga ccatgccagc ttcgtagcgg tcctcgatga aatagtcgtg      6480
     cgtggccttg cggttatcga taatactcat ggaggcaatg gtaagggcgc gcggtgccgg      6540
     taaaatccta gcattctagc catttgcgat agctgatgca caaagtccaa cgatccgtcc      6600
     tggttccgta ttcggccgcc cagatgttcg acctggtggc cgatgtcgag aaataccccg      6660
     aattcatgcc gtggtgcggc ggcgccgagg tgcactcgcg ctccgagcac ggcatgcagg      6720
     cctcgatcct gatcagcttc gcgggcctga aacagcgctt cagcacgcgc aacacgcacg      6780
     attatccgca gcgcatcgat ctcgagctgg tcgacgggcc tttctcgatg ctggtgggcc      6840
     attgggtatt ccagccgctg gccgaggatg cctgcaaggt gctgttcacg ctggagtacg      6900
     cgttctccaa ccgcgccctc gaaatggtgg tgggcccggt gttcaaccgt atcgcggcca      6960
     gcttcatcga ttcgttcacc aagcgcgcgc aggccaagta tggcgaatga cacgccggcg      7020
     cccgccggtt cgctgcgcgt gacggtctgc catgcatgcc cggacggggc atggcagcgc      7080
     gccgtcacgc tgccggccgg cgccacggtg gccgacgcgg tggccgccag cggctttgcc      7140
     gcggcgcacc gcggccagga tccctgggcg catggcgtgg gggtgttcgg caaggcgcag      7200
     gcggccgacg cgccgctggc cgatggcgac cgggtggaaa tctaccgggg cctcagcttc      7260
     gaccccaagg agtcgcgccg gcggcgggcc gagcaccggc gtgcgctggc cgcgcgcggc      7320
     ggcaaggcgc gtccggccgg cctgctgtaa ggccgcgggc ttcccggggc gattgcggcg      7380
     tccaggcgcc cacattgtcg ccggcaagac agtgcgcggc cgtttcgggc gtaacatact      7440
     cgccaacgac ttacgtttac gttaacgtca tgtcgagcgg ccgccggcga ttcacaagat      7500
     cgccacgcag ccgcatgacc ataccgagaa catctggaga ctggccgtgg atttcgaact      7560
     caccgacgag cagcgcgcgt tcgcgcaggc cgcgcgcgac tatgcacagg gcgaactggc      7620
     cccgcacgcg gcgcgctggg acgccgaggg cattttcccg cgcgaggcct tcgcccgcgc      7680
     cggcgaactg ggcttttgcg ccatctatgc cagcgaggag atcggcggac tggggctgcc      7740
     ccggctcgac gccacactgg tcttcgagga gatggcggcc gtggacccct cgaccacggc      7800
     gttcctgacg atccacaaca tggccacctg gatggtgggg caatgggccc ggccggcggt      7860
     gcgcgagcag tgggggccgc tgctggccag cggcgagaag ctggcgtcgt actgcctgac      7920
     cgaacccaat gcgggctcgg atgccggctc gctggccacg cgggccgagc gccagggcga      7980
     tgattacgtg ctcaacggcg ccaaggcctt catttcgggc ggcggcgata ccgacctgct      8040
     ggtggtgatg gcgcgcaccg gcggcgacgg gcccggcggg gtcagcgcct ttgccgtgcc      8100
     cgccgacgcc gcgggcatcg cctatggccg caaggaagag aagatgggct ggaacagcca      8160
     gtccacgcgg cccatcacgt tcgagcaggt gcgcgtgccc gcctcgcaca tgctgggcga      8220
     gcccggcgag ggcttcaaga tcgccatgaa gggcctggac ggcgggcgca tcaacatcgg      8280
     cacctgctcg gtcggcgcgg cccagggcgc catggacgcg gcgcgccgct acatggacga      8340
     gcggcgccag ttcaaccgca agctggcgca gttccaggcg ctgcagttca agctggccga      8400
     catggccacg cacctggtgg cggcgcgcca gatggtgcgg ctggccgcct gcaagctgga      8460
     cgccggctcg gccgacgcca gcacctattg cgccatggcc aagcgcttcg ccaccgacat      8520
     gggtttccag atctgcctgg acgcgcagca gatccatggc ggatatgggt atttgcgcga      8580
     ctatccgctc gagcgcctgg tgcgcgatac tcgcgtgcac cagatcctgg agggcacgaa      8640
     cgagatcatg cgggtcatcg tcgcccgaca attgcttgaa aaaggagccg atatccgatg      8700
     aatgcgcccg tgctgtttga agaacgaatt gccgacaatg gcgtgcgcct gggcgtggcc      8760
     acgctcaatg cgccgcagac cctcaatggc ctgtcgctcg agatggtcga gctgctcgac      8820
     gcgcgcctgc gcgcctgggc cgccgacgcg gccgtggcga tggtcatcct gcagggggcg      8880
     ggcgagaagg cgttctgcgc cggcggcgac ctgcacgggc tgtaccgcag catgcgcgag      8940
     aacaccggcg gcgatccctg ggccaatacc catgcgcgcc gcttcttcga gcacgagtac      9000
     cggctggact acctgatcca cacctacccc aagccggtgc tgtgctgggg ccatggcatc      9060
     gtcatgggcg gcggcgtggg cctgatgatg ggcgccagcc accgcgtggt cagcgagacc      9120
     acgcgcatgg ccatgcccga gatcaccatc gggctgtttc ccgacgtggg cggcagctgg      9180
     ctgctcaacc gcatgccggg gcgcaccggg ctgttcctgg cgctgaccgg cgcgcacgtg      9240
     aacgcctccg acgccttctt cgccgggctg gccgatttcc ggctcgattc ggcgcagtgg      9300
     ccggatttct gcgcctccct gctgagcctg ccgtgggccg gccagccggg cgggcccggc      9360
     accggcaacg cggcgccgcg ctcgatcaac gacggcctgc tgcgccaggc gctgctggcg      9420
     cacgaaccgg ccacgcagct ggagcccggc cccctgcgcc agcattcgtt cctggtgaac      9480
     agcctgtgca gcggcaagcg gctggacgac atctacgccg agatcgccga gctcaaggat      9540
     cacgccgatc cctggctggc cagggccgcg gccaccatgc tggccggttc gcccggttcg      9600
     gcgcggctgg cgtatgccct gcagcagcat acgcggctgc gttcgctggc cgatgtgttc      9660
     cgcatcgagt acgtggccgc gctggcctgc gcggcgcacg gcgatttcgc cgaaggcatc      9720
     cgtgcgctgc tggtcgacaa ggacaggcag ccgcgctgga atcccgccac cctgtccgag      9780
     gccagcgacg actgggtgcg caagttcttt gacgagccct ggccggccgg ccagccccac      9840
     ccgctggcgg acctgggcca cggcgcctag gcgcgccggt tcgctcgttc ccctatgacg      9900
     cacaggagac aaccatcatg agcagcattg cattcatcgg tctgggcaac atgggcgcgc      9960
     ccatggcgct gaacctggtc aaggcgggcc acgacctgac ggtattcgac ctggtgccgg     10020
     cggcggtcaa gacgctgacc gacgccggcg cgcgcgcggc cggttcggcc gccgaggcgg     10080
     tgcagggcgc cgaactcgtc atttccatgc tgccggccag caagcatgtc gaaggcctgt     10140
     acctgggcca ggacctgctg gccagcatcg gcgccagcgc gctggtcatc gagtgcagca     10200
     ccatcgcgcc cgattcggcg cgcaaggtgg ccgccgccgc gcaggcgcgc ggcatcgcca     10260
     tgatcgatgc gccggtatcc ggcggcacgg gcggcgccgc ggccggcacg ctgacgttca     10320
     tcgtcggggg cgaggcgccg gcgctggagc gcgcgcggcc ggtactggcc agcatgggca     10380
     agaacatctt ccatgccggc ggcgccggcg ccgggcaggt ggccaagatc tgcaacaaca     10440
     tgctgctggg catcctcatg gccggtacgt ccgaggcgct ggcgctgggc gtggccaacg     10500
     gcctggaccc caaggtgctg tcggacatca tcagcaagag ctcgggccgc aactgggcca     10560
     ccgagctcta caacccctgg ccgggcgtca tggagcatgc gccggcgtcc aagggctatg     10620
     ccgggggctt cggcgtggac ctgatgctca aggacctggg gctggcggcc gaggcggcgc     10680
     tgggcacgcg ctcgtccatc ccgctgggag agctggcgcg caacctgtat tcgctgcaca     10740
     gccagggcgg cagcggcggg ctggacttct ccagcatcgt caatctgtat tcgccgggcg     10800
     agcgcaactg atcccgccct ggccgggcgg ccagggccat tccgcgagag gcttgcatgc     10860
     ctgataccga ggctttcgag gcggcgcgcc agcgcgtgca cgacaacttt gcccgccaga     10920
     gcgtcatggc gctgatcggc gcgcgcctgg gcgccgtcga acccggcgag gtcgagatcg     10980
     cgttgccgta tcgcgccgac ctgtgccagc agaacggttt cctgcatgcc ggcatttcca     11040
     ccaccattgc cgacagcgcg gggggctatg ccgcctatac gctgttcgga cccggcgaag     11100
     acgtgctgac atcggagttc aagatgaact tcctggcgcc ggccgatggc gagcactttg     11160
     tcgccagcgg caaggtgcta aagcccggca ggcggctgag catctgccag gtggagctgc     11220
     gcgcctgccg cggcgagcgc agcacgctgt gcctggtggg gctgatgacc gcggtgcggg     11280
     tgacgccgcg ttgaacggcg cggcggccta tacttggcgc gccaatcccg gccgccacga     11340
     gtgacgcctg cccatgcccg cccgatccca ccatcgcatc ttccgttccg gctggctgcg     11400
     cgccgcggtg ctgggcgcca atgacggcat cgtctccacc gccagcctga tcgccggggt     11460
     ggcggccgcg caagccagcc atgccgccat cctgacttcg ggcctggccg gcctggtggc     11520
     cggagcgctg tccatggccg ccggcgagta cgtatcggtg aagtcccagg ccgatatcga     11580
     ggcggccgat ctgcggctgg aacagagttc gctcaagcgc aattcgcgcg aagagctgga     11640
     agaactgacc ggcatctatg tcgagcgcgg cctgtcgccc gacctggcgg ggcaggtggc     11700
     ccggcagctg acgcgccaca acgccctgga cgcgcatgcg cgcgacgagc tgggcatctc     11760
     ggtgcacaac cgcgcccagc cggtgcaggc ggcgctggcc tcggccgcgt cgttcgccgt     11820
     cggggcggcg ctgccgctgg ccatcgccat ggcggcgccg ctggcgcaac tgatgccggt     11880
     ggtgatcgcc gggtcggtgg ccgggctggg catactgggc gcggtggccg cgcgcgccgg     11940
     cggcgcgccg gtggggccgg ccgccgtgcg ggtggtgttg ctgggggcgg ccgccatggc     12000
     cctgaccgcg ggcgtggggg ccttgttcgg cgtggcggta tagccggaca gcctagccgg     12060
     cggcgttgcc ggccagttcg tagggcaggg gcgccagggc gatgcgcggg ccctgcgcgc     12120
     tgagcagccg caggtcgccg tcgggcaggc tggccagggt ggtttcgaac agcagcgcga     12180
     gctgcccgtc gctgcgcgcg gcgtcgacca cgcgtccgca gggttcgtcc ggccgcgcgc     12240
     tgtcgtagat gtcctggccg gccaaggggt cgggcaggtc ggccggggcc tcggcgatca     12300
     cgccatgggc catgcggcgc ttgaccgtgc cgcggtaatg gctgcgcgcc accacctcct     12360
     ggcccggata gcagcccttg gtgaagctga cgccgccgat gaggtcgaga ttgacggtct     12420
     gcggaatgaa gacgtcctgc gtggccgcgc cgatccaggg caggccggcg gccaggtcgg     12480
     cggcctgcca ggcggactcg gacgcgcggc ccaggtgcgc ggccagcgcg ccggcccgct     12540
     ccagctgcgc ttcggtggcg atccaccacc agcgcggctg cgcatcggcc gagggcgcgc     12600
     cgatccaggt gccggtgggc aattcggcgc gctgccaggg cgcggcgggc agggcgccgc     12660
     cggcggcgtc ctgcagcgcg gccagcgcgg cgggggcgca ttgcacgccc gccgcccacg     12720
     ccggcaccgg agccagccgc gccttggcgc gcaatacgaa catggacagg cgcttgagca     12780
     ccgcctcggc gacgtcggcg cgcaccagcg cctgccatac cggggcgctt tcgtcggccg     12840
     cggcggcccg ccacatgacc agcgtggcca gcaggcggcc cttggcggtg cagtagccgg     12900
     ccaggcgggc gtggtcggcg ggctggccgg tgacgtcctg ggtcagttgc ccatgcagga     12960
     aagccagcgc gtcggcgccg gccgcgccga tgacgcgcag gctggccagc ggcgcgcatt     13020
     gcgccgaacc atcggcgcgc gcgggaatcg aatcgtagaa agcgtgcatg gcggaattct     13080
     aaaaggggcg gatgacgcgc acgcgcgaac cggcgtgggc cgcgcggcgt cgaacaaacc     13140
     ccgatgatac ccggggcggc ccgcgccggc ccctatgacc cggctgaccg cgggggcgtg     13200
     ggcgggccag ccgccgcgcc cgcgatccat taaacttgcg cacacttatg agaaaacgca     13260
     ttcgtttcta ttttctgctg ctcgtgctgg tggcgctgct cggcgccgcg ctggcggccg     13320
     gcggcgcctg gacctggatg cacaggccgg tggcgctcaa gtccgaccgc atcgatttcg     13380
     tggtggatcc gggcagcacg ccgcgcgcca tcgcgcgcac cctcaaccag gccggcgtgg     13440
     cggtctggga gccgggcttc gtctggatgg cgcgcctgtc cgagctggac aagcagatca     13500
     aggccggcgg ctaccaggcc atcgacggcg actcgccctg gcagttgctg caacggctgg     13560
     cgcgcggcga catgagccag cgccagatca ctttcctgga gggctggacg ttccggcaga     13620
     tgcgccaggc gctgcgcgaa catcccgacg tcaagcagac cctgggcgag accagcgacg     13680
     aggccctgat ggaaaggctg ggctcgacgg tgacccatcc cgagggcatg ttctttcccg     13740
     acacctatgt gttcactccg ggcagcacgg atttcgacat cctgcggcgc gcctaccagg     13800
     aagggcagcg catcctggag tcgacctggg ccaagcgcca ggatgggctg ccggtgggca     13860
     cgccctacga agcgctgatc ctggcttcca tcgtcgagaa ggagaccggc cacgggccgg     13920
     agcgcgcgcg cgtggccggg gtgttcgcca accggctgcg catcggcatg ctgctgcaga     13980
     ccgacccgac cgtgatctac ggcatgggcg aggcctacca gggccgtatc cgcaagcgcg     14040
     acctgcagac cgacacgcca tggaacacct acacccgtcc gggcctgccg cccacgccca     14100
     tcgccgcgcc cgggcgcgcc gcgctgctgg cggcggtgca gcccgaacgc cacaaatacc     14160
     tgttcttcgt gtcgcgcggc aacggcacca gcgagttctc ggtcaacctg aacgaccaca     14220
     accgcaatgt gtcgcgctac atattgggac aagggcaacc gcaacaagga tcgcagcaat     14280
     gaccccgcgt ggacgtttca ttacgctgga gggcgtcgat ggcgccggca agagcaccca     14340
     taccgcatgg atggtgcagg cgctgcgcga cctgggcctg acggtgctgg ccacccggga     14400
     gcccggcggg acgccggtgg gcgagaagct gcgcgagctg ctgctgtccg aacccatggc     14460
     cctggaaacc gagaccttgc tcatgttcgc ggcgcgctgt gagcacgtgc gcgaagtgat     14520
     cgcgccggcg ctggcgcgcg gcgagtgggt ggtgtgcgac cgcttcaccg atgcgtccta     14580
     tgcctatcag ggcggcggac gccaattggg cgcggcgcgc gtggcggcgc tggagcagtg     14640
     ggtgcatccc gatctgcagc ccgaccgcac ctggctgttc gacgtgccgc tggacgtggc     14700
     gcgcgcccgg ctggcgcgct cgcgccagct cgaccgcttc gagcgcgagg aggatgcctt     14760
     cttcgaacgc acccgcgccg cctaccacga gcgggcgcgc agctcggatg gacgtatccg     14820
     catcatcgat tcgagccggc cgctcgaggt cgtgcgcgcg cagctcgaca gcgaggtgcg     14880
     cgagctggtg gcgcaagcgg catgagcctc ggtcgcttcc tgccctggca gacggagatc     14940
     gcccgctcct ggctgagcgg gcgcgaccgc ttcgcgcatg cctggctgat ccatggcaat     15000
     ggcggcatcg gcaagctgga ctttgcggcg gccgcggcgg ccagcctgct gtgcgagtcg     15060
     ccgcgccagg gcctggcgtg cggcgagtgc gcggcctgcg cctgggtggc cagcggcaac     15120
     catccggatc tgcggcgcat tcgtccggag gcggtcgcgc tggaagaggg cgccgaccag     15180
     accgaaggcg ccgaggaggc cgaggccggt tccggcggcg cggcggccaa gcgcgcgccg     15240
     tccaaggaca tccgcatcga ccagatccgc gcgctcgaac cgtggttcaa caccgccacg     15300
     caccggggcg gctggcgcgt ggcgctgctg tatccggcgc atgcgctgaa cgtgatatcg     15360
     gccaacgcct tgctgaaggt gctggaggag ccgcccgcgc atacggtgtt cctgctggtg     15420
     gccgatgcgc ccgaccgcct gctgcccacg ctggtgtcgc gctgccggcg cctgccgctg     15480
     cccacgccgt cggccgggca ggcgctgcaa tggctgggcg agcagggcgt ggagccggcg     15540
     gccgactggc tggctgccgc cggcggcgcg ccgctggcgg cgcagcgcct ggcggcccgg     15600
     ggcgatgcgc cgtgcccggc ctggctggcg caactggtgc agcccttggc cgcgggcaag     15660
     gcgcccgatg tgggcatgct gaccgaaaac ctggaaaagg tggcggcggc cgagtggatc     15720
     gacgccctgc agcgcctgtt caccgacctg acgctggccg cccatggcgc ggccagccgc     15780
     tactatccct cgctggccga gccggtgcgg caagccgccg cgcgcgcgca gcccgcgcaa     15840
     ctggccgaga ccgcgcgctg gctgagccgc cagcgcgggc tggccacgca tccgctcaac     15900
     gccaagctgt tcgtgcacgc ggccctgcag cgcgtggtgc tatcctgcca gtgacgatcg     15960
     ggccacggcc cgtttctcct gtgatccgta ttctgtggtc cgtatgtacg tagactccca     16020
     ctgtcatctg aattttcccg aattggcgca agacctgccg gccgtgctgg atcgcatggc     16080
     cgccaaccag gtcacccatg cgctggtcgt cagcgtcaac atgcccgact ggccgggcct     16140
     gatgcaattg gtcgagccgc acggcaatct ctgggcgtcg gtgggggtgc accccgacta     16200
     tgaagacacg cccgatcccg agcccgccga gctcgagcgc ctggccgcgc accccaaggt     16260
     ggtggccatc ggcgagaccg ggctggacta ctaccgcctg agcgagccgc tggactggca     16320
     gcgcgagcgc tttcgccgcc atatccgcgc ggcgcgctcg accggcctgc cgctgatcgt     16380
     gcatacgcgc gcctcggcgc aggacacggt gcgcctgctg cgcgaagagg gcgccgacga     16440
     ggtcggcggc gtgatgcact gttttaccga gtcctgggag atcgcccagc aggccatggc     16500
     gctgaatttc catatctcgc tttcgggcat cgtgacgttc aagaacgcgc agctcgtgca     16560
     cgaggtggcc gccaatatgc cgctggaccg gctgctgatc gagaccgact cgccctacct     16620
     ggcgccggtg ccataccgcg gcaagctgaa cgatccgtcc aaggtgatcc acgtggccga     16680
     gaagatcgcc gagctcaagg gtattccggt ggccgaggtg gcgcatgcct ctaccgagaa     16740
     tttcttcaaa cttttcaata agataaaacg ataatctaat ttgaattatt taaagtgaat     16800
     tctagatttt ggcggtattc caccatgaaa cccttgcgta cccgttttct gcgctggcgc     16860
     ggcgccgcgg ccggcggcct gctcgccggc gccttgctgg ccagccccgc ctgggcggcc     16920
     aagcaggccg actggtgggt gtatgtccat aacgacaagg cccgcgacat cggcgccttg     16980
     ctggcggcgg gcgccgatcc caatgtgcgc tacgacaatg gccagccggc catcatgcgg     17040
     gcggtggtcg acaacgcctg ggaggtgttc gatgtgctgg ccgccaaccg ccgcaccgat     17100
     ctcaacgccg agaatcccgc gggcgagacg cccttgatgt acctggcggt ggcggggcag     17160
     accgaacgcg cgcaggcgct gatcgcgcgc ggcgcgcagg tcaaccggct gggctggacg     17220
     ccgctgcact atgcggcctc gaagggccgg ctggagaccg cgcgcatgct gctgggcaag     17280
     caggcgctgg tcaatgcgcc gtcgcccgac ggcaccacgc cgctgatgat ggccgcgtat     17340
     tcgggcgatc gccgcatggt gcagttgttg ctggatgccg gcgccgatat caccacgcgc     17400
     aacctcaagg gcatgagcgc ggccgactgg gccgccttcg gcaagtccga ggcgctggcg     17460
     cgcgagctca agcccatgat cgcccgcgcc gaggccgaac ggcaggcccg ccatggcgca     17520
     gtggccacgc ccaagctggc gccggccgcc gaaacgccgc ccacggcaca gcccgcggca     17580
     gcccctgccg cggcgtcgca acccggcgaa ggccgctccc tgtccggcgt ctcgggcgtg     17640
     cggctgaact cctacgatta acccgggtgc ctgtccccgc ggggacaggc acccgccaac     17700
     tcctgtgcct gtccccgcat ggagacaggc acccgccaac tcctgtgcct gtccccgcat     17760
     ggggactggc gcccgccaac gtctcggtgc ctgtccccac agggaacagg cacccgggcc     17820
     tccctgttcc tgctcctcca cctgatcacg tgccgcccac cggggcggca tttttttgct     17880
     cggggttttc cctgaaattc tcataaattg agaatgaatt ctgaaaaaat gggaaaaact     17940
     gaataatctg cgcacgcaat atcaaggaac gatcgacatg caagaacaag ccatcgcggg     18000
     tggcgccgag cgcgtgctgt atgtgctggc caccctggcg cgcgaggaag ccccgctgac     18060
     cgtggcggcg ctggccgagc gcaccggcct ggcccagagc acgctgtacc ggcaggtggc     18120
     cctgctcaag cgctgggggt tcgtgctgga gcaggctggc gcctatacgc cgggcccgct     18180
     gtgcgtgcag ctggcgcgcg gcttcgacca atcgtcctat ctgatccagg aagccttgcc     18240
     cgatatgacc cgcctggccg ccgattcggg cgagacggtg ggcttgctgg tggccatgtc     18300
     cgaccaggcg gtctgcctgg agatggtcga aagccggcat ccgctgcgct gttcgttcgt     18360
     caagggccgc ggcctgccgt tggcgcgcgg ggcctcggcc aagtcgctga tggcgttcat     18420
     ggcgccggcg cgcctgcagg gccggctgca cgagctggcc gggcagggcg tcgacgccgc     18480
     cgcgctggcg cgcgacctgg aggcgatccg cgccgccggc tacgcggtca gcgacagcga     18540
     ggtcgacgcc ggcgtgtggg gctgcagcgc gccggtgttc gagcggccgc accaggcagc     18600
     cggctcggtc accctgatgg cgccttccac gcgcgtggcc gaacgcaccg cgaacctgat     18660
     caacctgacg ctggcggccg ccaaacgcat ttccagccgc ctgcagcatt cctgacgtat     18720
     ccctgtggcc gtatccatcc atacggtttt cttcactcca atgccgtacc catcaccaaa     18780
     ggaagcatca tgacgactcg ccgccaactg ctgaccgccg ccctgaccct gagcctggcc     18840
     tggggcgccg gcgccgcgca tgcccaggag accattcgcg ccgtgaccga cgcgacgttc     18900
     ccgcccatgg aattcgtcaa ggacggcaag cgcaccggtt tcgatatcga actggtcgag     18960
     gcgctggccc aggccatggg caagaaaatc gaatggatcg acatcgactt caagggcctg     19020
     atcccggcgc tgcaggccgg ccgcgccgac atcgccgtgt cggccatcta catcaccgcc     19080
     gagcgccaga aagtggtgga tttcaccgac ccgtactatg cgggcggcct ggtggtgctg     19140
     accaagaagg atggtccggt gaagtcgctc aaggacctgg agggccgcaa ggtgtcggtg     19200
     caggtgggca ccaagtcggt caactatctg aaggagcact tccccaaggt gcagcgcgtc     19260
     gaggtggaga agaaccagga gatgttcaac ctggtgcaga tcggccgcgc cgacgcggcg     19320
     gtgaccggca agccggcggc caagctgttc gcgcaaagca cgcaggacct ggccgtgctg     19380
     agcgagcaga tcaccaccga ggaatacggc atcgccgtgc cgaagtccaa gtccggactg     19440
     acccgcgagc tcaacgaggc gctcaagaag ctgaaggctg acggtaccta cgagcgcatc     19500
     gtcaacaagt ggttcgaggc gcaggccaaa tgatgctgga tttcgcgcct gtctttgccg     19560
     acttcgacgc attgctgcgc ggcgcggtcg tcaccgtgga ggtgacggcc tgcgcgctgc     19620
     tgctgggctg cgtcatcggc ctgctggtcg gggtcggccg cctcaacccg caacgccgct     19680
     tcatctacaa cctgtgcagc gtatacctgc tgttctttcg cggcacgccg ctgctggtgc     19740
     agctgttcat ctggttcttc gggctgccgc agttcggcat cacgctgccg gcgttcgcct     19800
     gcggcgtgct cggcctgggc atctattccg gcgcctacgt ctcggagatc gtgcgcggcg     19860
     ccatccagtc ggtcgaccgc ggccagatgg aagcggcccg ctcgctgggc atgtcctcgg     19920
     cgcaggcgat gcgcatcatc atcctgccgc aggccgtggt gcgcatgatt ccgccgctgg     19980
     gcaacgagtt catcgccctg atcaagaatt ccgcgctggt ttcgctgctg acgatccacg     20040
     atctgatgca cgaaggccag aagatcatca gcgtgtcgta tcgctcgctg gagacctatc     20100
     tggtggtggc cctgatttac ctggtgttga cgaccgcgac gacgacgatc ctgcgccgga     20160
     tcgagcatcg cctgcgcgcg ggagggatgg tgcaatgagt acgcaagaga tgatccgcat     20220
     ccgcggactg cgcaaggcct atggcgagca cgaagtgctg cgcggcatcg atttcaatgt     20280
     cgaggcctcg caggtggtgg tggtgatcgg gcccagcggc tcgggcaaga gcacgctttt     20340
     gcgctgctgc aacggcctgg aggtggcgca gggcggcacc atcgatatct gcggccacaa     20400
     cctgctcaag gatggccggc tgctgcccga ggcggagctc aatcgcctgc gcatgcaggt     20460
     cggcatggtg ttccagggtt tcaacctgtt cccgcacctt tcggtgctgg acaacgtgac     20520
     cgtcgggccg cgcacgctgc gcggcatgag ccgggcgcag gccgaggagc tgggcggcga     20580
     cctgctggcc aaggtggggc tgcgcgaaaa gatggcggcc atgcccggct cgctgtcggg     20640
     cggccagaag cagcgcgtgg cgatcgcccg cgcgctggcg atgcagccgc gcgtgatgct     20700
     gttcgacgag cccacgtcgg cgctcgaccc ggaactggtg ggcgaggtgc tgcaggtcat     20760
     gaagctgctg gcccgcgaag gcatgaccat gatggtggtc acgcacgaaa tgggtttcgc     20820
     gcgcgaagtg gccgatgtgg tggcggtgat ggacggcggc agcattgtcg agtccggtcc     20880
     gcccgagctg attttcagcc agccgcgcga ggcgcgtacc cgcgccttcc tgcaggccgt     20940
     cctcagcgca tcgcaggggg cggcatgagc gtggccaacg attccgcgtc catctggacc     21000
     gcgcgcgacg acagcggcga gcgcggcgat acgcgccgcc tggcccacat cgtcgcgctg     21060
     gggcaggacg ccggcgccgg cgacgccgcg gtgctgggct ttgcctgcga tgccggcgtg     21120
     gcgcgcaacc aggggcggcg cggcgcggcg ctggcgccgc gcgccatccg gcgcatgatg     21180
     gccggcctgc cggcgcacaa tctgcgtcgc ctggtcgacg ccggcgacgt ggtgtgcgag     21240
     gacgaccagc tcgaggcggc gcaggatgcg ctggccggcc gcgtggccgc gctgctgcag     21300
     gccggcgcgc atccggtggt gctgggcggc gggcacgaga tcgcctgggg cagtttccag     21360
     ggcttgcggc gctggctgga cgcgcgcggc gaccgcgaac cggtgctggt gctcaacctc     21420
     gacgcgcatt tcgacctgcg caccggccgg ccgggcagtt cgggcacgcc gttcgaccag     21480
     atcgccgagt attgcgcggc gcgcggccac gcgctgcagt acgcctgcct gggcgtctcg     21540
     ccgctgggca acacgcccgc gctctacgcg cgggcggccg aggtcggcgc cgtctgggtg     21600
     gaagaccgcc acatgcagga ggcccatctg ggcgagcgcc tggcccagct cgatgccttg     21660
     ctggcggcgg ccggccacgt ctatctcacg atcgacctgg acgtgctgcc ggcggcgacc     21720
     gcgccggggg tctcggcccc cgcgccctat ggcgtgccgc tggcggtggt cgaggaggtg     21780
     gcgatgcatg tgcgcgccag cggcaagctg cgcctggccg acctggccga gtgcaacccg     21840
     gcctacgaca tcgaccaccg caccgcgcgc gtggcggcgc gcctggcgtg gcgcttgctg     21900
     ggcggcgcgg cgcggtagac ggcgggcccg ccacgggctt aggatgtagg cgttggccgc     21960
     ccggatcggc ccgatccggg cggcctgccc gaaggttgtt gcaaggcgcg cttttttgat     22020
     gcggccctaa taaatattta tctcttttta ttggggccgc agctggtttc gtggaaaaat     22080
     aagcgcaacc tcagcccgga gatcctccct atgtctcaag ctcccgccca ttccttgccc     22140
     tcatacctgg atgccgagca tctgggcccc tgggggatct acctgcagca agtcgaccgc     22200
     gtcacgccgt acctgggtcc gctggcccgc tgggtcgaga cgctcaagcg tcccaagcgc     22260
     gcgctgatcg tggatgtgcc gatcgagatg gacaacggca gcatcgccca cttcgagggc     22320
     taccgcgtcc agcacaatac gtcgcgcggc ccgggcaagg gcggcgtgcg tttccaccag     22380
     gacgtgacct tgtcggaagt gatggcgctg gcggcctgga tgtcgatcaa gaatgccgcc     22440
     gtcaacctgc cgtacggcgg cgccaagggc ggcgtgcggg tcgacccgcg cacgctgtcg     22500
     cactccgagc tcgagcgcat gacgcgccgc tacacctcgg agatcggcgt catcatcggg     22560
     ccgtccaagg acatcccggc cccggacgtg aacaccaacg cccagaccat ggcctggatg     22620
     atggacacgt actccatgaa cgaaggcgcc accgccaccg gcgtggtgac cggcaagccg     22680
     atcgcgctgg gcggcagcct gggccgggtc gaggccaccg gccgcggcgt cttcgtggtc     22740
     ggctgcgagg cggcgcgcga cctgaacctc gacgtatcca aggcccgcat cgtggtgcag     22800
     ggtttcggca acgtcggcgg caccgcggcg cgcctgttcc atgaggccgg cgccaaggtg     22860
     atcgcggtgc aggaccacac cggcaccatc cacaacgacg gcgggctgga cgtgcacaag     22920
     ctgctggcgc acgtcggcaa ccagggcggc gtggccggct tcaccggcgc gcagcaactg     22980
     gccgacgacg atttctgggg attggagacc gatttcctga tccctgccgc tcttgaggga     23040
     cagatcaacg aaaacaacgc cgccagggtg cgcgccaagg tcgtggtcga gggcgccaac     23100
     ggcccgacca ccccggaagc cgacgatatc ctgcgcgaga acggcgtcta cgtggtgccc     23160
     gacgtgctgg ccaacgccgg cggcgtgacg gtcagctact tcgagtgggt gcaggacttc     23220
     tccagcttct tctggagcga ggaggagatc aaccagcggc tcgagcgcct gatgcgcgag     23280
     gcctacagcg ccgtgtcgca agtggccaag gagcacaagg tcaccctgcg taccgcggcc     23340
     ttcatcgtgg cgtgcacccg catcctgcag gcgcgccagg tgcgcggcct gtatccctga     23400
     ccgctgcgcg gcgggccccg cagggcccgc atcggcgtac caggcagccg gccccgcaag     23460
     gggccggcgc cgttttcagc gcaggctgat ccaggtggtc ttgaggtcgc tgtacttgtc     23520
     catcgcgtgc agcgacttgt cgcgcccgaa gccggattgc ttgacgccgc cgaagggcac     23580
     cgtgatgtcg ccgtcggcat agcagttgac ccataccagc ccggcgcgca ggcggcgcga     23640
     caggcggtgc gcgcggccga ggtcggcggt ccacagcccg gcccccagcc catagatgga     23700
     atcattggcc agcgcgacgg cctcgtcctc gtcggcgaag ccttgcgcgg ccagcaccgg     23760
     cccgaagatt tcctcgcgca ccagcgagtt gtcctggccg ggacaatcga agatggtcgg     23820
     ttcgatgtag tagccgccgc tgttggtcag cacttgccgg ccgcccaggc gcagccgcgc     23880
     gccttcctgg gcgccggcgg cgatgcgggc catgaccgcc tgcgtctgcc gttcgtcgac     23940
     catggcgccc agcgcgctgt ccgggtccag cggattgccg gggcgcaggg tggcggcgaa     24000
     ggcggccact ttttccatga aggcgtcgta gatgccgtgc tgcacgtaca ggcgcgaacc     24060
     ggcgatgcag acctcgccct ggttggagaa gatcgccagc gcggcgacct gggccgcgcg     24120
     gtccaggtcg gggcagtcgg cgaacacgat atggggcgac ttgccgccgc actccagcca     24180
     gacgcgcttg agattggatt ggcccgagta ggtcatgaag cgcttgccgg tcgccgtcga     24240
     gccggtgaag gcgatgcagt cgacgtccgg gtgcaggccg agcgcctggc cggcctgcgc     24300
     gcccaggccg ggcaccacgc tgaacacgcc gggcgggatg ccggcctgtt cggccagggc     24360
     cgccagccgc agcgccgaca gcgaggcctg ctcggcaggc ttgaggatga cgctgttgcc     24420
     cacggccagc gccggggcca ctttccaggc cgccatcatc aaggggtaat tccacggcac     24480
     cacggcggcc accacgccca gcggctcgcg cgtgatggtg gccagcgcgt cggcgccggt     24540
     aggcgcgatc tcgtcgtagc gcttgtcgat ggcttcgccg taccacgcat agcagcgggc     24600
     ggtctcgggc aggtcgaagg ccagggcgtc gcggatcggc ttgcccatgt ccagcgtttc     24660
     gagcagcgcc agctcttcct ggtgtttggt gatcagcgcg gccaggcgca gcaggcggtg     24720
     cttgcgctcg cgcggggcca ggccgctcca gacgccggcc tcgaaggcgc ggcgcgcggc     24780
     ggccaccgcg cggtccacgt cggccgcgcc gcaggcggcg acatcggcca gcttgcggcc     24840
     gtcgatcggg ctgtgcgcgg cgaaggtggc gccatcggcg gcgtcgcaat aggcgccgtc     24900
     gatataggcg cggccttcgg gggcgagggc ggcggcttgc gcgcgccagt aggcggaatc     24960
     gtgcagggtc atgggagtcg gatgcgggca ggcccggcgg cgcgccgccg ggcggggtga     25020
     atcagcgcgg cgcgttggcg cgcgccacca tggcgtcgag cagtacgttg cagccggcct     25080
     ccaggtgggc gggctgggcg tcctcgatct cgttgtggct gatgccgtcc ttgcagggca     25140
     cgaagatcat cgccgtgggc gcgaccgcgg ccatgtacac cgcgtcgtgg ccggcgccgg     25200
     tcacgatgtc catggccggc aggccgcggc gctgcgcgcc gtcgcgcacc ttgccgacca     25260
     ggtcgggatg gaagggcgtc ggcgcgaagt actgcacctg ctcgcactgc accgatacgg     25320
     catgccgcgc ggcggtgtcg gcgcacgcct ggcgccacag cgcgtccatc gtggcgagcg     25380
     tggcttcgtc ctcgtggcgc aagtccaccg tgaagcgcac ctggccgggg atcacgttgc     25440
     gcgaaccggg gtaggcgtgg atctcgccca ccgtgccgcg gccgtgcggc tggtgcgcgt     25500
     tggcgatctc gaccaccgcc tgcagcagat ggctggccgc gtacagcgcg tccttgcgga     25560
     tcggcatcgg ggtggggccg gcatgcatct ccatgccttg caccaccacg tcgtaccagc     25620
     gcacgcccag cgagccggtc accacgccga cgatcctgtc ttcgtgttcc aggatggggc     25680
     cttgctcgat gtgcgcctcg aagtaggcgt cgaccgcgcg tccgcccacc gggtcggcgc     25740
     cggcatagcc gatggcgcgc agctcgtcgg ccaccgactt gccctcggcg tcgcgcgcgg     25800
     tcagcgcggt ctcgagcggg aatttcccgg cgaacacgcc cgagcccatc atcacgggca     25860
     gaaagcgcga gccttcctcg ttggtccaga tcgccacttc cagcggcgcg tcggtctgca     25920
     cgccgtggtc atcgagggtg cgcatgactt ccagtccggc cagcacgccg tagcagccgt     25980
     cgaacttgcc gccggtgggc tgggtgtcga tgtggctgcc ggtcatgacc ggcgcgcgcg     26040
     acggatcgcg tccggcgcgg cgcgcgaaga tattgccgac ctggtccacg cgcacggtca     26100
     ggcccgcgtc gcgcatccag ccggtgacca ggtcgcggcc ctggccgtcg agcgcggtca     26160
     gcgccaggcg gcaattgccg cccttgggcg tggcgccgat gcgcgccagg tccatcagcg     26220
     actgccacag ccgctgtccg tcgatggaga tcggggagtt gttgctcatg tctttacctc     26280
     attgcacgcc ggcggcctgg gcctgggccg cctggcggat ttccgtcagg gtctggcccg     26340
     gcgcgatgcc gtcggcttcg tagcggattt ccaatagcgc cggcaattgc tcgcgttcgg     26400
     cgaaggcgcg cgcgcgctcg aaggccgggc cgaagtcctc ggtgcgctcg accgcttcgc     26460
     cgtagccgcc gtaggcgcgc acgaattggg tgaaatcggg attctggaag tccagggcaa     26520
     tggcgcggcc cgggaattcg cgttcctggt gggcgcggat ggtaccccag atgccattgt     26580
     tgaacaccag cacgaccacg ccgacgcggt attgcagcgc cacgccgagt tcctgcatgt     26640
     tcatctggaa gcagccgtcg ccggcgtagc agaccacggt gcgggcgggg ttttccagct     26700
     tggccgaaat ggccgccggc aggccgtagc ccatcgagcc gaccgtgggc gccaggctgg     26760
     tgcccgggcc gctgaactgg cggtagcggt gcgggtacag ggcgtaattg cccgcgccca     26820
     ccgtgatgca ggcgtcggcc gggatgtgct ggttgacgta ggcggcggcg ctgtcgaggt     26880
     tgagcgggcc gggcgagggc agcggggcca gcgtggccag gtattcgtcg tgcgcggcgc     26940
     gcacggcctg cgcgcggctg gcgcggtgtc ccggccgcag cgcgtcgagc gcggccgcga     27000
     acccggccgg gtcggccacg atgcccaggg tcggcgcgaa cacccggccc agttcgttgg     27060
     ggtcggggta gacgtgcacc agccgctggc gcggcagcgg gctctcgatc acggtgtagc     27120
     cttcggtggt ggcctcgccc atgcgcgtgc ccaccgccag gaccaggtcc gcgccggcga     27180
     tgcgctggcg cagttccggc gccatggccc agccgacgtg gccggcggca ttgggatggc     27240
     gctggtcgaa gcattccagg cggcgccagg ccgtgcctac cggcagctcg aagcgttcgg     27300
     cgaacgcggc ggcctgtccg atggcctcgg cgctccagcc tgtgccgccc agcagcatga     27360
     agggccgctc ggcctggtcc agcaattcga ccatgcgcgc caggtcggcc gcgccgggca     27420
     ggcagcgcgc gcgctggtag cgcggcatgt cggccacgcg ggcgcggccc cacagcgtgt     27480
     cctcgggcag cgccagcacc accggcccgg gccggccgct ggtggccacc gcgaaggcgc     27540
     gcgcgatgaa ttcgggaatc cgctcggtgc ggtcgatctg cgcgacccac ttggccatct     27600
     ggccgaacat gcggcggtag tcgatttcct ggaacgcctc gcgctccatg aagtcgttgc     27660
     cgacctggcc gatgaacaga atcatcgggg tcgagtcctg gtaggccgta tgcacgccga     27720
     tgctggcgtt ggtggcgccg gggccgcggg tgacgaagca gatccccggc tcgccggtca     27780
     gcttgccata ggcctcggcc atgtaggccg cgccgctttc ctggcggcag acaatggcgt     27840
     cgatggcgcc gcgatgctcg ttcagggcgt cgatgcaggg caggtagctc tcgccgggaa     27900
     tcatgaacac gcgccgcgcg ccgtgcacgc gcagctgctg catcaggatc tggccgccgt     27960
     tgcgctcggg cagggctggc gtggtcatga ctgctctcct tgggactcgc gggggcgcgc     28020
     cgcgcgggcg gcccattgtt cgaattcggc gtggcgcgcc agcaggcggc gcgcggtgtt     28080
     gtagtcgggc gggtcgacgc gcgcgccgcc ggcgtcgcgg ccgtcgcgtt gcgcctcgaa     28140
     gcgggccgcc aggtcgcgcg cggccgccac gcggtccgcg tccggcgtga aggcggcgtg     28200
     aatggcgggc acctgttcgg cgaacacggc gcacttggat ttcaggccga tgcggcgcgc     28260
     ccacagcagg tcggcctgct gggcggcggg gtcgcggtag ttgaacgggc agtcgatcgg     28320
     caggcagccg gccgcgacgc aatcgaccag gaagcgcgcg cgcagggcgt gcagctcgat     28380
     gccgtcgggg ccgcgctcgg cgcccaggct ggcggtcagg tcctcggcgg ccagcaggca     28440
     ggccgatacg cgcgggctgg ccgtcaggat ttcgcaggcg cgcgtcacgc ccagcgccga     28500
     ttccagcgtg ggcacgatct cggtgctgcc cggcgccagg ccggcctcgg cctcgcaggc     28560
     cgagatggcg cggtcgagcg cggcgatctg cgccgcgctt tcggcatgcg gcaggaaaat     28620
     cgcgtccggc gcgccggcca tgatgccgcg caggtcgtcc aggccgtctt cttccagctt     28680
     gttgatgcgc accgcgccga tcacgccggc ggcgcggcat tgcgccagca gcgcgacgat     28740
     gcggcggcgc gcggccggac ggtcggccgg cgcggtgaac tcttccaggt cggccaccag     28800
     cgcgtcggcg ccgctggcca ggccggccgc ctgggcctgc tccagcagcc cgggaacgaa     28860
     catccagctg cggcgcaggc tggcggggcg gcgttggccg cccgggttgg agatgggggt     28920
     cattgcacgt gcctcggcag gaacagcacc agttcgggga cgaaggtcag cagcagcatg     28980
     acggcggtca tggccagcat catccagctc agcgggcgca gggtctgcat catgttgatg     29040
     ccgccgatct tgcaggcggc catcaggtcc acgcccaccg gcggggtgtt cgcgccgatc     29100
     gccatgttga tcgacagcag gatgccgaaa tgcaccgggt cgatgttgta gtgggccagc     29160
     accggcatga ccaccggcgc cacgatgatg atgaccggga tggcttccat gaaggtgccc     29220
     agcagcagca gcaccaccgt cagcaccagc agtacggcga tcttgctgtc ggtccagtcc     29280
     accagcaggc cggacagggc ctgcggcacc tgctcggcca ccagcaccca ggcgaacagg     29340
     cccgaggcgc cgatcagcag caggatggac gcgctgcctt cgccggtcga cttcaggctc     29400
     tcccacaggg acttcaggct gagcgtgcgg taccagaaaa agcccaccag cagcgcatag     29460
     acgatggcgc tggaggcggc ctccgtggcg gtgaagatgc cgaagcggat gccgccgatg     29520
     atcagcacgg gcaccatcag cgcgggcagg gcgtcgatgg cggcggcgcg cagctcgccc     29580
     cacgagaacg gctggccgcc ggcccagttg tgcttgcggg cctgccagat cgccacgacg     29640
     atcagcgaag cgcccagcag gatgccgggg atgatgccgg ccaggaacag cttgcccacc     29700
     gaagtgtcgg tgatagtgcc gtagacaatc agcacgatgc tgggcgggat gatggtcgag     29760
     gtggcgccgg cgctgccgat cagcgcgcag ctgaacccct tgtcgtagcc gctgcgtgcc     29820
     atggcgggca gcagcaggct gccgatggcg atcacgtcgg ccacgcccga acccgacagc     29880
     gcgccgaaca tcaggcaggc cagcacggcc accacggcca ggccgccctt gatatcgccg     29940
     acgatggccg cgcacagccg cacgatgcgc tgcgtcaggc ccgcgccatt catcagctgg     30000
     gcggccagga tgaacagggg aatggccagc agcgtgaagc tgtccaggcc gaccacgtat     30060
     tgctgggccg ccaccatcat cggggcggcg tcgtagacgg ccaggtacgc caggcacgcc     30120
     agcaccagcc cgaaggcgat cggcatgtcg atcagcaccg tgaccgtgaa tacgcccatc     30180
     aggaaaaggg caccggtaga catcttttaa tcctttgccg cgacggggtc ggccggttgg     30240
     aacaattgcg ccaggtgcac cacgatggtg atggcgcacg ccaccggcag ggcgaggtag     30300
     accgtgccgg ccgatacgtc gagcgcgggc agggtctggt ccatggtcag ttcggccagc     30360
     tgccagccgg cataacccag cgcggccagg ccgacgatga tcaatgcctg gttgacgcgg     30420
     tcgcagatgg ccagcgcgcg cgggttgcgc acgacgaagg gcagcagccc ggccatcagg     30480
     tgggtgcgtt catggctgca ggtgacgccg ccgatgaagg ccgcccacac cagcaccagg     30540
     cgcggcaatt cctcggccca gtgcggcgtg gtgtgcatca cgaagcgttc gaacacaacg     30600
     taggtgatca gtgcggccag caaggccacc gccagggcgg cgatggcctt gctcaggccg     30660
     gacagcgcgt gcgagatccg gcccagcatt tacttggcct cgcggtactt ctgcagcagg     30720
     cccatcagct cggggccata ggcggtttcg taggtcttcc agatcggcgc gacggccgcg     30780
     gcgaaggggg ccttgtcgac ttcgttgacc tgcatgccct tttccttgag ctgcgcgacg     30840
     aactgcaggt cgccttcggt gatcatctgg cgttgcgcgt cgcgccactt gtcggcggcg     30900
     gcctggacga tcttgcggtc gtcggcagag atgcggttcc agatcggctt ggagacgatc     30960
     aggcttgccg gaccccacac gtgaccggtc agcgacagat acttctggac ctcgaagaac     31020
     gacgaggtgt agatgatcga cagcgggttt tcctgcgcgt cgaacacctt ctgctgcagg     31080
     gccgagtaga gctcgccgaa ggccagcggc gcggggttgg cgcccagggc ggtgaaggtg     31140
     tccaggcgca tcttgtcggg cgtgacgcgc gtcttcaggc cgttcaggtc ggccggcgtg     31200
     ttgaccgggc cgcgattgtt ggtcaggtgg cgaaagccgt tttcccacca cgacacgatc     31260
     accaggttct tcttctcggc cagcttggcc agcgccgcgc ccagttcgcc gtcgtaggcc     31320
     ttgtaggcct gctgcgaggt ggtccaggtg tagggcagct cgacgatgcc gaacttcggt     31380
     tcgatcggct gcagcgagcc cgagccgatg atggccgcgc cctggctgcc gatctgcagg     31440
     ccctcgagca tggtcttctc attgcccagc tggccgctgg ggaacaggat gaagttgacg     31500
     cggccggcgg tcttttcctt gacttcggcg gcgaaacctt cggcggcctt gttccagctg     31560
     tggctggggg ccagcacgtg gcccagcttg atgtccaggg cgtgggcggc cggggcgatt     31620
     gccagcgcca ggccggcggc ggcgaacagg gaggtcaggg tacgggtcag ctgcatggtt     31680
     ttcaccttga aatgttctgg cttgtgaaac gtcgggagga acgaagccgg aaaccgccgg     31740
     cgcaagcggg cccaggccga cgcgcgagcg tgtcggcggc aaggcgggaa atcggcaagc     31800
     agggcgccag cgtcgggcgc gggaggcgga cgggccgccg gaatcaattc atcggatggc     31860
     tccgctgcca aagtcttcgc gcaggcgcgc caggatgccg accagatggt cgtgcatggc     31920
     atggcgggcc cggataggat cgcggtcgac gatggccgcg aggatgcgtt cgtgttcgcg     31980
     ctcggcggct tcccagacct tggtcgtgac gaaatgctgt tcgagccggc tgaacaccgg     32040
     gctggtggcg ctgaggtgcc agatatgcga gatggcggcg gccagcgcgg cgttgccgca     32100
     ggctgccgcg atggcgccgt ggaaggcctg gtcgtgggcg ccgggcgagt cgctcagcga     32160
     catcgccgcg tgcgccgacg agatcgcggc gatctgcgcg ggcgaggcct tctgggccgc     32220
     cagcgacgcg cactcgggct ccagcagcag gcgcgtgtcg agcaggtcga acggaccgat     32280
     gtcggtgtgg ccgggctggg gcgccggcgc gacgccatag tcgccatcgg cgcgcggcgc     32340
     cgccacgaac acgcccgtgc ccacgcggac ttcgacatag ccttcgattt cgagggcgat     32400
     cagggcctcg cgcaccgagg cgcggctgac ctgcagttgc tcggccagtt cgcgctcggc     32460
     gggcaggcgg ccgccggcgg gaaaatcgcc ggcgcggatg cggccggcga tctggtcggc     32520
     aatcatgcgg tacaggcgcg tgggggcgac ggcttggaag gatcccatgg ttggtggcgt     32580
     gtccggttat ctggtggccc agtggtcagg ccactaatat accgaagcgc ccggcgaata     32640
     aaaatagcgg gcgatggcga atccgggctt tctagggaaa accactaggc cgcgccgcgt     32700
     ccgcccgccg ccagcgccag cagcgcctcg cgcaacacca ccgcgttgtt gtgctcggtg     32760
     tcgcgcgcgc cgtagaccag cgtaagcggg ccggccccgg cctgcgccag cagggcgcgc     32820
     agctgcgcct gatgcgacgg gccgcgcagc tcggccagat agcgttcgcg aaacgccggc     32880
     cagcggggcg tctggtggcc gaaccactgg cgcagcgccg cgctgggcgc caggtccttg     32940
     atccagtcgt ccagcggcag ggcgtccttg cgcaggccgc gcggccacag cccgtcgatc     33000
     agcacccggc gcccgtcggc gggcgcggcg gcctcatagg cgcgcttgag atggatggcg     33060
     ggcttcatgg gcgcgggcgc gtttgcgcat acactgggcg gcctgatcga aagcgagttt     33120
     tcatgaggcg gtttcctggg cggatgctga agtggctggt cctggcctgc ggcctggcga     33180
     cggcggccgg gctgctcgcc tggcggctgg cgccgtcttc cgactatatc gcgcctgcgg     33240
     ccgggcagga ccgcctgcgc ggccaggcca tctaccaggc gaactgcgcc gcctgccatg     33300
     gcgcgcggct cgagggccag cccgactggc gccagcggct ggccagcggg cggctgccgg     33360
     cgccgccgca cgatgccagc ggccacacct ggcaccaccc cgacgcggtg ctgctggaca     33420
     tcatccgcca cggcatggtg ccgggccgcc acgcgccgga cggctaccat agcgacatgc     33480
     cggcctacgc gggcgtgctg tcggacgcgg agatcgcact ggtgctcgcc tatataaaaa     33540
     gcacctggcc gagccaggtg cagcaggacc agcgggccgc cacgcagcag atgacgccgc     33600
     gctagcgtgg cggcgcctca gtgcgccagg accatggcga agtagccgaa cacggtcagc     33660
     agcacgccgg agacggcgta gccgaccggg aatcccagcc agggcacgct ggagccgact     33720
     tccttggcgg cttcgcgcgc cggccccgag tggctgcgcg cgccggcggt ggcgcccatc     33780
     agcagcgcgg ggttgatctt catgatgtga aagccgatgg cccacacgat gatgggcggg     33840
     atggtcgagg cgagaaagcc cacgatgaag atcttcagcg cgatcgcgcc ggtcagctgg     33900
     gtgagcaggt cggcgccggc gttgatgccg acgatggcca cgaagccgat caggcccagg     33960
     tcctcgagga tgttgcgcgc ggcgttgggg gtgttgccga aaaagcgcag ccgcgaggaa     34020
     atcgacgaca cgatgatgcc cgacagcagc aggccgcccg cgttgcccag ccccaccttg     34080
     gcgccgaacg ccggcacttc gatcagcccg atcagaaagc ccaggatcat gccgaacgac     34140
     agggtcagca ggtcggtggc cgagctatgg cgcgcaatca cgccgaagat ctcgccggcc     34200
     ttgctgacgg ccggctgcag gccggtcacg aatagcacgt cgcgcttttg cagcgtggtt     34260
     tccaggccga tgggcagcgg cacgccgctg cgctcgacgc gctgcagctg gatctgcccg     34320
     gccagctccg aaccgcggaa ggtcttcagc ggccggccgg tcacctcctt gttggtcacc     34380
     aggatctcgg cctggtccag cggtatgttc agcgcgcggg cgtcgggcac ctcggggccg     34440
     agcaccccca tgttggcggt catttcctcc aggcggccgc ccagcgccac cacgtcgccc     34500
     tgctgcagca cggtctcggc cgaggggccg agcagctggt cgccgcgctc gacattgacc     34560
     acctggtact ggggaaagcg cgtgcggaac tgctggaccg tcttgccgat cgattccggg     34620
     ttctcgaccc ggtaggcgcg caggtcgaac ggatgaaagg ccgtcagccc ggcgtcgtcc     34680
     acgttgggca cgccatgcgc cttctcgaac tcgagcgcgg cggccttggc gtccacgccc     34740
     cagatgcgcg gcaggtactt gcacagcagg atgatgccga ccgtgcccca gatgtaggtg     34800
     atgccgtagg acagcgcgat catggcgctg atctgctcgg gactctccga acccagcgac     34860
     agcacgccgg cgctgaccgc ctgttcggcc gagccgatgg ccgccgacat ggtctgcgag     34920
     ccggccagca tgccgccggc cgcgcccagc ggcaggccga agaactgcgt gcccagcacc     34980
     acgatggcca ggcccaggat cggcgcgatg atggccagga tggcgtagtt gatggactcc     35040
     ttgttcagcg cgttgacgaa ggacggaccc acgcgcagcc ccacgccgta catgaacagg     35100
     taatagagca gcgacttggc gaactcgtcc aggtggaact tgacgccgta ggccgcgccc     35160
     acggtggcga ccaggcagcc gaccacgatg gcggcggcga ccgcgcccag cccgtagccc     35220
     ttgatggaaa acttgccgac ccagaccgcc aggccgatgg tgagaaacag cagtatgtag     35280
     gggttgctgc ccaggaattg cacgaaagcc tgcatggtct atgctccgcg attcgtccag     35340
     tcaaccgtgc gatgcccggc cggcgcatcg cacgccttgc gcgcatggcg gcggacccgg     35400
     ccgggcccgc cgcgcggccc tagcacttgg ccggcgagga cttgtgcgtg tcgtgcagcg     35460
     ccggcggcgt ggccgtcccg ccgtgctgct ccaggtactt gcacgccttg acgatgtctt     35520
     cggccagcaa cagcgcgacg ttgcggttga tgtgcgggcg caccaccacg cgcaggctgc     35580
     gcaccgactc cgcgtcgggc ggcatggtat aggcggaaat cacccagccg cgttcgcgca     35640
     ccttgttgga cacgtcgaac tcgttgaact tcttgacctt ggggtccagc gtgacggcca     35700
     ccacgggaat gcgctgcgta tcgttcatga tggtgaagta gccgctgtcg accaggtgct     35760
     ggcgcagcgc gatggcgttg tccagcgtgc gctgcatgac gcgcttgaag ccgtcgaagc     35820
     ccaggcgcag gaactggtag tactgcaccg ccacctggaa cgagttgcgg ctgaaattga     35880
     gcgtggccgt gggcatctcg ccgcccagat agttgacgta gaagaccagg tcttcgttga     35940
     acaccttgcg ttcgcggaag atcacccagc ccaggccggg cggcgtcagg ccgtacttgt     36000
     ggccggaggc gttgatcgac tgcacgcgcg gcaggcggaa gtcccatttg tagtcgggat     36060
     acaggaacgg attgacgaag ccgccggagg ccccgtcgat gtgcatgggc accgaaacgc     36120
     cggtcttctt ctcgtaggcg tcgagccagt cgtggatgcc ctggatgtcg tcgtcctcgc     36180
     cggtgaaggt ctggccggcg atggcgacca ccgcgatggt gttctcgtcg acgtacttgt     36240
     ccaggtcttc ggcggtcagg cagtactggc cgggcttgag cggcacgatg cgcggctcga     36300
     cgtcgaaata gcgcaggaat ttcttccaca cgatctgcac gttgccgccg gtgaccatgt     36360
     tgggccgggt ggcgtccttg ccttcgcgtt cgcggcgctg gcgccagttc catttgtgcg     36420
     ccaggccggc cagcatgcac gcctcggacg agccgacggt ggccgtgccg tagggttcgg     36480
     cgtccttggg gccgttccac agctggtgca gccacctgac catgcgctgt tccatggcga     36540
     acagctgcgg gtacatgtca tggtcgatgt agttcttgta catgttcttt tcggcgatcc     36600
     ggacggcttc cggctcggcg aacgtcgtca cgaacgacga catgttcagc atcgggttgg     36660
     tatcggtcca ttcgtcgctg agcaccagcg cctgggcggc gcgcgccgac atgccctcga     36720
     ccgggaagtg gtcttccggg acttcgatgt tgaactggtc gtaaggcgtc atctgttctg     36780
     gcgatttgct catgctggat ctccgaagtg aactggcggg gaacaaggac agagccggcg     36840
     ggaacgcggc cggcgtacgc taagactgga atggctgggg cgcggcgttg cgcgtcgcgc     36900
     tagcgcggac ggcgcggcgg gacgggcagg aagcgggagc ggggcgcggg acgcgccggc     36960
     ggggcggtgg cggcggcagg ggggcggaag gtgttgcagg acatggacga gctcacataa     37020
     atgatgattt atgcaaaccg ttgcctactt gcggcagcgg gccgactttc gacgcggcgg     37080
     tgactcagta tggagaatgc ccctgggccg catgcgtagg atgatgcctg atgtcgatac     37140
     ggagcacaat gaaatttgca acgtaacgta acaaatgttc ggcgatccgg gggctttcct     37200
     aatccgcggt tacgggcccc atggcggcct gcgcggggcc ggccggagcc ggtggcgcgg     37260
     catggccgcg cccgcccgcg gcgctgacgg agatgtagct gacggcgtgc gtgacctgcg     37320
     gcgggttggg cccgctgtga aaggcctggg ccgcgtcgat ggccatcttg tcggccagcg     37380
     tcatgcggtc gttcatgcgc aggtactgca gccaggagtc gaccacgaac atctccgacc     37440
     agcgttcggc gtcctcgagg tcgcggaaca attgccattg gtcggcgccg ttgcgcatgc     37500
     gcatcagccg cagcgggccg gccgcgtcga tgaaggcgcg cgcgcgttcg gcggcgatgc     37560
     ggtactcgat cgagaccagc accacgccat ggcgcgcgtc gaagtccgac tgtccggcgg     37620
     gcagggccgc ccgcggcagc accgagaggc acttgtcgtc gacgtggtcg ggcagccgcg     37680
     agcggtacag cagcgccacg gtgaacagca gcgccacgcc ggccgccgcc atcgccccgc     37740
     gggtgcccat gctgccggcg aagtggcccc agatgaacga gcccagcgcc agcccgccga     37800
     aaatggcggt ctggtagagc gccagcgcgc gcgccttgac ccagtccggc accagcagct     37860
     gcacggtggc gttgtaggtg gccagcacgg cgatccagca cgagccggac agcagcagcg     37920
     ccgggaacac cacccacagg ttttcggtca cgcccagggc gatcaggccc agcgccagca     37980
     aggcggcggc cacgctgatc aggcggctga cgccgagccg ccgctgcacc gcgcggatgc     38040
     cgaggctgcc ggcgatggcg cccaggccga gggcgcccag catgtagccg tacagcgagg     38100
     cgctgccgtt gtcgtgttcg tgcgccagca ccggcagcag cgcccacagg gcgctggccg     38160
     acaggccgaa cgagaaggcg cgcatcatga ccaggcgggt cacgttcgag tactcggtaa     38220
     agcgcagcgc cgccaccacg ccttcgtaga tgcgctcggg cggcagggtg cgcggcggcg     38280
     tttcgcggcg ccagcgccag atcgcccaga tcagcgcgcc atagcagaag cagttcagca     38340
     ggaagaccca gggggcgccc agggcgccca gcagcacgcc gccgatggcc ggcccgatgg     38400
     cgcgcgcgac gttgtagttc acgctgttga gcaggacggc gttgcctacg tactggcgcg     38460
     gcacctgctc gctgacggcg gcctgccagg ccggggtgac gatggcgctg ccgatggaga     38520
     ccacgaacac cgccacgatc agggagaccg ggtgcagcag cccgaggaag gccagcgccg     38580
     tgatgagggt gccgacgacc agctccaggc ccatgcccac cagcatcacc ttgcgccggt     38640
     cgtggttgtc ggcgaccacg ccggtcacga tggacagggc caccaggggc agggcggcgg     38700
     ccacctggat catggcgacg atgagcgggc cgctctgggc ttcggtcacg atccaggccg     38760
     cggcgaccga ctgggcccag atccccagat tggcgaacag gttggcgatc cagatcatgc     38820
     ggaacgccgg atagccgaac ggcgccagca ccccggggtg ggacggcggc ggggcggctt     38880
     cggcgctggc gcgcggcagg tcttcggggg cggaggcggg ggcttgcagc atgggagcaa     38940
     ggaaggcgcg gcgcgacgcc gtcgggtgcc tggtaccttc tcgcgccgcg ccgaccctgt     39000
     caagcgcgcg cgggtagaaa cggatgcggc ggcgttcctc ctggtgtagc atccgtatgc     39060
     ccgccccacg cggcaaggaa atggccggcg gcgcatgacg cctctgtctg gagctgacta     39120
     tcttggcgct ttcccggcct gcacgcttac tgagccgtat cggcatggtg accgcactgg     39180
     gcatcgtggc ggcgctcggc atcgtgatcg cggtggcatc catcctggcc caggaccggc     39240
     aacaggtctg ggagcgcgaa gcccgttcgg cccgcaatgt gctgcaggcg ctggccggcg     39300
     aattcgagcg cacggtgacg gcctacgacc tggtcatccg cggcgtcatc ggcgacctgg     39360
     cccagccggc ggtggcggcg atggggcccg aggcgctgca tcgcctgctg ttccagcagg     39420
     gcgcgcggcc cgacaacctg gcggtcctgc tggtgctcga cgagcgcggc gaggtgatcc     39480
     tggattcgcg cacggccgtc gttgcacccc gcaaccgctc caggcgcgat tacttccagg     39540
     cgcatgtcga caacccgcag gccggcctgt tcatcagcaa gccctatcgc agccgcaacc     39600
     gcaacggcga gctgagcatc gcgctgagcc gccgcctcgc gcatccggac ggcagcttcg     39660
     ccggcgtggt ggtggccgcg gtcagcctgt cgtatttccg cgaccgcgtg gtccagctga     39720
     acgtgggacc gcgcggctcg atgaccctgt tccgcgacga cggcatcgtc atcagccgca     39780
     agccgtacgt ggaggcgcag atcggcgtgg acctgagcga gtccgccaac gtgagccggt     39840
     tccggcgcga gggcaggggc gccttcgtcg gcaccgccat cctggacggg gtggaacggc     39900
     tctaccagtt cgagcgggtg ggcaagctgc cgctgatcat ggtggtggcg ctgtccaccg     39960
     acgacatgat gacgccatgg cgccgccacg cctgggtgct ggccagcgcc gtgctgctac     40020
     tgtgcgcgtt gctggtggcg ctgctggcgg cgctcgagcg cgagttgcgc aggcgccgca     40080
     acgccgaggc cgagctggcg caactggcgc gcatcgacac cctcagcgga ctgctcaacc     40140
     ggcgcgcctt cgcgcaggtg ctggcgctgg agtgggaggc cgcgctgcgc ggccgcacgc     40200
     cgctggcgct gctgctggtc gatgtggacc acttcaaggc ctactacgac tgttatggcc     40260
     gttcggccag cgatgtgctg ttgcggcgcg tcgccgatgc ggtgcgcgat tgcgtgccgt     40320
     atgccgccaa tgtggtggcg cgccacggcg ccgacgaatt cgtggtgctg ctgcccggca     40380
     tggggttgcg cagcgccgcg tggctggccg agcgggtgcg cgcccgcgtg ctggggctgg     40440
     ccgtgccgca ccgcggcaac cggggcggcg tggtctcggt cagcatcggc tgcacggcca     40500
     tgacgccgct ggccggcagc gaggccgcgg tgctggtcga acgcgccgat gcggcgctgt     40560
     acctggccaa gtcgcgcggc cgcaaccggg tcgagcgcat cggcgacccg agcaccgcgg     40620
     ggcagggggc ggagcgcgaa atggcgcagg agccgggcgg cccctagcgc ggcgcgagcc     40680
     gcgggcaggc cggggccgac cggatgttca ggaatctgta agaaatggta aggttgggga     40740
     ttatgcgcgc cgctggcgcg tctagccctc catgacctcc gattcgccaa cctttcccgt     40800
     cgccgcccag ttgcccgccc tgcgcgccta cgcgcgcacc ctgacgcgca acccgcacga     40860
     cgccgaggac ctgctccagg aggcgctcac gcgcgcctac gagcgccgcc ataccctgcg     40920
     cgccgacggc aacctgcggg cgtggctgat ggcgatcgtg cacaacgtgt tcgccagcga     40980
     atggcgccgc cgccaggccg cgccggcgca ggccgcgccg ctgcacgaca tggaggacgc     41040
     cgccgcggtg gcgccgcccc aggagcacag cgtgcggctg gcgcagatcg agcgcgcctt     41100
     catgcagctg cccgacgacc agcgcgccgc gctgcacctg gtgacgatag aaggcatggc     41160
     ctaccaggaa gccgccgacg cgctgcagat cccgatcggc acgctgatgt cgcggctggg     41220
     ccgcgcccgc gcggcgctgc gccgcttcga ggacggcatg ggcgaggcgg cggctgaccg     41280
     gcgcgcccgc ttcaggatcg tgggaggccg ggatgccgca tgaacctgtg accgagatcg     41340
     atctcaacgc ctatgtggac gggcagctcg acccggcccg ccgcatcgag gtggaggact     41400
     tcctgtcgcg ccaccccgag gaggccatgc gggtcatggc ggacctgcgc cagcgcgacg     41460
     cgctgcggtg ggccctgggc gcgtcgcagc aggcgccggc cgacggcgcg gacaccccca     41520
     cggccgtgca cacccggcgc ctggcgcgcc ggctcgaacg cgggctggtc cgccgcgggc     41580
     tgggcgaccg gttgcgccag gccgccgcgg cggtgctgct ggtggccgtc ggctgggccg     41640
     ggcatgtcgg gtacgcggcg cgctacccgg acatgcggca cgtggtggcc gcgaccgcgc     41700
     cgtccttcgt cgaggacgcc gtgcaggcgc accgcaccgc caaggtgcgc gcggccatgg     41760
     catcgcagcc gcgcgtgccg catctggatg ccgacgaatt gctgcgcgcc accggcgtgc     41820
     gcgtgccggc cctgccggct tcctgggccg tgcgcgacgt gcaggtcttc cccggccgca     41880
     ccgggcccag cgtggagatg gaagtcgagg ccgccggcct gggccggctg tgggtgttcg     41940
     ccgcgcgcga gcccgcccat gccgccgagg ccgcgccggt cgtctcgcgc ttccaggacg     42000
     ccccgatcgc ctattggcag caggggcagt gggcttacgc gatcaccggc gacttgcccg     42060
     atgccgaact gggccgcgcc gcgggccaga tgaccgtcgc gatgctggcc acgccctgac     42120
     gggcgcccag tgtttctgtt ttcaccaccg aggagtatcc ccgcatgaca caacacgtta     42180
     tggcgcgcgg cgccgaagga ggcgcccgtg cttgagtttt tccagaccct gagctgggcc     42240
     gccgtattcc agatcatcct gatcgacatc ctgctgggcg gcgacaacgc ggtcgtgatc     42300
     gcgctggcgt gccgcaacct ggagcccaag cagcgcatgc agggcattct gtggggcacg     42360
     gccggcgcca tcggcttgcg ggtcgtgctg atcgccttcg cgctgacgct gctgacggtg     42420
     ccttacctga agatcgtggg cgcgctgctg ctgctgtggg tgggcgtgaa gctgctgatc     42480
     cccgaggatg acgcgcatgg caacatcaag ggcggcacgt ccatcgccgc cgcggtcaag     42540
     accatcatca tcgccgactt cgtgatgagc ctggacaacg tcattgcgat cgccggcgcg     42600
     gcgcagggcg cggcgcagga gcaccagctg ggcctggtga tcttcggcct ggtggtcagc     42660
     gtgcccatca tcatctgggg cagcacgctg gtgctcaagc tgatcgaccg cttcccgatg     42720
     gtcgtcacct tcggcgcggc gctgctgggc tggatcgccg gcggcatgct ggtcaccgac     42780
     gtggtggtgg tcgagcgctt cggcgaagtc tcgggcgtcg cgaagatcgc cgccgaggtg     42840
     gcgggcgcgc tgctgatcgt gggcctgggc cgctggttcg cccgtcgcaa ggccgcggcc     42900
     gcgccgcaga ccgcgcgcga aagcgcctga cggcatggca gcgggcgggc gcgcgcccgc     42960
     ccggcgaacg aaccggcgcc ctggtggcgc cggtttcttt attgcgcaag aaatgcccat     43020
     gccgatgcgc gggcaggcgt ggcgcggcgg cggggtgggt tatccacagc ttttccaccg     43080
     cgcttgtgga tgaatgcgcc gccgcgtgtc acccggccgc ggcggatgcc gcgccgtcca     43140
     gccagcgcgc gtagtccggt ccgctcatgg ggcgggcgaa caggtagcct tgtccctggc     43200
     ggcagtgcag ctgcagcagc gcctggtgct gcggcgggtt ctcgataccc tcggccacca     43260
     ccgtgatgcc caggcgctcg gccatggcca gggtggcggc gaccacgctt tcgctgcgtg     43320
     cgtcgccggg caggcggcgc acgaacgagg cgtcgatctt gagttggttg aagggcaggt     43380
     ggcacagccg ctgcatcgac gaaaagccgg tgccgaaatc gtcgatcgac accgtgcagc     43440
     ccatcagccg caggcgcacc aggttttcga gcgtggccgc gggcgcgtcg agtagcccgt     43500
     tttcggtgac ttcgatggtc acgatcgagg cgggcagggc gtgcttgcgc agcgcctgcg     43560
     ccagggtcgg caacagctcg gccgaaccga gctgcgaggt ttcgaagttg agcgccaggt     43620
     cctgcgtggc gccggccgtg gccagcaggc gggcctgtcc cagcgcggcg tcggtcaggt     43680
     gccagatcag gcggtcgagc aggtcctgct ccttgagcgc ctccaggaac gaggcgggac     43740
     cgagcacgcc gaggtcggga tggcgccagc gcgccaggac ttcggcgccg caggggcgca     43800
     gggtcagcag gtcgaccttg ggctggaagt agggcacgat ctggccggcg gccagcgcgc     43860
     gggcgacctc gcgcgcgggc ggcgccggcg gctggcggct ggccgtgggg gcggcgttgg     43920
     cccgggcgcg ctggcgctcg gcctcgtggc ggtccagcag ggccttcagg cgttgggcgt     43980
     ccagcggctt ggccaggtcg cccagcaccc gcagcccgat cagcgccgcc atgtccagca     44040
     ccgccgcgat caggtcgctg ctgacatcgc tgctgatgat gaccgcgccg agcaactgcc     44100
     ggcgggcggc cacgcgcagg aactgcgcgc catccatgcc ggacatcttg atgtcgcaga     44160
     tggcgatgcc gacctggccg tgctcgtcca ggcggcgcaa ggcttcgttg ccgtcggccg     44220
     cctcgaggat gcgggtgtag ccgagcgcgc gcagcgcatg gaccacgacc aggcggtggg     44280
     cgggatggtc ttcgacgacg agaatgtcgg gcagattcat gcgtatccct gggccgccgg     44340
     atcggcgtga gcaaccctga tgcttatatc gctttgcctg cgtttttcca agcctgggcg     44400
     gctcagtcct tcattgcaaa tgagaatcga tattatctat aatcgatgca tcgtggcctt     44460
     gccgcctcgc tacgcctgag ccatttcgcg ccatgcccca catcccgctc cagtacgact     44520
     tgctgcaaca ggaatacgcc gccttgctgt cgcagtacgg acgcgcgcag acgcgctgca     44580
     gccgcctgct gtcgcggcac gccgagcaga tcgcgcaatt gcgccaggag gtcatggtgc     44640
     tgcgcggcgc gctggtggcg cagaccagcg ccctggcctg ggcccgcgag gaccgcgctg     44700
     ccctggaggc gtccctgccg ggcctgccgc gtcgccgcgt gctggcgcgc cgcctcgact     44760
     tcctgatgga acgggtgcaa agcctgctgc gcgcgcgttc cggcggcacg cccgggcccg     44820
     cgctgatggt cgatgccagc gcgaagtcgg tgctgtgcgt cggcgcgggc ggggccgccg     44880
     cgcgggccgc gcgcgcagcc atcgagcgcg ccggcggccg ctttctgcat cacgacggcg     44940
     aagtcggcga tgccgccggg ctggaagcca gcctggtatc ggccgacctg gtcatctgcc     45000
     agaccggctg cgtcagccac ggcgcgtact ggcgcgtgca ggaccactgc aagcgcacgg     45060
     gcaagcaatg cgtgctggtc gagcagccgg ccgccctgaa catcgtgcgg gtgcgcaggc     45120
     ccgccgacgc gccgcaggac tgagcgcggc gccggtagcc ttgccttccc ggccggccgc     45180
     agggattaag cgcgccgctg gcgcgtctat tgcggtatgc attcgtacat cttgcccagt     45240
     ccgtgccgcc aggcggccgg gctccgatcg tgaagggcgg acccgcggac cccatcgcgg     45300
     atgtcgagct ggacgcctac atcgacggcc agctcgatag cgcgcggcgc gccgacgtcg     45360
     aggccttcct ggcgcgcgac gcgcgcgcgg cggcgcgcgt aagcgccgac ctgcgcctgc     45420
     gcgatgccct gcggcaaggc gccacgcgcc atggcgccgg cgcgcgcgac gcgcatacgc     45480
     gggccctggc cgaccgcctg caggcggccc acgcccggcg gcgggtcgcg cgccgcgccc     45540
     ggcgcctgct ggcggtggcg atcctggtgg ccgcgggttg ggcgggacat gcggccctga     45600
     cggcctggac gccggccgag ccggccggcg acgccggcgt gcaggtgttc ctggacgagg     45660
     cgatgcgcgc gcatcgtacg gcgcagttgc gcgccggcat gcgctcgcag cctgccgcgc     45720
     cgcgcctgga ccgcgccgaa ctggcgcgcc aggccggcgt gccgctgccg gcctggccgt     45780
     gggattggct gccgcgcgat gtgcaggtct ttccgtcgcg cggcgggccg gccgtggagg     45840
     tggcgctgct ggccgggcgc gcgggcccga tctcgctgta tggcgcgcca ggcggggcag     45900
     gccccgacag cgcgccgcgg atggcgcgcg gcgcgggcgc cgaggccttg ttctggtggc     45960
     ggcgcggcgc ttgggtctat gcggtgatcg gcgcgttgcc ggaggcggcg ctgcggccgc     46020
     tggcgcagcg gctggccgac gcccccctgg tgcacgagta ggcgagcaag cgcgattcgg     46080
     cgcacaatgg gatggtccgg ccggcgtgca ggcggcgggc cggacacgca gccccatgcc     46140
     ggccgtccgg cttgacgcgg gtcaagccgg tggatccggc agggcgttat ggttgtgcat     46200
     ccgggcctgg cggcgccgtg ccgcgacatg cccggccata ctttggagct cgccatgtat     46260
     caacacatcc tcattcccat cgatggctct gacctggcca atacggcgat cgacaagggc     46320
     ttggcgctcg cgaaagcgct gggcgcccgc gtcacggtgc tgacggtggt cgagccctat     46380
     ccgcacatgg ccgccgaggc cgtgcagctg ggcggcctgc gcaaggaata cgaaaagcag     46440
     gtccatgcgc gcgccagcga atggctggag cccgcgggcg ccaaggccgc ggccgcggga     46500
     gtgccgtgcg agctgctcaa gcgcgacgcc gacatggcgt ttcgcgccat cgtggagacg     46560
     gcggccgaac ggggctgtga cctgatcgcc atggcctcgc acgggcgcgg cggcgtggcc     46620
     gcggtgctgc tgggcagcca gacgcagaag gtgctggcgc attcgcaggt gccggtgctg     46680
     gtgtaccgct agcgcggcgc cggccaggcg gaccgcgaca ttgctatgat ggccggcttg     46740
     gcccgcgtcc ggcgggacgg gccgcccatt cgtcgtttcc agaggccgca tcttgaatac     46800
     ccccacgccc gtttccaccg attacctgcg cgcgcaccag ttcctgggtt tgcagccggg     46860
     gcccaggttg ctggtgctgg gcgcggtgca cggcaatgaa gtctgtggca cgcgcgccat     46920
     cgaacgcatc ctggccgagc tcgaaagcgg cgcgctggcg atcacgcgcg gccagctgac     46980
     gctgctgccg gtgaccaatc ccctggccta ccgcaaaggc gagcgccagg gcgaccgcaa     47040
     tctcaatcgc aacctgcgcg tatgcgcgac gccgaccgat tacgaggacc gtatcggcaa     47100
     tgccctgtgc ccgctgctgc aggcgcacga cgtgctgctg gacctgcatt ccttccacac     47160
     cggcggccag cccttcgcga tgctgggccc gcgcgacaac caggaggcgc tcgagccttt     47220
     cgcgcatgcc cgggaggagg cgcggctggt ggcgcacctg gggccgcgcc gcgtggtcga     47280
     gggctggatg caggcctacg agcgcggcgt gcggcgccgg cgcgagcaga accccggcgc     47340
     gcccgcggcc ttgctggacg cggcctatgg cgtgggctcc acggagtatt tccgcgcgca     47400
     tggcggctat ggcgtgacgc tggaatgcgg ccagcacgac gacccggccg cgcccgaggt     47460
     ggcctaccgc gccatccgcc agacgctggc gctgctgggc ctggccgata tcgcgctgga     47520
     gccgccgcgg cgcgacttcg agaccttgtg cctggtcgac gtggtggacc gcgaggccga     47580
     cggcgacgcc ttcgcgcggc cctgggccag tttcgacccg gtgcggcagg gcgagctggt     47640
     gggcacgcgc gccgatggcc ggcaggtgct ggcgccgcgc gacggctatg tggtgttccc     47700
     caacccgcgc gcgctggcgg gcaacgagtg gttctatttc gccgtggcca gcgaccgcct     47760
     gggcgaggat gcaggaaatt gaaacggcgc ggcgaacgcc ttggcatgcg ttgctagact     47820
     tttccgtggg cggcgatccg ccgccggttt tcctaggagg tgttcatgtc caagtccata     47880
     gtcctgaccc tggccgccgt ggccctggcc acgcaggccg ggttggcgca ggcccagtat     47940
     gtcggcccgt ccagcaacca gcagatgagc gtgaaggaat tgctggacac ggcgcgcgac     48000
     gacgcggtgg tgaccctgcg cggcaagctg gtcaagcagc tcagcgacga cacctatctg     48060
     ctggatgacg gtacggggcg cgttcaggtc gagatcgacc ggcacctgtt cccgcccaac     48120
     cagccggtcg acgccaatac gctggtggag gtgtcgggcg agttcgacaa ggaagtcatc     48180
     ggcacttccg aggtcgaggt caaggcgctg cgcatcctcg gcgcggccaa atagccgcaa     48240
     cggtcggcgg cttacaggca gcgtctcgct tcttaagatt attccttaat ttttgcctgt     48300
     agctgcctga tttatctacg tatttgctga tcggcagggc cggtccgcgc gatcgggccc     48360
     acggccgggc tgccgcgttg cgccgcgggc ggcattccct gcaggtcctg caccggcgca     48420
     ttgggcatgg ccacccggta ggcctgcagc accatcaggc aatcgatgtc gccgaggtcc     48480
     tgggcggcgc acggcgagcg cgccgccgtc tgcctggcgg cctgttccgc ctggtaagcg     48540
     gccacggcgc gcgccatgcg cgcctgggcg tgcaggtcgc gcagcaggtc cgccggcgcc     48600
     gccgcggggc cggcggcgcc gtgcggccgg acggacggcg ccgcgtgggg ccagtcgtgc     48660
     gacggcggcg cggccggggt gcgcggcggc accggcgcga ggcgcgccag gggcgtagac     48720
     caggtgaggg cggcgatttc catggcgtgc tccgaggcca ggcggtacag ggttggtccg     48780
     ggccgggcgc ccggaagttc cgcggcggga aatttgtaaa agtgcagagg caggcggatt     48840
     aaatcgccat gccgggggtc atatccccca tgaccgaaga acctccgtcc agacccgggc     48900
     cggcgcgcgc gccggcccat ccgcttgtct ccccgttttc gatgacgcgc cgcggcatgc     48960
     cgcggcgcgc gccgtttgcc cgcaaggaat gccgatgccg ttcgaatgga tgaccgaccc     49020
     caccgcctgg ctggggctgg cgaccctgat cgtgctggag atcgtgctgg gcatcgacaa     49080
     cctggtgttc atcgccatcc tggccgacaa gctgcccgcg caccagcgca accgcgcgcg     49140
     catgataggc ctgacgctgg ccttgctgat gcggctgggc ctgctggcca gcatcgcctg     49200
     ggtggtgacg ctgaccgcgc cgctgttcac ggtgtggggc gcgcagatat ccggccgcga     49260
     cctgatcctc atcctgggcg ggctgttcct gctgttcaag ggcaccatgg agctgcacga     49320
     acgcgtcgag ggcaacgcgc acgcgggcgg cggcgggcgt acgcagtacg ccgcgttctg     49380
     gcaggtgatc gtgcagatcg tggcgctgga cgcagtgttc tcgctcgatt cggtgattac     49440
     cgccgtgggc atggtgcagg acctgagcat catgatgacc gccgtggtgg tggcgatgat     49500
     cgtgatgatg gtggccagcc ggccgctgat ggccttcgtg gctcgccatc cgaccgtggt     49560
     gatcctgtgc ctgggcctgc tgctgatgat cgggttcagc ctggtcgcgg aaggcctggg     49620
     tttcgacgtg cccaagggct atctgtacgc ggcgatcggc ttttccatcc tggtcgaggc     49680
     ctgcaatcag ctggcgcggc gcaacctggc gcgcggcgcc catgcgctgg gccggcgcca     49740
     gcgcgccgcg cacgcggtgc tgcgcctgct gcaggccggc cgcgagggac gggcccatcc     49800
     cgaggaagtc gccgcgctgg tggccgatac gggcgagggg ccgctgttcg cgccggagga     49860
     aagcaccatg atcgagcggg tgctggcgat gggcgagcgc gatgtgcgct cgatcatggt     49920
     gccgcgcgcc gacatggtgt ggctggacgt gcgcgatccg cgccacgtgg tgctggagaa     49980
     attcgccctg ggccatgcgc gcctgccctt gtgcgccggc gacccgggca atgtgctggg     50040
     cgtggtgcat ctgcgcgacc tgctgccgcg gctgtccgcg ccggggccgg tcgacctggt     50100
     cgacgcggcg cgtccggccg cctacgtgag cgagaccacg ccgatcccgc aattgctgca     50160
     gcagatgcgc gacctgcgcc agcatctgct gctggtggtc gatgagcacg gggtgtgcgt     50220
     gggcctggcc acgccgctgg acgtcctgac ggcggtggcc ggcgaactgc ccgatgccgg     50280
     cgacgccgac ccgccgagcg ccagccgctt gcccgacggc ggctggtcgc tggatgggcg     50340
     gctggcggtc gaggaagtgg cgcgcctgct gcaggcgccg gacctgcggc gcgactatcc     50400
     ggacgcgacg ctggccgggt gcctgctgcg cgccagcggc gccatccccg aggaaggcca     50460
     gggcatggat tggcggcagt ggcgcttcga ggtcgagcgc cgcgtcgggc cgcgcatcga     50520
     gcgggtgcgc gccacgcgcc gcgtcgaagc gctggccgac gaactggctg gcccggcgta     50580
     ggcgcgccgg ccggctcagc gctggccgtc gtgcaccgag acggcttcct tggtcaggcc     50640
     gcccaggcgc gcgtgcacgc gtgccccggt gcccatgacc agcgcgaaca ggatttcgcg     50700
     cggacgcggg gcgtcctgga tgccgatctc gatgctgttg aaatggctgc gcacgtacga     50760
     ggcatggatg tagtgcaccg gcaccatcat gcgatagccg gccgtggcca cggccttgac     50820
     cgccgggacc atggccttgg gttcgcccag cacgctgcgc atcgcccagc cgccggcttc     50880
     gtgccagacc gcgccgtgct ccatttcgcc gtccacgccc acgatggcgg ctttgctgta     50940
     gacctcgatg ttgtccttgc ccagcgtgtc gaccagctcg gtggcgagca gggtgcccag     51000
     cgagcgcagc tcggccatga acggcatcag gtcgggctcg tagcggcccg cgtagggatt     51060
     gcggatcacg gcgcaggagg ccgccagctt gagcggctgc gccggcgccg ggccgttctc     51120
     gtgataggtg gtttcgacga tgagcgtgcg cttgcggatt tcgatcaaag acatggtgtg     51180
     atcctgtgag cggaggggtt actggggcgc aatgccggtt tccttgacga tgccggccca     51240
     tttgtcgatt tcgctgcgca cgaaggcgcc gaaggcggcg gggccttgcg ttttcacgct     51300
     caggccctgg cgcgcgtagg tctgcgtcaa ctcgggcgcg gccagcgcct tgtccagcgc     51360
     gccggccagg cgctcggtga ccgcgggcgg caggccggcg ggtcccatca ggccgaacca     51420
     gacggtcagg tcgaagcctg gcgcgccgct ttcgttgagc gtgggaatgt cgggcgtcag     51480
     cgcgaagcgc ccgggcgtgc tgacgccgta caccttgacc ttgccggcgc gcgcctgctg     51540
     caggccgttg gccaggtcgg tgaaggtcag gtccaccgtg ccgccgatca catcggtgag     51600
     cgcctgcggg ccgccgcgat agggcacggg cgtgacggtg atgtcgccca tggcggccag     51660
     cttggcgccg aacacctggg cgctgcccga gccgtaggcg taggtcagct tgcccgggtg     51720
     ctggcggccg tagtcataca ggtcggccac cgtcttgccc gcgacatcct gcccgcccac     51780
     cagcaggtac ggcgtttcgg ccaccgcgcc gatgggcgtg aggtcgcgcg ccgggtcgta     51840
     gggcaggttc ttgaacaggc tgacgccgct ggccgcggtc gatacgccga ccaccaccag     51900
     cgtgtagccg tcgggttgcg ccttgaccac gtcctgggtg ccgatgatgc cgttggcgcc     51960
     gggcttgttc tcgaccacga cgggctggcc gagttcggcg gccataccct ggccgaggct     52020
     gcgcgccacg acgtcggtaa tgctgccggg ggggaacggc accaccatgc ggatcgggcg     52080
     ttcgggatag gcggccgtgg cctggccgat ggccagcgcc agcgccgccg tggcgaacag     52140
     gggcttgaac atgtcgggtt gtctccttgg attcgttgga cggccgcgcc ttcaggcggg     52200
     ctcggtggct ggcgtgcgct gcgccaggaa gcggtggatc tcggtgttgt ccgcgccgcc     52260
     gggcagttgc gccagcgcct gccgccacag ctcggcgcac agcgccagct ggtccgcctg     52320
     cacgccggtc agcgcctgca ggctttgcgc cgtgccgagg tccttggcca tcagcgccag     52380
     cgcgaagccg ccgttgtagg tgccggggat gatgaactgc ctgagcttgg tttcgctggc     52440
     gacgttgcgg ccgctggagg cgttgagcac gtcggtgaag acctccaggt ccagctccat     52500
     gcggcgcgcg atcaccatgg cttcggagac ggccagcagg ccggccgcgt agacatagtt     52560
     gttcagggcc ttcatggcgt gcgccgagcc gaccgcgccg gtgtggatga tggccgcgcc     52620
     catgcgttcc aggatggggc gcacccgccg caggtcggcc tcggcggcgc cggccatgat     52680
     ggccagcgtg ccggtggagg ccttggccac ggctccggag acgggcgcgt cgatcagcgt     52740
     caggccgcgc gcggccagct gttcggacag gcgccgcgta tcggccgggt tggacgagcc     52800
     catgtcgacg atggcggcgc cggactcgag caggtcgatc agcccgggct ggccgtcgcc     52860
     gcccagcacc accgcgttgg tgatggcgct gttgggcaac atggtgatca ccgcgtcgca     52920
     ggcggccagt tcgtgcaggc cggcggccgc gcgcaggcgt ttgccccagg ccgggtggcc     52980
     ggccagccgc tcgaacgggg cgggcgagcg gtcgtaggcc aggatctgcc agcgctcgtc     53040
     gccggccagg ttttcgagca tcggcaagcc catcatgccc aagccgacga accccagtgt     53100
     ctgcatcatg catattcctt atcgaatgcg ccgtatcgat cgccggcaca acccggcaat     53160
     gctaccgatg acggggtttt tgcacttatg cttagttgga cctggggtat aacattccgt     53220
     tatcgattca atggaaatgc ggagggcaag ggtgcgtttc aagctcaggc agatggaggc     53280
     gttccgggcg gtgatgctga ccggctcgat gaacggcgcg gcccgcctgc tgttcgtctc     53340
     gcagccggcg gtcagccgcc tgatcgcgca tgccgagcaa agcctggggc tgcgcctgtt     53400
     cgagcgcgac aagggcaagc tgacgcccac cgcggaggcg cagcggctgt tcgaggaagt     53460
     gggccagctg ttcgacgagg cattgcgcat cgacgaactg gcgcgcgacc tggccgaacg     53520
     tcccgagggc gaactgaagc tgtgttccag tcccagcctg gcgctgaatt tcctgccgcc     53580
     ggtgatcgcc cgctatgtga acgagcaccc ccgggtgcgc ctgaaatacc acaccacgct     53640
     gctttcggac atggcgcacg agttgctggg gcgcaaggtc gagctggccg tctcggtgct     53700
     gcccatcgac aaccccaatc tggtggtcga gccgttcgcc accggccata tggtctgcat     53760
     cctgccgcaa ggccatgcgc tggcgcgcca ggacagcgtg gggctggccg agctggcccg     53820
     caaccggctg gtgctgtaca gccgcaatat tccgttcggc cagctggtgg cggcggcgtt     53880
     ccagcgcgcc aatgtgccat ggcgcgccac ggtcgatatc gtgcgcgcgg aactggcctg     53940
     cgcgctggtg cgcagtggcg tgggagtggc catcgtcgac gagttctcgg tggccggcgg     54000
     cggctggccg ggcatcgagg tgcggccgct gcgcgaaccc attccgctgg ccctgagcct     54060
     ggtgcgctcg cgcttcgagc ggcccggccg ccaggcgcag cgcttcgtca agctgctgaa     54120
     ggagcacgcc cagcggcgcg ccgctgccgt gcagtgaggc ggcttcagcc cagggcgcgg     54180
     cgcagcgcct cgaagaacag cgtcgattgc aggcgttcgg accgggcctg gccggccacg     54240
     ctggcggcca gcgcggcgtc caccggcacg agcggccggc cggtcgattc ggccagcacc     54300
     tgcgcgcaac aggcgcgctc gaggtagtag aggtcatcga acgcgtagtc gatgcgttcg     54360
     ccgcacacca ccacgccgtg gttgcccagg aaggcgatat ccgcgccgtc catggcgcgc     54420
     gcgatgcgtt cgccttcggc cgcgtcgagg gccaggccgt tgtagcggcg gtcggcggcc     54480
     acgcggccat ggaagcgcat ggcgttctgc gacagcgtgg tgtcgagcat gcgcgcctcg     54540
     gtcagggtca gcgcggtggc ataaggcatg tgggtatgca gcacgcaggc cttgccggcg     54600
     acctggtgga tggcggcatg gatgaacatg gccgtgggtt cgacttcatg gcggccggcc     54660
     agcttgttgc cggcggcgtc gaccagcacg atgtcctcgg cgcgcacctc cgaccacatc     54720
     agcccgcgcg ggttgagcag gaaggcgccc gcctggcccg gcagcgcgac gctgaagtga     54780
     ttgcatacgc cttcgcccag gccatggtgc gccgccgcgc gcagcgccag ggccaggtcg     54840
     tcgcgcagcg cggccacggc tgtgtcctgg tacagcgatc gggcggaatc ggtcggggcg     54900
     gaggggggca tggcggtctc ggcgaaagcg ggtggggacg agggattgcg cagagtctag     54960
     cagttgcgtg gggcggcgcg cgttgcgtca agggaaagcg ctggctacca tgcagccacg     55020
     ccaccgcgtc cggcacgtcg ccggcccgcg catcggatga ggcgccatgg aacccataca     55080
     tcgtcgcagg gattttttgc agcgcgccgg cgccttgctg ctgtcgggca cgctgctggg     55140
     cggttgcgcc gcgcgccggc ccgcggcgcc gggcccggcc gcgcctgcgg ccggcggcac     55200
     gcctgcggcg ccggccgcgc cgccggctgg ccagccggtg ccggcgctgc gggccggcgc     55260
     gcgcatcgcc atcgtggcgc cggcctcggc catcgccggg gcggccgacg aggcggccga     55320
     atggctgctg gagcgcggct acgagccgca ggtcatgccg gcggcgcggg cgcggctggc     55380
     gccgccgttc gactacctgg ccggcgacga cgcggcgcgc ctggccgacc tgcatgcggc     55440
     cttcgccgat ccggcggtgg gcgcggtatg gtgcctgcaa ggcggcttcg gctcgtggcg     55500
     ggtgctcgac cagatcgact acggcctgct gcgccggcac gccaagcctt tcatcggcta     55560
     cagcgacgtc accgcgctgc acctggcgat ccagcgctac gccggcttcg tgaccttcca     55620
     cgggcccatg ctggcgcagg acctgctggc cgggcgccag gcgcccaccg agcaggcctt     55680
     gctggacatg gtgagcggcc ggctgggcgc gggctcatgg atcgcggcgc cgccgcaggc     55740
     gcggctggcc accctggcca gcggcgtggc cacgggacgc ctgatcggcg gcaacctggc     55800
     cttgctggcc gccttgaccg gcacgcgcta cgccatcgat gcgcgcgacg gcatcctgtt     55860
     cttcgaggac gtcaacgaag ccttgccgcg cgtggaccgc atgctggcgc aactgcggcg     55920
     ggccggcgcg ttcgacgggg tgcgcggcgt gctggtgggc agcttcaccc ggctgctggg     55980
     cgtgccgggc gacggcgaag cggcgcaggc ggcgctgtac ccgctggtgc gcgagcattt     56040
     ccaggcgcgc ggcattccgg tgctggccgg ctggcccagc ggccacggcg accccaatct     56100
     caccttgccc ctgggcgcgc gcgtcacgct cgatgccggg cgcggcgcgc tgcggctgga     56160
     gcagccagtc gccgtctgag ccgcgcggcc cgaacgcgcg aacgccgcgg cgggcgcggc     56220
     gttcgcagta cgggcatgag ccgtgatcgc ggtcctagat catggacttg ccggtggcgc     56280
     gcgcgtcgcg gatgtcacgc cacagggtga cgatcagcac cagcaggacg gcagccgaaa     56340
     cgacgggcca ggccaggaag taaagcgtca atagcatgat ggaatctcct gattggaacg     56400
     gcggctcagc cgcgggcagg ctggggttgg gcggcggggg ccgcaggctt ggcgcccatc     56460
     atgcgcgcct tctcgtagtg gaacgaggtg acgcgctcgg ccagcaggct gaaatcgaag     56520
     cgctcctggt tgcgcaggct cagggccacg cagaccacgg tgctgacgcc gtaggccgtc     56580
     agcgaaccca gcagcacgat gtattcgcgc agcgtgccga cgaagcaggg cagcaggatg     56640
     agggtcgcca gcgtgcccag cgtcagggcg gtgacacggc cgaagaaggc gaagctcatc     56700
     aggccgatca ccacgccgcc gccgatggcc gcgcagattt catagaacac cgccacggcg     56760
     ccttcgatcg gcaccagttc gaagcgcacg atggtaaaca gcaccaccgc cgagatcacc     56820
     gaccagaaga aggcgctgtt gctgacgcgg tcccagtaga agctggcgat gacgggaaac     56880
     acgatggctc cccacagcgc gccgacgaac accagcatga ccaggatgtc cagccgcagg     56940
     ctggcgaaga tcacgccgac catggtggcc acgatcatgg tcgcgcggcc ccaccacagc     57000
     atgcggcgcg gatcggggcg gccgccggcc aggttcttgg cgtagatgtc cgtcatcacg     57060
     atggccgaca gcgcggccag gtcggagtcg gcggtggagg acagcgagcc caccaccagg     57120
     atgaagaaca gcgcgatccc gacgggcggc aggtaggtcg aggccatctg cgggatgatg     57180
     ttgttcatgt tgccgttgac cggctccagg ccgacgaaca aggccagcag gcccagcatg     57240
     cccagtccga tcaccaccgc gccgtagccg atggtggcgg tcaggaaggt cggcttgatc     57300
     aggtcctcgc gcaccgcgaa caggcgctgg gcgatggtct ggttgccgat ggcataggcc     57360
     agtaccgcca cgaagtaggg cgcgccctgt tccaggatgg ccgtggtcga gaagaagtcg     57420
     gcctgctcgc tgctcagccg ccacatgttg gcctgcagca tgtcggggcc gccggcgttg     57480
     aagaaaatga gcgggatgat gatgaccgcg gccaggatca tggccaccag ttgcgcgaag     57540
     tcggtcatca ccgaggcgcg gaaccccgac cacagcgtat acgacagcac gcccaggccg     57600
     gcgatcagca cgccctggat gaacgacagc gggctcagca ccgagaccag cgcgccggcg     57660
     gcggtgaagt tgaccatcag gctgatgcag ctgccgacga tgttggagac ggccatgatc     57720
     atctggctgg acgcgccgtg gcgggcgtgg atgacctcgg ccagggtgtg ggccttgggc     57780
     gccagctggc ggaagcgctt gccgaacggg tagatgaaca gaatcatcag cgcgccccag     57840
     aaaccgtagt ggatggggcc ggacaggccg tacttgaagc cggaggtggc gctggcgtag     57900
     aacgacgcgg cccagatcca ggtggcgatc atgctggccg ccgacagccc gaaaccgacc     57960
     gagctgttgg agaccatgta gccatcgacg ttctccttct tctgcccgat catcaacgac     58020
     atcaggaaag tggcgccgta gaaggccacc aggagcagga cggctgtggt ccctgagagt     58080
     tggaaaaatt cagactcttg catcttatgg gtccttttcc cccgctgggc gcatgattca     58140
     ccgttcatgg ccgcatgagt gccgtttccg cggaagtgcg atgggcggca attacccatg     58200
     gcagaccgaa acaccggacg atcgatgacg tacgcgcgat cgcatgcacg cccgacaggg     58260
     tcgcgatcgg cgaggcccgg cgtcaggcaa gcatcaagac acaccgcaat ggtgtcttgc     58320
     taccggatcg ggttggattt gtgggcgtct ggcgctgccc gatacggtgt agcaatgaac     58380
     cggctttgtg ggccggcatg ttggttccgc ggccgtgggg ccgggagggg tgtttcggca     58440
     cgaatgccgg gccgctgtgc gcagcctggt gctggacatc aaggccggtg aacgtcttga     58500
     tgcctggtga cagtaagaat agaccgcaag tatagggtca aacgcgcgtc aggtccagcc     58560
     gcgcgccggc gccggcggct gcggcatggc gcaaacgcag caggctggcg atgcccgcga     58620
     tgacggcgaa ggccacgccc agccatagcg cggcgggcgc tgcggccgcg ccgcgcaggg     58680
     tgaacaggcc ggccaccagc gccgcgccca gcgactggcc cagcatgatg ctggagctgg     58740
     tcatgccgct ggcgccgccg ctgcgttcgg gcggcgcatc ggccagcatg gcgcgcatgt     58800
     tgggcgcctg gaaaaagccg aagccggccc cgcacagcgc catgcgccaa cccaggtcga     58860
     aggcgtccgg cgcggccggc aacgccacca gcgacagcag gcccgcggcc agcacggcca     58920
     tgccgatgcc gccgagcagg ccgggcggat ggcggtccga cagcgcgccg gcgctggccg     58980
     cgctcagcgc ggccagcgcc ggccagggcg tgatcaggaa gccggtctgc acctgggtgt     59040
     agcccagcag gctttgcagc atgaagggca gcgcgacgaa ggccagcgtc tgggccgcga     59100
     aagcgcccag cgtggcggcg gccgacagcg cgaagatggg gcggcgcagc aggtcggtgg     59160
     ccagcatggg cgcgccgcgg cccgattggc gcctgagcag cagcgccagc attgccagcg     59220
     tggcaagcgc gtaggcggtg ttgccgccgg cgccgacatc gtgcgcgtag gcattgagcg     59280
     tatagaccag caaggccagg aacagcgcgc acagcaggcc cgcgacggca tcgtagcggc     59340
     gtgcgctgcg cggggtgggc ggcagcgcgc atacgcccag cgccaggccc agcaggccca     59400
     gcggcacgtt gatcaggaac agccagtgcc agctgcccag gctgaggatc agcgaggccg     59460
     cagtggggcc ggccgccagc gacaggctga cgaccagcgc gttcaggccc aggccgcgcc     59520
     cgagctgttc gcgcggatag acaaagcgcg tcatggccag cgccacgccc aggatgccgg     59580
     ccgcgcccac gccctgcgcc agccgtccgg cgatcagcca cggcagcgaa ggcgccaggc     59640
     cgcacgccag ggaggccagg gtgaacagca ccaggccggc catggaaatg cggcgatggc     59700
     cgatgatctc gcccagcgac gcgatgggca gcagcgccgc caccatggcc aggtggtagg     59760
     cgctgatgac ccagatcgaa ctggcttcgc ttacgcccag gtcggcggcg atggccggca     59820
     gcgccgtgtt ggcgatggcc gattcgagcg tcgccatgaa gacgttgatc aggatggccg     59880
     cgacggcgat ggcgcgggtc gggtgcggca ggccggcacc ggcctgcgca agctggttga     59940
     gtctgaaact gagcaaagcg gttatcggag ggaggtggcg ggacggcggc atcgggccgc     60000
     ggcgccgccg cggggctggc gaggctgcgc gggcagcggc aaggccgggg gatggcacat     60060
     ggtagcggcc gccgctgccc gcgtgaaatt aaaaatccca ctcgtgccca gtgcgtatgg     60120
     caatgcctgc ggggatcgac ggcggctaca ggcgctggcc gcccgtggcg tcgatgcgct     60180
     gcccggtgat ccagcgcgcc tggtccgagg ccaggaaggc cacgatgtcg gcgatgtcct     60240
     cgggctggcc cacgcggccg agcgcgatgt cgcgcgccag cgcgtcggcc atggcgggat     60300
     cgcgggcgcg cgtgttcatg tcggtggcgg tggcgccggg cagcacggca ttgacggtga     60360
     tgccgcgcgc gcccaggtcg ctggccagca acagggtcag cgcctccagg ccggccttgg     60420
     ccggcgcgta gacgctcatt tcggggtagg cggcgcgcgt gcccatcgac gagacgttga     60480
     cgatgcgccc gccgtcgcgc agcagcggca gcaggtgctg gatcaggaag aacggcgttt     60540
     tcaggttgac ctggatgatc cggtcgaagt cctgcgggga gacctcgggc aggcgcgcgc     60600
     gcaggcttac gccggcgttg ttgaccagga tgtcgaggcc ttcgtcgccg gtctgttcgc     60660
     gcaggctggc gcgcaggtcg cgggccagcg cgccggcgcc gtcggggtgc gccaggtcgg     60720
     cgcgcagcgc ccaggccctg ccgccggccg cgccgatggc ctggacgacc tcgtcggcct     60780
     gttcccgcgc cgcgttgtaa tgcaccgcga ccgtcgcgcc gcgccgaccc agcgccaggg     60840
     cgatcgcgcg gccgatgccg cggctggcgc cggtgaccag ggcggtcctg ccggccaggg     60900
     acgattgagt ggcgacttga ttcatgctgc gagctccggt tgcgaggttg gcgggtgtcg     60960
     gttcgatgcg ggggacattc tcgcccgcca gcgcgggcct gtcatcgccg cgggcaggaa     61020
     cagcgggcga atcgtcgggg cagcgcccgt caaggcgcgc cggccgcggc gccgaggtag     61080
     gcgtggaagg cctgagcgag cggggagcgc acggacgagc gcagccagac catgccgacc     61140
     tgccgcgatg ggcagggatc gggcagcggc cagcgcctga cccgcgcatc cgcggggccc     61200
     agggttggcc agtcgggcag cacggagacg ccgaagcctt cggcgaccag cgccgaaatg     61260
     tgttcgatgc cgtccagctc gaattgcacc ttcgggcgca ccccatgggc gcgcaggtat     61320
     tcgtcggcca tcttgccggc gaccaccttg cggtcgtact ggatgaaagg ttcgcgcgcc     61380
     gcgacgcgca gggcgttccc gacgcgcagg gcgctgggag ccaggaggac caggcgttct     61440
     tcccggatga ggctccaggc gcaggtcttg tgcagctcga aattcgggtg caccaggatc     61500
     gcggcgtcga gctggcccgc catgacgcgc tccagcagga cggacgaggt gccgggctcg     61560
     atgtagatct ggatgtccgg atgcgcccgc atccagcggc gcagcagggg cggaaccagc     61620
     cccatcagcg ccgtgggcgt tgcgcccagc cgcatggggc cggccggcag gccggtgtcc     61680
     gaggcggccg agcgcaggtc gcgctcgccg cgcagcaatt cgcgggcgcg gtccacgatg     61740
     cgcgcgccgg ccacggtcgg ccggaccgtc cgtcccgcgc gcgtgagcag ccgcgagccc     61800
     aggtcggcct cgagggcgcg tatctgctgc gcgaccgtcg tgggcgccag gccgagccgg     61860
     cgcgcggcgt cggcgatcga gccggactcg gccaccgtga cgaagctgtg gaggaatcgc     61920
     atgtccataa acacgtattt tacgttttat gaaacttggg agtgcgcctt tttttattta     61980
     ttgaagacgc gcaacatcgc gttttcccat tcaacaggca tcaggagacg atcatggcca     62040
     tcatcaagtc catcgaagtc tgcgtggcgc gcgtcccgat ggacaaggtc acctatctgt     62100
     ccaaccgcac cgtcgtagac cgccactacg ggctggtgaa agtgcgcagc gccgacggcg     62160
     tcgaaggcat cggtttctgc tacgtcggca accaggccgg ggagatcttc cgggtcgccg     62220
     tcgagcaatt gctcgggccg gtgctgatcg ggcgcgattc tctggccgtg gaagggctgt     62280
     ggcgcgagat gtaccaggaa gcgctgctgc agggccgcat gggcacggtc atgcgcgcgc     62340
     tcagcgcgct ggatatcgcc ctgtgggacc tgaacgcgcg cgccgcgaac ctgcccctgc     62400
     acaagtacct gggcgccgtc gagctcgaca gcgtggcggc ctacgccagc ggcggctatt     62460
     acgtggaggg caagaccgcc gggcagctgg gcgaagagat ggccagctac gtcgagctgg     62520
     ggttcaaggc ggtcaagatg aagaccggcc gctggtcgcc gcagggcgag gagtcgcgcg     62580
     tgcgggccgc gcgcgaggcc atcggcgagg acgtcgagct gatgctggac tgcaacaacg     62640
     gctgggtgga taccgtgcag gcgatggaat acctgcggcg catggagccg tacaacccgt     62700
     acttcatcga ggagccgttc agccccgatg acgtggaaag ccacgcgcgc ctggcccggc     62760
     tgacccgcat tcccgtggcc accgccgaga tcggctacgg ccgctggtac cacaagcagc     62820
     tgctggacat gggcgcggcc gccatcctgc agacggacgc ggcggtctgc gggggcatca     62880
     ccgagtggaa gcgcatcgcg gcaatggcgg ccggctacgg catccagatg tgcccgcact     62940
     ggttccacga tgtgcatgcg ccgctggccg cggccacgcc caacgcgcgg tacgtggagt     63000
     tcttctggga cgaccaggtg ctgaacttcc gccggctggt ggaccgccag ctcgagcaca     63060
     aggacggacg cgtcatcctg catcaaaccc ccggcctggg cttcggattc gacgagaatg     63120
     cggtcgccag gtacgggcgc tggacgacgg tgtcctgaac cggccgccgc accctgtacc     63180
     caaccctcat cggagacaag aaaatgatga aacttcgcgc ggcctgcgcg ctggccgccg     63240
     ccctggcctg cggcgcggtc ctggcccagg acctgggcgg caagcccctg accctggtgg     63300
     tgccgttcgc cccgggcggc aacgccgata tcgtggcgcg ctcatacgcc gttcccatgg     63360
     cccggctgat cggcgcgacc gtcgtggtcg acaaccgcgg cggggggggc ggcgcgatcg     63420
     gcacggccat cgtggccaag gcgcccgcgg atggcagcac gctgctttcg gcgacgccgg     63480
     gccaattggg gaccttgccg cacatgttca agaccggcta caagtcggcg gacttcgtgc     63540
     cggtgggcgt ggtgagcaag acctcgatcg ccctggtcgt caagcacgac gacgcgcgct     63600
     tcaagaccac ggaggagttc atcgcgtacg ccaggcgcaa cccgggcaag ctcaacgtgg     63660
     gccatgccgg accaggctcg cccaatcacc tggccatgct ccagttcgag aacgcgacgg     63720
     gcacgcgctt cacgcccatc gcgtacaagg gttccggacc ggcattgatc gacctgttgt     63780
     cgggccagat cgacgtcata ttcgaccagg tgagcagctc cctgccgcat ctgaaggcag     63840
     gcaagctgtc ggccctgctg atactgggcc cgacgcgcga cccgagcatc gggcaggtgc     63900
     gcacgctcaa ggaagcgggg ctgcccgagt tcgacgccag cacctatatc ggcgtgctgg     63960
     cccccaaggg cgtgccggcc gagaccgtgg caaagctgac gtcggtcatc cggcaggtgg     64020
     ccgacgaccc ggccttcgac agcaagctgc gggaaatcgg cagcggggcg ttctacgccg     64080
     atccggccga tttcgcccgg atcctgcagg ccgacgagga cctggccaag gcgatgatcc     64140
     agcagggcag gctgatcgat ggttgagcgc gcgcgcctgg ccgagggcgg cggttgggac     64200
     tgccatttcc atgtcttcga cgccagccgc tacatgctgg cggccggcag cgcgtaccag     64260
     cccgaggacg ccagcctggc cgcctttcgc ggcgtgtgcc gcgcccgcgg gatcggccgg     64320
     gcggtgctgg tccatccgag tgtgtacggc gccgaccaca gcagttatga agacgcgctg     64380
     gcagccaacg gcgactggct gcgcggcgtg gcggtggtct atcccgacga ggcgaccacg     64440
     cccgacgccc ggatcgagca ctgggacctg ctgggcaccg ccggcacgcg gatcaaccgc     64500
     ctgtttcccg gcgcgccgca acatcccgaa cgcatcgtcg agcgcgtcaa gcccttcggc     64560
     tggcatgtcc aggtgctgac cgacatcgtc gaggacatcg gcctggtcag gcgcatcgcc     64620
     gcacgcgatg tgcccgtggt ggtcgaccat ttcgggcacc acccgcatgc gcagctgctg     64680
     cgcagcgcgg gctggcagga cctgcttgcc ttggtgcggg agggggcggc ctgggtcaag     64740
     ctgtcggcgc cgtaccgggt gggcgcgcaa ggcccggcct ggccgggcgc gcaggcgctg     64800
     gtggaccagc ttgtacaggc caatccgcgc cagctcgtgt ggggcagcga ctggccgcac     64860
     ccgcccgatc accggcatcc gttcccggcg ccggaccagg cggcgatcgg cgcgacgatc     64920
     gcgcaatggc tgccggacgc gcaactgcgc cgccaggtca tggaactgaa tccgctgcgc     64980
     ctgtacggcg ggacgcgcgc cgccgggcgc tgagcgccag cgcggcgcgg caggcgggtt     65040
     gtttacactg gaccggcaca tacacccgcc cggccgcggc cctgcgccgc ggacgcgggc     65100
     ttcgatggag cgaatgccat gttcagtcat gtgaccgtgg gcgtcagcga tctggcgcgc     65160
     gccggacgtt tctacgatgc gctgctgcag ccgctggggc tgcgccagcg gcagacgcag     65220
     cccgatggcg ggccgccttc gttgtgctgg gtgcgggccg gcacgagcct gccgcgcttt     65280
     ttcgcctata tgccgttcaa cggccggccg cccagcccgg gcaacggcgc catggtggct     65340
     ttcctggcgg agacgtcgga gcaggtcgac cgggcccacg cggccggcct ggccgccggc     65400
     ggcagcgacg aaggcgcgcc gggaccgcgg gcgcgctatg ggccgggcta ctacggcgcc     65460
     tatctgcgcg atcccgacgg caacaagctg cacgtcgtgc atcgcagcgg cccggccgcc     65520
     gcgggctagg cgcggcggcg cggggcgggc gggcgcttca ggcgcggatc gcgccgcgct     65580
     ggcgcagcgc gtccaggcgc gtggcgtcca ggcccagttc gtcgcgcagc accgccaggg     65640
     tgtcggcgcc ggcgtccttg cccaggctgc gcacggcgcc gggggtttcg gacaggcgcg     65700
     gcaccacgtt gggtaccgtg acttcgccca gctgcggatg cggcaggcgc gccagcgcgc     65760
     cgcgcgcctg gaagtgcgga tcggcgaaca cgtcgtccac gccgtagatc ttggcgtgcg     65820
     gaatctcggc ctgcgtcagg cgcgccagca ccgtggggca gtcgtggcgg ctgaaccagt     65880
     cctggatggc cgcgtccagt tcggcgtcat gcctggcgcg ctggccgggc tcggcaaagc     65940
     gcggatcgtc ggccagctcc ggcgcatcca gggcggcggc caggcgccgg aacaaggcat     66000
     tggtcagcgt cgtgacgtgc acataggcgc cgtcggcgca gcggtacagg ttgttgggcg     66060
     ccgacccggg caggcgcgaa ccggcgcggt tggccacttc gcgcaactgg tcgtacgcca     66120
     tgacgtgcgg ctccatgaag ctgaaggcgc attcggccag cgccgtgtcc accacctggc     66180
     cgcgcccggt gcggcggcgc gattcgaggg ccagcagcgc gccgaacgcg ccatacaggc     66240
     cggtgatgta gtcggacagc gaggtcgcca cgcgcgaggg cggccggtcg gggtcgccgg     66300
     tgaccgagcg caggccgctg tgggcctcgc cgatcacgcc atagccgggc cgcccgctgt     66360
     aggggccgtc ctggccgtag ccgctgatgc gcaccatcac caggccgggg ttggcgcggc     66420
     tcagcacgtc gtagccgaga ttccatttct ccagcgcgcc ggggcggaag ttctcgatca     66480
     ggatgtcggc gcgggcggcc agttcgcgca ccagttcctg gccgtcgggc tggcgcaggt     66540
     cgatgctgac cagttccttg ttgcgcagca gggacagcgc atagagcgaa tggccgccct     66600
     tgtggcgccc catggagcgc agcgcgtcgc cctcggtcgc ctcgaccttg atgacgcgcg     66660
     cgccgaaatc ggccagcaag cggccgcaga acgggccggc gatggtggag ccgagctcca     66720
     gcacggtgta gccggccaac ggtccggcgc cggctgcggg ttgggtcatg agtggtgtct     66780
     ccttgccagg tatcgggggc ggtgcggcgc gcgggctact gcacttcgag catcgccacc     66840
     acgtcgcctt cgcctatggc gtcgcctttc tgcacggtga tttccaccag gcggccggcg     66900
     gccggcgcgt ccacggggat ttccatcttc atggactcca ccacgatgag cgtttcgcct     66960
     tcctcgaccc ggtcatcgcc ggccttgagg acttcccaga cgttgccggt gacttcggat     67020
     ttcacgggga ttttcttcat gtctattcct gagagggtta tcaagcagtg agcgcggccg     67080
     gcgcgggctc ggccagggtc cgggccacga tgccggtgtg caggcggccc tggcgccagg     67140
     gttcgaaggc cagcgcgcgc gccaggaagg gcaggttggt cttgacgccg gcgatctcgg     67200
     tgtcggccag ggcctgctcg gcgcgcgcga tggcctgggc gcgatcggcg ccgtgcacga     67260
     tgatcttggc gatcatgggg tcgtagtgcg ggcttaccgc gttgccggcg cggtagccag     67320
     tctcggtgcg caccccgggc ccttgcggca gctcgaacac ggccagcgtg cccggcgacg     67380
     ggatgaagcg caccgggtct tcggcgtaca cgcgcagctc gatggcgtgg cccgagggct     67440
     gcaggtctgc cggcaccacg cggtccagcc gctcgccggc ggccaggcgg atctgcgcct     67500
     gcaccaggtc caggccggta atggcctcgg tgacggcgtg ctcgacctgc agccgggtgt     67560
     tcatttcgag gaagctgtag cggccctgct ggtcgcgcag catttccacc gtgccgatca     67620
     cgtcgtagcc cagctcggcc agcagcgcgg cgatgcgctc gcccagcgcc tgcgtctcgg     67680
     ccgtgggcac gcgcggcgcg cgcgcctctt cgatgacctt ctggtggcgg cgctgcaccg     67740
     agcagtcgcg ctcgtacagg tggcgcgcgt tgccgtggcg gtcggccagg atctggaatt     67800
     cgatgtggcg cggctgctcg aacagctgct ccaggtagat atcgccgttg ccgaagctgc     67860
     gcgcggccag cgagcgcgcg cgcgccaccg cggccagcag ctcggcttcg cccgcggcgg     67920
     cgatcatgcc gatgccgccg ccgccgccgg ccggcttgac catcaccgga tagccgactt     67980
     cgcgcgccgc cgccagcacg ccggcctcgt cctcgcccag caccgccgac gacttgcaca     68040
     tgggcatgcc gtggcgcgcc atcagttcgc gggcgcgggt cttgtggccc atggcttcga     68100
     tccagcgcgc cgccggaccg atgaagacgg cgccggccgc gtccacggcg cgggcgaacc     68160
     cggcgttctc ggacaggaag ccatagcccg gatgcaccgc gtcggcgccg gtgcgcgcca     68220
     gcacgtcgag cagggcggcc tggtcgaggt agctctgcgc ggccggcgcg ggcccgatgc     68280
     aataggcttc gtcggccatc tgcacatagg gcaggtcgcg gtcggcctcg gagtagacca     68340
     cgaccgagcg caggcccatc tcgtgcacgg cgcgcgccac ccgcgcggcg accgcgccgc     68400
     gattggcgat caggatcttg ttcacgtcgg gctcctagta gctggtgggc caggtgcgca     68460
     tcaggtgctc gcccacgccg ttggtcaggc gcagccggtg cacgcgcagc aggcggatca     68520
     gcgtgtcgcg ggtgtcggcc ggattgatga cgtggtgcgc cgaataggcc ccgcccatct     68580
     cccaggccga ggtgtcgcgc tccatctcgg ccaggcgcgc cgcgtaggcg tccggatcgc     68640
     tctgggcggt caggccgtgc acgatggtca cgcccgagcg cgggtccatg aagttgactt     68700
     cggcggtggc ccaggcgatg acttcgtcgg cgttgcccgc gccgcccatg ttgagcaccg     68760
     cctggccgta ggtcttgcgc atgatgatcg agatcttggg cacgctgacc agcgacaggg     68820
     cgttcatcca gttcatcacg cggcccaccg cgccgcgccg ttcgccttcc acgccgatga     68880
     gaaagcccgg ctggtccgcc atgaacacca gcgggatgtt gtacgagtcg cacagcacca     68940
     tgaagctggt ggccttgttg caggcgtcga cgtcgatggc gccgcccttg gcctgcgggt     69000
     tgctggcgat gatgcccacg gtgtggccgt cgatgcgcgc cagcgcggtg accaccgaac     69060
     gaccgtagcg cgccttcagt tcgaacaggc tgtcgttgtc gacgatcagc gacaggatct     69120
     tgcgcacgtc gtacaccttg gtgcgcgact cgggcaggat gtccaggatg cggtggccct     69180
     gttcgcccga gccggcggga accggccgca ccggcggcgc ttccatgtgg tgcgagggca     69240
     ggtaggacag gaagcggcgc accgcgtcca gcgcttcttc gtcgctgtcg accgccatgt     69300
     ccaccaggcc cgagccgctg gtcagcattt cccagccgcc cagttcctcg gggtccaccg     69360
     cctcggtaat ggccatggag gtcagcttga cgctggagac cgccatgatg gcgcccttgc     69420
     gcatgaccgc gaagtccgcc agcaccgcgt accagctcga cgagccgtag caatgtccca     69480
     gcaccgccga ggcccagggc gtctcgcggg tgcggcggta ctgggttgga cggtcgccgc     69540
     tgccgatgcc gcgcgcgccc atggtgtcgg gcatgcgcgc gccggtggac tcgcccagga     69600
     acaccatggg caggccgcgc cgcgtggcgt tcttgaccat gtgcccgatc ttgctggtgt     69660
     tgaccgagct gctggaggcg cccatgaccg tgaagtcatt ggcgaccagc gcgatgtcgc     69720
     ggccgtcgac ctgcgcgtag ccggcgatct tgccgtcggc cggggtgcgg tcgcgcacct     69780
     ccgagcgcac cgataccgcc agcagcccgg actccaggaa gctgtcggcg tcgaccaggc     69840
     ggtcgatccg ttcgcgcgcg ttgagcacgc cttcggcgcg ccgccgcgcc agtttttcct     69900
     cgccgcccat ggcgcgcgca cgcgcctcgc gttgggccag ttcttcgatc aaggtttcga     69960
     atgccatctt ctgcgctttc cttccatgcg tgtgtcgtga tcggccgcgc ggcggccgcc     70020
     tactgcttga acagccccgg gttggccttg acgaactcgg acgcgttgtg ggcgtcccgg     70080
     acgatcagct cggccagcgc ctgcggggtg gacgattcca gctggtagcc ttcgtcgctc     70140
     aggcgcttgt tgatgacggg gtcgcgcacg aaatcgcgcg acagcgccgc catgcgttcg     70200
     accacctcgg gtggcgtgcc cttggggccg aagacgccat accagttgga gaagtcggac     70260
     ttcgacatgc cgctctcgag catggtgggc gtatcgggga aggcatcgct gcgcttgccg     70320
     gaggtgacag ccagggcgcg cagcttgccg ctgcgcacga acgaggccag caccggcacg     70380
     ttggcgatga ccaggtcgac ctggccgccc atcgcgtcgg cggcggcctg ggcgccgccc     70440
     ttgtacggga tgtgcgacag cctcatctcg gagccgcggt tgagcatgcc gacctgcagg     70500
     atcagcgagg cgctggagat cgaatacttc tcgggatcag tgcgggccag cttgatcagt     70560
     tcggccgcgt cgccgccctt gaacttgggg ccggcggcca ccaggcaggg cacccgcgtc     70620
     agcaggctga tgggagccag gtccatggcg gggtcgaacg gcggcaccgg accggtggcc     70680
     tggttggtgg ccaggccgtc gatgcccacc aggaaggtgt agccgtcggg cttggacttg     70740
     accacgtagt cgctgccgat attggtggaa gcgccgggcc ggttctgcac cagcacgggc     70800
     tgcttgagat gctcgcgcag gtagtcggcg tattcgcgcg ccaggcggtc ggtggtgccg     70860
     cccggcgcat acggcacgac cagcgtgatc ggctcggcgg gccaggcgcg cggctgcgcg     70920
     gcggcttgcg gggtgggcgt ggccagcgcc aggaagcagg ccagggtgcc cgcgtagcgg     70980
     gccaatctgc gatccgacat gttgtctcct catgtcatgt gctcttctgg tgaggagaca     71040
     atacgaagcc tcgctatatt agtcaagtta ctttactaaa aatagtaaag cagatttact     71100
     attgtggcat tcttgccgcc aaggagaaag cccatgcgag aggcagacgc aggtccgggc     71160
     aggggggtgg ggccggggat tggccgccgc ttgggggata atggcgcggt cgccatccca     71220
     cgtataccca tgatcagcaa aaaacagttc gccaccctgc aggcctcccg gcagcgcgga     71280
     ctcagccgcc tgctgttatt ggccaggcgg gtgttcctgg agcgcgtcgc cgaggccatg     71340
     gcggcctcgg gcctgcagcc catgcccgac gcttgcgtga tgatcctgcc ctatatcgac     71400
     ctggaaggca cccgcagcac cgtgatcgcg cagcgcgcca gcaccacgcg ccaggcggtg     71460
     ggccaggtgg tggccacgct ggaagccatg ggcctggtcg agaaacggcc cgacgaggcc     71520
     gacaagcgcg cggcggtggt gtccttcacc gacgccgggg tgcgctacct gatcaagatg     71580
     cacgacgtga tcgaccgggt cgagaacgag ttcgcccagg ccagcggcga gggcgacatg     71640
     gaaatcgtgc gtcgcacgct ggcgcgcatc gcgtacggag cctgagcgcg gccgtggcgg     71700
     cgtggggccg cggtggtgcc tgtccccccg gcggtgtgcc tgtccccgct gggacaggca     71760
     caccgccggg gcaggttcag gaaatccggt cgcacagccc gtagtaggcc acggccaggc     71820
     cgatgtacag gcgcttgagc ccgtgcagcg gaatcggcgc gatgggggtg acgggatagg     71880
     gcagcggttc gccgccgctg atttcgcgcg ccaggtagtt gcccatctgc gtggccagcg     71940
     ccacgccgcg gccgttgtag cccagcacga tgcgcaggtt gggcgagggc tggtgcacgt     72000
     gcggcacgaa gtcgcgcgtc agcgccacgc gcccgctcca gcggtgcacg aacggcgtgt     72060
     cggccaattg cggatacagc aggcgcgcgc cgcgcaccag atggttccag tcggcgtccg     72120
     atacggggtc ggcgaagcgg ccgcgtccgc ccaggatgaa gcggcggtcg gcgtcgcggc     72180
     ggaagtacag cagcagccgc cgcgagtccg aggcgacttc gccgccgggc aggatggccg     72240
     gcgccagggc gggatccagc gggccggtgg ccacgatgaa gctgttggcg gcgatgacgg     72300
     tgcgccgcag gccgggccac aggtcgtcgg tgtaggcgtt ggtggcgatc agcacgtgct     72360
     cggcgcgcac gctggcgcct tgcgcgcagc gcaccagcca gcggctgccc tcgcgctgca     72420
     gagccaccac cggcgactgg ccgtgcacgg ccgcgcccag cgacagcgcg gcgcgcagca     72480
     ggccgcgggt gtagcgcagc ggctggatgc tgccggcgcg ccggtcgatc cagccgccca     72540
     ggaagcgccc ggtgcccagg cgccgcgcca cgtcgccggc gtccagctcg gccacgtcgg     72600
     cgccgcgcgc gcgccactgg cgcgcgcggg ccagcacggc atcgagcgcc tggcgcgagt     72660
     gcgccggctg gatccagccg cgccgcaccg gatggcagtc caggccgtat ctgtcgatca     72720
     ggtcgaacac cgtgtcggcg gcagtgccca ccatgtgcag cagcggctcg ccgcgttcgc     72780
     ggccatggcg cgccaggatc tcgtccggat cgtgcttgat gcccgggatg acctggccgc     72840
     cgttgcgccc ggaagcgccc cagccggggt cgcgcgcctc cagcacgcag gcgcgcaggc     72900
     cgcgttcggc caggtgcagg gcggccgaca ggccggtgat gcccgcgccg acgatggcca     72960
     cgtcgcagtc ggcgtggccg gccagcggca ccgtggccat cgcgggcgcg gcagtgtccg     73020
     tccacacgga gcgcatggcg tcgtacggca ggggcggggg catggcggga tcaggcctgt     73080
     ggcgtcgtgg ggaagtcgaa aggcgtgtcg tgcgcgaagc ggctcagcac attggcggtg     73140
     atgcgcgaga cgttgttgtc gtagccgttc caggccagcg aggcgcccca ggtgatcgag     73200
     ccggtggaga acaccgcgcc gccgttcagg cattcgtaga acagcaggtc ggcgtagcag     73260
     tacttggctt cctcgccgtt gatggtgggg tggtggtagg tggtctcctc gggcaccacg     73320
     ttgtagtagc gcgtgtgctt ctccgagcgc gccacgatga gcgcgtgcgg cggcgtgccc     73380
     aggcggaaat cggcgcggtc gatttcgtcg ccggcggcgc cgccgccgct gctgccgaag     73440
     tcgccgatga tctcctcgct cacgccgtcg aacatgaagg cgacccgcgg gtcatggctt     73500
     tccgggcggc ggcggtaata tgacgaggcg tcgaagccgg tggcggtggt gccgatgccc     73560
     accagcgtct gcggcgcgat gccgatgcgc cgccaggtgc cgccgtattc gccgttatag     73620
     ctgtggtagc tttcgccggc cggggtctcg ctgtagcgcg cgcccgtttc ggtgcggcgc     73680
     agctccatca gccagggctt ttcggggtgg taggcgcagc gccagtaaaa gccgttgccg     73740
     cccatgtaca tcaggcgccc gccctgcgcc tggtaggcga ccatggcctg ccacatgcgc     73800
     gtgctccagt actcggggtg ggcgccggtc atgacggcgc ggtagccctg cagcgcggcc     73860
     aggccctcgg cgtgcagcat gtcgtcggtg atgacgtcgt actcgaaacc cttttcgtcg     73920
     agccagtcca ggaagtgggt gtcgccgttg agcgaccagg tgcggcactg caggtgcatg     73980
     ctgaacaccg gccggcggcg cgtggcgtag tacacgccat agccgtcgga gtgggtgtcg     74040
     tacatggaca ggccaagctc gcggtgttcg cccaggtagg tctcccaggg atagagcacc     74100
     atgaagttgc ccgatttcat ttccatgcct tcctcgtcca ggcggtagtg cgagttcgag     74160
     taggccatgt aggtggcggt cgaggcgaga aaggcgatgc gcttgcgcgg cgcgccggcg     74220
     cgcgggcgca ccacgaaggt gatgcgctcc tgttcgcctt gggcgccggt cagccgcgcg     74280
     gcatacaggc cgctgggcag gttggcggga atctcgaggc tgaaatcggt gtcccagttg     74340
     gcgtcttcca gcgtgtcgtc atggaagtgc agcgcgccgt agtggtcggg gccgtcctgc     74400
     cagcgcatga tgctggcgtc ccagcgcagg ccgggtacgg cgcgcgcggg caggttctcg     74460
     atgcggccct cggcccaggg gatggcggtg ttgacgatca cgtcgctgtc gatgcgcagg     74520
     ccgaagtccc aggcggccag cggcggcgcg ccgtggcggc gccgcgccgc ttccacccgc     74580
     aactgggcca ggtcggcgtc gccggcgcgg cacggcagca aggtgggcga atcgatgcgg     74640
     ccgttgtagt ggtgcaggta ggccggcgcg cggccgccgc tgggacgggc gccgaacacc     74700
     acgggcagcg cgtcggtggc gccagcgggc aacgggctcc agcggacgct ggcctggtcg     74760
     tggctgttgg ccgccagcag cgggttggcc ggcacttggc gcagcgtcac ctcgccgctg     74820
     tcggcgtcga tgccgacggc caccagatac cattggcggg ccaccacggc gcgcgccagc     74880
     gtcaggcggc gagccttgcc cgcctgcgcc tgctcccaga acaggcagcc ggccttgtcc     74940
     aggcccaggg cgtagccggt gccggcggcg ccgtcgtggc gcgccaggat gatctgctca     75000
     tggccgcttt gcggcagcgt gggcatgatg gccagcaccc agctcctggc gccgcgcgcc     75060
     ggttcggcaa agggcggcgc gaccgcgcgc gagccggtct cggtgtgttg cgggcggcct     75120
     tgcacgccgc gcgcgatgcc ggccagtgcg acggtctcct tcaggccggg cgcgcccggc     75180
     gagacatcgc cgctgcggat gcgaaccagg tcggcgtcgt agcgcagcgc gcgggcgcag     75240
     ctgaccttga attcgatggt ttccccggga gcgacggtcc aggtgctggg gtagccaagt     75300
     atctcgtaca taggggttcc ggaagaggcg ttggattcga tggcgcaggg gcggcggcgg     75360
     gccgggacta gtccaggccc accggccagg gatagggcga gtggatggcc cagcggatct     75420
     tgagaatggc ccactgggcc tcggccagcg tggcgtagcg ttcggcgtgc agcgccacgg     75480
     ggtcgccgcg ccgctcgccc agggtgccga tggcgtactc gctgtagggc cgggtgcaca     75540
     cgatgacctg cttgcccgcc atgggctcca tgcgcaggcg gttgagcagc cggttcagct     75600
     tgagcggccg cgtcttggtc gtggtggtgc ggaagtgcct gagcagttcg gcatcctcgg     75660
     gctggatctc atacatggac ggtctccggt aggggggcga tgtcagcgct cgcgctgcgg     75720
     ggcggcgaac agctccagcc ccacggtgcg ctcgagcagc agcaccagcg aaagcgtgaa     75780
     caggatcagg aaggtggcga tggcggcgat gaccgggctg gcgctttcct ggatctgcgt     75840
     caggatgcgc accggcaggg tgttgacgtc gggggcgatg aggaagatcg tcaccgtggc     75900
     ttcgtcgaac gacacgatga agcagaacag gaaggccgtg atcagcccgg gccgcagcat     75960
     gggcagcgtg acggtgcgca gcacctgcag cggcgtggcg ctcaggctca tgctggcttc     76020
     ctccagcgcc gggtccagct tgcgcagcgc gttcaggatg ggccggtagg caaacggcag     76080
     ggtgatgatg caatgcgcca gcacgatacc caggtaggtg ccgccgatgc ccagcaggcc     76140
     cagcacgccg agaaaggcca cgcccagcgc ggcgttggga aacaccagcg gcagcatgat     76200
     cagggtttcg agcagcccgc tgccggcgaa gcggcgccgc gccagcacca gcgcggccag     76260
     cagggccgcc gtggtgctga tcagcgccac ccccagcgcc accgcggcgc tgaccagcag     76320
     cagcgagatc cattgccagt cggtgaagaa ctcgacatac cagcgcagcg acagcgcatc     76380
     cagcggcacc gagaaatagc cgctctgggt gaacgacgag atggcgacga tgacgatggg     76440
     cagcggcagg aagccgaaca gcaggcacag cagcagcagg cgggcggtct tcatctcagg     76500
     cgccccttcc cgatacgcgg gcggccacgc gccgttccag ccattgcagc ggaatgacca     76560
     gcgtgaacgc ggtcagcagc agcaccacgg ccatgctggc ggccttgggg taatcgaaca     76620
     cctgcagcac atcctggtag atctgcgtgg ccagcatgcc gtcgcgcacg ccgcccagca     76680
     gcaggggcgt gacgatggcg ccggtcgaca gcaggtagac cagcatggcg ccggtgatga     76740
     ccccgggcat gctcaagggc agcgtgacgt gccagaaggt cttgaagggg ccggccgaca     76800
     aggtctgcga ggcctcgtcc agcgagcggt ccaggtacag cagcaccgcc agcaccgaca     76860
     cgatgaagaa cggacagaac acgtgcacca ggccgatgac cacgccggtc atgttgaaga     76920
     tcaggcgcag cggcgtatcg atgacgccgg ccgacagcag catggagttg agcgtgccgc     76980
     gcgggccgag gatgaccatc cagccatacg tgcgcaccac cacgctgacc agccagggca     77040
     tgatgaccag catcatcagg aaattgcggt tgccgcggta gcgtgcgatg acgtaggcga     77100
     tcggatagcc gaccagggcc gcgcacgccg tcaccgccac ggcgatgacg atggtgcgca     77160
     ccagcaccgc cacatagtcg gggcgctcga aaaagcgcac gaagttgtcc agcccccagc     77220
     ccgcgccggt gtgcagcgat tcgaccacca ggtagccgac gccgaccacg aacagcgcca     77280
     ccagcagggc cggcggcgcc agcagcagca ggggaggccg gatcgcccgc atcatggccc     77340
     gcgcctcagc gcgccgcgcc ggccatggcg cgctcgaccg cttcgatgcg ggtcttgcgc     77400
     gtcttggcga tcaggttcca gtcgggctgg tacagctggt cgcgcagctt gtccagcggc     77460
     tggccgagtt ccttctcggc cgcgggcgac agcctggcct ggctgttgag cggcatgtag     77520
     ccggcgatct cggcgatgcg ttgctggccc tcgggctggc cgacgtattc cagccacttc     77580
     atgtagtgct cgcggccttg cgcgcccttg ggcaccacga ccaggtacgg cagcatgagc     77640
     gcgccttcct tgggcaccac cagttcgaca ttgcgctgcc cgtcgcgctg catctgccag     77700
     atgcgggtgg agtaataggg cgccgcggcc acctcgccgc gctgcagcag ctggttcatc     77760
     tgcgccatcg agctgtacat ggtcagcgcg ttcttgccca gcgcggtcag cagttcgagg     77820
     cccttggcgg tgtcgcgctc gctgccgccc tcggccaccg acatgatggt caggtcgtag     77880
     gcggagctgt acaccgggcg cgtgaccgac agcttgccgg cccacttggg atcggcgagg     77940
     ttcttccacg aggcgaagtc ggccggcttg gccaggtcgg tgttgacggc aatgccgtag     78000
     taggcgaagt aggtgctgac gccgatcagg cggccattgg gcgccttgag caggtacttg     78060
     tccggcacgt tcttgagcgc cgggaaatcg gccatgtcga aatcctcgag caggccgtcc     78120
     tcgtacatct gggcggcctc gaacagcgag gacagcaccg cgttgaactt gggcgcgcct     78180
     ttctgggccc gcacctgcgc ctcgggcgtg ggcacctcga cgatcttcac ctccagcttg     78240
     ctggccttca tgaagggctc ggcgtacgcc tcgcgccagg ccttgccgac cccgccgccc     78300
     caggtcgcca tggtgatgtc ctgcgcgggc acggcggccg aggcccccag catcgaggcg     78360
     gccagcgccc acttggcaaa tcgctgcgtg atgttcatgt tggctcctgg agagtgctgc     78420
     gagtcaaagg gaaacgacac agacgcgccg gtcgtcccag gtcaggccga cggtggcgcc     78480
     cggctcgggc ggcgcgccgt cctcggcgcc gtgccagtcg gccagcagct tgcgctggcc     78540
     cacggccagc cacaggcgtg tgttctgccc ggcatagacg cggcgcagca cggtggcgcg     78600
     caggcggcct tgctcgagcg cggcgatgcg caagtgttgc gggcgcagcg agacgccgac     78660
     ccgcgcgccc tcggcccact gcgcggcggg cggctgcagg ctgcaatccc agtcggccag     78720
     ccgcacgcgc ggcgcgccgc cggcctggcg gtcgacggtg ccttcgagaa aattggtgtc     78780
     gccgacgaac tcggccacga agcgggtagc cggacgttcg tagacggcgg ccggcgtgtc     78840
     gacctgctcg atcgcgccgt tgcggaacac cgcgatgcgg tcggacatgg tcagggcttc     78900
     ctcctggtcg tgcgtgacga agatgaaggt cgtgcccagc gactcctgga tctgcttgag     78960
     ttcggtctgc atctggcgcc ggatcttcat gtccagcgcg cccagcggct cgtcgagcag     79020
     cagcacgcgc ggctcggtca cgatggcgcg ggccagcgcc acgcgctgct tctggccgcc     79080
     ggatatctgg ccgatgtagc gctcgccgta gccggccagg cccaccatct ccagcgcctg     79140
     cgccaccttg gcctggcgcc gggccggcgg cacgcggcgg atcttcaggc catagccgat     79200
     gttctcggcc acgttgagat ggggaaacag cgccaggctc tggaacacca tgcccagcgg     79260
     gcggcggtag ggcggcgcgg cgacgatgga gcggccgtcg atgcgcacgt cgccggcggt     79320
     gggcgtctcg aagccggcga tgatgcggat cagcgtggtc ttgccgcagc cgctggggcc     79380
     cagcaaggtg aggaattcgc cttcgcgcac gtccaggtct atgccggcca gggccgtggt     79440
     cggaccgaac gttttggtga cgccggatat ctcgaggatt cgggagccgc gctgcgggga     79500
     gtgaccttcc atgctcgaac agcctcgggt ttgcgggtag gcgatgtcgg caggataggg     79560
     gaacggatat gtgctgacaa taatgtttac ccgtaaaacg gtttagaatt accgtacagc     79620
     gataataatc acccgaaatt cgggtaaacg aggagtgcgt atgcttgatt acgacgagga     79680
     gctggccagc aatgccatgt tcaaccagtc gttcgccaag ggcctgaaag cgctgttcgc     79740
     cttccagggc caccagagcg ccatgtcgct gtccgaactg gccgcgcggc tcgacgccag     79800
     catcagctcg gtgcagcgca ccgtcttcac gctggagcgc ctgggcctga tcagcaagtc     79860
     gcccaagacc cgcaagtatt cgctgacgct gcgcgtgctg gagctgggct gcaactacat     79920
     cacggccgat gcgctggtgg aggcggccaa tccgttcctg gccgagctgt cgaacatcac     79980
     cggcgagacg gtcaacctga ccgagccgct ggagcgcgag atggtctacg tctcgcgcgt     80040
     ggtggcggcc aagttcattc ccatccacat gcccatcggc agccgcattc ccatgtattg     80100
     cacggcgtcg ggccgcgcct acctcagcgc gctggacgac gcccgcgtgc aggccatcct     80160
     cgacggctcc acgctcaagc gccacacgcc ctggaccgag accgatccgg cgcgcctgcg     80220
     cgccctgatc gagcaggcgc gcgtgagcgg cgtggcgcac aacaaggaag agctgttcct     80280
     gggcgacatg acgctggccg cgcccatcgt gggcgggcgc ggcgcgccgg tggcctgcgt     80340
     gcacatcgtc gcgcccacca gccgctggac ccaggaagag gccttcgcgc ggctggcgcc     80400
     gccgttgcgc gattgcgcgc gcggcatcgc caacgcggtg cgcgccttca cctgagcggg     80460
     cgcgttcagt tggccacgta gccgccgtcg accggcagcg tcacgcccgt gatgtaggcg     80520
     gcccagtcgc tggccaggaa gcagatggcg ttgaccacgt cgtcgaccga accggggcgc     80580
     gccagcggca cgcgggccag gaagcgggta agcccctcgg ggtcggccac cgtggcgcgc     80640
     gtcatgtcgg tgacggtcag cccgggcgcc acggcgttga cgcggatgcc gtcggcgccc     80700
     agttccagcg ccagcgcctg cgtcatctgc ttgatgccgc ccttggacgc cgtgtaggcg     80760
     gccgaattct tcaccgccac gaacgaatgg atggaggcga tgttgacgat gcagccgcgc     80820
     gtggcgcgca gctgcggata gaaggcctgc gcggccaggt acgggccgtt caggttgacg     80880
     tccagcgtgg cggcccagaa gtcgcgcgcc cgcgggtcgt cgaaggcgct gcgcagcagc     80940
     acccccgcat tgttgaccag cacgccgcac ggccccagcc gctcctgcgc gtcgcgcgcg     81000
     gcggccagca gggcgtcctg gtcggtgacg ctgatcgcgt aggcggcggc cgcgccgccc     81060
     agcgcggcga tgcgcgcgca ggtgtcgtgc gccgcttcgc cgttgatgtc gatcaccgcc     81120
     acggcggcgc cggcctgggc cagccgcagc gcggcggccc ggccgatgcc ggcgccggcg     81180
     cccgtgacga ccgcgctgcg gccggacagg tcgaggaccg gcgcgatgga cggtactgcc     81240
     gtcatggcgc gcagcgtcag gcgaggtggc gctgcatgaa cgccaccgag cgttcctcgg     81300
     ccagcgcggc ggccgcggcg tcccagtgct cgccgccggg gcgggcgaac gcgtggtcgc     81360
     agccttcata gacgtgcgcc tcgcattgcg gcagcttgcc ggccgcctcc aggatgacgg     81420
     cgcgcgcctc gggcggcacg aagcggtcct gctcggccac gtgcagcagc gtgggcgcgg     81480
     cctgcgcgtc cacggtgggc agcagctggt ccagcatcac gccgtagtag ctgaccgcgc     81540
     attgcaccgg cgtgtccatg gccaggcgca cggccaggcg tccgcccagg caatagccca     81600
     ggccggcgac cttgccgccg ctgcgttcgg ccagccaggc gcgggcggtg tccaggtcgg     81660
     cgatggcctg gttctcgtcc atggcctgca tcaggcgcac ggcctggccg aaatcggcct     81720
     cggaggtcgg gtccagctgc acgcccggct cctggcgcca gaacaggtcg gggcacagca     81780
     cgtcgaagcc cagccgggcc cattggtcgg cggcggcgcg catggcgggg ttaatgccga     81840
     agatctcctg gatcagcacc aggcccggcg cgccggccgt gggcgccggg gcgtgatagg     81900
     cctcgaaggt ctggccatcg cgggtcttga gcgtgatcat ggtcatgtcg gatagtcctt     81960
     tgcgttgcgg tggaacaggc aacgcccgcg cggcgggcgt cacgaagatt gggcggccga     82020
     gaaatcgatg ctgactttct cgggatgatg cagcgagcgc acgtattcga ccagcgcgcc     82080
     gtcggcctcg tgcagccagg cgctgacctg cagcaccggc gcgccggccg gcaggcccag     82140
     cgcgccgctg gcgtagccgg gcagggccac ggcggtgacg cggtggcgca gccgagccac     82200
     cttcagactg tacacgcgct cgatgaccgc atagacggaa tccaactcgc catgcagcag     82260
     cggcgcgatg ccctggtagc ggccgggcac gaacacgcgc gtccaggtcg agggcgcgtc     82320
     gtcgtcgacc aggcgccggg tgccggtgac gcgcagccat tggccggtgg cgttgggcag     82380
     cgcggccagg cccggttcgc cgcccgagcc ctcgacgatg gcggtgtcgt cgatgcgcat     82440
     gagcgactgg ccggcgaact ccagcgcgtg cgccaggccg tccatgtgct gcacgtagcg     82500
     gtggccgggg gtattgcgca ggatgcgcgt acccaggcgc ttgacgcgtt cgaccatgcg     82560
     atgctcgacc aggatctcca tcgcatcgcg tatcgtggcg cggctcacgc ccaggcgcgc     82620
     ggccagctcg acctcggtgg gcaggatgct gcccaccggc atggtggcga tgtcgcccat     82680
     caggtcctgg gccacgcggc ggtacagcgg cgttttcttg tcggaatcgg tcatggcggg     82740
     caaggatctc agttgcgcag cgtgccgggc agccacagga cgatctcggg ccacacggcc     82800
     agggccatgg cccacgccag cagcagcaaa aagaacggca gcgtggcgcg cgccacgaaa     82860
     ctgagcgaac gccccgtgat cgattggatc acgaacaggt tgaagccgac cggcggcgtg     82920
     atctgcgcca tctcgaccac caccaccagg aagatgccga accagatcgc atcgtagccc     82980
     gccgccacca ccagcggcag ggcgatgggc agggtcagca cgatgatgga ggtgccgtcc     83040
     aggaacatgc ccagcaccac gtagaacagc agcagcagcg cgatcagcag cagcggcgac     83100
     aggcccagtt cgccgatgcg cgcggccaca tacttgggca ggccgaggta gctcatggcc     83160
     accgagatca gcgccgcgcc ggccaggatc agccctatca tcgagcaggt gcgcaccgcg     83220
     ctgcggccgg cggccaccag gctggcgcgc gtcagcgaac gctgcagcag cccgatcgcc     83280
     agcgcgccca gcacgcccac ggcggcgacc tcggacgggc cggcgatgcc caggtagagc     83340
     gcgcccatga tggcggcgat cagcccgatc accggcagga tctgcgccag cgcggcgatg     83400
     cgctcgcgca gcgtgtagcc cggcccggcg tcgtcggggc gctgtgcgcg cagcgcgatg     83460
     taggccatgt agacggccgc caggcccagg ccgggcagca cgccggcgat gaacagctcg     83520
     acgatggact gctcggccag cacgccatag acgatcatga tgaggctggg cgggatcagg     83580
     aaccccagcg tgccggcgcc cgccagcgag ccgatcgaca gccgcgcgtc atagccgcgc     83640
     tgctgcagct cgggcagggt gacgcggccg acgatctggg tggtggccac cgaagagccg     83700
     cagatggcgg cgaacagggt gcagcccagc acgttgacgt gcgtcaggcc gccgggcagg     83760
     cgtcccaccc agggcgccag tccggcgaac agcgagcggc ccacgctggt cttggccagg     83820
     atctcgccca tcagcacgaa cagcggcagc gacagcagtt cctggctggt cgacgcggtc     83880
     cagacgatct ggccggccag cacgtccagg ggcaggttgg gcttgaacag cagcaacagg     83940
     aagtaggccg cgccgaacag gctgaggctg acccatatcg aggcgcccag gaacagcagc     84000
     agcaaggcgg cggtgacgac ggtgatggcg atcatgatgg cggggcggcg cgggtcaatg     84060
     gccggcggcg cggccgccgt cggtttcggc cgggcggccg gtcagctggc gcagcaggcg     84120
     cgcgacgaag gccagcgcca gcagcgcggc gccggccagc accacggcct gcgggatggc     84180
     cagcggggtc tgcatcacgg tgttcgacac caggccgcgc gcgatcgact tgccggtcag     84240
     gcgcgccagt gcgacgacga tgaccgccga cagcgccagg ccggcgcaac tggccgcgat     84300
     atccagcagc cgggccggcc gcgcgggcag cgcatcgcgc aggaacagga cgcggatgtg     84360
     ggcgccatgg cgcagcgcgg ctcccatgcc gaggaagaac gcggcggcca tgccgtaggc     84420
     gcagtactcc cacgagaacg ggatgctgcg ccccatggcg cgcgcgccca cttcggccag     84480
     catcagcgcg gcgatgccgt acagcaaggc gatggcaagg tgctcggcgc cggcgcacag     84540
     cgcgtcgatc aggcgtagca ggcggtccat ggcggctcgc tcagggctgc ttgcggtctt     84600
     gcagataggc gtcgagcagc tggcgcgcct gcgggcccgc ctggcgcgcg aaagcgtccc     84660
     acatcgggcg gcccacggcg gccacgcgcg cgccgagcgc ttccgagggc gtggcgatgg     84720
     cgaccttgtg ctcgcgcagg atggccaggt ctttctcgtc ctgcgccgcg ctgatctgcc     84780
     agaagcgcgg ctcgagctcg gcggccgcgg cctgcacggc ctgttgctgc gcggcgctca     84840
     gcttgtccca ggcgtccagg ttgacggtga ccaggctgag cgaggtggcc cagttcaggg     84900
     gcaggaaatg cggggtgaat tcccagaact tgccgtccac gccggaggac gcggaggtgc     84960
     ccacgccatc gatggtgccc gcggccagcg ccggcaccac ttcgccccac ggcatctggg     85020
     tgggcgccgc gcccagctgg gccatgaatt cgtaggcggc cttgtcgtgc gcgcgcagct     85080
     tctgcccctt catgtcctca ggagtggaca gggccttgcg gctgaacagc ccgggcgagg     85140
     gccacggcac ggcgtacagg atgcgctggt tgtgggccgc ggcgatgcgg tcgtagaccg     85200
     gccgggcgtg gcgcaggaag gttttcatgt cgtcctggcc ggcgatcagc ccgggcaggg     85260
     cgtccatgcc caggagcggc tcgacgccgg cctgttgcga caccagcatg tcggccagct     85320
     gcacgatgcc ggactccacc gccatcagcg tgtcgggccc cttgacgttg agttcgccgc     85380
     cggcgtgcac cgtgatcagc acctggccgc cagtggcctc gcgcaccttg gcggcgaacg     85440
     cctcggcgtt gcggctgtgg aagttgcccg ccggccaggc cagcgacatg tcccagcgct     85500
     gctgggcatg ggcggtcgcg gcggcggtca gggcgcacgc gcccagcgcg gcgcgaagca     85560
     ggaaacggac ggcggcggac ataggttttc ccttggctaa taagttcgta cttattcaat     85620
     aagtccgaat cttattggcg aacggcgccg ccgggcacta gggaaaacac gggccgcgcg     85680
     ggcggccccg cgctcagcgc gcgtacatgg cggcgaagtc gggcgccggg tcgggatggt     85740
     ccagccccag gcgcttgcac agcagcacca ggccttcgac catcagcgcg gccgccagcg     85800
     atgccgtggt cccattgacg tcgtgcggcg ggctgaccgt attgacgtcg atggcgacga     85860
     tgttcaggcc ggccagcccg cgcaggaacg cgatcgcctc gcgcgcgctc aggccgcccc     85920
     agctgggcgc gcataccccg ggcgcgcagg acggatccag cacgtccatg tccaggcaca     85980
     ggtagaccgg ccgttcgccc aggcgcgcgc gcaggtcctg cagcacttcg gccatgccgc     86040
     gcgccagcag ctcgttgagc gggatgatct ggtagccgaa gtggcgcgca tggcggaaca     86100
     catgctgggt gaaggtggtg ccgcgcgtgc cgatatgaaa cgccagcgag gtgtccacgc     86160
     ggccttccag ggcggcgtgc gtgaactgcg tgccggcgtt gtattccttg cccttgacga     86220
     aggtgttggt gtcggtgtgc gagtcgaggt ggatgacggc caggcccgga tggcgtttgc     86280
     cgaccgcgcg cagttgcggc agcgacacgc tgccgtcgcc gcccatggtg accggcaccg     86340
     cgccgccatc gacgatggcg ccgaccgcct gctcgatgcg ctcgaaggca tcgagaatgt     86400
     cgctgggcac cacgcgcacg ttgccgcagt cgatcacccc gagccgctgc agcgggttgt     86460
     agtcggccag ttcggggttg aaggtgcgca tcaggcgcga ctgttcgcgg atcgactgcg     86520
     gaccctggcg cgcgccgatg cgaaacgcgt gcgtgccgca atcgaagggg atgccgagga     86580
     tggctgccct ggcgccgtcg atggcatggc gatggggcac gcccatgaag gtaggtggcg     86640
     tgtcgcacag gtcatgcagc gcgctggggg atggcatggc ggaggtctcc tggcggcgtg     86700
     gcgccgcccg tggtggttcg gggaagcggc ggcggcgcgc cgttattgca tgctgacgcc     86760
     ggcggcgcgg gcgatgtcgc gccagcgctg caggtcgcgc tgcagcgtct gggcgaacgc     86820
     ctggggttcg ccggcctgcg cgaccacgct caggcgcacg aactgctcgc cgatggccgg     86880
     gtccttcatg acctgggcca gcgcctgctg cagcttgtcc acgatgggct gcggcagtcc     86940
     gtccggaccg aggatgcccc accaggtcag gaaggtcagt ccgggcatgc cggcctcggc     87000
     gaaggtgggc acgccgggaa aggccggcag ccgctgcggc gcggtcatgg ccagcacttg     87060
     cagcttgccc gaggcgacga aaggctgcgc cgaggcatag gtcgagaacg aaccgtccac     87120
     gatgccggcc acggtgtcgg tcaaggccgg cgccgagccg cggtacggaa tgtggttcag     87180
     cgagatgccc gcttcgtgct gcatgagttc gagcagcagg tgggtcgagg tgccggcgcc     87240
     ggcgctggcg gccttcagcc tgcccgggtg cgccttggcc tgggcgatga aatcgtcgag     87300
     gtccttgacc cgcccggccg gcgcgtagag gaacgagggc gaggtgccga tgatgccgac     87360
     cggggcgaag tccttgacgg ggtcataggt cacggccggg ttgaccgccg cgttgaccac     87420
     cagcgggctg tcggccagca gcagcgtata gccgtcgggc gcggcgcggg ccacgaacgt     87480
     ggtgccgatc gcggtggccg cgccggactt gttcaggacc accacgggct ggccgaggat     87540
     ctcgcccagc ggcttggcca gcaggcggcc cagcacgtcc gagctgccgc cggccgggta     87600
     gggcaccacc agttcgatcg ggcgggtggg ccagtcggtc gccggctggg cgcaggccgc     87660
     ggccgcggcc agcaggccgg tgatggccag cgtggattgg acgaacaggc gccgggcggc     87720
     gggcatagta cggagcatga cggttttccc cttggttcga atcatcagcc ggtagtaccc     87780
     tttgcgcagt ctccggccgt ggcaccgagt gtaggagggt gtgcggcgcg ccggttataa     87840
     gcattcaagg ggcatgcagg cggtttgctt atacgcgcgc cgcccgccgc gccgcaccat     87900
     gccaggggaa cgcatgcgct tgcgccatat cgaggttttc cacgccgtga tggtcggcgg     87960
     gtcgctgagc gcggcggccc ggctgctcaa catgacccag ccggccgtct cgcagaccat     88020
     gaacagtctt gaactgcagc tgggcttcgc gctgttccag cgcgtcaagg gccggcttgc     88080
     gcccacgccc gaggcgcacg cgctgcacgc cgaagtggaa aagctcaaca gccagctcga     88140
     cgcggtcaag ctgatggccg tcaacctgcg ccaggacggg ccggcgcgcc tgcgcatcct     88200
     ggccgcgccg gcgctggcga tggaagtggt gccggacgcg ctggccgcct tcatggcgga     88260
     cagccccaat gcgcgcatga cggtcaagac cggctactcg ggcgacatcc tggccgcctt     88320
     gctgctgcgc gatgccgata tcggcctggt ctatcgctgc gcgccgcagg cgctgatccg     88380
     ccaggaaacg gtgggccgcg gcatgctggt ctgcgtggcg ccggccgacc gctacgccgg     88440
     gcgcgaccac gtcacgctgg ccgacctgcg cgacagcgct gtgttcgtgc cggagcggcg     88500
     ccatcccatg ggccgccggc tggccgagct gtgcgccggc caggcgctgg acgcggacaa     88560
     ccacgtcgag atcgagcagt tccatgtggc cctcaagctg gctaccgccg gcctgggcgt     88620
     ggccctggtg gattcgctca ccgcgctggg cgccgacttg cgccgggtgc gcatcctggc     88680
     gctgcggccg gaggtggggt tcgaggtctg cgtcgcctat ccggagttcg acgcgcatcc     88740
     gcacctgtcg caccgcttcg cgcgctgcgt gcgggaggtg gtggccgcac gccaggcgcg     88800
     catggcgccg ggctagccag cacttagcgc gccgcgtcgc aggcagccat ggcggccacc     88860
     cgcagttgcg gatcctgcgc ggcgagggcg cgctgcaggc aggcgtcgta gccgccggcc     88920
     gcttgcgccg gcgggccgct gacctgttgc gccagcgacg catcgaactt gcgcagcgcg     88980
     cgcatcagga cttcgttctc gcggcgatag ccttcggcga tggcggtggc gccgccggtg     89040
     cgcgcccaca tgttgaaatg ctgcgcgtct tcgccgctgg cgtcggcaat gtgccgcagc     89100
     tcccggtcga agaaggcgac cttgatgcgg gcgaccgaat cgtccgccgg atacgcatag     89160
     acatcgacga tcgccagcac gtcgccgctg gcctgcggca gttgggccag gcttacctgt     89220
     tcgacgctgc cgaaatagcg cttcagggat gccgcgaccc aggccagcgg gtaatcgggg     89280
     tcgaacagtt cagccccggc gctggcgatc gtggcgtcgc cgaagcgttt gccctgcgcc     89340
     atggcgcgcg cgttatcgtg gattttccgt ttccaggccg cgttggccag ggtgttttcg     89400
     ctcagtaccg ccaccgcctt gacgtcgggt ccggccggca ccttggccag cggcgacttg     89460
     gggcgctcgc cggggaagat gccggcggcg gcgtcctttt gcggcggaat gggcggcgcc     89520
     ccggcgcagg ctgccagcag cagggcgcac gagagagcgc atagccgcat cagggcgccg     89580
     ggcaggcggc gcatgcgatc ggcggtcact ttggcgctcc cagcggatcg taggtgccga     89640
     ggtggtaggg gcagccgggc gcggacgggt ccgggcagcg cccgccgccc tgaggaccgg     89700
     ccgagcgcag gtcgtactgg ggcgagtagc ccgatctcga cggcgtggcg ggcggctgtt     89760
     gcgcgccagc ctgccgcgcc tgcgcggcgg cggaggtgat cgccgccgcg gcacccaggc     89820
     ccgagatgat gctgttgaag gaggcgtcgc gcgccctgcc accggacact gccgcatcga     89880
     agccggcctg cttcgatgcg gggtcgaagc cgccgggtgc caggccggcg gagaacgccc     89940
     gggacgcgcc gctatcgtcg ggcgccgggg cggactcgct ggccgcgaag gcgctcttgc     90000
     gggcgcagat ggcgcagcct tgcaccttga cgttggccgc cttgatgggc gaggtgccgg     90060
     aggtcgattc ggtgtcctgg ttgcgccgtg tcagcaccgt ggtgtagggc gtctggtcga     90120
     tcaggtacga cacgcgcgag caggcggggg cggagctttg caccagcagc tcggccgagt     90180
     aggatggcgc gctgcccccc gttttcagga tcctgaccgt ggcgctgcag gtgccgacct     90240
     gctgcgcgca atcgcattcg aaggcgtcga aggcctgcgc tggcgcggcc agccagaacc     90300
     cgagcagtag cgcaggccgc ctgttgcgca gcaaggtcca catgttcgtc tcccgtatgt     90360
     gcgcccggcg cgacgctttc gggaacgatt gtgaggccgc gccggcgcgc gcgcgccccc     90420
     catttggggg gcgggcgcat ccgctatctg gcggtctcga tgctccagcc ctgcggcgga     90480
     tagtcgtaga acgcgtacgg gtgggtgtcg acgttggatt tgtccaccac ggtgatgggg     90540
     acgttgaagt gcgggtaggg cacgctgcgg gtcggcttgt ccagcggcgg catgggcagt     90600
     ccttcgtgtt cgcggatggc gtactggaca atgaggcgcc ccatgatgac gcccggctcg     90660
     gaggcgaccg cgagcaggcg gccctcgcgg atcatggctt cgttctcctt gaccatggcc     90720
     gaggtcagca ccttgacggg gcggttggcc tggcgggccg cgcgcaccgc gcccatgccc     90780
     aggaaggtga ccggggtgaa cacgtattcg gcgtccgggg tgcgcatcag caggtcctgc     90840
     gtctgcgcca tgccgtcggc caggctcatt tcgccgcgga aggccgccgg cgtcagcttg     90900
     gcgccgcagg cggaggccac ttccttgaag ccttcgtagc gcagccgcga ccattccagc     90960
     ccggcggctc cgggcacgac gatgacctgc ttgccctgcg cgccgtcgtc gcacagcgcc     91020
     ttgcccagca ccttgccgat cagggtgtcg tcctgcagca cgccgaaggc gatcttgtcg     91080
     ctgttgaccg ggatgccggc ggaaatggtc ttgatgccgg acctggccag gtcggcgacc     91140
     accgggtcgt agcccgaata ggccgccggc gacagcacgg cgtagtccac gcccagggtc     91200
     ttgaacgact gcagttgcgc gaactgctgc tgcacgttgc cgtaggcgcc ggccaccgcc     91260
     acctgcacca cttccacgtt gctgcgccgc gcttcgtcga cgatgccgta ggcgatgccc     91320
     ttgtagaaat tgtccagcag gtgcaccacg gtcacgccca gcttgagagg ctgcctggcg     91380
     acgatgggtt cgacgatgcc ctgcaggcgg tcgccgtcgg attccttggc ctgcgccggc     91440
     aggctggcca gggcgcacgc cgccagggcc aggccggcgg cctggcgcgg caggcccggc     91500
     ctgcgcgagg ttttgccgaa gagtgtcatg gttgtattcc ccttgtggtg tgacgggcgc     91560
     gggcccggtt cagcttcgac gaaagcggtc caggatgacc gcgatgatga tgaccacgcc     91620
     gacgaccagc gtctggaagt acgccgatac gccggtgatg ttcatggcat tggagagcac     91680
     ggacagcacc agcacgccca gaaagacctg cacgatgctg ccgctgccgc cggtcagcgc     91740
     gacgccgccc agcacgacgg cggcgatcga ttgcagcgtc aggccgggca cggccaccgg     91800
     ctgggccgaa ctggtccagg cggtcagcac cacggcgccc accgcggcgc acaggccgct     91860
     ggcggcatac accatcaccg tgtagcgctg cacgttcacg ccggccttgg acgccgccga     91920
     ctcgctcgaa cccagcgcgt agacgtagcg gccgaacacg gtgcgcttga gcgcgaaggc     91980
     ggcggccagc gtcacggcgg cggcgatcca gaccatgttg ggcaggccca gggtcctgcc     92040
     gaagcccacc gcgttcacat agggcgccgg cacgtcgtag atgggaacgc cgccggacag     92100
     gatcagcgcg atggcctggg tcaccgacag catgcccagg gtgaccacca gcggggtggt     92160
     gcgaaagcgc gcgatgatga agcccgagac gacgccggcg gccagcccca cggccagcat     92220
     caccgccagc cccgccgcga cgccccaggc gggcatggcc agcacgccgg ccacgcccgc     92280
     cagcgacagc acggacgaca tggacaggtc caggccgccg cgcaggatgg cgaacgcctg     92340
     cccgaccgac aggatcagca gcggcaccag ctgacaggcc aggttggtca ggttgtccag     92400
     cgaggcgaaa cgcggttcga tcaggctggc gaccagcgcg atcaacgcga tgatcagcgg     92460
     caggatggcg tcggccaggc gcgcggccgg cgcggggcgc gcggcgcggg atacggccag     92520
     ggtcttagtg agcatgctgg gactcccgtt ggccgaggac atcggcgagg atgtggggtt     92580
     ggcaatccgg gccgggctgc gcgtagcgcg cgacggccgc gccgtggaag aaggtgtaga     92640
     cggtgtcgca cagggcgatc acctcgggca ggtcgctgga cagcaccacg acggtcaacc     92700
     cctgcgcggc cgccgcgcgc accagttcgt ggatgtgctg cttggccagg atgtccacgc     92760
     cggccgtggg ttcgtgcagc agcaacagcc ggcgcgccgc gcccagggcg cgggccagca     92820
     aggccttttg ctggttgccg ccgctcaggc tttcgatcgg gtcggcgggg tcgccgtgct     92880
     tgacgccggc gcgttcgagc tgttcgcgcg cccaggcggc ctcgcgggcc ggatcgatgc     92940
     attgccagcg gctgacgcgg tcgagctggg tcagcatcag gttctcgcgg atcgagcggc     93000
     cggtcagcac gccgtggctc tggcggccgg ccggcagcag ccccacgccc tggcgcaagg     93060
     ccgcggccgg attgcgcggc cgataagggg cgtcgtccag gtagtagtcg gcgcgcggcg     93120
     gtccgtccag gcccaccagg ccgtacatca gttcgcccgc gccgcagccc agcacgccat     93180
     agaagcccac cacctcgccg gcgcgcgctt cgatgccggc cagcccgccg ccggccggca     93240
     gcgcgatgcg cagccgggtg gcgccgagcc ggcgcggcgc ctcggcggcg gccgccagca     93300
     cttcgcggcg tccggtcagt ttctccagca ccgcgtcgct ggtgatgccg gcgtgcaggt     93360
     cgaacgagtc gacgcgccgg ccattgcgca tgatggtgac gcaatcgccc accgcttcga     93420
     cgtcgtccat gtggtgggtg accaggatgc aggcgatgcc gtcggcgcgc aggccgcgca     93480
     ccacctcgaa gaagcgctgc ttctcggccg cgcccagcat ggcggtcggc tcgtcgaaga     93540
     tcacgatgcg cgggctgctc atcagcgact tggcgatctc caccagctgc tgcacgccgg     93600
     cgggcagctg gcgcaccggc gcttccatgt ccaggtccag ccccagccgc gccagcacgg     93660
     cgccgacttg cgcggtctcg gcgccgcgcc gcaagggcga ccagggccgg cgcccggcct     93720
     cggcgcccag gcacaggttg gcgcgcaccg acaggtccgg cgccagcgac agctcctggt     93780
     acacgacggc gatgccgcgc cggcgcgcct cgctggcgtc ggccaggcgc acttcgtggc     93840
     cgtcgagcag cagcgcgccg ctgtccggcg caaacagccc ggcgacgatc ttgcctatgg     93900
     tcgatttgcc cgcgccgttc tcgcccagca ggcagtgcac cttgccggcc tcgaacgata     93960
     cggacacatc gtccagcgcc tgggtggcgc cgaagcgctt gctgatctgc cgcaagcgca     94020
     acagcggcgg cggctggggg gagggcgccg cgctggcggc gccttcggaa tgcatcatgg     94080
     cggcaactcc cgaatggccg tcaggggcgg cgcagggtca gatgacaggg ttttccagca     94140
     cgccgatcgg ttcggcgcgc acgcgcacca cgtcgccgcg gcgcaggtac ttgggcgggg     94200
     tgaagccgat gcccacgccc acgggcgtgc cggtggcgat cacgtcgccg ggctgcagcg     94260
     tgatggatgc gccgatggcg cgcaccaggg tgggaatgtc gaagatcagg tccgacaggc     94320
     gggcggactg gcgcagttcg ccattgacct cgcaggtgat ttccagggcg ccgatgtcgc     94380
     cgatctcgtc ggcgctgacc agggcggggc ccatcgggca gtacccgtcg atgcccttgc     94440
     ccagcagcca ttggctatgg cgtttctgca ggccgcgcga ggtcacgtcg ttgaccagcg     94500
     tgtagccgaa cacgaaagac cacgggtcgt cgtccggggc gacgcgcccg gccttgccga     94560
     tcaccacggc cagctcggct tcgtaatcga ccgaatcgca cggatcgagc gcggtgtcga     94620
     tggcgtcgcc cggcccgctg accgacgagg gcggcttgct gaagatgatg ggcgcggcgg     94680
     gaacggcgcc ggccgccgcg ctggagtcga agccgctgcg ggcgaactcg cgggcatgct     94740
     cgtggtagtt cttgcccacg cagaacacat tgcgcggcgg attgggcagc ggcgccagca     94800
     cgcgcaccgc gtccagcgcc accgtatggc gcgcctgcgc ggccagccgg gcgacgtcgc     94860
     cggccagttg cccgtgccgt tgcagcaagg tcagcaggtc gggcaggtcc atggcgtcgg     94920
     tgaggtcgac gagggtgtcc gggccggtca tgacgccggc atggcggcgg ccgtcgggca     94980
     gttcgaagct gatgtatttc acgttggatt ccgttgcggg tggggatcag tcgcgcgcgc     95040
     gcacgaccgc ctcgacttcg atgagaaact cttccttgac cagccggtcc acgatgagca     95100
     gggtgttggg cgcataggcc ttgccggcga acagcgtggg gaacagttcg gcgcgcttgc     95160
     gcatgaagcg cgggatgtcc tgcgagtgca ccaggtaggt cgtgaacttg gccacgtcgt     95220
     tgaaatcgac gcccaggccg gccagcacat cgcgcaggtt gccgaacacc tggtcgaatt     95280
     gcgcctcgaa atcgccgacg ccggccacgg cgccgtcgcg gcccaccgcc agttgcccgg     95340
     cgacgaagta caggtcgccc gcgcgcacgc gcgtggcgtg cgagtacagg ccctgcgccg     95400
     gcgcggcgcc ttcggggttg agatactgca cggctgcttg actcatgttc atgtccttgg     95460
     gggaaggcgc cgcgcggcgc ccggttggga agaatcggaa ggtcactgca ccaggcgccc     95520
     gcaggcgttc tcctggtcgt actcatagac gccggccagg aagatcttgg tgcgttcgta     95580
     ccacttgcgc acgcgcggcg ccggcgcggt gcggtccacc ggcgtgccgc ccttgaagat     95640
     gtagtcgaag cggctgggcc gctgcaacaa ggtgatgtcc tcgagcggat tgcccggcag     95700
     caccagcacg tcggccaggc ggccggcctc cagcttgccg acctcgtggc cgtggcgcgc     95760
     cagcaggcgt gtgcaggcca gcgtattggc gtggatggcc tgcagcggcg tcaggcccag     95820
     cagcttgacg aagatctcca tctcgcgcgc gtgccagtgg ccgtacggca ccggcgacca     95880
     gccgctctcg ctgccggcca gcaggggcac gcccgcgtcg taggcgcgcc gcagattcac     95940
     gctggccgcc tcgatctctt ggcggaaggc ctgggcgctg gacgcccccg cgtgcgattg     96000
     cttggcttcg accaggttga ccagcagggt cagcgtcggc gtgatcacgc atccgttctt     96060
     caggcatgcc tcgatgcctt cgtcgtcgat gtacgaagcg tggaacagat tgtcgaagcc     96120
     ggcctgcgcg gcatacagcg ccgcgtcgcg cgagcgggcg tgcacgctgc acaggcgccc     96180
     caggcgatgg gtctcgtcgg cgatgatctt gaattcttcg taggtgaacg ccgacgaccc     96240
     cagcgcatcg ggcgtgatca ggttgtcgtt cgaccccgat accttgatgg cgtcgacctc     96300
     gtccttgacc tggtagcgga tcgcctcgac caggtcctcg cgcgtcttga ccagcaccgc     96360
     gctttgcccg ggcggaaacg ccatttcgtt ggggaacgaa tcctccagcc cctggtgatt     96420
     ggtcagctgc ttgcccgaga ccgtgaagcg cgggccctcg aacatgccgg tgtcgatggc     96480
     gtcgcgcacc gcctgggcga tgttgtagct ggtggccgcg tcgaaggcgc tggtcacgcc     96540
     ggcctgcagc accttgcggg cataccacag cgccttggcg gtgcggaact cgaccggcgt     96600
     ataaagcgca ttctcttcct ccgagcggga ctcgccgaag gagatatggg tatgggcgtc     96660
     gatcaggccg ggcatgatgg tgcgcccggg cagatccacc accgtatggc ggtcgccggc     96720
     gtattgcgcg ggcaagcccg attgcgggcc gacccaggcg atgcgctcgc cctcggtgac     96780
     gacggcgcct tgctccagcg ccggaccgag cgtgccgtcg atgaccctgc ctttgagtac     96840
     gtagcctgtt ttcatgggga tattcagaga aagtagggaa gtgcgccaaa ccgctggtgc     96900
     accatggcga ggaaaacgtc cggccgctcg aaggccaccg aatgggagca accggccagc     96960
     agcaccaggt cggcatcggc cagctgttct gcgatccgtt gcgaggcggc gggcgggaag     97020
     gcggcgtcgt cgcgcccgtg cagcagcgtc accggacagc ggatgccgcg cagcgtccgt     97080
     tccgacagcg tggccgcggc gatataggtt gcgggcgcgg cgtcgaacat ggcgtcgaag     97140
     taatcggcat agcccggcgc gaagatgacc ggctcgcgca cggcgagata ggcctcgtcg     97200
     atgaccgaat ggtcgtggat caacccctgc agcgcccgca ccagttccgg gcggctgcgc     97260
     gggcacttcc aggtgcggcg cgtcgcgtcg ttcggcgcga aggggatgcc catggtgccg     97320
     gtggccacca cgccgcgcac cgccggattg ccgctggcca ccgtcagcgc cagggcgccg     97380
     gccagcgagt ggccgaccag cccgatcggc ccctcgccca ggtgggacat catggcgcgt     97440
     acctggcgca cccacatgtc gaaatcgaaa tacggcgcgg cgggcttgcg gccgctctgc     97500
     ccgaaaccga ccaggtccat ggcgaccacg tcgaagcggc gcgccagcgc cggcagcacc     97560
     gcgcgccaat tgcccaggct ggacgcgccc ggaccggagc catgcaccag cagcagcgtc     97620
     ggcccgctgc cgccgcgcag gtaggcgcat tgcgtgcctt cgaaggggag atgcgagagg     97680
     gtgtatccgt cgggtaggga catggcatgg caatggttgt ttcgaattaa aatggattct     97740
     atgtattcaa atcgatcaaa acaacaccgc gtaaacccgt acagtagaat ccatacttgc     97800
     attgaaaatc agttatgggt gccgcgtgtg ctaccattgc cgcactattg gtcagccaca     97860
     tcatgaaaaa cgcgaagaac gggcgcacac tcaatgccga ggtctacgcg caattgcgcg     97920
     cgcagatcct taccggacaa ttcatgccgc gccagcggct caaggtttcc cagctatccg     97980
     agcagcacgg cgtcagcctg aatgtcgtgc gcgaggccct caatcgcctg gccggcgagc     98040
     aactggtcga gctgcagccc caattcgggt tcgcggtgcg cgggctgtcg gccgaggatc     98100
     tggtggatct gttcgagcag cgcggcgtgg tcgagagcct ggcgctgcgc cagtcgatcg     98160
     cgcgcggcga cctcaactgg cagtcggacg tggtggccgc gcaccatcgc ctgggcggca     98220
     ccgccgtggt ctcgcccgac gacccgcaga agctgaaccc ggaatggctg gcgcgccacg     98280
     aggagttcaa cctcgtcatg atgcgcgcct gcggcagccc ccggctgctg cagatcgtgc     98340
     gccagctggc cgaggcctcg gccatctacc agcgcgcgct gttgcccctg gcggccgtgg     98400
     cggcggagct cgagaccgag cacgacgacc tgctgcagcg catcctggac ggcgacgccg     98460
     atggcgcggt gcgcgtgctg ctcaagcaca tggaacagac ccgcgacgcc atgctgcctt     98520
     tcctggtcca gcaggaagtc gccgggcagg cctgaggaag cggcctggcg ggcattccat     98580
     gcattgaacc cgcaacgccg ctcaggatgg cggccgcgcc ggctggcggc gcctgcgtgg     98640
     cgccagcagc ggcgactcgc cgatgcgttg cgcggcaaag tgcgcggcgg gagcgggccg     98700
     tggcagcccc tcgtcgcgcg ccgttgcgac ccagtcggga acggcgatct gccggcgttc     98760
     gctcagccgc ttcataccct cgttccattc ccacagcatg cgcaagccga ccggctcgaa     98820
     acccggcgta tggcggatgt gcgccttgag ttgcggcacg gtgtcggcga tcgccgaaca     98880
     cacccggtcg accagctcgc gctgcgcagc gggcgcgaaa ccgaggtgct gctgcaggta     98940
     acgccacaag gccttggaca tggtccatga cttgcggcca tcgagggcca tgccgggcgg     99000
     attggccgca tagcggtcgt aggcaagaat cgtcaacatg tcatagaccg gtgcgatgcg     99060
     cacgtcgtcg atcgtgtcat agacgagggc aagattcttg gcgtggcaat ccgcgttgcc     99120
     caatgcgaaa ctcagcagca gcgtgatcgc caattgggtg cgggcttgca gccgtccttc     99180
     cggccgcacg taatcgctgg ccacgcgggc cacgcgctcc caggtgctgt cgtatttttc     99240
     gtcggccgac aggcccagca ggctgcagaa gtcctcgaag cccaggcggc ggccggtagc     99300
     cggatcgatg tcgaatcgct cgaccaccag cacttgtccg tcgtcggaca ctctggtgcg     99360
     tgccaccggg atgccggtgc cttgcgcggc cgtcatgcaa agatgctcgt tgagggccac     99420
     gaagggttga tgctcggagc tgcccttgac aatatgccgc tcggtggcga tggtgccctt     99480
     gcgaaagagc gcctgggttg ccggcgtgag gaatttgggg accacgcccg agacgccgga     99540
     ggcggcgtat tgggccatca gttccagaaa gacctgttgc gatgccggcc cgtgcagcag     99600
     cggatccagg ctctcgagtg ccatcgcggg ctcgagcgtc gcgcccacgc tgacctggac     99660
     gcggccgatc atgttcgggc cgacgactgc cagcagatcc agctgcctgg cgcccagttg     99720
     gggaccgagc tgctccttga gcagcatgag aagaaatccc tcgggcaggc ttacctggaa     99780
     gaagggatgc agcgttggcc agcgccaggg ctcggcgcgc accggcatcg tcagcgatgc     99840
     gaatctggcc gggtccgttt cgggcaggta ggccagccga tgctggaagc catcggggct     99900
     gtcgaggagg gcgactcggg tcccgtggac gaagacgttc agcttcaaga cgggtccttg     99960
     gcgtcgtcca ggcggccgcg tcgctcggcc agcagatcgt cgagatcggg gcggcgcacg    100020
     accggcttga agtcgaattc caggtccagg gcctgcagca gcgtcagcag cttgttcagg    100080
     gaaaagtcgc tcgccgaacc ggcctcgaag cgggagatgg cttcctggcg catgcccgtc    100140
     gcggcggcca gctcgcgctg ggttttgcgg gcctgtttgc gcaaggttct gaagcgcgcg    100200
     cccacgtccg gcaaggtctt catcgaaata tatgcggcaa gaggcataaa atacaccaga    100260
     ccaagaaaaa aatgctgtga aacgcataaa tcgaagagca gcgatctgat gagcacgtct    100320
     taatttatgc gatcggtagc atattttagc agttaatctg aaaattatgc gttcatcagc    100380
     ataattctcc ttgcgcgctc ccatgggctg cggcgcaagg cgccgcagcc cggctcgtcc    100440
     gggctaccat ttgtttagaa gtcactttaa ataatcaaga ttaaaaaata tacttaactt    100500
     gttgatatta aatatattaa ataaaacacg gaagtgattt ccgcagccca tgagcgcgca    100560
     cgcacgccgg gctggtggta cgctggatgg cattcctcca accatccctg tttatgaacg    100620
     attccattcc cgacggtttc gcgccctggc ggccgggcag ccccttcatg gcccatctgg    100680
     ccgatctagg caccttctac gtgcgcgagg ccgacgacgc gctggccgtg cgcgtgggac    100740
     cgccgcatac caacatgcac ggcatcgcgc acggcgggct gctggccacg ctggccgaca    100800
     gcgcgctggg ctactgtatc tcgcggcggg cacaggcgtc ggtggtgacg gtgcagatgt    100860
     cggtcgaata cctgagcgcg gtcaagccgg gcgactggct gcaggcgcag gtgcgcatcg    100920
     acaagcaggg gcgccggctc atctacgcca cttgcctgct gcaggtcgaa gacaggctga    100980
     tgctcaaggc caacgcggtg ttcgccgtgc gggcggcgcc ggcgccggtt tcggacggct    101040
     agccgcccgg cgtggtggag gccgattcgt cgtgggccgg ccgggcatgg cggcggcggg    101100
     ccgccagcca cttgccggcc gccaccacca ccagcgcccc ggcggcttcc acggccagct    101160
     tcagcatggg cgcgggctcg ccccagcgct cgaccacgta gatgtcggtg atgagcatgc    101220
     cgccggcgat ccagcccagc aggccggcgc ccagggtgac gaccagcggg aagcggtcga    101280
     tcagcttgag caccagcgtg ctgccccaga cgatgatggg cacgctcacg cacagcccga    101340
     agatcacgta gtacagctgg tggtcggcct gcgcgttctg ggccgcgccg gcgatggcga    101400
     tgacgttgtc caggctcatg gcgaaatcgg ccaggatgat ggtgcggatc gcggccagca    101460
     ccgaggtgcc gccggtgatg ttgccgtgcg cgtcctcatg cggggccagc agcttgacgc    101520
     ctatccagac cagcagcagg cagcccaggg ccttgagaaa cggaatgtcg agcaggacca    101580
     gcgcgaaggc gatcagcagc acgcgcagca gcaccgcgcc ggccgtgccc cacaggatgc    101640
     ccttgatgcg ttgccggtgc ggcaggttgc gacaggccag cgcgatcacg acggcgttat    101700
     cgccgccgag caggatgtcg atcagaacga tctggaatat ggcgccccaa tggaacgtct    101760
     cgatggcctc gaccataagt agtccgccga aaggacgatg gagcgccgca tcgacgcggc    101820
     ccgcaggccg ctcccttgaa agacacgctc ctgccgattc taggcagggc ggcgggcgga    101880
     tcggccagta ccggtgacgc gctcagggtt actgggccgg ggcgcggcgc gcgccggtcg    101940
     tcgcggcgcg gccgttgcgc ggttcttacg cggccgcggc gcgcccgccg tcgatctgga    102000
     agatcgagcc ggtcacgtgg cgcgattcct cgctggccag gaacaccgcc atcgcggcga    102060
     tttcgtctgg ttcgggcagg cccagcaggt ggcgcgacac tgccgcggcc acgcgcggat    102120
     cctcatcgat gaagcgcgcc atgcgctcgg acagcacggc gccgggcgcg atggcgttgc    102180
     agcgcacgcg ttgctcggcg aactccaccg ccatcgagcg cgtgagcgca tgcacgccgc    102240
     ccttggcggc cgtgtaggcg tcgcgccctt tcaggccgcg cagggccgcg atcgacccca    102300
     tgttgacgac cgcgccgccg ccggccgcgg cgatgcgcgg gatggcatgg cggcagcaca    102360
     gcacggtgcc cagcaggtcg atgttgatgg cgcgccagaa ttcctccagc gcgaattcca    102420
     ccaccgagcg gtcgttcagg ctggagccgc cggcgttgtt gaccaggatg tgcagcggcc    102480
     catgctcggc ctcggccagc tccatcgctt gccgcacgct gtcctcgtcg gtcacgtcca    102540
     ggcgcgcgaa acgcgcgcgc gcgccggttg cggccagctc cgcggccagc gcctggccgc    102600
     gctcggcatc gatatcgccc agcagcacgc tcgcgccctc ggcgcagaag cggcgcgcca    102660
     tggccgcgcc gataccgacg gccgcgccgg tgatgagggc gttgcgcccc gaaagtcgtc    102720
     ccatagtgtg tcctggtgag ggccgggccg cttcggcccg gcccgatggt tcattcgagc    102780
     cgggtgcccg agcgcttgac gatctcgtcc cagcgggcga tctcgtcctg gatgaactgg    102840
     ccgaaggccg ggccatcgag cgtcttgatg tccatgccca gcgcttccag gcgctcgcgg    102900
     atggccggct gctgcacggc ggcgatcata tcagccgaca gtttctcggc gatcggcgcg    102960
     ggcgtgcccg ccggagccag cacgccgaac caggcgcgca cgttgaagcc ttccagccct    103020
     tgctcggcca ccgtgggcag atcggggaag gccgacgagc gatgcgcggc ggtgaccgcg    103080
     atcgggcgca ccttgccgct cttgatgaag ggcagcgccg cgggcacgtc gacgaacatc    103140
     agctgcacct ggcccgacac caggtcggtc agcgccggca cgctgccgcg atacggcacg    103200
     tgcagcagct cgacgccggc ggccagcttg aacagctggc ccgacaggtg ctgcgagctg    103260
     ccgttgccgg ccgacccata ggcgaccttg ccggggttgg cgcgcaggta ttcgatcaat    103320
     gtcggaatcg aggttaccgg caggtcgttg ttgaccagca cgatattggt ctgctcggcc    103380
     agcagggcca gcggggtgaa acccttgacc ggatcgtagg gcaggcgctc gccatagagc    103440
     gcggggttga tgccgtgggt ggcgatggtg cccatgccga tggtgtagcc atcgggcttg    103500
     gcgcgcgcca gcaggtcggt gccgatattg ccgctggcgc cggtgcggtt ttccaccacg    103560
     atcgactggc cgtagcgggt ggacagttcg ctggccatgg tgcgcgccag cgtgtccagc    103620
     acgccgccgg tggagaacgc caccagcagg tgaatcggct tgtcggggta ggtaccggta    103680
     ctggcggccg ccggggcggc caggaatcca gccgagccca ccacggccaa ggcatgggca    103740
     aatcggcgaa tcaatcgcat gcgagtctcc atcttgttgt cgtgactgaa ggcaggcgac    103800
     gatctcgccc gcgccaggcg cacattaagg cagacccggg cgggcaggca aaaccaaatc    103860
     tttttatgga ttcagcagaa tattttatga atgcgcgcgg ccgcgcggcg cggcctggaa    103920
     agtccgcgag atcccggcgg gtcagaagat cagcgcgacg gtgcccagca cggtgctgtc    103980
     gctgtcgagc cggcgcgtgc tgctgatggt gggggtccag cgcaggctga acgacagcga    104040
     acgctggtcc gccagcttgc ggtcataggt gaggatgggg ccgagcgccc agtcgcggcc    104100
     ctcgaagccg ttgaggcggt cggccgtcgg gcccttgtcc ggccccagct gctgctgggt    104160
     gccgacgatg agcccggcgc ccacgccgtt gccgaacagc ttgcggccca tcagctccag    104220
     gccgaagatc ggcgcgttgc ggtagtcggt ggccgtattg cgggtataga actgcacgtt    104280
     ggccacggcg tcgagctgca ggccgtgttc ggggaacatg ccggtatagg cgacctgcgg    104340
     aatgaaggtc cagttgttca ggctggggtt ggccagcgcg tcggcgtcgt acttgccggt    104400
     gggcgcccag atgctcaggc tcagggccag gtgctgggtc tcggagaagt ggtagccggc    104460
     gatcaggggc gtgaagttca ggtcgaacag attggacgcg atgtcgcttt cgcgggccgc    104520
     gcgtccgcgc tcgccggcca gcgtggcggt ggtcttgagc cacaggtagg ggacggtcag    104580
     gctggaggcg aagttccagc gtccggggcc ggtgtcccag gtcttcatga gcgtggccag    104640
     ggtcagggcc atttcggcgt ccaggcccag cgaggtcttg cccgccaccg gcacttcgcg    104700
     gctgccgcct atcctgccgt cgagatagag ctggcccagg ctcagcaccg taatgggttg    104760
     cggcgacacc acaccggcat tgggctgcac cgtcgtgccc gtgaccagcc tgcccagcgc    104820
     gccttcggtg gcgcgtgccg cgccgggcag ggcggccagc gccagggcca gaccggcgtt    104880
     gcaaaagcgc catgcaaacc tgctgcgcat attgtctcca cgatcgctgc gtaggaagcc    104940
     ggacggacga gcagccaggc ggcggatggc atccggagca tggggggctg gtcggtggat    105000
     gcgcgctggc tcgctgcctg cccggcgagt ttctgccgat tccccagggt agtcaagccg    105060
     gtgcgcaagg ttaccgattg ccccaaagtt gatgacaact gaaaacaaaa ctgggtatcc    105120
     tgccagggtc gaatgtctcc ctgggcgcgg atcgggggac attcagctgg atctggcaag    105180
     ccttggcggt accgtgttgg cgatggcgcc tctgtggggc gctccgttct cagacgcgtg    105240
     acggagaagg gccgtgaagc agcagctgaa gatcgcattg gccatggcgg ccatcgtggg    105300
     cgccgcgggc gcgctgggcg cctttgtggc gagcacgtcc gatgcgccgc aggcgcccgc    105360
     cgtcaggctg ggcgacggca aggcggggcc ggccggcatg gcctggattc ccggccacca    105420
     gttcctcatg ggcaatgacc acaagctgtc gcagcccaac gagcgccccg cgcaccaggt    105480
     gcgggtcagc gggttctgga tggacgtgca cgacgtcacc aacgcacagt tccgccgctt    105540
     cgtgcaagcc accggctacc tgacgaccgc cgaacgcaag ccgcgctggg aagacctgcg    105600
     gccgcagctg ccgcccggca cgccgcgtcc ggacgacagc cagctggcgc ccggcgccat    105660
     ggtattcgtg ggcacccaga gcgaagtctc gctgcgcgac tattcgcgct ggtggcgctt    105720
     cgtgccgggc gccagctggc gccatccgca agggccgggc agcggcatcg acggcaagga    105780
     cgaccacccg gtcgtgcaag tgtcgtacga agacgcgcag gcctatgccc gctgggccgg    105840
     caagcgcctg cccaccgagg ccgaatggga attcgccgcg cgcggcgggc tggagcaggc    105900
     cacctacacc tggggcgacg agctgctgcc gcagggccag gccatggcca acatctggga    105960
     tacccgccag cagcagccgt ttccggtcgt caaggacgag aaagtgcagg tcggcacgac    106020
     gccggtgggc agcttcgcgc ccaatggcta tggcctttac gacatggccg gcaatgtgtg    106080
     gcaatggacg gccgactggt accgggccga cgcgttccgg atccaggccc agtaccgcga    106140
     acccccgctc gatccggccg gccccgccga cagtttcgac ccggacgacg gcaatgtgcc    106200
     ggccgcggcg cccaagcgcg tgacgcgcgg cggttccttc ctgtgcagcg acacctattg    106260
     catcagctac cgcgccagcg cgcggcgggg caccgatccg ctcaatccca tgtcgcacct    106320
     gggctttcga acggtgatga cgccggagca atggaagctg gcccaggccc gccagggccg    106380
     cctcgccagc cgctgagccg gcgcgcgccg gcggcccgcg cacgtgggcg cggacacaca    106440
     caggagcatg catggccaat cgtgatggca ttctggcgtt ggagcaggcg gtgtcggcgg    106500
     cggtgctggg gcaggcggcg gtgatccgcc acgtgctggt cgccttgctg gccgatggcc    106560
     acgtgttgct cgaaagcctg ccgggcctgg ccaagacgcg cacggtcaag gcgctggcgg    106620
     cgcacctgga cgcgaccatg cggcgcatcc agttcacgcc cgacctgctg ccttcggaca    106680
     tcaccggcgc cgacgtgctg cagcaggacg ccgaaggccg ccagcgcatc gagttccagc    106740
     aggggccgct gttcggcaac ctggtgctgg ccgacgagat caaccgcgcg ccggccaagg    106800
     tgcaatcggc cctgctggag gcgatggagg agcggcagat cacggtgggc ggggtgacgc    106860
     ggccgatggc gccgctgttc atggtgctgg ccacccagaa ccccatcgag caggagggca    106920
     cgtatccgct gccggaagcg cagatggacc gtttcctgat gaagatccgg ctggactatc    106980
     cggccgccga cgacgagagc gcgatgctgg ccttgctgcg cgccgcgccc cagcccggcg    107040
     cggccgccgc gacgcggctt gcgcaggagg agttgtttgc ctgccgggac gcggcggccg    107100
     ccctgtatgt ggcgccggcg gtcgaccgct acatcgtgga tctggtcaac gcgacgcggc    107160
     ggccggccga ctacgacgcc gagctgggcc gctggataca gatcggcgcc agcccgcgcg    107220
     gcgccatcgc actggaccgc gcggcgcgcg cgcatggctg gctggccggc gccgacttca    107280
     gttcgcccga cgatgtgcgc gccgtggcgc atcccgtgct gcgccatcgc ctgcacctgt    107340
     cgtacgacgc ggtggccgac ggcgtcacgg ccgaacaggt catcgaccgg ctgctggaca    107400
     ccgtggccgt gcccgcctag gaacgccgat gccgcgcgcc gcccatcccg tccacccgcc    107460
     gttgcccgaa ctgatggcgc tggaagcggc cgtgggcggc ctgtcgttcg tggccggcca    107520
     gccgctgggc agcgtgctgg ccggcctgca tggctcgcgg ctgcgcggcc gcgggctgga    107580
     cttcgccgaa ctgcggcgct atgtgccggg cgacgacctg cgccagctcg acccgcgcgc    107640
     gtcgctgcgc tacggcaagc cgtacgtgcg cgcctatacc gaggagcgcg accggcccgc    107700
     gatgatcgtg gcggaccagc gcatgagcat gtatttcggg tcggtgcgcg ccttcaagtg    107760
     cgcggtggcg gcccgtctgg cggcgctggc ggcctggacc gcctatcgcg gcggcgaccg    107820
     cgtcggcggc ctggtgttcg acgacgacgg cgtgcgggcg ttcaagccgc tgcgcagccg    107880
     cgaccgggtg caggcgctgc tggcggaagt ggcgcgcgcc aacgccgggc tgtccgcggc    107940
     gcggcccgag cggccggcgg gcgccggact gaacgcggcg ctgcgcggcg cgctggcgca    108000
     tgcgccgcac gattgcctgg tgtgcatcgt gagcgacttc gccggcgccg acgccgagac    108060
     cttgcgcacg ctgcgcctgc tggcgcggca caacgacgtg gtggcgatgc tggtgttcga    108120
     tcccatggcg caggatctgc cgcgccgcgg ccggctggtg gtgacgcagg gcgaattgca    108180
     gctggagatt gccgtgggcc ggcagcgcga gcgccagccg ctggccgact ttttcagcgg    108240
     ccgcctgcgc gaagtggccg acctgctgcg gcgcagccgt gtgccgctgc tgtcgatcga    108300
     cacggccgag gacgaagtgg tgcagctgcg ccgcgcgctg gggcgcctgc agacgggagc    108360
     acggcgatga gcgacgcgct gcccggcctg gaccagttgc aggagctgcc gctgccggcg    108420
     gcggtgccgt attggccgca gacctggggc tgggcggtgc tggcggcgct tgtgctggcc    108480
     ggcgcggcat gggccggcta cgcgggctgg cggcgccggc gccgcaaccg gtaccggcgc    108540
     caggcgctgg ccgagctgca gcggctggcg cgcgccgcgg ccgccgatcc gctggccgcg    108600
     cgcgccttgc cgggcctgct caagcggacc gcgctggcgg ccggccagcc cgccgtggcg    108660
     ccgctgggcg gccaggcgtg gctggcgcgc ctcgcgcagg atgccgcagg cgccgcgttc    108720
     ccggacgaca gcgcgcgcat gctggcgctg ctggcctatg cgcccgacgg cgccgtgcgg    108780
     gcgctggacg cgccggcgct ggcgcgcctg ttcgcggcca gccgccgctg ggtggagagc    108840
     catcatgtgg cggcttgagt atccctggct gctcgccgcc gcgccgctgg cgctggcggc    108900
     ctatcgctgg ctgccggcct acgtgcaggg ccggcaggcg ctgcgcctgc cttttttcga    108960
     cgccatggcc acgctgaccg gcaagtcgcc cacgcgcccg ggcgtgcagc gcggccgggc    109020
     ccagttgtgg gtgaacgtcg ccgtgtggct gctgctggcg ctggcgctgg cgcgtccgca    109080
     atgggtcgag ccgccgctca cgcacgtaga gcccatgcgc gacatcctgc tggccgtgga    109140
     tatctcgcag tccatggaca gcgaggattt ccgcgatgcg cagggccggc cggcgtcgcg    109200
     ctggcaggcg gtccaggcgg tagtgggcga cttcatcgac aaacggccgg acgaccggct    109260
     ggggctgatc gtgttcggcg ccggcgccta cccgcaggcg ccgctgacgc gcgaccacgc    109320
     cgcgctgcgc ctgctgctgc agcgcacggc ggtgggcatg gccggaccca acaccgcgct    109380
     gggcgacgcc atcggcctgg gcatccgcat gctggaccac gcccgggagc gcgacaagat    109440
     actgatcctg ctgaccgacg gcaatgacac ggccagcgcc gtgccgccgg cgcgcgcggc    109500
     cgagctggcc gcgcagcatc gggtcgtggt gcacaccatc ggcatcggcg accccgccgc    109560
     cagcggcgag gaccgggtgg atttcgacgc cttgcgcgac atcgcgcgca tcgccggcgg    109620
     gcgtttcttc cgcgcccgcg accaggcgtc gctgcaggag gtgtacgcca cgctggaccg    109680
     catcacgccg cacgaagtgc gcacgctgcg ccaccagccc aagcgcgagg atttctggat    109740
     gccgctgggc gcggcgctgg cgttgctggc gctgtggcat ggcggggcgg ccctggccgc    109800
     ctggcgctcg gcgcgcccgg accggcaggc gcgccgggag gacgcatgga catagacctg    109860
     agcgccttcc atttcctgcg cccatggtgg ctgctggccg tgccgctggc cgcgctgctg    109920
     tggtgggcgc gccgcggcga gcgcggcgcg cccgggcgcg acctgcgcat cgcgccggcg    109980
     ctgctgccgt acctggtgct gcgcacgccg ggcagccgcg ggccgcgtcc catcgatgcg    110040
     ctggcgctgt tcctggcgct aggcggcgtc gccgcggcgg ggcccgcctg gcagcgcgac    110100
     gagccggcct atctggacaa cgtggcgccg ctcatcgtgg cgctggatct gtccgcttcc    110160
     atggacggcg cggacgtgcc gcccacgcgg ctggaagcgg ccaggcgcgt gctgcgcgac    110220
     ctggcggcgc ggcgcgcggc cgcccgaacc gggttgatcg cctatgcggg cagcagtcat    110280
     ctggtgctgc cgcccaccga cgacgcgggc ttgctggacc tgtttgcgca ggccctggcc    110340
     accggcctga tcgagcgccc gggccgcgac gccgacggcg cgattgcgct ggccgcacag    110400
     gccctggcgg ccgagcgcgc cggcggcacc ttgctgatcc tgaccgacgg cgccgaccgc    110460
     gcgcgcatgg acgccgtgcg ccggcaggcc caggccgcgc gcgacatgca ggtgctggtc    110520
     atggcggtgg gcgtgaacgg catcgatacg caggccctgc aggagctggc gcgcgccgcc    110580
     ggcgcggcgc tgggcagcct gacgggcggg ccggacgacc aggactggat cgcgctgcat    110640
     gcgcaggcgc atttccgtgc ggtgcaggat gcgcagtccg ggccggtgca ttggaaggac    110700
     gcgggatact ggctgtgctg gccattggcc ttgctggccc tgctggcggt gcgccgcggc    110760
     tggagcgtgg cctggagcgc cggcgtgctg gtcgtggcca tggccggcat gccgcagccg    110820
     gcgcgcgccg atgcgctggc cgatgccttc ctgaccgccg accagcaggg ccgccgggcc    110880
     ttcgagcacg ggcgctacga cgaagcggcg cggcatttcc atgatccgta ctggaaaggc    110940
     cgggcggcct acgaagccgg cgattacaag gccgcgctgg cggcattctc gaccctgccc    111000
     agcgccgagg gctatttcta tgtcggcaat acccagactc gcctgcatcg gtacgacgcc    111060
     gcgctggcgg cctacgaccg ggcgctggcg ctgaagccgg gctggcagcc ggccgtggtg    111120
     aaccgcggca tcgtcgcgcg cctgctggcc gccatggcgc agacgcagca ggaccagccg    111180
     gccgagccgc ccgaccagac gattgccgac cggaccgcgc aggcgggcaa gatgagccag    111240
     gcgccggtgg cgcaggccgg ctcggaagag gcctggctgc gcaatctgac gctgtcgccg    111300
     gcgcgtttcc tgcgcagcaa gttcgccgcc gaggacgcgg cggccggagc gcggccatga    111360
     ggcgctggct gccgctcgcc tgcgcggcct tgctggcatt ggggctggcc ggcgcgccgc    111420
     gcgcccagga cgcgccgccg ctgcgcgtga cggcgcgcct gcccgcaggc gcgcaggcgc    111480
     aggctggcgc cacgctgcgc ctggagctgg acgtgatgac cactacctgg ttcacacagc    111540
     cgccgcggct gcccgcgctg acgctgccgg gcgtgatggt gacgccgccg tcgggcgaag    111600
     gcgagctggt gcgcgccgaa cacaatggcg tggcgtacag cgggctgcgc tacacctatc    111660
     tgctcagtcc caccgccgcg ggccaggtgc aggtgccggc gctggcggtc agcgccgagg    111720
     tggggccggg caagacgccg gccagcgcca gcagcgcgcc gctgtcgttc accgtgggcg    111780
     gcgcggcggg cgggcagccg gccccgcacg gcgcgttgac ggtgtcgcag gacttcgcgc    111840
     tggcgccgga cccgctggtg gcaggcggcc gggtgacgcg cagcattacg cagcgcgccg    111900
     aaggggtgca ggccatgctg ctgccgccgg cgccgttggc cgatgtgccc ggtttcaagc    111960
     gctatgcgcg cgaaccggag gtgaccacgc tgaccgatgg ccgtggcggt ttcgtgggcg    112020
     ggcaacgtat cgatcgcgcc gattacgtgg ccgagcaggc cggcgagctg agcctgccgg    112080
     cagtgacgct ggcctggcgc gacggcgccg gcgggcagcc gcgccagcag gcgctgcccg    112140
     gccgcacctt cgcggtggcg gccgcgccgg ccgtcgcgcc gccgttctcg ctgaccgacg    112200
     atctggcccg gctgcgccac ggcttgcgct gggtgctgcc ggcggcctgg ctggcctggg    112260
     ccgccggcgg tgcgctggcc ttgctggcgc tctggctggg ttggccctgg tggcgccagg    112320
     gcctgtgccg gctgcgcgcg gcggcgctgc gccggcgcgc gcggcggcgg gccggcgagc    112380
     cctggcactg gcgcgcctgg cgccgcgagg cgcggcgcga cagcggcacg ctgagcgcgt    112440
     tctaccgctg gctggcgctg gccgccggcg cgcccgatat gcgcggcgcc acggcgacgc    112500
     tggacgaggc ggcgcaaggc gcggcggcag ccgcgctgcg cgacgcctat ggccgcgccc    112560
     cggcccgggc cggctggcgg gcccgcctgg gcatggcgtc acggcaatgg cgcggcaatt    112620
     ggcgggcgcg ccgcgccgcc gcgccggcgc atggcctgcc tgaggttctc aaccccgcgc    112680
     gcgccgcgcg tccaaggagc tgacgatgaa cagacatacg accgagggtt ggcgccgctg    112740
     ggcggcgcgc ctgggcgcgg ccgccatggc cttgctgctg gccgcctgcg cggcgccgcg    112800
     ccagcaggcc gcgtccgtcg acgagctgcc gtcctggaac gacggaccgt cgcgcacggc    112860
     catcgtcgag ttcgtgcgcg cggtcacgcg ctccggcggg ccggatttcg tcgccgccga    112920
     cgaacgcatc gccgtgttcg acaacgatgg cacgctgtgg agcgagcagc ccatgtactt    112980
     ccagatgctg ttcgcgctgg accgcgtcaa gagcatggcc ccgcgccatc ccgactgggc    113040
     gcgccgccag ccgttcaagg ccgcgctcca ggacgaccac gcggcgctgg ccaagggcgg    113100
     cgacgcggcg ttgatgaaaa tcgtcggcgc cacgcacacc gacatgagca ccgacacttt    113160
     tacccgcagc gtcaggtact gggcctcgac cgcccgccat ccgcgcttcg accggctcta    113220
     tacggaactg actttcgcgc ccatgcgcga actgctggac tatctgcgcg cccacggctt    113280
     caagacctat atcgtctcgg gcggcgaaac cgagttcatg cggccctgga cgcagcaggc    113340
     ctatggcatt ccgccggagc aggtcatcgg ctccagcttc gtcacgacct acggcgtgcg    113400
     cgatggcgag cccacgctgt ggcgccacgg caagctggaa ttcaacgacg acggaccggg    113460
     caagccggtg gccatccagc gctacatcgg ccggcgcccg atcctggcgt tcggtaattc    113520
     ggacggcgac ctgcagatgc tgcaatggac cgcggcgggc gatggcaagc gtttcgccgg    113580
     cctggtgcat cacaccgacg cgcagcgcga atgggcctat gaccgcgatt cccggatcgg    113640
     caggctcgat cgcgcgctgg acgaagcgcg gcggcaggac tggaccgtgg tggacatgaa    113700
     gaccgagtgg aagcgcgtat acgcattcga acaaccctga agtttgttga cttggcggca    113760
     caaggccctg tcgggcgagg agagcagtca tgaatgcaag acgatggttg acggcggcgc    113820
     tggtggccgc cggggggctg gcggtggcgg ccggcgcgca tgcacaggcc cagggcgatg    113880
     cggccaagcc gcaagcctcc ggcaagccgc ccaatatcct ggtgatcttc ggcgacgata    113940
     tcggacaggc caacatcagc gcgtatacgc gcggcgtggt cggctacacc acgcccaata    114000
     tcgaccgaat cgccaaggag ggcatcatct tcacggacta ctacgccgag aacagttgca    114060
     cggcgggccg gtcctcgttc atcaccggcc agtcgccgcg gcgcaccggc ctgtccaagg    114120
     tcggcgtgcc cggcgtcgat gtcggcctgc aggaccgcga cgtcaccatc gcgcaggcgc    114180
     tcaaggcgca cggctacgtg accgcgcagt tcggcaagaa ccacctgggc gaccgcgacg    114240
     aatacctgcc gaccaagcac ggcttcgacg agttcttcgg caacctctat cacctcaatg    114300
     ccgaggaaga acccgagcgg ccatactggc ccaaggatcc caaggatccg gtggtcaagg    114360
     cgtacaagcc gcgaggcgtc atcaaggcca gcgccgacgg caagatcgag gacaccggcg    114420
     cgctgacctc caagcgcatg gagaccatcg acgacgaaac cgtgggcgcc gcgctggact    114480
     acatcgacaa gcacggcaag ggcgacaagc cgttcttcgt gtggatgaac accacgcgca    114540
     tgcatatcta tacgcatatc cggcccgagc accagggcaa gagcggcatg cccggcaacg    114600
     actacgccga cggcatgtgg gagcacgacc aggatgtcgg caagctgctc aagaagctgg    114660
     acgacctggg catcgccgac aacaccatcg tggtctacac gaccgacaac gggcccaacc    114720
     agttcagctg gccggacgcc gccaccacgc cgtttcgcaa cgagaaggac tcgaactggg    114780
     aaggcgcgtt ccgggtgccc gccatggtgc gctggcccgg ccacatcccg gcgggcgtga    114840
     ccaggaacgg catggtgtcc gggctggact ggttcccgac gctgctggcc gcggcgggcg    114900
     agggcgacat caaggaaaag ctgctcaagg gctgggccgc gggcaacggc ggcaagaact    114960
     acaaagtgca cctggacggc tacaaccagc tcgagtacct gaccggcaag agcgacaaga    115020
     gtgcgcgcaa cgacttctat tacttcaacg acgacggcct gctggtcgcc atgcggatgg    115080
     agaactggaa aatcgtgttc tgcgaacagc gcgcgcccgg cggcttcgac gtgtggaagg    115140
     atcccttcgt gtgcctgcgg gtgcccaagg tgttcaatct gaggatggac ccctacgagc    115200
     gcgccgatat cgtgtccgac cagtactacg actggctgtc caagaacgcc tacctggctt    115260
     tcatcggctc ggccaaggcc tcggagttcc tggagacctt cgtcgagtgg ccgcccagcc    115320
     agcgtcctgc cagcttcagc gtggaccagg tgcaggaaga ggtggatcgc aagatcatgc    115380
     agtacttcga agagcagaag aagaagcagg gcaagtaggc gcgggcgggc gcgggcaggc    115440
     cccgcgcccg cttgcgtcgc gcacgccatg ggcatgtctt ttacggatca ctcgacatga    115500
     gcagtacacc cttgcgggcc gggcgcgcgg cggcgccgcc gcgcgccgaa gcgcggccgc    115560
     tggccggact gtgggcgccg gccctcttgc tggcgctgtc cggcaccgcg gcgctgatat    115620
     tccagatcct gtggatcaag cagttgtcgc tgatcgtcgg cgtggaagtg cacgccatcg    115680
     cgctggcgct cagcgccttc ttcctgggcc tggcggccgg cggctggtgg ctggggcgcc    115740
     gggccgaccg cagcctgcgc ccgctgcgcc tgtacgcggc catcgaggcc ggcgtggcgg    115800
     tcctggcgct ggcggtcacg ctggcgctgg cgcgcgccgc gccgctcttc gtgcagggcg    115860
     agcagtacag cccctggctg gcctggctgg cggtgctgct gctggtgggc gcggcgccgt    115920
     ttctcatggg cggcaccttg ccggtgctgc tgcgcgcggc cggcgcgggc cgggtggggc    115980
     gcgccggggc cacgctgtac gcggccaata ccggcggggc catcgccggc gcgctcttgc    116040
     cggccttcct gctgattccc gcgctgggcg tgcagggcag cgcctgggcg gccgcgggcc    116100
     tgaacctgct ggccgcgctg ggcgcctgct ggctggacca tcggcgcggc gcggtcgccg    116160
     gactcgccga gcagcccgcg gcgacgcccg cggctggcga atggtcgccg ggagcccgcc    116220
     tggccatcgg cctgtacagc gtcgccggcg ccatcgccat gggctacgaa gtgctgtggt    116280
     cgcagatgat cgtgcccttc atgagcacgc gcgcgttcgc gttttccatc gtgctggcgg    116340
     tgtacctggc ggggctggcc ggcggcgcgg cctggtatgc ccgctgggag agccggctgg    116400
     gcgatccgtg gcgggtgttc ggcctgctga tcgccggcgc cgggctggcc gcgctggtcg    116460
     aggcggcctt gctgggccgc tggctggtgg ccgcgcaaag cgtggccgag gccgccgtgg    116520
     tggactggac cgccagcggc ctggccggca tgagcgcgcg cttcgccgtg gccgcggcgg    116580
     cggtggtgct ggcgccgacg ctattgctgg gcgcggcgtt tccggccgtg ctgcgcattg    116640
     ccgtgccgcc cgggcggcgc ggccagggcg ccggcgcggt gctggccggc aatacgctgg    116700
     gcggtatcgc cggcaccgcg ctgacggcct tcgtgctgct gccgtacctg ggcacggtgc    116760
     gggccctggc gctgctggcg ctggcggcat gctgcgtggg cgcgctggcg gcgtggcgcg    116820
     cgccggcccc ggccgcgatg gcgcgggcgt tggtggcggc gctgaccggc gcggcgctga    116880
     tcctggcctg ggccttgccc gcctcgcatc tggcgcggct gctgccgggc gcccagggcg    116940
     gcaggctgct gttctacgaa gagaatcatg gcggcaccgt ggcggtggtg gaaagcgggc    117000
     agggcgagca gcgcttccat cgtctctaca tccagggcgt ctccaactcg ggcgacgcca    117060
     tgccttcgct gcgctacatg cggctgcagg ccttgctgcc gctcatcgtg catgccggcg    117120
     aaccgcgctc ggcgctggtg attggctatg gcaccggcat cacggccggc gcgctgtcgc    117180
     gctatccggg gctgcgccag cgcgtggtgg ccgaactgct gcccggcgtg ctgcacgccg    117240
     cgccgctgtt ccagggcgcc tacggcgcgg ccggcgaccc cggcctgcaa gtgcggctgc    117300
     gcgacgggcg gcgcgagctg ctggccagcc ccgaacgcta cgacctcatc accctggagc    117360
     cgccgccgcc gtcggccgcc ggcgtggtca acctgtattc gcgcgacttc tacgcgctgg    117420
     ccgcccggcg gctgaacatg tacggcatcg tcgcgcaatg gctgccgctg cccacgcaga    117480
     acctggacga tacgcgcgcg ctggtggcca gcttcatcga ggtgttcccg cacgccacgc    117540
     tgtggaccac ggagttccac gaaatgctgc tggtcggctc gctggcgccc ctgccgctgg    117600
     acgccgcccg catcgccgcg cgctacgccc agcccggcgt gcgcgaagcg ctgtcggaag    117660
     tgggggtgga ttcgccggcg gcgctgctgg cgacctgggt caccgaccgc gcggggctgg    117720
     cgcgctttgc cggccagacg cccgcggtga ccgacgaccg gcccgccatc gagtatgccg    117780
     gctgggtgcg gccgcgcgaa gtgacgcgca cgctgccggc gctgatggcg ctgcgcggcg    117840
     cgccgcccct gcagggcgac ggcgtcatcg ccgccgccga gatcgcccgc gcgcgtgccg    117900
     agctggacgt gctgtaccgc agcgccctgg ccgcctacca gggcgaccgg caggcatggg    117960
     ccagccatgc gccggcgctg gcgcgcgcca gccgcgacaa tccgtatctg cgctggttcg    118020
     tgggcggggc cggggagcgc taggcatgcg gccggcggcc aggcggctgg gctcgtggct    118080
     gatggcgctt gcggcctgcg ccgcggcatc cgccgcctgg ggccagcaag gcttgcggct    118140
     gagcaaggac gacctgcaaa agcgcgccaa tggcgtgctg gcgctgatgt cgttttccat    118200
     tgttcccgac atcaccacca gcgccttgaa catcgccggc ggcgggggct cgaccagcgg    118260
     gtcgaccgag ttctacatga cgcagctggg cggcggcgac actatctcga aatcggtgcc    118320
     cctctacctg gaaggcgtgc tggcggccag ccgctacgat cccaccttca tcgccaccca    118380
     aggcgtcgaa tcgcgccgca tccccgccaa gtggaacagc gtctcggcca ccggcggcat    118440
     aggctgggat ttcccgctga ccgacgagct gaagctgcgg cccatcttca acgtggcgct    118500
     gggcaacgtg accagcgacc tgcgcgcggc cagctggtac gtggggcggc agaccgggca    118560
     ggacatcgac ttcctggacc gcggctcgct caacgcctac gggctgggcg ggtcgctgat    118620
     gctggactat gagcattacc ggccgggcta cgaggtggac gtggaattgc gctactcgga    118680
     tatccggctg cgcagtttcg acagctcggc ggcggtgcgc ggccaggcca cggcgcaatc    118740
     ggccaatctg tgggcgcgct atcgggcgcc caccggcgcg acgctgctgc agcggccgct    118800
     gcgctacgtg ctggagctga cgcattcgga attcctgggc gatcagcgcg gcatcctggg    118860
     tttcgatcgc ctgacctcgg tgggcgcggg cctggagctc gattccagcg cctacgacgt    118920
     attcatcacc cgcacgcggc tggtcggccg ctatgtgttc ggcaacaacg tatcggggtt    118980
     ttcggtcggc ctggcggtca gcttctgagc ggggccgcgc ggcacatgca gttcgaaatg    119040
     gctgccgcgc gccacctcgc gccagagaag gcgcgcctcg atggcgcgcg cgcgcgcctg    119100
     catgccggtc aggccgcgcc cgggcctgga tgcggccggc gcctggcgcg gaccgcaaaa    119160
     ccccgcgccg tcgtcgatga tggcgatgac cgcgtgcgca ggctcgagcc gggtgctcac    119220
     ggtcaggcgg cgcgcgcgcg catgcttgag gatattggtg aacacctcct gcaggatgcg    119280
     cagcacgtgc agggcggccg gcggcgtcag ccaggagacc ggcggcagcg ggccgacccg    119340
     ccagtcgatc gccagcccgg cggcctgcag gcgcggtccg agccgagagc gcagcgtggc    119400
     cagcagcagg gccaggtcgg tctgggcggg ttcgagcgaa tcgatggtca gcctgagatc    119460
     atccaggcat tcctgcaaca cctgagcgac cgcgccctcc gaactgttgc cgtgctggac    119520
     catgcgcagc gccgacacca gcgaggaacc caggccgtcg tgcatgtcct gcatcaggcg    119580
     ttcgcgctcg ctggccagga tgcggatgcg ctcgacgtcg cgcaggcggc ggtggctgtg    119640
     ctccagctcc cgttcgcgct cggccaggcg gcgctgcagc gtggcctgcg cgccggcggc    119700
     ctcggccagc gcgttgaggt agcggcggta ggccacatac aggaagatga cgaacatgcc    119760
     gatgccggta tagggcagca ggtagacgtg ttccatgctg agcctgtagt tctgcaggag    119820
     catgtcgtgc accgccaccg ggatggccgc caggttccag caggccagcg ccaggccgtc    119880
     gcgcgaaccg gcccgccacg cgccccagac cgccagcagg caggcgaaca ggctgaccgc    119940
     cgtaatgccc aggtaggcca gcggcgccag cagcaccaga tgcggatgga tctgccacac    120000
     cggcagcatg gcggccgtca gcgcgcccat gccggccagc atggcgcgct cgctgcgcgg    120060
     ataggcgcgg ccgtgcaggc ggaacgcgaa gaaataggac gcaatcgcca gccagccgac    120120
     cgaggtgatg gtcagccagc tgaaccattc gtcgtcgagc agcaactgga acggcccggc    120180
     gtggtaatgc aggcaacgca ggtagaacac cacggaagcc gcgaagaaca ggccgtagat    120240
     ggactccttg cggcgcaccg cccacacgcc cagcgcgaac agcccgatcg ccaggaacac    120300
     cgcgctggcc aggtacggca ggtcctgctg cagccagcgg cgcagctcgt agcgccaacg    120360
     cagttcgccg gcggcgccga cccaggcggt cgacagcccc gcgcccgcgc cgtccaggct    120420
     gctgatgcgc agcagcagcg tcgcgggcgg cgggccgccg gcagccaggg gcagccacac    120480
     cggccggttg aagccgctcc attgcgcgct gccgcccgag cgatacagca acttgccgtc    120540
     gccgtagacg gccaggcggc cgacggtctg ccagcgcggc agatacagca cggggtcgtc    120600
     gacaccgctg gcgtcgaggt ccagccggta ccaggccagc gccgcgtcgc cggcctgcgg    120660
     atcgggcacc acgcggcgct gcaggccggc atggggcagc gccacgcttt gccagtcgcc    120720
     gggcgggccc aacgccggca cgcgatccgg cgcagcggcc gctgcctcgt cctgcagcag    120780
     gaactgcgcg gccgtgaaat gccgcggctc ggccagcacg gccgcgggca gcgccaggca    120840
     cagccaggcc agcagcgccc aggcccgccg cgccaggcgc cggcgctcag ccatccgggc    120900
     gcaggccgcg cgcggcattg atggcgtcga ccttggaatg gacctgcagt ttgcggtaga    120960
     tgcgccgcac gaaggtctgc accgtgtggc gcgaaacctc gaggtcgcgg gcgatttcgt    121020
     cgtaggtgta gcccagcgtg atccgttcga gcacctgatg ctcgcgtggc gacagcgcca    121080
     tcgcggcggg cggcgcggcg gcaggcaggc cctggcgcag ccggtcgagc aactggcgcg    121140
     cgatcagcgg gttgatcggg ctgccgccgt cgcgcagggc gcggatgtcg cgcacgatgc    121200
     cggccggttc gctgtccttg agcaggtagc cgcaggcgcc ggcctcgatg gagcgcatca    121260
     cgtgcgcctc gtcgccgaac atggtgttga ccatgatgtc gcaatcgtcc cagagccgcc    121320
     gcgcctgccg gatgacgtcg atgcccgatc cgtcgggcag ccccaggtcg accagcagca    121380
     cgtcggccgg cgggccttgc agcatggccc gcgcctgggc gcaggtctgc gcctgggcca    121440
     gcacggacat gccgggctcg tgcgcgatcg ccgcgaccac ggcgtggcga aacgccgggt    121500
     cgtcctccac gatggcgata cgcagcgatc cggccggccg cgtcggcgta caggtttgca    121560
     tggcgtgcgt ctccgtgcgg ccccggctgt cccccgttcg ggggacagac acagagcgaa    121620
     agtaatcgta acttttgctg cactgtagcg cggccccagg gtcgcgacaa cccggactcg    121680
     atgctcgttc atgaaaccga tttttcgaat cgaacaccca tttggatcgt tgcccgcgcg    121740
     ggccgcgcgc ggcggactgc tgctggccgg cgcgctggcc tgttgcgctg ccgcgcatgc    121800
     cgagctgctg ggcgtggacg gcggcgggcc gtccggcggc gcgggcgcca gcggcccggg    121860
     gctggcggga cagccgggca gcggacccgc gccgggcctg ggcggcgaca ggacgacgcc    121920
     cgtacccggc ggtaacggcg gcgccggcgg cggtgccggc gccgcgggcg gcagcggcga    121980
     atcgactcac tatggcgggg gcggcggcgg cagcgacagt ggcggaggcg gcggcgcatt    122040
     ggtctacgag atggcggggg gggcggcggg cggcaacggc ggcggcgtgg cccaggcgct    122100
     cagcgtcggc gcggatctgc agtccagtcg cggcggcgcg ggcgacgacg gcggcgctcc    122160
     gagctacggc acggagcccg gcggtggcgg tggcggcggc ggaagcggcg cggccgtgct    122220
     tgccggcggc ggttatcgtg cgctgggcgc ggccatcgtg ggcgggcgtg gcggggccgg    122280
     cggcgcgggg ttcgagtcgg gcggcggcgg gggcggcggg catggcatac gcgtcgatgc    122340
     ggcggatgta cggatcgact tgttcgccac gcaggtcgcg ggcggccagg gcggagacgg    122400
     cggcgccggt tccgggggca gcggcggcgg cggcgacggc gggcacggcc tggcgggcgc    122460
     ggcgaacgat ctgcgcctgc gcgtaggcgc ggacagcagc ctgcgcggcg gcgatggcgg    122520
     cgccacgtgg ccggttaccc acagggcggg cgcgggcggc gccggcgggg ccggcctgtt    122580
     cgtgtcggcg tcgcggtggc aggtggaaac cgcaggcctg atccagggcg gtaacggggc    122640
     ccggggcgag gccagccggg aactcgacgg cggcgatggc ggcgcgggcg gcgcgggcat    122700
     cgcgctggcc ggcgatacgg gccggctggt caaccgcggc gagatccggg gtggctcggg    122760
     cgcgacgggc ggtacgagcg agcgggccgc gcccggcgcg gcaggcgcgg gcggcgccgg    122820
     cgtgcggatc gccggcaacg gcaatcgcct ggtcaacgcc ggccgcatcg ccggcggcct    122880
     gtccgcggac ggccagcagg ccgacgcggt gcgtatcgat ggcgcgggca acaccttcga    122940
     gctgcgcgcg gggtccgtcc tgcaaggcaa tgccgtcgcc acgggcggcg ccaacgtgct    123000
     ggccctgggg ggcgcgcagc cgggcgtctt cgacgtgtcg gcgctggtgg ccggcgcgcc    123060
     ggccgcgtgg agcggcgtgg cccggtatgg cggcttcacg gcgtacgaga agaccggcac    123120
     gggctcctgg cgcctgaccg gcggcaacgc ggcggccctg tcctggaccg tacgcgccgg    123180
     acgcctggcc gtggatgccg agatggcggg ctcggccatg acggtggccg ccggcggcac    123240
     gctgggcggc accggcacgg tgggcgacac caccgtccgg gccggcggcg cgctggcgcc    123300
     gggcaattcc atcggcacat tgcgcgtggc gggcgacctg gtgttcgagc cgggttcgcg    123360
     cttcgaggtc gaagccgacc cggccggcac ggccagcgat cgcgtgacgg tcagcggcac    123420
     ggccgacatc cgcggcggca cggtcctgca tgtcgggccg gaaggcgggt tcgaggcgcg    123480
     ccagcgctac gtgatcctca ccgcgggccg gcggctcggc cagttcgatg ccgtcggttc    123540
     gggctacgcc tatctcgcgc cggcgctgtc gtatgacgcg accagcgtgg cgctgaccct    123600
     gcagcgccgc ggcgcggcag gcagcggcga actggctttc gccgacctgg ccgatacggc    123660
     caaccagcgc gccaccgccc gcgccgccga gacgctgccg gctgcccacc cggtctaccg    123720
     cgccatagag acgctgcccg aaggcgcgcc gccggcggcc ttcgatgcct tgtcgggcga    123780
     ggtgcacgcc agcacgcgca gcgcgctgct gacgggcgcg cgccaggcgc agcaggtcaa    123840
     cctggggcgt ttgcgcgacc acctgggcct ggcctggcag gctggcgcgc cgatggcggc    123900
     cagcggcagc gcgcccggcg cggcggcgct gccgggcgcg ctgtcgccgg cctgggccga    123960
     ggtggtcggc gcctggcaac gcctggacgg cgacggcaac gcggcgcagg tgcgccagca    124020
     tgtcggcggg ctgttcgtcg gcgccgacac cgcgctggcc aacggctggc gcgtgggcgg    124080
     ttcgctgggc tttaccgatg gccggatcga ggtcgacgca cgcgcctcgc aaaccgacgt    124140
     cgccagctac accgccgcgc tctatggcgg ccgcgcctgg gatacgggcg ccggacgcct    124200
     gaacctgctg gctggcgccg cctatacctg gcacgacatc gccagcgagc gccgcgtcga    124260
     cgtgggcgac ctgcggcagg aactgacggc ggactacggc gccagcacca cgcagctgtt    124320
     caccgaactg agctacgcca tgccgctggg catgacagcc gaactggagc cattcgcggg    124380
     gctggcctgg aaccagttgc gcgtgcgcgg cttcaccgag acgggcggca gcgccgcgtt    124440
     gagcggcgca agcagccgcg acgacatggc caccacgact ctcggggcgc gcgtggcggt    124500
     gccgctcggc gccggtgcca cgctgcgggc gatggccggc tggcggcatg ccttcggcga    124560
     tcgcacgccg caaagcacgc tggccttcgg ccagggcagc gccttcgagg tggccggcgc    124620
     gccgatcgcg cgcgatgcgg ccttgctggg cgtgggcgcc gggatcgagg tggcgcacaa    124680
     tgccttcctg gacgtggcgt acgcggggga attcggcggc ggcaaccgcc agcacaccgc    124740
     caacgcggtg ctgcgctggc ggttctgaat cgcggcttgc cttacgcggt ccgcagcgct    124800
     cgcacggcaa tgtccggggc gcttgccacg attttcagaa gcgccacggc agggcccgtc    124860
     ggattgcggt gaccttgctc ccagttctgc agcgtacgga cactgacgtg gatggctttg    124920
     gcgaattccg tttgagacat gtgcgttttt tcgcgcgttg ccttcacatc cacagtctca    124980
     accttgaata cacgcgatgg cggcatcttg ccttggcgaa tggccacggc ttgcttcagg    125040
     ctggcttgca ggtcgttgaa caccgtgttg tcttttttca tcgttacagc tccttgacca    125100
     gttcgcgcag cgccgcgatt tcgtccgggg tcaggttgat cttcttcgac tttgcataag    125160
     ccgcaagcat gtagatctga caatcctggc tgatccagta ataaatgacc cggatgccac    125220
     ctcgcttgcc cgtgccttgc cggccgtaac gcatctttcg tataccgccg cccccacgca    125280
     gcagatcgcc cctttcgggg ttgtcgatca gcagctgttg cagcctggaa tattcctcat    125340
     ccgacagcaa cgcggtgatc aattgcgtga aaattggggt ttcgatgaac tccattcatg    125400
     gaaggatata cgtcattgac gtatatttca acctccagca caccgccagc gcggtgctgc    125460
     gctggcggtt ccgaacggga cccagtgctg cctgcggcga cgcgccgctc agccgttcat    125520
     ctcggccagc gcgcgctgca cggccggccg cgcgccgacg cgcgccaggt agtcggccag    125580
     cttgggaaag cgcgtcatgt cgacgctgtc gccttccatc cagctgccga cggtgtacag    125640
     atagccgtcg accacgctga agcgctcgcc cagcgcccag ggaccgacga tctgcgattc    125700
     caggtagccg gcgatggccg tcatgttctc ggggatcttg gcgcgcatgg cctcgtgcgc    125760
     ggccgggtcg tcggcccagc gcgcgccgcg ccgtttgtgc gcgtgcgcga cgtgcgcggt    125820
     ggaggccagg tagttggcca gttcctgcat gcgcgcgaac gcgaacggat cgcccagcgg    125880
     cgccagctgc gcctgcggaa agctctgcgc gatgaaagcg agcagggcgg gattctcggt    125940
     cagcacgcca tgttcggtgg ccagcgccgg cacgcggccc ttggggttga cgcgcaggta    126000
     gtcggggctt tgctgctgcg tggcgccgaa atccagcttg accagatcga aatcggcgcc    126060
     ggcttcgtgc agcgcgatgt gcgtcgccag cgcacaggtg ccaggggcgg tatagaaggt    126120
     ccagcgggac atcgtcatcc tcgtcgtgtg tcgtttgcca gcggtatcgc cgcgttgccg    126180
     cggcggactg cgtacagagt agccggcgtg gaccgccaag caaagccccg cccatgcccg    126240
     gcgccgccgc tcaggcgccg ggaaaccgca tgggcatggc ctcgaagacc gagcgaaagc    126300
     gcacgatctg cggatgggtc tcggcgcttt tgcgcaggat caggcagacc tgcatcggcg    126360
     ccacccccag cgcgatgtcc agtaccttca cgcggccgct gcgcgcgtgc gccatggcgg    126420
     tgtggcgggg cgccgcggtc agcaggcggg tggcggcgac gatgtccagc gcctgggtgt    126480
     aggtgggggt ttccaccacg gggtggggca gcagcagccc ttggcgcagg aaggcctcgg    126540
     tcagcgcctg gcgcacgctc gagctgatcc gctgcagcac ccagtcgcac tgcgccagcc    126600
     gggcgtagcc cggtttcttc aggcgcgccg ccggatggtc gggcccgcac accacgcaca    126660
     cgtcatcctc gtacaggttg acgaaggtca gcgaggcgat gtcgcggccc agcttggcca    126720
     cgtccggcgg caggcgcccc agcacgcagt ccagttcgcc ggccagcagc cgcgccagca    126780
     agtcttgcgc gctgccttcc accgtatgca gatgacagcc gccggtctgg cgaaagccct    126840
     cgatggcgcg cggcagcagg acggtgaacg cctgcggcac cacgccgacc cgcagcacct    126900
     cgtgctcgcc ggtgtccagc cggtccagca tggcgcccag ttcgtcgaag tcgttcatga    126960
     ggatgcgcag ccgcggcgcc agcgccagcg tttgcgccgt gggcgccacg ccctggcggc    127020
     tgcgcgtgaa cagctgcacg ccgagcaggt tctcgatgtc gctgagcatg gcggtggcgg    127080
     ccggctggct gatgctcagc cgccgcgccg ccttgcgcag cgtgccttcc tgcagcaggt    127140
     actggatgag ggcgatgtgg cggaacttca ggtgcgagag cgccgcgcgc gaacgttgga    127200
     ccatggcgga ggagggtgaa aggtattggt tatcacataa gaggattttt tgaatattaa    127260
     ctttgcagcc caatccctac actcaggtct ttcgctatgc agacgaaaag gggaagcgca    127320
     tgaaaacagt cttacgtatc ctgctgcttg gcgccggcct gctgggcgcc gcggcggcca    127380
     gcgccgagtg gccggcggac cagcccatca agatcatcgt gccgcaggcg gccggcggca    127440
     ccaacgatac ggttgcgcgc ctgatgggcg tggagctggg caaggccctg ggccagaccg    127500
     tggtagtgga gaaccggccc ggcgcctccg gcgccatcgg catgcagctg gcgtcgcgct    127560
     cgcccgccga cggctacacc ctggccattg cgtccgacac ggcttccatc ctcagcgcca    127620
     cccgcaagat ggactggcgg ctcgaccatg acatggctgg cgtggcgatg gtgggcgacc    127680
     agcccatcgg cgtggccgtc tcgatgcgcg cgccgtacgc cagcctggac gagctgctgg    127740
     ccgcggcccg caaggaaccg ggaaccattg ctttcggcac ctccggcctg ggcacgtcgc    127800
     agcatatcgt cggcgagtgg ctgacccacc tggccggcgt gcagatgatc cacgtgccct    127860
     acaagggcgg gggccaggcg gtcaccgacc tggtgtcggg caccaccccg gcggcggtgc    127920
     tgggcttcgc gcccctgctg gggcaggcgc gcagcggcgg gatacgcatc gttgccgtca    127980
     ccactgccga acgcaacccc gccatgccgg aggtgccgac gctgaccgaa ctgggctacc    128040
     cgcagatcac gcgctcgcaa tgggtgggcg tggtggcgcc gcgcgacacg ccgccggcga    128100
     tcgtcaagcg cctgtccgac gccatggccg ccatcggcgc gcagccggcg atacaggaca    128160
     agctgcgcga gatcggcctg acgcccaagt cgatggatgc cgcgcagttc gacgccttca    128220
     tccacaagga cgtggccgac tggggccgcc tggtcacgga actgaacatc aagctggact    128280
     gattcggagg tatttcatgt cgcaagtgac gcaacatccc aacgtggtac tgatcctggc    128340
     cgacaacctt ggctggggcg agctggggtg ctatggcggc ggcgccatcc gcggggcgcc    128400
     cacgccgcgt atcgatgcgc tggccgcgca gggcacgcag tttctcaact tcaacgtgga    128460
     aagcgattgc gtgcccacgc gttcggcgct catgaccggg cgccacccgg tgcgcaccgg    128520
     cgccatgcag tcggtgccgg ccggcctgcc gcagggcctt gttccctggg agcgcacctt    128580
     ggcgcaggcc ttctccgagc aaggctacgc caccgccatg tacggcaaat ggcacctggg    128640
     cgacaaggag ggccgttacc ccaaggaccg cggcttcgac gagtggtacg ggatcccgcg    128700
     caccaccaac gaaagcatgt tcatggaggc ggtgggcttc gaccccgacg tggtggaagt    128760
     gccgtacgtc atggagggcc gcaagggcag tccggccgaa aggcgcgaac gctacgacct    128820
     ggaaatgcgc cgccgcatcg acgaggtgct cacgcagcgc agctgcgagt tcatcggccg    128880
     ccacgcgggc aaggccccgt tcttcctcta cgtgccgctg acgcagctgc atttccccac    128940
     cattccgcac cgcgaattcg aaggccgcac cggcaagggc gattttgccg actccctggt    129000
     ggagatggac gcgcgcatcg ggcagatcct ggatgcggtc gaccagcacg gcatcgccga    129060
     cgataccgtc ttcatcttcg ccagcgacaa cggaccggag taccgccggc cctggcgcgg    129120
     cagcgccggc atgtggaccg gcacctatca cacggcgatg gaaggggcgc tgcgggtccc    129180
     gctcatcgtg cgctggcctg gcaaggtgcc ggccggccgg cagaccaacg agatcgtgca    129240
     cgtggtggac ctgttcccca cgctggccgg catcgccggc ctgcaggtgc cgcaagaccg    129300
     gcccatcgac ggcgtcgacc agtccgcctt cctgctgggc cgcgaggaga aatcggcgcg    129360
     cgagggcttt gtctactaca tcaagaacga gctgcgcgcg gccaaatggc gcgactggaa    129420
     aatgcacttc gtctgggagg tggagcccaa tgccgggccc aaccacctgg agacgcctta    129480
     tgtgttcaac ctgatgcagg accccaagga agaaaccgac gtcaacacca tgcaaggctg    129540
     ggtgcgcgga cccatacgcc gcatggtcaa tgcgttccag gcctcgctca agtcctatcc    129600
     gccgattccg cccggcgcgc cggacgatta tgcgccgtcc tacgacatga cgccgccggc    129660
     cgccacggac ggcggccagg aggcgccgtg agcgacgccc aggccgaatg ggccgcgcat    129720
     atctgcccgg acgccggcgc tgcattggcg gcgctgccgc cggcgtgccg catcgtctac    129780
     ctggccgacg gccaggcgcc ggccctgggc cgcgccgtgc gggcgcttgc cgccgatctc    129840
     gtcgtgggcc tgagcctgga ctatccgccc gggctggacc cgcgcgagcg cggcgcggcg    129900
     gcgccggaca ccgagctgga agacgccttg ctggcgcggc tggccggctt cgcggccatc    129960
     gcgcggcgct gggaccgccc gctgcgcacg gtaggctgcc acggcgccct ggcgctggac    130020
     gtggccgacg acgaacgcac cacgcaggtc gtggcgcgca tgctgcaacg ctacgatccg    130080
     gcgctgtcga tggcggtgcc ggccgggcgg cgcggcatcg cggtggcgca tcattgcggc    130140
     atcgccgtgg tgcgggaagc ctgggcgcgc gcgccttcgt ccggcgccgc cgatatgtcc    130200
     agtgtgcgtg tcgaccggta ccggctatgc ctggacgccg gcggcgcagg gcagggcgcg    130260
     ggcacggccc cctaggggcc gcgcgccggc ctattgcaat gcctgcgcca cgtactcgtg    130320
     ggacctggcc ctttcgtgcg gatcgtagat cctgctgtct atcatcagct cgtcggcgcc    130380
     ggtccgttcc accacgctgt gtatccaagc cctgaccttt gccttgtcgc cggcgacggt    130440
     catggcgagc acctcgtcga gcacccggcg ctcgttgtca ggcaggcctt cgacatagcc    130500
     gtgcacggga cggggcagca gcccgaggcg ccccatgtgc aggtcgagca tccactggcg    130560
     gtgggaactg gccagaaatt ccgcctgctc gttcgagtcc gccgcgaaga tgttggcgcc    130620
     gaccatcacg tacggggatg cgagccacct ggagggacgg aagttcctgc gatagtggtc    130680
     gacggcctgg tccaggaacc gcggcgcgaa atgcgaggcg aatgcgtagg gcaggcccag    130740
     cgccgcggcc agctgggcgc cgtacatgct cgaacccagg atccacaccg gtacgtcatg    130800
     ccgtccgggc acgccgcggg caggctggcg gccattgttg gcgagatagt ccatgacttc    130860
     cgtgacatcg gcggcgaagt cgctctcggc cgcgccgcgg cgcagcgcgc gcaccgcggc    130920
     gccggcgctg cccggggccc gccccatgcc caggtcgatc cggccgggat agagggcgtt    130980
     cagggtgccg aactgttcgg ctatcgccag gggcgcatgg ttgggcaaca tgatgccgcc    131040
     cgctcccacc cgtatgcgcg aggtggcggc ggcgatctgg tcgatgatga gggaagtcgc    131100
     ggccgagccg atgccgggca tgtcatggtg ttcggcgatc cagtagcgcg tgtagccatg    131160
     ccggtctaca tggcgggcaa gttgccggga ttcttcgatg gcggtggcga ggtccttgtc    131220
     ttcgccgatc attaccagat cgagaacgga aagcgcggtc attgtggtgt cctgttgatg    131280
     caaaacgggt tacgggaagg gggaggcgcc gcgctcaggc tgccggctgg gcggcggcgt    131340
     agcggggata gtcggtgtaa ccgcggtcgt cgccgccata gaaggcatgc ttgccggctt    131400
     cggctagcgg ccatccgtgg cgcatgcgct cgaccaggtc ggggtttgcg atgaacgggc    131460
     ggccgaagac caccaggtcc gcctcgccgg catcgagcgc ggcctgagcc gtctgggcgg    131520
     taaagccgcc ggccagcatg aaggtgccgc cgaatgcctt gcgcatatcc cgttggaagc    131580
     ctgcctggcc aagatggctg gcgtgcaggt aggcaatccg ccgctggcaa agcgccccgg    131640
     ccaggcccag ccagcttgcc ttttcagagt cgaactcatg caggtcgccc gcgtgcgcga    131700
     acggtgagat gcgtacgccg acgcgttgcc tgccgatgac ggcactgacg gcatccaccg    131760
     tctccagcag cagccggagc cgattggcga tcgacgggcc gccgtactgg tcctcgcgcg    131820
     tattcaggcc cgcgttgatg aactgctcga acagaaagcc gttgccggca tggatttcca    131880
     caccgtcgaa accggcgcgc gcggcgtttt cggcagcggc gcggaagtcg gcgacgatac    131940
     ggcggatgcc ggcgatatcc agcgccgccg gcgggctggc tggaacctgc gcgggccggc    132000
     cgtcgtggcc gtatgcctgc accagggtgt gggcggcggc cacgctcacg ggcccgaccg    132060
     ggctccctcc atcgggcagc aggctggtgt gcgacagcct gccgacatgc cacaactgga    132120
     tgaagatccg cccgccggcc cggtgcacgg cgtcggtcac gtttcgccat gccgcgacct    132180
     gttccggggt atggatgccg ggggtgcaca gatagccgcg cccctgcgcc gatacctggg    132240
     cgctttcggt gacgatgagg ccggcgctgg cgcgttgcgc gtaatagagc gccatgcttt    132300
     gcgcgggcac ggtgtccagg gtccgggcgc gcgtcatcgg cgccatgacc acccggttgg    132360
     gcagtatcag ttcgcccagt tcgtaagggg agaatatcga agccatggtc atgcctgcct    132420
     caagaatggg aggggaattc gggcagcacg tactgcgcca gctcgtccag gatttccgca    132480
     tacggctggc ggctgacctt gggattgagc gcgacgtgcg ccacgccggc cgcgcgcgcc    132540
     agttccaggt aggcgcgcaa tccgttgcgt ccggcgcgaa aaccgcccgg aatacgctgg    132600
     aagggttcat ccgggttggc gctcaggtcg agatagccgc caagcccaag cggcttgaaa    132660
     tgcgccgggc cggccagccg cgcgacgtgg tcgcgccatt cctgcgccag ccgcgagagg    132720
     cgctgcggca tgggcgcgcc ggtgagcaag ccatccatat tccttgccag ccatgccagg    132780
     gtctgctgcg cggcgcccac ggcgatggcg ggaacgcggc catgcagcgg cttgggcacg    132840
     aggtccagct ttccatccga gccgccgaag cgcgccgatc ggaagctggg aaaacgctgt    132900
     tcggtaagcg tacgcaggac gccgtaggca tcgcggtagc gctcgccacg ggagtcgtaa    132960
     tcgatgccca gcatggggta gtcgctcagg cggtcgcccg acgacaggcc cagcacgaaa    133020
     cgcccgccgc tcagttgatc gagcgaggcc gcctgtttgg ccaggtacat cggctcgtgg    133080
     gtcggcagaa cgattccggt cgtgcccagc gcgatgcgcc gggtggccgc ggcgaggtag    133140
     ccgatgtaga ccaggggttc gaatatctgg gcgacgtcgc cataggccgg gtcatgaaag    133200
     ggcacgtcgc gcagccacag ggctccgaaa ccgagcgctt cggcgcgctg cgccatctcg    133260
     acgtggcgcg ccatggtggg cgcgggcctg tccgggtggg tttccagcgg cagaatcagg    133320
     ccgatgctca gggccgcggg ccggaacagc cggccgaacc ccgcgtggct tcccaggcct    133380
     gcgcaaggcg gttcgaagga ggggcggtcg aggggggcgg aattcggggt gtccatcggg    133440
     tgaggctcca atcagtacat gccgtgcagt ctgattgatt cctggcggcg gataaactgc    133500
     ctgcgacgcc cctcactcgg gattgaaatt cccgaatgcg tcgcagtctt tgtcagctgg    133560
     cgggctccag gcgctcccac ggcacgccat cgcgccaccg ctcgatcagc agatcgatga    133620
     aggcgcgggt gcgcggggaa aggtggcgct tgctcgggta gatgagccgt atcggatcgg    133680
     cgggaggacg gtaggcttcc aggacctcca ccaggtcccc gcgctgcagg tccttgcccg    133740
     tgatgtaggt gggcaaatgg atcagcccga agccggagag cgcggcctcg cgcagcgcct    133800
     ccgaactgtc tatgttcatg cggccggggc cgtcgcacac ctcgatcgcg tcgccctgcc    133860
     caagccgcca cggcatgggg cgctgtccgc tcagaaagaa gatcgtgtcg tggccggcaa    133920
     ggtccgcggg cgtcgacggc acgcccttct tggccaggta gccgggcgcg gcgcaggtga    133980
     cgaactgttg tccgccgatg gtgcgcgaca gaatgcgggc gtcgtccttg acgccaccga    134040
     ttcgaacggc gacgtcgatg ccttcctcga tcagatccac gtaatgatcg gtgaaccaga    134100
     cgtctgcctg gatctccggc caattcgtca cgtatgcatt gaggatgggc aggatatggc    134160
     gctggccgaa ggacagcggc gcggtcagcc gcaggattcc ggctggcttg ccccgccgtt    134220
     gcgccatggt cgcatcgact tcctccaggt cttcgaggat ctggctccag cgctcgaaga    134280
     cgaccaggcc ctcgccggtc acgttcagct tgcgcgtggt gcgatgcaag agccgcacgc    134340
     ccagccgcgc ctcgagccgg gcgacgctct tgccgaccgc cgagcgggtc acgcccagcg    134400
     tggcggccgc cgacgtgaag ctgccggctt tcaccgccga cacgaaagcc aggatgtcgc    134460
     cgaagcggtt gggttccatg gaagccgtcg atccaaaggg cgcgatggtg cgcgttgcct    134520
     gccgtgggaa gccatttccc cgactgacga aatggtattc caacttgcgg cgcgaagtgc    134580
     gggcgcgcga aggcggccgg tttttccggg cggtgtcatg cgccgcctgg aaagacccgg    134640
     tccctggcat cgcagctagc gccaggccgg cgccacggcc gtttcgcgca tgatggcttc    134700
     gggcgtccgg taccgctccg ccatctcgcg ttcggcgtcg tcgcgcaatt gggcctgcat    134760
     gtagcggccc aggtcgcgtg cgtggccgac gatgaacttg ccgaacggca agcgttcgtc    134820
     ttcgtacgcc tgtagcgcgg cgccgatatc cggcgtgccc gcgagcgcat aggccagcgc    134880
     gcgcgcgtcg ccggcggcct tggtcacgcc catgccgcag tgcgggcgcg ccacgaacgc    134940
     cgcgtcgccc agcagggcca cgcggcccag cgccaggcgc gggctttcca ggtcgaaaat    135000
     cggctggaag aacaggttgg cggttttggc cacgacctcg ccgaactgcg gggccagtac    135060
     ctgcgcggcg gcctggcgcg cctgcgccac gatttccggc cggatcagcg ggggaggaat    135120
     gccgtccatc caggcctgac cctgggcgtc ggtcaccatg tcccggaacg tggtgtgttc    135180
     gtcggccggg cgataccaca cgaagttgaa gcgccgggcg gcgtcttgcg cgccggagcc    135240
     tgtgcctgcc acgggatagg cgatcatctg ctcgtgcgcc ggcaggccga aggcaaagta    135300
     ggggcacagc tcgcggcgcg tgcgttcgct caggctggct tcgtcgacca gcccccgcca    135360
     ggccacgtag cccgcatagg cgggcctggc ctgcggcagc agcgcctggc gcagggtcga    135420
     gcgcaagccg tcggccgcca ccaccaggtc cacctcggcg cgcgcgccgt cggcaaaccg    135480
     cagcaaggcc ctgcgctcgt cctgctccag ggattcgagc gcctggccgc gatggtagcg    135540
     ttcggccggg aagcgcgttc tcaggatgct gaacagccgt ccccaggcgg tcagcagttg    135600
     tggcagcgca cggctggcca gtacgctgcc gtccaggtcc agggtgacgc ggcgcgccac    135660
     ctcgatgccg atcgattcgg tcggcgccac gcctatccgg cgcagcacgt ccagcagctc    135720
     gggatgggtc acgataccgg cgccacggcc gtcgagctcg tcgtgcaccc gctcgtggac    135780
     gtggacgtcc cagcccgcgc gcaacaacag gttggcggcg aacaggccgc ccagggagcc    135840
     tcctatgacg gccgctttac gcacgggttg catgctggtc tccgttgtgc ggggttgcgg    135900
     cgtcggcgcc catcgcctgt gccgcgggat agttcaattc gatggtcacg ccggatgggt    135960
     cttcgacgaa cacctggtgc agcccgaggt ccggcaccgt gcgctcgcgg aaatcgaggc    136020
     cggcgttcgc caggcgcgcg cgcatgtcgg ccaggtcggt cgccaggaac gccaggtggt    136080
     cgatcgccgc gctgccatgc aggctggcgg cgtccttgtc gccgagatag tcggccagcc    136140
     cctgcgggtc gtcgcggtcc acgccgatga ggtggaccac gccgtagtcg gcctcgtcgc    136200
     cgccctggta cagccagacg cccggaaact tgaacgccgg gcggtagcct tccttgaacc    136260
     ccaggatttc ggtatagaag cggcgcgagg cgtccaggga cgccgtgcgc acggagtagt    136320
     gggcgagttt gcggacaggc atgtggcgcc tccttgattc aagtaatcga gtgataaata    136380
     atagagatcg atttcccgct gcgcaagcga atggaaagaa aacgacgcca agggttttcc    136440
     ccggcgaaga aaaaattgac aagccgaatg gcctgtacga tagttatcaa atgataaaca    136500
     acggatcgtg cgggatccaa tctgaccagg agacatcaat gtccatgcga accccatggc    136560
     gcgcctcggg cctgctggcg gcagcgctct ggtgcgccgc cagcgcggcc caggcgcaga    136620
     ccatcaagat cgggctgccg gtgccgctca gcggtcctta cggcgcggaa gcgcaagacc    136680
     aggtgcgcaa tgccgagctg gcggtcaagc agttcaacga tgctggcggc ctcgacggcc    136740
     gcaaggccca gcttctggtg cgcgacgacc gcctcaaccc ggccgaggcc gccacccgcg    136800
     cgctggagct gatcgagaag gacggggtca acttcatcgt cggcgggctt tcggcggcga    136860
     cgcagctgtc gatcaacaac gtcaccaggc agcgcaagaa gctgtatatc tccatcagcc    136920
     agtccgacgc gatcaacgag gccgccgacg ccagcccata cactttccat gaggcgctca    136980
     atccgcacat gaccacgcag gcggtgggca agtacgtctt caagcccggc atgagggtgg    137040
     cctttctcac cgccgattat gcgtatggcc acgagatgac gcgcggcttt accgaggtgg    137100
     cccgccagca gggcgccgag gtggtcggcg aggtcaagca tccgctgggc gcctccgact    137160
     attcggcttt cctgccgcgc ctgaaggcgc tcaatccgga cgtgctggtg ttcaacaact    137220
     tcggcgccga caaccgcatt tcgatcaagc aggcggccga tttcggcatg aagcgcaata    137280
     tcaggttcgt caccccgatc ctgacctaca ccgcccgcgt ctcgggcggc gcggcgacct    137340
     accaggatgt cgtgggcgga acccagtact actgggcgat ccaggacagc gtgccgtcgg    137400
     ccaaggcgtt caacgccgcc ttccaggccg agaacaatgg ccgctttccg tccgactatg    137460
     gcgccatggc atattcggcc gtgaaatcgc ttctgctggc ggtccgggac gccggcagca    137520
     cggataccga cgaggtcgcg gcggcgctgc gcaagctgaa gtacgacacc tacaagggag    137580
     cccagtatta ccgcggctgc gaccagcaat cggtgcagtc ggtgctggtc atccagtcgg    137640
     tgggcaagga caacgcccac cccgacgagg tattcaagct gctgcatacc gaagcgccca    137700
     gcgagcagat cctgcgcagc tgccaggcgc tgggcttcaa gtaggcattt cgccccgccg    137760
     ccgtgcttgg gccggcgacg gggcagggga cgagaatgac tgttgatctg gtgttgctcc    137820
     agctgtttac cgggctggcg ctgggagcca tctacgtgct gctggcggtc ggcctgtcgc    137880
     tgatattcgg catgctgacg gtggtgaatt tcgcgcacgg ggcttttttc atgctcgggg    137940
     cgtacgcggg cgtcgtggtg ctgggcctga cgcagaactt ctgggcggcc atgctgctgg    138000
     cgccgctggc cgtggcggcc gtgggcatgg tctgcgagcg ctggctgata cgcccgctct    138060
     acggacgcgg aatcgactat ccgctcctgc tgaccttcgg gctggcctac atgctggtgg    138120
     aagccgtgcg catgctgttc ggccgcgcgg ggctgccctt cgacacgccc gaggcgctgg    138180
     ccggcttcac caacctgggc tttgccgatt tcccgaccta ccggcttttc atcatcgccg    138240
     tgacgatcgt gctgctgctg gcgctgtggc tgctgatcga aaagaccgcg ttcggattga    138300
     tcgtgcgcgc cggcgcgcgc gaccccgtca tcgtccgcgt gctgggcatc gatgtgtcgc    138360
     gcgtctggct gctggtattt ggcctgggca ccggcatcgc cgcgctcgcc ggcgtgctgg    138420
     cggcgccctt gcagggcgtg tcgcccgaga tgggcacctc ggtgctgatc gtggccttcg    138480
     tggtgacggt cgtcggcggg atgggatcgc tgatgggcgc ggtggtggcg gggctgctgg    138540
     tcggcgtggc cgaaagcatg tcggtgctgt ttttcccgga ggcggccaag gtgtccatgt    138600
     tcgtgatcat ggccgcggtg ctgctgtggc ggccgcaagg gctgttcggt cgatccggac    138660
     tgctggcgta aggagaggat tcatgcgttc attgtcattc gcggcgggcg ccaggccctc    138720
     cggcgccacg gtactgcgcg ggctggtcgc gcgccaccgc gtgctggccg ccatcgcgtt    138780
     cttctgcgtg ttcccgtgga tcatgccgta tcagtcggtt gccatcaacg tgctgatctt    138840
     cgggctctac gccgtcggct tcaatctgct gttcggctac atgggcctgc tgtccttcgg    138900
     ccatgcggcc tttctcggca cgggcgccta cacggccggc atcctgatct cgcagcacgg    138960
     cgccgcctgg tggtgggcgg tgccggcggc catcgccatg tcggccctgg tcgcgctggc    139020
     catgggcctg ctggccatcc gcacgcgcgg catctacttc gcgatggtca cgctggcgct    139080
     gtcgcagtgc gtctacttcc tggtctacca gttgccggcc tcgggcggcg agaacggcct    139140
     gcgcggcgtc aacgtggccg aggtctcgct gctggggctg cgcctggacc tgctcgatcc    139200
     catgcagaag tactacttca tcctggggtt cgtcgcgctg gcgatggccg tgctctcgcg    139260
     catcctgtcc tcgccgttcg gcggcgtggt cgaagcgata cgcgagaacg aatcgcgcgc    139320
     ccgcgcctgc ggcttcgacg tggaccgcag caaactgctg accttcgtgc tgtcggccgc    139380
     gttctgcggc ctggccggcg cgctcaacgc gatccacctg tccagcgtgg cgatcgagac    139440
     cctggcctat acgacctcgg gcatggtcgt catgctttgc ctgctgggcg ggatgggcac    139500
     ctatttcggg ccgttcgtgg gcgcggccct gtttctcttc atccaggacg tcgcatccga    139560
     atacaccgag aactggcagc tctacgtcgg agcggtgttc gtgatcttcg tgctgttctt    139620
     ccccaagggc gtgtggggca ccgtgctgga aaggatcgac catgagcgct gaccccatca    139680
     tcgaaacccg cgcggtgacc aagcgcttcg gcgacttcgt ggcgctgagg aacgtatcgg    139740
     tgcgcattcc gcgcggccgc ctgacctcta tcatcggccc caacggcgcc ggcaagagca    139800
     cctacttcaa cctgctttcg ggcgccttcg cgcccagcga gggcagcgtg ctgttcgagg    139860
     ggcgcgacat caccggcctg cccgagcatc gctacgcgca caccggcatc gccaagtcgt    139920
     tccagatcac caacctgttt cccagtttca gcgtgctgga gaacgtgcgc atcgccctgc    139980
     aggcgcaggt gtcgcgctac aacctgtgga gccggcgcag cgacctgccc gagttgcgcg    140040
     agcgggcgat ggcgctgctg cagacggtgg ggctggccga taagagccgg gtcagggcgc    140100
     gcgagctggc gcatgggcag cagcgcgcgc tggagatcgc ggtggccctg gccgccgatc    140160
     ccggcctgct gctgatggac gagcccaccg cgggcatgag cccggaggaa acccgcgcga    140220
     tgatggacct gatacggcgg ctagtcgagg cgcgcagcgt gatcctggtc gagcacaaga    140280
     tgaagctggt catgggcatc agcgaccgga tcgtggtgct gcaccacggc gagctgctgg    140340
     ccgagggttc gccggacgac atccgcaaca acgaccaggt caggcgcgtc tacctgggcc    140400
     agggcaagca ctgaggaaca tcatgctgaa aatccaagac ctgcacgcct ggtacggcag    140460
     cagccacatc ctgcagggcg tcagcctcga cgtggagcgc ggagagctgg tctgcctggt    140520
     cggccgcaat ggcgcgggca agaccaccac ggtcaagagc gtggccgggc tcatccccaa    140580
     ggcgcgcgga acgatacggt tcgatggccg ggacattctc ggcctgccgg cgcacgcccg    140640
     ctacgccatg ggcctggcct acgtgccgga agagcggcgc atcgtgcccg gcctgacggt    140700
     gcgcgagaac atccagctgg gcctgctgcg ctcgcccttg caccgccgcg aaaaggaggt    140760
     catcgacgaa atcgccgaga ccttcccgcg cctgaaggaa cgcctggacc agcaggccgt    140820
     gaccatgtcc ggcggcgagc agcagatgct ggccatcgcc cgcgccgcgg cctcgaagcc    140880
     caagttcatc atgctggacg aaccctcgga aggcatcatg ccggtgctgg tcgacgaaat    140940
     gttccgctac ttcgaaaccc tgaaggccgc gggcgtgacg atgctgctga tcgaacagaa    141000
     cgtggagctc gcgctggcga tcgccgaccg ggcctacatc ctggaccagg gcgaggtcgt    141060
     ctacagcggc ggcgcgcagg ccatgctggc cgacgaagtc atgcaggagc gctactgctc    141120
     cgtgtgacag gaccggcccg ccgcccggag ggcagggcgg gttggtagaa tcttccggta    141180
     ttgccggacc gagggcgatg caagcccaga ctaggaggcg gatctgaaca ccgcaagcaa    141240
     gcaagtgcga cggctgcagc cgcaggaacg ggagcaacag atcgtggaga aggccatcga    141300
     gcacttcacg aagaacggct tcgagggcag cacccgtgag ctggccaagc agatcggcgt    141360
     gacccagccc ttgctgtacc ggtatttttc cagcaaggaa gccctgatcg agcgggtgta    141420
     cgccgaggtg ttccagtggc ggcgcgactg ggaggcgcag atcaaggacc gcaaggtgcc    141480
     gctgcgcgac aggctgcacg cgttctacat ggactattcg tcggtcatcc tgcgcgagga    141540
     atggatacgc atcttcatct tcgccggcct gacgcgcgac ggcatcaaca accgctacct    141600
     cacgcgcctg cgcacccacg tcttcctgcc ggtgctggcc gagctgcgcg cggagttcgg    141660
     cctggacgag ccgcgcgacc gcgccgaggt cgaagccgag atcgagatga tctggagcct    141720
     gcacgcggcc attttctacc tgggcgtgcg caaatggatc tacggcctga aggtgccgac    141780
     cgacctggac cgggtcgtgc ggcagaaggt cgacatgttc ctgcacggcg cgccgccggc    141840
     catgcgcgcc ctgcgggccg ggcggccggc ctgagcccgc tgcctgctca ggcccggcgc    141900
     gccgcggcgg ccggtttccg gggttttgcc tccgacggcg ccacgtagcc caggctgtgg    141960
     ctcagccgcg ccgcatgctc gatcagcgcc tgggtgtatt cggcttcccg cctggcgttg    142020
     aagcgtccct ggggaatggt caggcacaaa gatccgagca cgttgccgtc gacgccgaaa    142080
     aacggcgcgc ccaggccgat ggagccggcg atgcgttgcc ccttggtcac ggcatagccg    142140
     cgcttgcgga tctgggccag gtccttgtgc accgttttat cggccacgcc ggctccggtg    142200
     accgacgggc cggcctcggc gaggatgcgg tcgatatcgt cctggggcag aaaggcaaga    142260
     atgctgcgcg ccgtggcgcc ccatgccatc tgcagcggcg tgttctcctt gacgtcgtag    142320
     cgcaggagtt ccgttccgtg gtggacgctg acgatggtgt agcggcgctg ctgggccagg    142380
     tacaggcaca gcagggtggt ttcgttgaac cgttccacca gggattgcag caggggcgcg    142440
     gcgaggtcct tgatctgcga cgaatccacc accagcgagg cgatgcgcac gaattcgaca    142500
     tcgcagtaat acatcttcgt gacgggatcc ctggccacca atccttcgtc cttgagcagc    142560
     gccagcaggc gatggatggt ggaaggcgcc agcgccagtt ccgccgccag gtcgctcagg    142620
     gtgacccggt tgctgcgttc ggccaggatg cgcagcaatg cgaccacgcg cgcgacggtg    142680
     cccaacgtat tgtctgtctt tgccatagtt cccatgtcgg tagcgacgag cgcggccgcc    142740
     ggcctgccag gccggccggc gcgccgccgt cctggccgcg caggaaaggc ctgcgccggc    142800
     cctgatggcc gacattgtag cggggcgccg tggcgcggac agccacggga tggcgccggc    142860
     cgggaactac atgacgactt tcctggcctg catggcctgg atctcctgtt cgctccagcc    142920
     gagccattgc gccaggatcg ccggcgcgtc ctcgcccagg cgcggcgggt agcgggccgg    142980
     cggctcggct tcgcccagga acttgatcgg gttgccgacc acttcgatct ccggtccgcc    143040
     tggccgccgc aggggcatga ccatgccgcg tccgctggcg cgcgcttcgc tcagcgcctc    143100
     gggtacggtc ttgatcaagg ccaccggcac gccgttggcc gccagcggtt ctatccattc    143160
     ggcggcggga cgggcgagga aggccgcctc gagcaaatcc cacaatggct cgcggttctg    143220
     caggcgcatc tccgcgtcgc agaaccgggc atcctgggcc agctcgcgca accccaatgc    143280
     ctcgcacagg cccttccaca tgcgctcggt gttggcggtg accaccagtt cgcggccgtc    143340
     gccggcgagg aacgaccgat aggtggggat ggagtcgtgc cgggccgcct ggcgttgcgg    143400
     cgtcacgccg gccaccagcg cgtaggtgct ttggtacgag agcatggcca gttggcaatc    143460
     gagcatggaa atgtcgatgt ggcgtccccg tccgccgcgc gcggcgtcgg ccagcgcggc    143520
     attgacggcg atggcggcgt acatgccggc cgccaggtcg ccggcgggaa tgcccaggcg    143580
     gacggcggga cggccggctt cgcccgtcag gctcatgacg cccgacatgg cctgcacgat    143640
     catgtcgtag gcgggacggt cgcgcagcgg gccgacctgg ccgaaaccgc tgatcgacgc    143700
     ccagaccagg ctcgggtgct gcgccatcag ggcggcaata tccaggccga tccgcgccgc    143760
     cacccctggc cggtagttct cgaccaccac gtggctgcgg gcgatcagcg acttgaccag    143820
     ggccagcccc tcgggctgct tcatgtcgac ggccaggctc ttcttgtccc ggttgatccc    143880
     gaggtagtag gcgctgtcgc cgtccacgaa gtgcggcgga atgtgccggc tggagtcgcc    143940
     gtccggcgcc tccaccttga tgacctcggc gccgaggtcg gcgaggatct gcgtgcagaa    144000
     ggggcctgac agaaaggtcg tcaggtccag cacgcgatag ccggccaagg gcttggcggc    144060
     cggcgcgggg gactgctgtt gaacttcatg catgttgctg ctgttccagg cttgttcttg    144120
     tcgcggcgtc tcagacggct tcgtacagat gcacggtgca tgcgccatgg tccaggccgg    144180
     cgatgccgcc gccggtcacg tggctgagcg cgcgcctggc gccgggcacc tggcgctcgc    144240
     cggcctggcc cgtcaggtgc caatagacct cgacggcctg cgccacgccg ctggcgccca    144300
     ccgggtgccc cttggagagc aggccgccgc tggggttgac cacgacctgg ccgccgtagg    144360
     tggactggcc gcagcgcagg aacgcggcgg attcgccgcg cgggcacagg ccgagggcct    144420
     cgtaatagac cagttcggca atcgagaatg cgtcgtgcag ttcgaccacg tccaggtctt    144480
     gcgggccgaa accggccgct tcataggcgt cgcgcgccga gtcggtgctg atctcggggt    144540
     tgagcatgtc gcgatatccc gcggtgacct ggccgctatg gacgaccgag gcggccacgc    144600
     gcacggccgg ggcggcgagt ttgcgccggc ccgcttcgga gaccatgatc accgccgcgg    144660
     cgccgtcgcc ggtcgggcag cactgcagca gcgtcagcgg gtcgcagatc ggccgcgagt    144720
     ccagtacttc gtcgaccgtc acttcggagc ggaactgcgc atagggattg cgggcgccat    144780
     gccggcgggc cttgacgctg acctgcgcga gatccgccac ggtggcgtcg cgttcgtaca    144840
     ggtagcgttg cgcgcgcatg gcgtagacgg ccggcatcac gatgcctagc cggacctcgg    144900
     gatcctcggc gaccagcggc agcgtcccgc cgccgaactg ggtcagtttg tccacgccga    144960
     tgaccagcac gatgtcgcgt atgccggcct ggatatcctt gtaggcgagg tgcagcgccg    145020
     aggcgccgcc ggaacacgcg ttatcgacat tgaagacggg gaccgcgcct attcccattt    145080
     ccttgacgat gcgctggccg gtcagcatgc cgccgaaggc atggccgcag accacggctt    145140
     cgacatctcg cggcgcgatg ccggccgagc gcagcgcgtt gagcacggcg gggacggcga    145200
     ggcccgagta gctggactgg cggtgcctgc ccatggggat catggccgcg ccggcgatgt    145260
     agactttgct cattgatatc tcctggtccg ggtcaggcgg gcgtgacgaa ccagcgctcg    145320
     ccatcggcgc gcagccggac ggattggccg caatgcaggg gctgggcggg gtcggccagt    145380
     acgtgcgcga gcacgcgcac cccgttcgga aaatccacat agccgagcgt gtagggcacg    145440
     ggccgcgcgg acgaaacgtg gacggtggtg tacgaataca gtgttgcgtc ggggccgaac    145500
     aggaacggct ccatgtcgcg cgcgccggtc tgcaggcata cctcccgttc gggaaacgcc    145560
     atgctgcccg aggaccggct acggctgccg cgcaggtaca ccacggcgtc cttgacctcg    145620
     aacggcggta gcggggcttc tttcaagtcc ttgatgggga gggcgtcgtc ggcatactgc    145680
     tggccgccgg ttgccggtga tgtttcctgc attttccttg ctcctgtcgc tgtgtctggg    145740
     gcggcggggc gctcgccgtc cggatggtgt cgccgtgcgg gccgatggcg ctcagctcgg    145800
     attgatgccg gcatccttga ccagcgtgat ccagcgcgcg gtatcttccg caatgacctg    145860
     ctcgaattcc ttgccgccgc gggtgtcgac ctgcatgccc atggactggt aggcggtgcg    145920
     cacttcgtcc gtgcgcgtgg ccttctcgat ggcggcgtgc agtttccggc ggacgggctc    145980
     gggtacgccg gctggcgcgg agatgccgta ccagatggtc atctcgaacg gcacgccaag    146040
     ttcgcgcagc gtcggcacgc cgggccaggc cgggtcgcgc tcgcgggacg tcaccgccac    146100
     gccgcgcacg ttgccgccgc ggacctgggc cgatgccgag cccgacgtat cgatggcgaa    146160
     ctgcacgttt ccggcgatca ggtccaccat catgggcccg gtccccttgt agggcacatg    146220
     gatcgcgctg agtcccgccg cgctcaggaa cgaggccgtc gccatgtgca gcgccgcgcc    146280
     caccccggaa gagccgtagt acagcttgcc gtcgttggcg cgcagatagt ccaggaacgc    146340
     cttgccgtcc ttgacgggca ggtccttgtt gatctccagg acgcagggca cctggccgag    146400
     cagggagatc gccgacatgt ccttgctgaa gtcgtaggac atgttcttgt acagggccgg    146460
     ggccgaggtc agggtgacgt tcgagagcag cagggtgtag ccgtcggcgg ccgcgcgcgc    146520
     gacataggcc gcgcctatcg tgccgccggc cccgcctttg ttctcgacga tgaccgattg    146580
     ccccagttcg gccgccaggg ccttggcgac gacgcgcgcc agcatgtcgg tggatccgcc    146640
     cgcggcgaag ggagcgacca gggtgatggg cttggcggga aaggcgtccg cggcgtgcgc    146700
     cggcgatagc gcggccagcg gggccaacgt gagcgagcac gccgccgcga gggttttcag    146760
     tgcgcggcgg cgcggggcgg caacatcttc ggggtggtgg tccggcatgg aaagtctcct    146820
     gtcttttctc ggcccggggc cgggcgctgg cgcgcgatag ttggtgtaaa ttccgttgaa    146880
     cggaaatgac ttccgttaaa caaaattcta agcgcgcgac aaaagacagg gatagctagg    146940
     gttttcccgt ggctagggcc cgaggcgcgc cagggctccg ccgtccacgg gcaattgcac    147000
     gccggtaatg aaacccgcct ggtcggacgc caggaacacc gcggcgtggg cgacgtccca    147060
     gctcgtgccc atgcgcccgc gcaacggcac catcgcattg cgttcggcga cgatctgttc    147120
     gcgcggcttg ccggtcaacc tgacgcgagc ctcgatggcc atcggcgtat cgatcaaccc    147180
     tggcaggatg gcgttggcgc gcaccccgtg ctcggcgtag gtcatcgcga tgtgctgcgt    147240
     caggccgagc acgcccatct tcgtggcctt gtaggcaacg ttgggataca gcgcgtaggc    147300
     cgccgtcgat gcgacgttga gcacgcagcc gctgcgctgc gcgcgcatgg ctggcagcac    147360
     gtgcttgcat gtcagcatca tgcctttcaa gttgagattg gcgagcaagt cgaacgcttc    147420
     gacggagata tcctcgaccg gcgcatcgcc gcccgcgccc gcgatgccga cattgttgtg    147480
     aagaatgtcg atgcggccgt gcgtttccat gacttgccgc accatggcca cgatggcggc    147540
     ttcgctggtg atgtcggctt gtaccgccat ggcctggccg ccttcggcca ggatcagtcc    147600
     ggccgtctcg ccggcgctgg ccatatcgcg gtcgaccgcc acgacgcttg cgcctgcgcg    147660
     cgcgaatgca atcgcggtgg cgcggccgtt gcccatggtg ctgccgggcg tctgcccggc    147720
     tccgacgacg atggcgatct tgttttcaag aacattggac ggcatggttt tcctttttcc    147780
     gatggagccc gcgggcccgc gctgcaaata caggggtgcc ctatatttcc gtttaacaga    147840
     aatgaattcg ttacagcgga aattagtgta ttcgatcgga cgaggaagca cggccgcgca    147900
     cgagcgcggc gcggcgtgcg gccgtcgaca tgtgcgagtc cggcgcgccg ccggtcgtgc    147960
     gggcgcgcgc gtcgcctggg cctaaggcag gctgtcgaaa tcgcgtagcg gctccaggcc    148020
     gccgatcaat cgctcgacca gcccgttcgc ggtgctctcg cgccagatca ggctgagctc    148080
     cagatagtgc ggcgtgccgg tcagcggcag gaagaccgcg ctgcccttgt agatgcgctg    148140
     cagggagcgc ggcacgatgg tgacgcccag ccccatggcc accatctgca gcatggtcga    148200
     ctggtggcgg gcggtatggt ggatcttggg gctgaagccg gcgttcatgc acagcgacac    148260
     cattttgtcg aacagccccg aggccagcgt gcgcggaaag aacacgaatt cctcgctggc    148320
     cagctccgcc accggcacgg cctcgcggct tgccaagggg tgctggctgg gcacggcggc    148380
     gtagaacggt tcgcgcagga tctggcgtgt ccgcagatcg gccgtatcga tgggggtgtg    148440
     gaccagtccg atgtccagtt catcgcgcag gacggcgagg gtctgttcgc gtgaactcat    148500
     ttccgtcagt tcgaccttgc tgccaggcat ggatcgcttc acctgggtca ggatgtacgg    148560
     aaccagatgc gccagcgccg agctgaccgt gcccatgcgc acggtgccca gcatgccggc    148620
     ggcgatctgg gtggtttcct gcgccgccag ccgcacattg gccaggatgg ctctgctgga    148680
     cttgagcagg gcggcgccgg cggccgtgag cgagacgccg cgcggcaggc ggtgaaagag    148740
     cggcgcgttc agttcctctt ccagcgcctt gatctgttgc gacagcggcg gctgcgaaat    148800
     gtgcaggcgc tcggcggcgc ggctgaaact gcgctcttcg gccaccgcca cgaaataccg    148860
     catctgcttc agatccatgg tcctgttctt cgattcgatg ttggtagtcg attttcatat    148920
     gggaaggata taaattcaat atttgttcat atggcactgc gttggctacg cttctccccg    148980
     tcacaacaag aacccgcaat cggcgggaca acgggagaca ggaaatgaac cgacgtgatg    149040
     cgctgggcgc gctcgccgcg ctggcaagca cgacctggct gggccgcgcc gcggccgcca    149100
     agccttaccc gcagcgtccc gtgacgctga tcgtgccgta ttcgccgggc ggagccaccg    149160
     acaacgtagc ccgggtcatc gccgaacacc tgcaggcccg gctgggccag ccggtgatca    149220
     tcgacaaccg cgccggcgcc aacgggcgga tcggcacgct ggcggtggcg cgcgccgccc    149280
     cggacggcta tgtcctgctg ctgggcggta taggcccgat cacgatcgcg ccgcacctcg    149340
     agaaggttcc ctacgatccg ttcaaggact tcgcgcccgt cagcctgctg gtcaagaacg    149400
     acgtcgtgct gctggtcaat ccggcggtgc cggcgcgcaa gccggaggaa ctgatcgcgc    149460
     tcctgaaagc cgagccgggc aagttcaact atgcgtcctc gggcacgggc ggcccgttcc    149520
     acctgtccgg cgagctgttc aagagcatgg ccggcgtgga aatgacgcac gtgccgtaca    149580
     agggcgacgg acccgccctg gtggacctga tggccggcaa tgtgcaggtc atgttcacga    149640
     cgatttccgc gtcggcggcg catatccagg cgggcaaggc cattgccctg gccagcgcgg    149700
     gcgaggtgcg ctccagccag atgcccgacc tgcccacgct ggcggagtcg gcgctgcccg    149760
     gctttgcgtc ggagacgtgg caggcgctgt tcgcgccggg cggcacgccc gcgccgacca    149820
     tcgacgccct gcaggccgga ctggccggcg ccatgcgcga tgcgcgcttg cgccaggctc    149880
     tgcaggcgca gggcaacagc gtcgtggcca gcgacgtgcc ggcatgcgcg cagttcgtgc    149940
     gcgatgaata cgagaaatgg ggcaacgtcg tgcgcaagtc cggcttggcc gcgtgaccca    150000
     agaaggagcg aagatgagtg gtggcggtgc aagcaagccc atgccgatgg acggcatccg    150060
     ggtgctggat ttgtcgcgcg tgctggcggg cccgtggtgc acgcagatgc tggccgattt    150120
     cggcgccgat gtgatcaaga tcgagcggcc agggcagggc gacgacagcc gggcctgggg    150180
     gccgccgttc tacgagtcgg ccgacggcca tgaacgggtg tccgcgtact tctgcgccgc    150240
     caaccggggc aagcgctccg tgtgcctgga cctggagtcc gaggcggacc gccaggcgct    150300
     gcgcgaactg gcgctgcgca gcgacgtact ggtcgagaat ttcaaggccg gctcgctggc    150360
     gcggcatggg ctggattacg ccacgctgtc ggcgctgaat ccgcgcctgg tgtactgctc    150420
     gatcacgggc tatgggcaga ccggcccgta tgcggccagg ccgggctacg actcgatcat    150480
     ccaggccgtg ggcggaatga tgagcgtgac aggcctgccc gatgacgccg ctggcggcgg    150540
     tccgcagaaa accgggattc ccatcatcga cctgatgacc ggggtctacg cctgctgcgg    150600
     cgtgctgatg gccttgcgcg agcgcgaggc cagcgggcag ggccagcacc tggatctctc    150660
     gctgatggac gtgcaggtat cggcgctgtc caccctggcc gccaacttcc tggcgtgcgg    150720
     ccaggcgccg caacgcaacg gcaacgaaca tccgaccgtc gtgccgggcg acgccgtcca    150780
     gtgcctggac ggcccgctca tgctgatggt gggcaacgac cggcagttcc agcgcctttg    150840
     ccgccatctg gaccgcgagt cgctggcgcg cgatcctcgc tatgcgacca acgagctgcg    150900
     cgtccagggc aagaatgcat tgatggcgca actgcgcgag gccttccgcg gccagacacg    150960
     ccagtactgg ctggaacgcc tgctggccga aggcattccc tgcgggccga tccagaccgt    151020
     ggcggaggtg ctggccgatc cgcacgtgcg ccaccgggcg ctcgtggccg cagcgccgga    151080
     cccggtgttc ggcgaaatcc gcgcgatggg cagcgcgttg cgcatgtcgc gcacgccggc    151140
     ccgccacggg cgggcgccaa ccgtgctggg cgagcacacc gaagcggtgc tgtcgtcgct    151200
     ggcctcgtcc cgtcttcaat ccaacccgca agccaaatga acacatcccc gaccgtaaga    151260
     ttcgaaacgc gcgaacagat cgcgatcatc acgctgaacc ggcccgacaa acgcaacgcc    151320
     atcaacctgg agatgcggca ggcgctgatt gccgcctggg agcggttcga gaacgatgcg    151380
     gcgctgcggg tcgcgatcct caccggcgcg ggcgaacgca gcttcagcgc cggacgcgac    151440
     ctgtccgaga acacggatct cagccagaag acgttcctgc ccatactcgg cgacaacgtc    151500
     caggcaagca agcctgtcat cgcggcggtc aatggcgccg cactgggcgg cggctggttc    151560
     ttcacgcaaa tgtgcgacct ggtggtggcc gcggaccatg ccgtgttcgg catgccggaa    151620
     tccaaggtcg gccgggcgcc ggcctgggcg gtctggttgc agggggtgat cccgcagaag    151680
     ctggtgctgg agctgctgct gaccggcaat cccatcggcg cgcagcgggc cgccgagatc    151740
     ggcttcgtca atcatgtggt gcccgccgcg cagctgatgg acaaggccat ggagctggcg    151800
     cgcgccatcg tggccacggc gccgctgagc gcggcggcct gcaaggagat ggtctatgcc    151860
     gcggccgaga tggggcgggg cgcggccctg cggacggctt tccatatcct ggagccgcta    151920
     taccgctcgg aagacgcgcg ggaaggcgcg ctggcgtttc gcgagaagcg cgcgccgcgc    151980
     tggagcggac gatgaagatt gctcaacgag gagaaagaac ggaatgaccc ggtttctaga    152040
     agtggagcgg cgtggccgcg tttgtatcgt caggatgaat cggcccgagg cgcgcaatgc    152100
     gctgaccgat gccgagcagt tccaggagtt cgaggacctg gtgcgcgagc tcaacgcgga    152160
     cctggatgtg cgggcggcca tcctgaccgg caacggcccg tcgttttgcg cgggcggcaa    152220
     tgtcaagaag atgctggcgg actacggccc ggacagcgga ccggcggcgc gcattcccgc    152280
     gaagtacagc acgggcatcc agcgcattcc catggccctg gcgcagcttg acgtgccgct    152340
     gatcgcggcg gtcaacggcg cggccatcgg cgcgggctgc gacctggcct gcatgtgcga    152400
     tatccgcatc gccgccgacg atgcgcgatt cgccgagagt ttcgtcaagc tgggcatcat    152460
     ccccggcgat ggcgggtcgt ggttcctgcc gcgcatcatc gggctggcgc gcacctacga    152520
     gatggcgttt accggcgata cgctggacgc ggccaccgcg ttgcaatgga acctggtgtc    152580
     cagcgtcgtg ccggcggcgc agctcatgga cgccgcctgc cagctggccg agcggatcgc    152640
     cgtcaatccg ccgcagcagg tgcgcttcgc caagcggctg atccgcgaag gcctgcacca    152700
     gcggctggag gccatgctgg agttctccag gctgtatcaa accctgtcgc accgcaccgc    152760
     ggaccaccag gagggcattg cggccttgct ggaaaagcgc ccgcctgtct ttcacggacg    152820
     ctgaagccgt cccgttcttg cacgagagga gaccatgaga aaaaaacact ttgttctgtc    152880
     gttcctgctg ggcgcggcgt cgctggccgc gagcggcgcg gccctggcgc aacaggcgtt    152940
     tcccacgcac ccgatccggc tcatcgtgcc gttcgcgccc ggcagcggca cggacaacac    153000
     ggcgcgccat ctggcgcgcg agatggaagc cgagttcggt tcgccggtgg tggtcgagaa    153060
     ccaccctggc gccaacagtt tcatcgccgc caagatggtg gccgccgcgg cgcccgacgg    153120
     ctatacgctg ctgatctctg gatcgtcggc catgacggtc aacgcggcca tcttcaaggc    153180
     gctgccgtat gaccccctga aggatttcgc gccggtggcg cgcctggcga aaggcgcgat    153240
     gggcctggcc gtgaacgcac agtctcccta tcgttcggtg gacgacctgg tccaggccat    153300
     gcggcaacag ccgggcacgc tgaactatgg ctcgggcagc gcggcctacc agatcacgac    153360
     cgagctgttc ctgtcgatgg cccaggccaa ggccagccat attccctaca agggcgcggc    153420
     ccaggcattg accgacctgg ccggccggca ggtcgacttc gcgttcgccg actatgcggc    153480
     gctggtgccg ttcctgcgct cgggcaagct gcgcctgctg gccgtcagca gcgccgagcg    153540
     gctggaaagc gagcccgcga cgccgacggt ggcgcaggcc ggctatccgg ggttcgacat    153600
     ggtgaactgg acctccgcgt tcgcgccggc gggcacgccc gcgcctatcg tcgacacgct    153660
     gagcaaggcc atcgtcgcca tctacgaacg cgagcagacg cgggcgttcc tggccggcac    153720
     caactgggag agtttcccgg tagggcccgc cgagctgcgg cgctaccagg tcgacgagat    153780
     cgccaaatgg agccgcgcgg ccgagatcgc cggcatcgag aaacagtagg agcctggata    153840
     tgtcggtagc gatcgcgatg cggggcgaca taggagtcgt gaccctggac agcgcgccgg    153900
     tgaatgcatt ggggcggacg ttgcggcacg gcctggcgca atgcctggag caggtgtacg    153960
     ccaggccgga cgtgcgggcg ctgctgctgg tcagcgcccg tccgggcatt ttctcggctg    154020
     gcgcggatat caaggagttc gaccaggcag ggtcggacca ggatgccggg ctggccgaac    154080
     tgatagaccg catcgagaac gcgccggtgc ccgtggtggc gctgctcgat ggcgcggcgc    154140
     tgggcggcgc gctggagctt gcgctggggt gccactatcg gctggcgtcg ccgcgcgcct    154200
     cgctggggtt gccggagatc aagctggggt tgctgcctgg cgccggcggc acgcagcgct    154260
     tgccgcgcct ggtcggcgcg cgccaagccg tcgagatggt gctgggcggc gaacccgtgg    154320
     gcggcgaaac cgcgcttcgg tacaaactgg ccgatgcgct gttgtctgcc gacgatacgc    154380
     tggagcaggc gctggcgtgg atgcgcaacg cgccgggcgg gctggcgcgg cgccgcgttg    154440
     ccagtttgcc tgcgttggcg ccggcatcga tcgccgaggc ggcgcgcgcg gccgccatcc    154500
     ggccggtggg cagcgcggcg gcgcgcgagg cggcgctggc atgccttgcc gcggcacagg    154560
     ggccgttcga cgccgggcgg gcgctggagc gcgagtcgtt cgcgcgcctg cgcgacgggg    154620
     ccgaggcgcg ggccttgcgc tatgcctttt ttgccgagcg gccgcgcccg ccggccggcg    154680
     atgtgtcggc ccggcgcatc gagcaggtcg cggtcgtggg ggctggcacg atgggcaccg    154740
     gcattgtcat ctgcctggcc gacgccggcc tgccggtgat ctggcacgac gtggacgccg    154800
     accggctggc gcaggggcgc gcgcaggtat gccagcattt cgagcgcctg gccgcgcgca    154860
     agcggctcac gtccaggcag gccgagcagc gtgtcgccgc cgtcgcgaca accggcgaga    154920
     tggccggcat cgcgcaggcc gatctcgcca tcgaggcggt gttcgaggac atggcggtga    154980
     aatgcgcggt tttccgcgag ctggaccggg tcctcaagcc cggcgccatc ctgggcacca    155040
     acacgtcgac gctggatgtc gaccggatcg cgcacagcac gcggcgcccg caggacgtgg    155100
     tggggctgca tttcttcagc cccgcgccgg tgatgccctt gctcgagatc gtgcgcggcg    155160
     cggccaccca cgccgatgtg gtggccgccg cgcaagggct ggcgcggcgc ttgcgcaaga    155220
     ccgccgtggt ggccggcgtg tgcgacggtt tcatcggcaa ccgcatgtgg catcagtatc    155280
     tgcggcaggc ggccttgatg gtgcacgagg gcgccatgcc catggaggtc gacgcggcgc    155340
     tgcgcgactg gggctttgcc atgggcccgt tccaggtcgc cgacctggcg ggcctggatg    155400
     tgggcgacag catccgcctg cggcagcgca gcgagatgcc gcacaggccc tggcccgact    155460
     ggctggaccg ggtcagcgcg gcgggccgcc tcggcctgaa aggaggcagc gggatccatg    155520
     cctatccgga cggcggccgg cagccccggc gcgatgccga ggtggaggcc atgattgcgg    155580
     ccgcttcgcg cgaggccgga gtatcccgcc gggccattgc ggccgacgag atcgtcgagc    155640
     gttgcctgca cgcgctcgtc gtcgaggccg cgcgcctgct ggaggagggc atcgcggcca    155700
     gcgcgacgga cgtggacgcg gtgttcctgg ccggctatgg ctttccgcgc tggcgcggcg    155760
     gcccttgcca cagcgccgac gccatgggcc tgccggcggt ggtggccggc ttgcggcggc    155820
     gcgccgccac ggcggaaccg gaattctggc aaccgcccgg cctgctggtc cgcctggcgg    155880
     cgcagggcgg ccggctgcag gatcacggcc aggagggcgc atgagcgacg acatcgtcat    155940
     cgtatcgacc gcgcgcacgc ccatcggcaa ggcctatcgg ggcgccttca acaataccca    156000
     tggcgccacc ctgggcgggc acgccgtcga gcacgcggtg cggcgcgccg ggatcgagcc    156060
     ggccgaggtc gatgacctca tcatggggtg cggccgcccg gaaggaacgg cgggcgagaa    156120
     catcgcgcgc caggccgcct tgcgcgccgg cctgccggtc gaggtgcccg gcgtcacggt    156180
     gaaccggctt tgctcgtccg ggctgcaggc catcgccatg ggcgcccagt ccatcctgtg    156240
     cggcagcgcc gatatcgtgg tggcgggcgg gctggattcg atttcctgcg tgcagaacga    156300
     acacatgaat caccacatgg aacaggaccc ctggctggcg cggcacctgc cggagatttt    156360
     cctgcccatg atcgataccg ccgaagtggt cgcccggcgc tacggcattt cgcgccagcg    156420
     ccaggacgag tacgcggcgc gcagccagca gcgcgccgcg caggcgcgcg cggccggccg    156480
     catgcgcgac gaaatcgcgc ccatgcgtgt gagccacctg gcggccgacc cgcacggcgc    156540
     gccgcccgtt gaaaccgaaa tgctggtggc cgaggacgaa ggcgtgcgcc ccgggacgac    156600
     ttccgaaaag ctggccgcgc tcaagagcgt gcgcgagggc ggctgcatta cggcgggcaa    156660
     tgccagccag ctttcggacg gcgcctcggc ctgcgtgctg atgcgcgcgg ctgccgcgcg    156720
     ggcgcgtggc ctgcggcccc tgggccgctt ccgcggcttc gcggtggcgg gctgccgtcc    156780
     cgatgaaatg ggcatcggcc cggtgcaggc cgtgccccgc ctgctggcgc gcgccggcct    156840
     ggcgatcggc gacatcggcc tgtgggagtt gaacgaggcg ttcgccgtgc aggtaatcta    156900
     ttgccgtgac cgcctgggcc tgcccgatga acgcctgaac gtgaacggcg gcgccatcgc    156960
     gctgggccat ccctatggca tgtccggcgc gcggctggtg gggcatgcgc tgctggaagg    157020
     gcgcgcccgg ggcgtgcgtt atgtggtggt gaccatgtgc gtgggcggcg gcatgggcgc    157080
     cgcgggacta ttcgaggtgc tatgaacgga ttcgagtttc ggacacatgc ccgcacgctg    157140
     gcgggcgagg gggcctcgca acggttgggc gaggcggtcg cggcgcaatg ggggccgtgc    157200
     cgcatcctgg tcgtcacgga cgagcagctg gtgcggctgg gcctggtcgc ggccctggcg    157260
     caaagcctgc gcgacgccgg ccacacggtc caggtctacg acggcgtgct ggccgatccg    157320
     cccgaagcgg tggtgagcca ggcgatcgcg cggggccggg aaacggacgt gcaatgcgtg    157380
     atcggcttcg gcggcggctc gtcgatggat atcgcgaaac tggtggcggc gttcgccggc    157440
     tccgcggccg actttcgcga cagctacggc atcgaccgcg tcgccacggc gcgcctgccg    157500
     ctggtgcagg tgccgaccac ggccggcacc ggctcggaag ccacgcccat cgccatcgtg    157560
     acccgcgagg acgcctccaa ggcgggcatt gtctcccccg tcctgtactg cgacatcgcc    157620
     gtactggatg ccgcgttgac ccggggcctg ccgccggccg tgaccgccgc caccggcatc    157680
     gacgccatcg tgcacgccgt cgaggcctat accagccggc tgcgcaagaa cccgatctcc    157740
     gatggcctgg cgcgcgaggc gttgcgcctg ctgtgccgtt ccatcggccc cgcatgccgc    157800
     gacggcgccg acatggcggc ccgccatgac atgttgctgg gcgcgatgct ggcggggcag    157860
     gcgttcgcca atgcgccggt ggcggccgtg catgcgctgg cctatccgct gggcggcgtt    157920
     ttccacgtgc cgcacggcct gtccaatgca ttgatgttcg gcgcggtgct gcgtttcaac    157980
     ctgccgcagg ccggcgccgc ctatgcccag cttgcgcaga tcgcctgtcc gcaggtcgac    158040
     ggcccgcagc aggcgcgcgc cgaaggattc gtgcaggaaa tggccggcct ggggccgcgt    158100
     ctggggctgc cgcggcgcct ggccgaagtc ggggtggccg aacgcgatct gcccatgctc    158160
     gcgcaacagg ccatgcagca acagcgtttg ctggtcaaca accccaggga gctcggctac    158220
     gacgacgcct tgcgccttta ccgggaggcg ttgtgaacga tagcgcgggc caggccccgc    158280
     gtccgcaacg gtggcagcgg gccggcttcg gccatttcga ggccatgccg gtacgctgga    158340
     tggattgcga catgtatggg catgtcaaca acgtcgtgta ttacgcctac ttcgatacgg    158400
     cggtgaatcg ctacctggcg tcggccggcc agctcgaccc gcaggcgggc gccgtgatcg    158460
     gcctggtcgt ggaaacgcac tgcaatttcc acgcgccggc cgagttcccg gaaacattgc    158520
     agatcggcct gcgcgtggcc cacgtggggc gcagcagcgt gcgctacgag ctgggcgtgt    158580
     tccgccccgg cgacgaactg tgcgcggccc agggccactt cgtgcatgtc tacgtcgacc    158640
     gcgccagccg ccgccccgtg gcgctgccag ccggcctgcg ggcctgcctg ggccggctgg    158700
     cggcggccgg gcgcgcttga ggcgcgcgcc gctggccgcc tgcctgccgt ctacgtgccg    158760
     gcgccggccg tcaccgcttc ggccaccagc tgggcggtcg cggccgacag cgtccatccg    158820
     aggtggccat ggccggtgtt gtagaacacg cccggccgct tgccgggccc gacgcgcggc    158880
     agcatgctgg gcagcatggg ccgcaggccc gcccagggca cgacgcggct ggtcgagacc    158940
     tgcggaaaat accggcgcac ccatgcgacc agcggttcga cgcggtcggc gcggatatcg    159000
     cgattgaagc cgttgaattc ggcggtgccg gccacccgga accggccggc gccgagccgg    159060
     ctggtcacga tcttggcgcg gtcgtccagc aggctggtcc agggcgcgcc ggcctggctg    159120
     gcctcgtcgt ccaggctcac cgtgatcgaa tatcccttga ccggatagat gttgacgcgg    159180
     tcgcccacca tgctggcgaa gcggcggctg cccacgcccg cgcagatcac caccttgtcg    159240
     tagcgttcga cgtcttcggc ggtcgtgatg gcgatggcgc cgccgcgatg gtcgatgccg    159300
     ctgactggcg tttcgtagcg gaacagggcg ccgtgccgcg cggcggcccg ggccaggcca    159360
     gtggtgaact tgtggatgtc gccggtggag tccgactcgg taaagaagcc gccgtagaag    159420
     tcgccctgca gggccggttc gatggcgcgc atttcctcgg gcgatacggg ccgccgctcc    159480
     agcccgccgg cgcgcagcag ggcgttgacc cgcaaggcgc tgtcgtactc ccgcctgctg    159540
     gcatagaagt gcaggatgcc gcgccgctca tgatcgaaat cgatccgttc gcgggccgcg    159600
     atgtcgaaca gatgctggcg cgcggcgatg gccagccgca cggtttctat ggtgttggct    159660
     tcgtagcggg ggatctggcg caggaactct cccagccacg agtacttgtg ccagctgggc    159720
     cggggattga gcagcagcgg agcgtcgcgc cgcagcatcc agcgcaggcc cttgaagagc    159780
     gtggagcggc tgttccagac ctcggcgttg ctggccgaga gctgcccgcc gttggcgaac    159840
     gaggtttcca tcgcgctata gcggtggcgg tcgaacaccg tgacctggtg atcgcgcaag    159900
     gcgagcgcat aggcggtggt gacgccggtg atgccggcgc cgatgacggc gattcgagac    159960
     atggtcgtgg tcccagagga ggttggcgtc tgccggccat cggaatggcc cggccgcaac    160020
     cccatctgtc catttacctg agagcttcac ccgtgcgccg ctgcaaacgc gccagggatc    160080
     cccttcggtg ggcgccgtac cgcgcgccac tctccagatg ttccagcagg tcggtccttt    160140
     tgcctgagag tttccggggt ggttgctccg tcggcgccgt ccgctggacg gtctctcccg    160200
     aactgcacgt tggtggaacc ggcacaagtt acagcgattg cgccggcagg acaagacgcg    160260
     ggcgcgcatc caaggggaaa ccctggccac gcgcgggcgg cgccctcaga ccggttcggc    160320
     gtccacgtcg tacgtgaaga gccactcgta tctttcgcgt acccgggcct cgctccattg    160380
     ctgttcgaca taggcggccg cgccggccgc gtgcgccagc tccgggttgt ggaagcgcct    160440
     ggcgttctcg gccgagccgc gcaccacgcg cgccgtgcgc tcgacgcgca gatcctggta    160500
     gcggaccagc gcctgccgcg catcggcgcg catgccgtcg aggcagcgcg ccagcacgta    160560
     gccgtcctcg atggccatgg ccgcgcccga ggccagcatc ggcagggtcg ggtggcaggc    160620
     gtcgcccagc agggtgatgc gcccgctggt ccagcgcgcc aggggctcgc gcagcatcat    160680
     cgcccacttg aagggcgtat ccagcgcatg gatcagcgtc tgcacgtcct cgtgccagcc    160740
     ggcgaaatcc cgcgcgcatt ccgcgatcgt gccctgctgt gtccaggact cgacctgcca    160800
     gtcgtcgcgc tccaggatgc cgacgaagtt caccagttcg ccgcggcgca gcgggtagtg    160860
     gatgacatgg gcgccggggc cgacccagtt gacggcatac ggctcgcgca aatgcggcgg    160920
     cagcttgtgc gccgggatga cgccgcgcca ggccagcgcg ccggagaagc gcgcctggtc    160980
     ctggccatgc agggcggcgc gcacgcgcga gtgcacgcca tcggcgccca ccaggatatc    161040
     ggcctggcgc gtgctgccgt cggccagcgt gacgctggcc gcggcatcgt cctgcgcgac    161100
     gctctcgacc cgggcgccca gttcgatggc ctgcggatcg cgcgccagca cggcttcggc    161160
     cagcacgcgg tgcaggtcgg cgcggtaaat ggtcaggtac gggtagccat agcgttcgac    161220
     ggactgcgcg cccaggtcga acagcggcca ggtctggccg gtgttccaca ggcggatgcg    161280
     cttgccggac gccgggctgg ccacctgttc cagggccgcg cccaggccca gccggtacag    161340
     cacgcggttg gcgttggcgc tgagctggat gcccgcgccc agttcgcgca gctgcgcggc    161400
     ctgttccagc acgcggacct ggaaaccgcg cgcctgcagg gccagcgcgg cggtcaggcc    161460
     gcccaggccg gcgccggcga tcaggatccg gggggaggag gtgtcgggca tcgtgggttg    161520
     tccttctgtg tcgcgtatgc gtaggcgcgg ttactggggc ttgacgcccg cgctgcggac    161580
     cacgccggtc catttgtcga ggtcggcgcg gatcgcctgg gcgaactcct gcggggtgtc    161640
     gccgaccggc tccaggccca gcgcgctgag ctgcttgatg acctcgggat ccttggcggc    161700
     ggcggccagc gcgtcggtca gggcctgcac cgccggcgcg ggggtgccgg ccggcgccag    161760
     caggccgaac caggagtagg cctcgaaggg cttgccgatc gtctccgcga cggtgggcac    161820
     ctcgggcagg ccgctgtagc gctggctgcc ggtgacggcg taggcgcgca gcttgccggc    161880
     gcggatctgc ggcgtcagca gcgtgaccgt atcgaagaac aggtcgacct ggccgcccat    161940
     gacgtcggtc agggccggcg cgccgccgcg gtagggcacg tgcagcatgc gggcgccggc    162000
     ctcgctcttg aacatctcgg cggtcaggtg gccgatggag ccggtgccgg ccgaggccac    162060
     gctcaggtca tggttcttgg cgtagtcgcg cagctggccg atgtccttgg ggcccaggtc    162120
     ggggcggctg accaggatca gcgggccgcg cacggccatg ccgatgggcg tgaaggactt    162180
     gatcgggtcg tactgcaggt tggtgtagag ggccggcgcg accacgatgc tgctggtgcc    162240
     gccccacagc agggtgtagc cgtcgggctt ggcgcgggtg accacggtgg tgccgacgct    162300
     gccgccggcg ccggcgcggt tctcgacgat gacgggctgg cccagcttgt cggccatgac    162360
     ggcgccgaac aggcgcgcgc tggtgtcggt cgggccgccg ggcgggaagg gcacgaccag    162420
     ggtcacgggc ttggcgggga acgtctcggc ggccgccggc gcggccgggc ccagggccag    162480
     gctggcggtg gcggccagcg ccagcacggc gcgcagcgtc atggtcaaag cgggcgaact    162540
     cgtcatgtct cgtctcctgt gtctcttgtg gcaatgaggc ctcgcatggg ccgatgggct    162600
     tatttcaccg catcggatta aataagtaaa agaacaatat tggataaatt gacaagcatt    162660
     gcttgttaat atgaatgcct gtttcccccc cggccggccg accatgaact tctcctttcg    162720
     ccagatgcgc gcctttctcg cggtggcgcg ccatgccagt ttcaccaagg cggccgaaca    162780
     gctgcacatc tcgcaggccg ggctgagcgc catggtgcgc gacctggaaa cgcagctggg    162840
     cagccggctg ttcgagcgca ccacgcgcgc ggtccgcctg acgccggcgg gccagagcct    162900
     gctgccggtg gcgcagcgcg cggtgcagga cctgggcgcg gcggtggcgc aactgggggc    162960
     cctgggcgcc ggcggacgcg accgcctgcg catcggcgtg acgccgttga tcgcctgcag    163020
     cgtgatcccg gatgtgctca agcgtttcca ggcgctggcg ccgcaggtgc gcgtggaagt    163080
     gatggacctg gatcgcagcc tgatcgccgc ccgggtggaa agcggcgacc tggacgccgg    163140
     cttcggcgcc ttcttcacgc gcgcggccgg catacggcgg caaaccgttt tcccggcccg    163200
     gctggcgctg gccgtgccgc gcgtggaggg cgagcggcgc cggtcggtgc gctggcccca    163260
     gatcgaccgc gacgggctga tcgccttgcc cgacgagaat ccgatccagc gcctggtcaa    163320
     ccggcacctg ggcgtgcagg gcgatgcgcc ggcgcgcgtg gtcacgcacc tggaaacggt    163380
     attggccatg gtcgaggcgg ggctgggcca ggccgtggtg ccgtcgttcg ccgcggtggc    163440
     gcgccggcgc tggcgcgtca gcctggtgcc ggtggcgccg cgcgtggcgg tcgattacta    163500
     ctgcatcatg cgggccgggc agggggatgg cgagcgcatc gacgccttcg cgcaatgctt    163560
     cggctcggtg gcggccgaac acatgggcgc cacggccgcg cgctagatgc gggcttgcgc    163620
     cgtgcgccgc gacagcgcct cggcggcttc cttgcgctcg ctgtagcgat cgaccaggta    163680
     cggcgacgcg tcgcgcgtga gcaaggtgaa cttcatcagc tcctcggcca cgtcgaccac    163740
     ccggtcatag taaggcgaag gctgcatgcg tcccgcctcg tcgaactcct ggtaggcctt    163800
     ggccaccgac gattggttcg ggatggtcag catgcgcatc cagcggccca gcacccgcat    163860
     ctggttcacg gcgttgaatg actgggatcc ccccgatacc tgcatgaccg ccagcgtctt    163920
     gccctgggtc gggcgcaccg cgcccatcga cagcgggatc cagtcgatct gcgtcttcat    163980
     caggccgctc atggcgccgt gccgctccgg cgaactccag atcatgcctt cggcccaccg    164040
     gaccagctca tgcagctcac ggaccttggg atggtcctcg ctggcgtcgt cgaccagcgg    164100
     cagcccggac gggttgaaca gccgggtctc gccgcccagc gcccggagca gccgcgcggc    164160
     ttcctccgcg accaggcggc tgtaggagcg ctcgcgcaac gacccataca gcagcaggaa    164220
     gcgcggggca tgcgtggcgc gcccgggcgg gaacagctcg gccgcgctcg gctgcttgaa    164280
     ccgtgacgga tcgatattgg gcagatcggc gagaacctca gacacggttg ccgtccgcat    164340
     cgatgacagg ctgcccgtcc tccttgtcga aggcgccgcg ctggggccgg gacaggagat    164400
     ccagaacggt ttccgacggc cggcacagac gcgttcccag tggggttgtc acgatggggc    164460
     gattgatcag gatcgggtac tggagcatga aatcgatcag ctgctcgtct gtccatttcg    164520
     gatccgacaa accgagctcg tcgtaaggcg tgcccttttg cctgagcagg tcgcgcaccg    164580
     gcatccccat ggcgacgatc aacgaccgca gcgttgcggc gtcgggcggc gtcttcagat    164640
     attcgatgat ggccggctcc tcgccgctgt tgcgaatcag cccgagcaca ttgcgcgatg    164700
     tcgcgcaggc cgggttgtga tagatcgtga tggaagtcat gacacacctc tgttgatgca    164760
     agactagggc ttgattgggt cgggccgcgc gcgcagcacg agcagcgcgg cgcaggccgc    164820
     caggcctatg cccccggata gccacaaagc gttggcgcgc caggcgtcca gcgccaggcc    164880
     gaagagaaac ggcgccagcg cctgcgcgac ccgcgccggc atcatcagcc agccttggcg    164940
     cgcgccatag ccccgggggc cgaacagcgc cagcggcaac gtgcctttgg cgatggtcag    165000
     gatgccgttg cccgccccat gcaggatggc gaacagcggg gccagcgccg ggccggcggc    165060
     caacagcacg gcaacgccgg ccggatgcgc cagggccgcc aggcgcgccg acagcaaagg    165120
     atgaacatgc cgcagcaagc cgaactcgag caggcggccg gccacttgcg cgggaccgat    165180
     gagcgcgccc acggccacgg cggccgcgag cgtggcgccc gtggcttgca gcatgcgcgg    165240
     caagtgggtg gccatcgcgg tgctgatgaa ccacgtcgcc gcgaacacga aggcgagcag    165300
     ggcggtggcc agcccctgcg gtcccggccg cgcagcaggg agggtcccct cctgcgcggc    165360
     cggggcatcc gggcttggcg tctcggcggc aacggctttg ggaagccagg cgttcaacgg    165420
     caggccgatc atcaaatgca aggccgccca gcccaggcat gcgccgcgcc agccgaacag    165480
     cgtctccatc caagcggaaa gcggccagcc aacggtgctg gcgaaaccgg cgatcagcgt    165540
     gattccggtg atggccccgc gggcgtgatg gccataaagg cgtaccaggc tggagaaggc    165600
     ggcctcgtag aggccggcgc ccatcgccac gcccatgacg agccaggcgg caaccattgt    165660
     ccacaggccc tgggcggcgc cgagcatgcc cagcccgagg gcaaacaaca gactggtgcc    165720
     ggccaggacc atacggccgc cgtggcggtc gatcgccagt cccgtccatg gcccgatcaa    165780
     cgccgatgcg accagggcgg cggagaactc cgcatagacc gtcggcgtgg acacgcccag    165840
     gtcgcgagcc atcggatccg ccagcatcgc cggcagatag tacgaggagg cccaggccag    165900
     cgtctgggcg gttcccagga tcccgacgac gcgaaccggt gcgcctggca tggatcaggc    165960
     ccgcctggcg ccggcgtcgc aaccggctgt gttctttcgg gaatcggaca cctcgcaggt    166020
     cgcgccctgg cagcagtgtt cggtgagata gccgagcaat gcattcatcc ggaagaaatc    166080
     ggcgcggtag atcagattgc ggccctgttg ctcgacgctg accaggccgg cgtgcgccag    166140
     ctccttgagg tgaaaggaca gcgcattgcg ggcgatgccg agcccgtcgg ccatgacgct    166200
     gggcgtgagc cccgccgggc ccgcgacgac aagggcgcga aacacgctca ggcgttgcgc    166260
     atgggccagg gcgccgaggg aggaaacggc ttgttctgca ttcatgccga aataatacaa    166320
     tgattcttga atcattgaat agtcatgatg ggctgcgccg aattgccggc ccgggggggc    166380
     aggtgggcgg gcgaacggcc tggcggccgc gccgtggatc gggaatcctt gtcgcagcat    166440
     aagaaatcct tgcttgtcgc tcgcggggtt cgccggtgta attcgtcggg gcaggcattg    166500
     ccgaatccgg ccccaacgca gacgcgcaca gggcagctca atcgaggaag aaatgcacga    166560
     cgaacaggca cttgatcttg tcatccgcgg cggattgctc atggacgggc atggcggcgc    166620
     gccccgggtc gccgacatcg gggtgcgcgg cgccctgatc gccgagatcg gcgacatcgc    166680
     gccgggcgcg gccgccgaga tcgacgcgcg cggcaagatc gtcacgccag gcttcgtcga    166740
     catccatacg cactacgacg ggcagatcat ctggaattcc cgcctggctc catccagctg    166800
     gcacggcgtg accacggtgg tgatgggcaa ctgcggggtc gggttcgcgc cggtgcgcgc    166860
     ggccgatcgc ggcaatctga tcgagctgat ggaaggcgtg gaagacatcc ccggcatcgc    166920
     gctgcacgaa gggctggact gggcctggga gacgtttccc gacttcctgc gcgcgaccga    166980
     acggatcgag cacgacatcg atttctgcgc gcaactgccg cacgcggcgc tgcgcgtgta    167040
     cgtcatgggc gagcgcgcgc tgcggctcga gatggccacg cccgaggaca tcgcgcggat    167100
     gcgcagcctg gcggccgagg ccatgcgcca tggcgcgatc ggcttctcga cttcgcgctc    167160
     gatcaatcac cgctcggtca ccggcgaccc gatgccgtcg ctgcgcgcgg ccgaggaaga    167220
     gctgaccggc atcgccatgg ggctggccga tgccggcggc ggcgtgctgg agatcatcat    167280
     cgacttcgac gatccggaca tgctggaggc cgagttcggc atgatgcgcc gcctggtgga    167340
     gaaatccggc cggccgctgt cgttctcgct gatgcagaag cacggcaaca aggacgggtg    167400
     gcgccggctg ctggccctga cggcgcaggc ggcggccgac ggcctgccca tccgcgcgca    167460
     ggtcgcgccg cgcggggtag gcgtgctgct ggggctgcag ggcagccgca atgtcttctc    167520
     tgactgcgcc agctacaagg ccatcgccca gcttgcgctg gatgagcggg tgcgccgcat    167580
     gcgggacccg gccttgcgcg cgcagctgct gcgcgaactg cgcgagagcc aggatacgcc    167640
     gctgggcaag cgcctgaacg agttcgacaa catctttccg ctgggcaacc cgccgtgcta    167700
     cgacccgggc ccggaacgct cgatcgcggc gctggcccgg cgcgccggcg ccgatccggc    167760
     cgagctggcc tacgactgcc tgctcgagga agacggcaag gcgctgctgt tctcgccatt    167820
     cgcgaactat gccgaccaga acctggacgc ctgcgcgcaa atgcttgccg acccgaacac    167880
     ggtcatcggc ctgggcgacg gcggcgcgca cgtggcgctg atctccgacg ccagcttccc    167940
     gaccttcctg ctcaagcatt ggggcggggg agcagggcgg ccggccttcg atctgccgtg    168000
     gctggtcaag cgccagacgg cggacaccgc gcgggccgtc ggcctgcatg accgcggcgt    168060
     gctggaggtc ggcaagaagg cggacatcaa cgtcatcgac cccgcgacga tagatcccgg    168120
     cgtgcccgtc atgaacatgg acctgccggc cggcaagggc cgctacctgc aaaagcccag    168180
     cggctacgtg gcgaccatcg tgtccggcgt ggtggtctac cgcgacgccg cggccaccgg    168240
     cgcgctgccg ggcaggctgg tgcgcatggc ggccgagccc gcggccgcct gatcgcgccg    168300
     tcacagcgcg gccggcgacg gcccacgaac aataaacaag gaggagaaga ccatgatgaa    168360
     aggcatctgt gcagcgtttg cgttcgccgc gcttgcggct tcctggcagg gcccggccca    168420
     ggccgcgttt cccgaccagc ccatcaagct ggtggtgccc ttcgcgccgg gcgccacgat    168480
     cggcccgctc gcgcagctgg tgtccgagca actgtccagc gacctgggca cgccggtgta    168540
     caccgagttc aagaccggcg ccggcggcaa catcggcgcc gatatcgtgg ccaagtcgcc    168600
     gggcgacggc tatacgctgc tgctgggcac gatcagcatc ctgaccatca acccgtcgct    168660
     gtacccggac ttgccgttcg atccggtcaa ggacttcaag ccggtgtcga tgctggtcac    168720
     cacgcagaac atcctggtcg tcaaccccga gagcaagatc caatcggtgg cggatctggc    168780
     cgactatgcc aggcaacatc ctggccaggc caccttcggc tcgtccggca ccggcagcac    168840
     catgcacctg gcgggcgaac tgttcagcac cacggcgcag gtcaagatga cgcacgtccc    168900
     gtaccgcggc ggcggaccgg ccaggtcgga cctgctgggc gggcggctga cgctgatgtt    168960
     cagcgacctg agcgcggtcc ccatggtgca ggccggcaag ctgcgcgcgc tggccgtgac    169020
     cgggtcgcag cgcgacggcc gcatccccga tatcccgacc atgcaggaaa gcggcatgaa    169080
     aggcttcgat gtcgaaccct ggtatggcct ggtggcgccc gcgggcacgc ccgacgcggt    169140
     catcgccagg ctcaacgcca gcgtgcgcaa ggtgttcgac aagcagcagg tgcgcgacgc    169200
     gctgcagaac atcggcctgc ggccggccag cgacctgtcg gtggcgtaca tggccggcaa    169260
     gatcgacagc gacctgggca agtgggcgcc catcgtcaaa tcggtcgaca tgaaaaccaa    169320
     ctgatgagcg gcccggcatg aagacgcaag caacagccgg cgatggcgcg gcggtggtgg    169380
     ccatcgcggg cggaatgggc gcgctgggca gggcgctggc gcagcggttc aagcagcgcg    169440
     gcgaccaggt cgtcgtgctg gaccaggcca ccggcgccgc cggcctgccg caggcgggcg    169500
     ccgacctggc cttgctcgac gtcgatctca acgacgtcgc cagcacgcgc catgccttcg    169560
     acacgatcgc gcgccggttc ggccggctcg acgccctggt cagcgtggcc ggcggtttcc    169620
     atcacgaaac gctggccgag ggcaaggtcg aggcctggga ccgcatgtac gcgctcaatc    169680
     tgcgcaccgc tgtggtggcc tgccaggccg cgctgccgct gatgctggcg cgcggcgccg    169740
     ggcatgtcgt gtgcatcggc tcggacgcca tcgggcgcgc gcacgccggg ctcggggcgt    169800
     atgccgcgtc caaggcgggc gtggccgaac tggtcaggac cctggccgcc gaaacccgcg    169860
     accagggcat cgcggccaac gcggtgctgc ccggcaccct ggataccccg ggcaatcggc    169920
     gcgccatgcc cgatgccgat ttttcccgct gggtgtcgct cgacgcggcg gcggcgctga    169980
     tcctgttcct ggcctcgccg ctggccgccc agatcaacgg cgcctgcatt ccgatcgtga    170040
     accgctgcta gagcgctatg cggcggcgct gcagtgggcc gccagcagcc tggagaatac    170100
     gtggatggac gaggaggccg gattggacgc gtcgctcgtg caatagaaat cgaccgccgg    170160
     cgcgccctgc ggcagcgcaa tctggccgac cgtgtcgcga tcgtagaaat ccgccaggaa    170220
     agtgggcacg aaacccatcc ccatgccggc gctgatcaag gacgccaccg tggccacgtg    170280
     gcagacctcc tggcggcgca gggcatgcgc gccgacctcc agcaggtacc ggtcgacgac    170340
     ctgctggacc gcgttggagt ccggcagcgc ccacagcaca atgtcgtgct ggcgcgccca    170400
     gtcttccacc cccgcgatct ccaggcccgg cgggatcagc ctgccgggac cggccagccg    170460
     cagcgccatg ccgaagatgt actcgctctt gagccgcgag gcgcggcgca tataggtgcc    170520
     gtaggtcgcg tcgagcctgc cggtctccac catgtcgtgc agcacttcca gttcggcgtc    170580
     cacgacctcg cacgaacggc ccgtgcattg ctggaactcg cgcatcacgg ccggcagcac    170640
     cgtgctggcg atcaagggcg acaccccgac gcggatcccg ccttgctggc ggcggttcag    170700
     cgcggacagc tccagcatgc ccttgttgag gctttcgacg gcctggcggg catagggcag    170760
     gaactgcgtg ccggcctggg tgagggcggt cgcgcggttc gaacgctcga acagccggat    170820
     tccgacctgc gtctccagtt cgttgatcat ggagctcagg cccgcctggg tgacgtgcag    170880
     ggtttcggcc gcgcgcgtga agctgcggac ctcggcgacc agcaggaagg cttggagctg    170940
     gcgggtggat actctcatgt cggttgggcc catgcttgtc ggccccgtct tttatcatgg    171000
     cgtcgatgcc gccggccagc caagcctggg aaggacgcgg tgtcggtcgg attcaacatt    171060
     ccaacaggag cagcccgcct tgtctctcta ttaccggatc agtttcgtcc tgagcgtgct    171120
     ggcgctcgcg gcctgggcga tcgccgtcac gctctacaag gcgccgcgtt acggcgacgg    171180
     ctacgggccg gacccgctcg gggtcttgct tttcctggcg ctgtggccgg tgggcctgct    171240
     gctggcgcat tccggtctgc tggcgtgcct ggtgcgcggc cagcggcccg cgtcgatcct    171300
     gcaaggccgg tacggggtcg ccatccatct ggcgctgggc gcgggtttcc tggcttacgc    171360
     gctgtacagg gtctagccgg gcctgatggc tggccagggc gggcagcgaa gcggcatgca    171420
     tgcgggcaac agtcgatccg ccggcgcgcc catctcgtac tttacataat atacattatg    171480
     cgaattattg aaaggctagt ccgggcgcgc aagcgccctg gacccggcct gcgcgctcag    171540
     gtttccagcc gcacatgctc gatgcggtgc cgtccgttct tcttggccgc atagagctgc    171600
     tgatccacgg ccttgatgaa gccggccggc gccgtctgcc cgccgggcac caccgtgccg    171660
     gctccgatgc tgaccgtgac gcgccgaccg tgcggcgaca gcgcgtgcac gatggacttc    171720
     ttctcgatca atcgctggca gcgctcggcg accttgcggg ccacctcggc gtcggcttcg    171780
     ggcagcagca cgacaaactc ctcgccgccg tagcgcgcca cgagatcgcg cggaccgtcc    171840
     agcgccaggc tcagcgtctg ggcgatctcc accaggcatt cgtcgccctg ggtgtggcca    171900
     tacaagtcgt tgtattgctt gaaataatcg acgtcgaaca acagcatgga cagcggctgg    171960
     cgttcgtggc gcgcccgctc ccactccagg tcgaaactgc tgtcgaagcg gcgccggttg    172020
     gcgatgttcg tcaagccatc cttgaaggac agcacttcca gctccttttg cagcagcagc    172080
     agcttttctt ccgtcttctt gcgttcggtg atgtcgaaca tgaagccgat cagcgcctct    172140
     gcctcgccct tgtcgttgcg caccacgtgc accacgtcgc gtatccacac atagccgttg    172200
     tccttggtca gcgcccggta gtccgcttca tggtcctggc cggcctggga ttgggatacg    172260
     cagtaattca ccacgtattc gcggtcctcg ggatgcatgc gcatggccca gtcctcgacg    172320
     cttacccagc tgtcggcgct ccagcccagc aaggcctcga tctgggggcc gatataggtg    172380
     aatttcatcg tggcccagtc gatcttccag ggaatcgcct tggtcgactc gagcaaggtt    172440
     cggtacaccg cgctgtcgtt gaacagcgtg cttgcgtcag gcatatccag cccttttcga    172500
     tacatattga tacgctactg tagcccgaag acggcggttg cgaaagagaa ttgaacgatc    172560
     ggttagcatg ctgacgtggt ggttgaattc atgcataatc ggtgcgcgtt ccctgcgagt    172620
     ctttcgtgcc gccatggatc ggatggcgcc ctggaatgca tcaggcttga ccgataacca    172680
     taacgccagc caaggagaca aaccatgcgg ggtcgatacg aattcctggc ccaggaccgg    172740
     gtcatctatg gcgagccggc cgccgccgcc gtgctcgata tggcgacgca gatgggcgcc    172800
     aaccgggtgt tcctcgtcag cagcgccacc ctcagccgca agaccgacga gatcgaggcc    172860
     atcaaggctg ccctgggcgg gcgctactgc ggcattttcg acgaatgcgt ggcccatgtg    172920
     ccgcgcgaca gcgtgctgga ggccgcaggg cgcgtccggc aggcccggcc cgacctcatc    172980
     gtcaccatcg gcggcggcac gccgatcgat acggccaaga tcctgctgat ctgcctggcc    173040
     gaggacatcc gcacggccga cgaactgggc gcctatcgca tccaggtgct cgaggacggc    173100
     agcaagcgca tcccggcggt caaggagccg ccgatccgcc agatcgtggt gccgaccacg    173160
     ctgtcgggcg cggaattcag caatctgggc ggctgctccg acccgctgcg ccaggtaaag    173220
     gacctctata ccggccggct gatcggcgcg caggcggtca tcctggaccc gcgcctgacc    173280
     gtgcatacgc ccgagtggct gtggctgtcg accggcatgc gcgcgatcga ccatgcggtg    173340
     gagacgatct gctcgcgcaa tccgcagccg ttcaccgatg cgacctgcct gcatgggctg    173400
     aaaatgctgt tcgacggact gcgccagacc cggcgcgcgc ccgacgacct ggatgcgcgg    173460
     ctgcagagcc agctgggcgt ctggctggcc tccaccggcc tgggccggat cgaatggggc    173520
     gccagccacg gcatcggcca ccagcttggc gcggtggccg cggtgcccca tgggcatacc    173580
     tcgtgcgtca tgctgcacaa cgtgatgcgc cataacctgt cgcataccgc cgagcggcag    173640
     gcgctgattt ccgccacgct gggccagccc ggcgtgccgg ccgccgacct gatcgaggcg    173700
     ctggcgcgcg agctgggcat gccgacgcgg ctgcgcgacg tgggggtcga gcgggcgcat    173760
     ttcgaggcca tcgccgccgg cggcatgcag aacatgatgg tccgcagcaa tccgcgccct    173820
     atcgcctcgc cggccgatat cgtggcgatc ctcgaacagg cgtattgagg cggcggcgcc    173880
     ggctcccggc cggcgcgcgc gggcacgggc cttgctgacc ggcgggcgtg aaacggaact    173940
     acgcccgcaa aaggagtacg ctggacccaa cgaggcgggc tcgccgcccg ccgtcgtccg    174000
     cccaccgcga tttgggggat acgcgcatgc atgcccgcgt cccgaggctg gtcgccgatt    174060
     tattgcacct attgcgcctg ctgggctgcc tggccgccct gctgctgccg gctgcctggg    174120
     acggcgcgcg cgcggccgac agtgccgccc cggcgccgcg cacggccgtg gtgctgtcgc    174180
     tggacgggat cgtcgggccg gccagcgccg actacgtggc gcgcggcctg gccggcgccg    174240
     ccgcgcagca tgcgctggtc gtgctgcgca tcgacacccc gggcggactg gatgcgtcga    174300
     tgcgcgagat catccgcgcc atcctggcct cgcccgtgcc ggtgctggcc tatgtggcgc    174360
     cgggcggcgc ccgggcggcc agcgcgggga cctacatcct gtacgcaagc catgtggcgg    174420
     ccatggcgcc ggccaccaac ctgggcgcgg ccaccccggt gtcgctgggc ggcggcttca    174480
     cgccatcgga cgacaagaca gagcccgaca agacggacgc caaggcgccg gccgatggcg    174540
     gcaagccggc cacgccgcgc aatgccgccg aatacaaggc catcaacgac gcggtggcct    174600
     atatccgcgc gctggccgat ctgcgcggcc gcaacgccga ctgggccgag caggcggtgc    174660
     gcgaggcggc gtctctgtcg gccagccagg cgctggcgcg caatgtgatc gatatcgtgg    174720
     ccgaggacac ccccgccctc ctcgcccagg ccgacggccg cacggtgcgc gtgggcgcgg    174780
     ccaatgtcgt gctgcacacc agcggcctgg cgctggtcga gcgcgggccc gactggcgta    174840
     cgcgcctgct gggcgtgatc accaatccca atctggcgct gatcctgctg atggtgggcg    174900
     tgtacgggct gatcttcgaa ttcatgagcc ccggcgcgct gtttccgggc gtgctcggcg    174960
     ccatctgcct gttgctgggc ctgtatgcct tgtcggtgct gccgctgagc tacgccggcg    175020
     cgggcctggt cgcgctgggc gcggcgttga tggtggcgga gatcttcaca ccctcgcttg    175080
     gcgcgctggg cgtgggcggc gcgctgtcgt tcgtgctggg cgcgaccatg ctggtcgacg    175140
     cggatacgcc cgcctacgcg gtgtcgctgc cgctggtggg cggcgtggcg gtggccagcc    175200
     tggggctgac tttcctgatc gcgcggctgg cgctgcgctc gcgccgcgcg ccacaggtca    175260
     gcggcgcgca gggcctggtc ggccggcgcg gccgcgtcct gagctgggag cacgatcagg    175320
     gttacgtcgc ggccgacggc gaacgctggc gcgcgcgcgg cccggccggc ctggccgccg    175380
     gcgacgccgt gacgatccac gccgtgcagg gcgtgacgct gcatgtggcg ccggagccgc    175440
     cggcgccgca agcgccctcc cgcccgtgac ccgcgggcgg cccgactacc ctttccttcc    175500
     ggagtgcgcc atgttcatga acctcgcttt ctacctcccc atcctcgtgc tgttgctggc    175560
     cctgatcgca ctggccgtgc gcatcctgcg cgagtacgag cgcggcgtga tcttcacgct    175620
     ggggcgcttc acgggcgtca aggggcccgg cctgatcctg atcatcccgg tggtgcagca    175680
     gatggtgcgg gtcgaccagc gcacgtccgt cttcgacgtt cccagccagg acgtgatctc    175740
     gcgcgacaac gtgtcggtca aggtcaacgc ggtgatctat ttccgggtga tcgatccgga    175800
     gcgctcggtg atccaggtgg agaacttccg ccaggccacc agcgagctgg cccagaccac    175860
     gctgcgctcg gtgctgggca agcacgacct ggacgaaatg ctgtccgagc gcgacaagct    175920
     gaatatcgac atccaggaga tcctcgacgc gcagaccgat gcctggggca tcaaggtcgc    175980
     caatgtggaa atcaagcata tcgacctgaa cgaaagcatg gtgcgcgtga tcgcgcgcca    176040
     ggccgaggcc gaacgcgagc ggcgcgccaa ggtcatcaac gccgagggcg aggagcaggc    176100
     cgcgcagaag ctgctggatg ccgcgcgcac gctggcgcag cagcccgagg cgatgcagtt    176160
     gcgctatctg agcacgctgg ccgtgatcgg cgcgcagaac aattccaccg tggtgttccc    176220
     cttccccacc gacctggccg gcgcgctggg gcgctgggcg cagaaacaat aaggccgcgc    176280
     ttcagttgcg gggccggcgc agaaacagat agcggtgccg gaattcgtcc ggcaccgtat    176340
     gcgtgcaacc gtgcacgccg tcgatggcgg gcacatgcgg ttcgaacagc gcatggccgt    176400
     cggtgtcttc gacacggaac gggacgcgtt ccggggtgtc gttgtagccc agcaccagca    176460
     ggccgcccgg cgccagcacg ccgtgggcct gggccagcag ccggtcgcag tctccgcggg    176520
     tatcgatgcc gaagccgagc aggccgttgg caatgacgaa atcgaacatg gcggaccgat    176580
     agtggcgatc cagctccagc gccgagccca cgacgtgcag cccgggctgg ccgtagaccg    176640
     catgggccgg gtcgcaatcg atggaatgga acgccgggct gagcagcctg gggtaatgcc    176700
     agttgtgctt gtccacgccg atgaacaggc aagcggccgg atgagccagg ctggcggcgc    176760
     gggcgttgat gtacgagaag acttcggctt cgaggaactg gcggctcggc gcctgcagcg    176820
     tgaacgccac gcccctcctg gccgcccatg ccggcgaaat gcgaaacaac aagcgtttgg    176880
     ccgcgtagcg gcctttcttc aaccatccaa gcatggcgcc ccctcgtcga cggccaggac    176940
     cccgcgcccc ggcacgcacg cattctgcgt gccgcaagcc gggcaggaaa ccggaggcgt    177000
     ctgaaacgga tgcgggcgcg ggccgcgatc aagcggccgg acaaggccgc ccgggcctac    177060
     agcatgtggg cgaggaattc gcgcgtgcgg ggatgctgcg gcgcgtcgaa gaagcggtcg    177120
     gacgcggctt cctcgaggat gcggccttcg tccatgaaga ccacgcggtg cgcggcctcg    177180
     cgggcgaagc ccatctcgtg ggtgacgacc agcatggtca tgtgctcgtc ggccagctgg    177240
     cgcatggtgc gcagcacttc gcccgtgagc tcggggtcga gcgccgaggt gggctcgtcg    177300
     aacagcatga tgtccggctc catggccagc gcgcgggcga tggccacgcg ctgcttctgg    177360
     ccgcccgaga gccggccggg gtagttgtcg cgcttggcca gcaggccgac cttgcgcagc    177420
     agttcttcgg ccttggggat cacggcgtcg cggcgcaggc ccttgaccgt gaccggcgcc    177480
     tcgatcacgt tctgcagcac cgtcatgtgc ggaaacaggt tgaacgactg gaacaccatg    177540
     cccatcttgc ggcagaggcg gcgcacgtcg gcatcggcgg cgtactggct cttgccgccg    177600
     ggcacggcgc gcgccagcgc ctcgccttcg acctcgatgc tgccttcgtc gatgatttcg    177660
     aggtgattga ggcagcgcag gaaggtgctc ttgcccgagc cggacggccc gatcaccgcc    177720
     accacctcgc ccttgcgcag cgtcagcgat acgccgtcga gcacgcgcag gccatggaac    177780
     gccttgacga tgccccgggc gtctatcatg gccgcgcgct cgccgggccc cggcttactg    177840
     gtcgtatttg gcatagcgct tttccatgtg ttgaaagaac caggtgagga tcagcgtcat    177900
     gatcaggtag aaggcggcgg cgaccaggaa cggcgtggtg gtgaagtcgc gctgcacgat    177960
     gccgcgcgcg gtgcgcagga tgtcgttgag cgccagtacg tagatgagcg aggtgtcctt    178020
     gaccagggtg atggtttcgt tgctcatggg cggcagcacg cgctgcacca tctgcggcag    178080
     gacgatgcgc cgcatggtct gcaggtaggt catgcccagc accttgctgc cctcgtactg    178140
     gccgcgatcc accgactgga tgccggcgcg gaagatctcg gcgaaatacg ccgcgtagtt    178200
     gagcgcgaag gcgaccaccg ccgccgggaa atccggcagg cggatgccga ccaccggcac    178260
     gaacggcagc gcgaagtaga tgaacagcag ctgcagcatc agcggcgtgc cgcgcatcag    178320
     ccagatatag ccgttgacca ggcgcgacag caggcgccag cgcgagatgc gcgccagcgc    178380
     cagcaccagg cccagcggca ccgccagggc cagcgtgatg aagaacagcg tgagggtgac    178440
     ctgggcgcct tgcgccatcg gccccaggag ggaaattacg tagtccatgc caggggttcc    178500
     caccgcctgc gacgacctgc gggaaagagg attggccggg ccctgcccgt ccgcgccggg    178560
     gcgcggacgg gggcggggcc gtttacttga tgatgttggc gccgaaccac tgggtggcga    178620
     tgcggccggc cgtgccgtct tccttcatcg acgccagggt cttgtccagc ttggcgagca    178680
     gctcggtatc gtccttgcgc acgcccacgc cgtagtcctc ggtgccgaag ttctcttcca    178740
     ggacgcggta ctgcccttcg cgcttgctgg ccaggtagcg gcccaccact tcgtcgacca    178800
     cgatggcgtc caggcggccg gccgccaggt ccatcagggc ggtgacgttg tcggcgaagg    178860
     tcttgatttc cttcaggctg gcggccacgg gggcgtcttt cttgatggcg tcgacggcgc    178920
     tgctgccttc ctgggcgccg accaccttgc cggccaggtc ggccttggtc ttgatgggcg    178980
     aggcgctgcc cacgatgatg atctggtggt tggccatgta gggcgcggtg aagctgatgt    179040
     tcttcttgcg ctcttcggtg atggtcaggc cgttccacag cacgtcgacg cgcttgccgt    179100
     tgagttcggc ttccttggcg ctccagtcga tcggcttgaa ttcgacctgc atgcccaggc    179160
     ggcggctggc ttccttggcc atgtcgatgt cgaagccgac cagttcgttc ttctcgtcgc    179220
     gaaagcccat cggcgggaag ttgtcgtcca ggccgaccac gaccttccgg gacgccgccg    179280
     gcgcgctggc ggtggacgag gcgtcgtcgc cctggccgca ggcggagagc agcgcggtgg    179340
     ccgagaacag caatacagcg gtgattttct tcatggatag tggcgcgatg ggcgcaagaa    179400
     tggacaacgg tgcggcgcag ccccaggctg cggacagcca ttttatcccg ccccggggac    179460
     gggggcgccg ggcgatcaag gccgcaattg tagccatacc ggggcgccgc ggcccgctat    179520
     cgggaccggc ggggacatcg aaccggccta tttccgccgg cggcttgccg tgccgcaaca    179580
     ttgatttatg tcattgaccc ccatgaccgg cctttgatac aacgatggca ttggcacgtt    179640
     ggcgcaatat caaccagcag aaaggtgacg cgtggcgaac gatccaagca cctacaccaa    179700
     gcgccaggag ctcaacagtt tcctgctgct tgcggcggtg atggcccctg tgatcacagg    179760
     catcatcatc gtgacctacg gcttcgccgt atggttctac cagctgcttg ccggccctcc    179820
     cggcagctga tggcgcagcc ccccatgtca gcgcttccct cccgcgcact cgccccgccg    179880
     ccggtggccg agctgcatat caccagcatg gtcgtgcacg ccctgcccgg gcgcgcgcag    179940
     gcgctgggcg cggccatcgc cgccctgccc ggcgcggaaa tccatgcggt gtccgatacc    180000
     ggcaagctgg tcgtcacgct cgaagcccac agcacaggcg aaatgctgga gcgcatcgcc    180060
     gccgtgcagg gccaggacgg cgtgctcgct tcggcgatgg tctatcaaca tatcgatact    180120
     ttggactcga tgaacgagga gattgacgat gtcaatggct cgtagggatt tcatcaagca    180180
     gaccgccgcc gcggccgccg ccaccgtggc cggggtgccg ttgacggggt atacccagaa    180240
     catcgtgacc gagtccgagg ccgccaagct caagtggtcc aaggcgccct gtagattctg    180300
     cggcaccggc tgcggcgtga acgtggccgt caaggacaac caggtggtgg ccacgcacgg    180360
     cgacttcaac gccgaggtca acaagggcct gaactgcgtc aagggttatt tcctgtccaa    180420
     gatcatgtac ggcagcgatc gcctgacgca gccgctgttg cgcatgaagg acggcaagta    180480
     cgccaaggac ggcgagttcg cgcccgtgtc ctgggaccag gccttcgacg tgatggccga    180540
     gcagttcaag cgggtgctca aggacaaggg gccggaagcg gtcgggatgt tcggctcggg    180600
     ccagtggacc gtgtgggaag gctacgccgc gctcaagctg atgaaggcgg gctttcgcac    180660
     caacaacctc gaccccaacg cgcgccactg catggcctcg gccgcggtgg gtttcatgcg    180720
     caccttcggc gccgacgagc cgatgggctg ttacgacgat atcgaaaacg ccgacgcgtt    180780
     cgtgctgtgg ggctcgaaca tggcggagat gcaccccatc ctgtggacgc gcgtcaccga    180840
     ccggcgcctg agcgcgccgg ccaccaaggt ggcggtgctg tcgaccttcg agcaccgctc    180900
     gtacgagctg gccgacctga cgctgacgtt cgagccgcaa agcgacctgg cgatcctcaa    180960
     ctacatcgcc aaccacatca tccggaccaa gcgcgtcaac cgcgacttcg tcgacaagca    181020
     cacggtgttc cgcgagggca acgccgatat cggctatggc ctgcgccccg agcacccgct    181080
     gcagcaggcg gccaggaacg ccggcgacgc gggcggctcc aagccgatca ccttcgacga    181140
     cttcgcgcgc ttcgtctcca agtacgacct ggaatacacc gccaagctga gcggcgtgcc    181200
     caagaaccgc ctggaggagc tggccgagct gtacgccgac ccgaaggtgc gcgtcacctc    181260
     gttctggacc atgggtttca accagcacac gcgcggcgtg tggtgcaaca acatggtcta    181320
     caacatccat ttgctgaccg gcaagatctc caccccgggc aacagcccgt tctcgctgac    181380
     cggccagccc tcggcctgcg gcaccgcgcg cgaggtgggc accttctcgc accgcctgcc    181440
     ggccgacctg gtggtcacca accccgagca ccgccgccac gccgaggaga tctggaagct    181500
     gcccgacggc acgattccgt ccaaggtggg cgcgcacgcc gtgctgcaga accgcatgct    181560
     caaggacggc aagatcaacg cctactgggt gatggtcaac aacaatatgc aggccgccgc    181620
     caacctgatg aacgagggcc tgcccggcta ccgcaacccc gagaacttca tcgtggtgtc    181680
     cgacgcctac ccgacggtca ccaccctgtc ggccgacctg atcctgccgg cggccatgtg    181740
     ggtggagaag gaaggcgcct acggcaacgc cgaaaggcgc acccagttct ggcaccagct    181800
     ggtcgacgcc ccgggccagg cgcgctcgga cctgtggcag ctggtggaat tctccaagcg    181860
     cttcaaggtc gaggaagtct ggccggccga cctgctggcc aagaagcccg agtatcgcgg    181920
     caagacgctc tacgacgtgc tgttcgccaa cggcaaggtc aaccagttcc ccaacaccga    181980
     gctggacgcg gagtacgcca accaggaggc gcaggccttc ggcttctacc tgcagaaggg    182040
     cctgttcgag gaatacgccg agttcggccg cggccatggc cacgacctgg cgccgttcga    182100
     cgtctaccac aaggcgcgcg gcctgcgctg gccggtggtc gacggcaagg aaaccctgtg    182160
     gcgctaccgc gaagggtccg atccctacgt caagccgggc acgggtttcc agttctacgg    182220
     caaccccgac ggcaaggcgg tgatcttcgc cctgccctac gagccgccgc ccgaggcgcc    182280
     ggacaaggag taccccttct ggctgtcgac cggccgcgtg ctggagcact ggcactcggg    182340
     ctcgatgacg cggcgcgtgc ccgagctgta caaggccttt ccggaggcgg tctgtttcat    182400
     gcaccccgac gacgcccagg cgctgggcgt gcggcgcggc gtcgaggtcg aggtggtgtc    182460
     gcggcgcggc aggatgcgca cccgcgtgga gacgcgcgga cgcgacaagc cgccgcgcgg    182520
     cctggtgttc gtgccatggt tcgacgccgg ccagctgatc aacaaggtca cgctggacgc    182580
     caccgacccg atctcgttcc agaccgactt caagaaatgc gcggtcaaga tcgtgaaggt    182640
     ctgaccagga cagggagaca gccatgagct tacgcaccgc cgccatcgtc ctgtccgtcg    182700
     cgctgggcgc tgccgcctgg gccgcgccgc ccctgccgct gcaggacccc atgcgcgggc    182760
     ccacgccggt ggccgacgag accaatccgc cgctgatgag cccggtcgag aacaaggata    182820
     tccgccgcgt gcggacctac tccatgcagc cgccgaccat tccgcacaag atcgacggct    182880
     accagatcga caagaatttc aaccgctgcc tggcctgcca tgcgcgcgtg aacaccgagg    182940
     agacgcaggc gccgccgctg agcgtgaccc actacatgga ccgcgacagc aacgtgctgg    183000
     ccgaggtgtc gccgcgccgc tatttctgtg tgcaatgcca cgtgccgcag gccgaagcgc    183060
     gcccgttggt gtccaatacc ttccaggata tcgacgtgat cctcaagcgc ctgacggcgc    183120
     cgaaaccgga ccagaaatga cgggcgggtg ccagccatga gagaactcat caagcgctat    183180
     tgggacatca tccgccgccc cagcgtgcat ttcagcctgg gctttctgac cgtcggcggc    183240
     ttcgtcggcg gcatcctgtt ctggggcgcc ttcaacaccg ccatggagct gaccaacacc    183300
     gagcagttct gtaccggctg ccacgagatg cgcgacaacg tgtatgccga gctcaagggc    183360
     accatccact acaccaaccg ctcgggcgtg cgcgccatct gctcggactg ccacgtgccg    183420
     cacaactgga ccgacaagat cgcccgcaag atgcaggcct ccaaggaagt ctggggcaag    183480
     atcttcggca ccatcaatac gcgcgagaag ttcgtcgaga agcggctgga gctggcccag    183540
     cacgaatggg cgcgcctgaa ggccaacgac tcgctcgagt gccgcaactg ccacaactac    183600
     gaatcgatgg acttcacgcg ccagagcgtg cgcgcgcaga acatgcactc gacctatctg    183660
     gcggacaaga gcaagacctg catcgattgc cacaagggca tcgcccacac gctgccgagg    183720
     atgccgccgg accagacctc gctggcgccg cccgcggcag gcccggcgcg cgaactggcg    183780
     cgcgcggata ccggccatgc aaaacgctga ggccgcgccc gccctgctgg ccgcgcacgg    183840
     cctggtggga cggcgcggcg gccgccggcc gctggacctg aacctgcgcc cggggcagct    183900
     ggtgcatgtg cgcggcgcca acggcagcgg caagaccagc ctgctgcgca cgctggccgg    183960
     actgctgcgg ccgcggcgcg gcgaggtgcg ctggaacggc gccgacatcc atgccgacct    184020
     gcccggctac tacctgcaca tggcgtacct gggccacgac aatggctgca gcgatgcgtt    184080
     gaccgcgcgc gagaacctgc gctacgcgct gcacgtggcc ggcgccccgc gcgccgagcc    184140
     ggaactggag cgggccttgc gggactgggg cctggccgcc ggcgccgacg cgccggccgc    184200
     gcgcctgtcg cagggccagg gccgccggct ggcgctggcg cgcgtgatgc tgtcgcgcaa    184260
     acggctgtgg ctgctcgacg agcccgacgc cggcctggac gccgccagcc tgcagcggct    184320
     gcacggcatg ctggacgcac acctggccgg cggcggcgcg gccgtgctgg cttcgcatcg    184380
     cggcggcggc gcctgggccg gttgtacgca aaccctggaa ctggacgaat acgcgcatgc    184440
     tgaagtcgtt ggcgcagatt gcctggcgtg agctccggct ggcctggcgc aggccggccg    184500
     atacgctggg cgccacgctg tttttcgtgg tggcgggcac gctgtttccc ttggcgctgg    184560
     gtccggatcc gcagctgctg gccgccatcg gcccgggcgt gctgtgggtg tcggccctgc    184620
     tggcgatcct gctttcgctg cagcagccct ttgtccacga ccacggcagc ggcgccctgg    184680
     agcaattgct ggtctcgccc catcccctgc cggtgctggt cggcctgaag ctggcggcgc    184740
     actggctggc cacctgcgcc ccgctgatcc tggccagccc tttcctggcg ctgcagttcg    184800
     ggttgtcggc ccaggcggtc ggcgtgctgg cgctgtcgct gctgctgggt acgcccacgc    184860
     tggccttgat aggcgggctg ggcgcggccc tgacgctggg cctgcgcggc ggcgccctgc    184920
     tgccgctggt ggtgctgccg ctgtacgtgc cggtgctgat cttcggcagc ggcgccgtgg    184980
     ccgccaccgc gtccggcctg ggcgcctggc cgcaattgtc cctgctgggc gcatgcctgt    185040
     gcctggcgat cctgttgtgc ccgtggagcg cctcggcggc gctgcgcgtg gcgttggagt    185100
     aagcccgcca tgtcgaaatc atcggccgcc ctgcccgtgc gcgaccgccc cgccggcggt    185160
     cgcggctggc tgcgctatgc ctcgcccgcc gtcttctacc ccatggccgg ccgctgggcg    185220
     ccgcgcctgg gcgcgctggc cgcgctgctg gcggccgccg gactctacct ggggctggcg    185280
     gtggcgccgg tcgacagcca gcaaggcgag gtctaccgca tcctgttcgt gcacgtggca    185340
     gcggcctgga tgtcgatgtt cctgtacctg gtcatggccg gctatgccgc gctggggctg    185400
     gtctacaaca cgcggctgtc gttcatgatg atgcgggcgc tggcgcccac cggcgcgctc    185460
     tttaccgccg caaccttgtg gaccggggcc ttgtggggca agccgacctg gggcgcctgg    185520
     tgggtctggg acgcgcgcct gacctccgag ctgatcctgc tgtttctcta cctgggcttc    185580
     atggcgctgc aggcggccgc cggcgacacg cggcgcgccg accgaggcgg cgccatcctg    185640
     ctgctggtgg gcgtgatcaa catacccatc atctatttct cggtgacctg gtggaacacc    185700
     ctgcaccagg gcgcctcgat ttcgctgacc gccgcgccca gcatggcgcg catcatggtg    185760
     gcggccaccc tgttgatggt ggcggcgttc tgggcctaca gcgccgccgt ggcgctggcg    185820
     cgcgtgcgcg tcgtcatcgc cggccgcgaa ccggccgccg cggccggcgg ccccttgtcg    185880
     cgggagggct catgagctgg gacgcgctgt tttccctgca ggggcacagc ccctatatcc    185940
     tggccgccta tggcggcgcc gcgctgttga tcgcggtcga actggccgtg ctgtggcgcg    186000
     ccgcgcggcg cccgcccacc ggaggcgacg atggcgacgc gtagaggccg ccgcgcgctg    186060
     ctgatcgccg gcggcgtggg cctgctggcg ctggccgccg cgctggtgct caatgcgctg    186120
     cgttcgaacc tggtgttctt tttcagtccc acgcaggtgc acgcgcacga ggcgccgtcc    186180
     agcggcagct tccgcgtcgg cggcctggtg cgcgccggct cggtcgaacg cgccgccgac    186240
     ggcctgaccc tgcgtttcgt cgtcaccgat acggtgcgcg aggtgccggt agcctatacc    186300
     gggctgctgc cggcgctgtt tcgcgaaggc aagggcgtgg tggtggcggg caacatgggc    186360
     gccgacggcg tgttccgcgc caccgaggtg ctggccaagc acgacgagaa ctacatgccg    186420
     ccgcaggccg ccgacgcact caggcaggcg ggcgccctgc cgagcgccac cttgcagacg    186480
     gaggcgcgat gatcccggaa atcggcctgt tcagcctcat cctggcgttg ctggttgcca    186540
     tcgtgcaggg cgtgctgccg ctggtgggcg catcgaccgg ctggcaggcc ggcctgcggg    186600
     tggcgcggcc ggccgccgtc acccaattct gcctggtcac cgtagccatg ggctgcctgg    186660
     cgtggtcgtt cctggacaac gatttctcgg tgctgtacgt ggcgggcaac tcgcacgccg    186720
     acctgcccgc cgcctaccgc ttcgcggcgc tatggggcgg ccacgaggga tcgctgctgc    186780
     tgtggctgta cctgctgacc gcctggacgc tggcggtggc gctgcacagc cgcgcgctgc    186840
     cgccggcctt cgcggcgcgc gtgctggccg tcatggcctg gatcagcatc ggcttcctgc    186900
     tgttcctgct gttcctgtcc aatccgttcg agcgcctgat gccgccggcg caggccggac    186960
     gcgacttgaa ccccttgctg caggatccgg gcatgatcgt gcatccgccc atgctgtaca    187020
     tgggctatgt gggcttttcg gtggcgttcg ccttcgccat cgccgcgctg ctgtcgggcg    187080
     agctggacgc catctgggcg cgctgggtgc ggccctggac cttgctggcc tggatgttcc    187140
     tgaccatcgg catcctgctg ggcagcgcct gggcctacta cgtcctgggc tggggcggct    187200
     ggtggttctg ggatccggtc gagaacgcct cgttcatgcc gtggctggcc ggcacggcgc    187260
     tgatccattc cctgatcgtc acggagcggc gcggcgcctt ccgcagctgg acggtgctgc    187320
     tggccatcgc ggcgttctcg ctgagcatac tgggtacttt cctggtgcgc tccggcgtgc    187380
     tgacctcggt gcacgccttc gcggtcgatc ccggccgcgg gctgtacatc ctgggcttca    187440
     tgacgctgat cgtgggcggc tcgctggccc tgtacgcctg gcgcgcgccc accgtgggcc    187500
     tgggcggggg cttcgccctg ctgtcgcgcg aatcgctgct gctcagcaac aacgtggtgc    187560
     tggccgcggc caccggcgcg gtgctgctgg gcacgctgta cccggtggcg ctggacgtgc    187620
     tggactgggg caagatctcg atcggcccgc cctacttcga ggcggtgttc gtgccgctga    187680
     tgacgccggc gatcttcctg atgggcgtgg gaccgatggc gcgctggaag cacagcgccg    187740
     tgccggacct ggcgcagcgc ctgcgcattg ccttcggcgt gagcctggcc accgcgctgg    187800
     cggtgccgct ggcctggccc ggcgcgcgcg cctggccagg ctcgccgctg atcgtattgg    187860
     gcctgtggct ggcggcctgg tcggtcgcca gcgccgccgc gcatgcctgg cagcgcctgg    187920
     ccgacggcga aggctcgtgg gcgcggcgcc tgcgccgcca gccgcgcgcc tggtacggca    187980
     tgctgctggc gcacgccggc gtgggcgtgt tcatcgccgg cgtgacgctg gccaatggct    188040
     atgaggacaa gcaggaattg cgcatggaca tcggcgccac gcaggccgcc ggcggctacc    188100
     agttcacctt cgccggtatc gcgccggccg ccggccccaa ctaccaggcc gaacgcgccc    188160
     gcttcgtggt cacgcgcgac ggccggccgg tggtcacgct gcatcccgag aaacgccact    188220
     acacggtgca gggcatgccg ctcagccatg ccgccatcga cacccgcttt acccgtgacc    188280
     tgttcgtggc gctgggcgag ccggtcggcg agcgggcctg gacggtgcgg ctgcaggtca    188340
     agcccttcat ggcctggatc tggtcgggtt gcgtgctgat ggcgctgggc ggcctgatgg    188400
     cggcaaccga ccggcgctac cgccagtggc gcgccgccga agcgcgccaa gcggtggcgg    188460
     cggtggcgcg ggaggccggc tgatgctgcg ctacctgttg ccgctggcgg cctttctggc    188520
     catggccgcg ttcctggcgc tgggcctggg gcgcgacccg cgcgccctgc cctcggccat    188580
     gctggacaag ccggccccgc ccatcggcct gccgctgctg caaggcgacg ggcggcggct    188640
     ggaagtcgcc cagctgcgcg ggcgcgtctg ggtgctcaac gtctgggctt cctggtgcgc    188700
     gccctgccgc gaagagctgc ccttgctgca ggaagtcgga ccgcgcgacg cggtgcccat    188760
     ctacgggctc aactacaagg acaagcccga ggacgcgcgc gcctggctgg cccgccacgg    188820
     caatccgtac gtggcctcgg ccagcgacgt ggacggccgc gtcggcatcg agtacggcgt    188880
     ctatggcgtg ccggaaacct ttgtcatcga cggggccggc cgcatccgct accgccagct    188940
     cggcgtgttg acgccgcaga tctggcgcga gcgcctgctg cccgtcatcg agggcctgcg    189000
     atgaggcgcg cggccgtgct gctggggttg tggctgctgc tgggcgcccc ggcggcggcc    189060
     gatatcgcgc agcgcgagct gcgcctggcg cactcgctgc gctgcctggt ctgccagaac    189120
     cagaccctgg ccgaatccaa cgcgccgctg gcgcacgata tgcgcgccct gatccgccag    189180
     cagctggccg atggccgcag cgacgaggaa gtgatgcagt tcttcgagga ccgctacggc    189240
     gatttcgtgc gctacgagcc gcccttcaag ccggcgacct ggctgctgtg gctggggccg    189300
     ttcgccctgc tgctggccgg cttcgtggtc ctgtggcgcg cgctggcgcg ccgccccggc    189360
     gcggcgccgc tgaccgacgc gcagcgcgcc cgcgccgaac gctttctgga cgaggaatca    189420
     tgaccgcgct gtggctgatc gtgctgctgt tgctgctggc cacgctggcg gcgctgatcc    189480
     tgcccatgct gcgccgcgag cgcgcggccg gcccggccga cgcggcggcc acggtgcgcg    189540
     ccttctacca ggcgcagcgc gcgcagctgc agcgcgaact gcgcgagggc gccttgaccg    189600
     cccaggccca tgcgcgcgcc gaggaagaac tgcagcgcga attgctgcag gccctggacg    189660
     cgcgccgcga caccgcgccc gcgccggcgc ggcgcgccag cctggcggcg gcctgcgcgc    189720
     tgagcgtggc cgtgccggtc gcggccatgc tgctgtacca gcatctgggc gacccgcgcg    189780
     cggccgcctc gatgatgctg gccgcgccgc aggacgccca cgccgaggat gccgcgcagg    189840
     acatgaccca ggccatcggc gcgctggccg agcgcctgcg ccgccagccc gacgacgccg    189900
     agggctggta catgctggcg cgctcgtacg agacgctggg gcgctatgac gacgcggtcg    189960
     ccgcctatat ggaaaccgtg cgcctggtgc cggaccagcc ggcgctgctg gccgacctgg    190020
     ccgacgcctt gctgtcggcc aatggcggcg cgcccgacgc caagtccgag cgcgtcatcg    190080
     cccaggcgct ggccttgcag cccgaccagc ccaaggcgct ggcgttggca ggcatggcgg    190140
     ccttgcggcg cggcgacgcg gcgcaggccc tggcgcactg gcagcgcctc aagacgctgc    190200
     tgccgcccga ttcgccggcc gccgcgcaga tcgacaacaa catcgcgcag gcgcgcgcca    190260
     tggccacggg cgcgccgccc gcgcccgcgc cgcaggcggc ggcgccggac agcctggccg    190320
     gccatgcgtc gatcgccgcg gcgctgcgcg cgcaggtggc cgataccgat accgtgttca    190380
     tcctggcgcg cccggccggc ggcgggcgca tgccgctggc catcctgcgc aagcaggtac    190440
     gcgagctgcc gctggacttc accctcgacc gcgcccaggc catgtcgccg gcggccacgc    190500
     tggcccaggc gagcacggtg gacgtggaaa tccgcgtgag ccgcgccggc gccgccgagg    190560
     cccggcctgg cgacctggtc ggcgtgctgc gcggcgtggc ggtgggcagc cgcggcctgc    190620
     gattggtggc cgacacggtg gtgcgctgac gcgcgcttgc gccatcgccg cccagcccat    190680
     acagtggcgg ggccggcgcc tgccgccctg tccgaggaat agccgccatg ccgtcttgcc    190740
     gtccacgcct tgccctggcc tgcctggccg tcctgctggc cgttcctgcc gcgcctgtgc    190800
     tggccgcgcc atcgggcgcc gcgccctgcc cgcccgccgc acaggccgtc agcgcgccgc    190860
     tgccgggcgg cggcgcggtc gtcgtcagca acggcgcctg cgagccggct tcgatcggct    190920
     cgtacgtcgt caaccgctac gacgacctgg acgccggcgc ctttcgcgcc gggctggcca    190980
     tcgcgcgcga cggcgtgctg gtggaatggg cgctggacga acgccagggc aagcgcgtgc    191040
     tgcggctggt cagcgaaacc gccggttcgg gcgcgtaccg caacacgcaa tacatcgaac    191100
     tgaccggcga cggcgggctg cgcctgctcg acaggccgta aggcaaagca ttgcgccgcc    191160
     cgggcgctga acggcgcgtc ggcttgccct gccgcgccat cgccccgaga atggctgctt    191220
     cggacttttt catgctttgc agaaggaaac ccacatgtct gccatcaccc gcattgccag    191280
     ccccctgccc ctgccctttt cgcgcgcgac catcgccggc ggcttcctgt tcctgtccgg    191340
     ccagatcccg atggacgcca acggccaggt agtgcgcggc gatatccgcg cccagaccga    191400
     cgccgccatc gcccgcatac gcgaaacgct ggcgctggcc ggcgccggtc tgcaggacgt    191460
     ggtgaaggtg acggtgtggc tgtccgatct ggcgctgttc gccgatttca acgacgccta    191520
     caaacagcac ttccaggacg gcttcccgtg ccgcagcacc gtcgaagcca agctggccat    191580
     ggaagtggac gtggagatcg aggtccaggc ctggatcggc gacaagacgc cgcgcggcgg    191640
     cgcgagctac acgccggggc ccgtgtcgga agcctaagcc tgcttcccgc gtgcctgtcc    191700
     ccgcatgggg actggcacgc gctgaatccc gggtgcctgt ccccgcgggg acaggcacac    191760
     tgccgtacgc catgaacgct agcctgccaa gacggacggt atctgtcccc gcagggacag    191820
     ccagcgccgg cgacgggcta cttccacgcc tcctcgcgct gcttgaccag cgcggtaagg    191880
     gtctggttga ccggggcctg gatgccggcg cgggccgcct gcctggggat ggcgccgttg    191940
     atgtagtcga tttcgctgac gcgccgctgt tcgtggtcca gcatgaccga cggcttggcg    192000
     ccgcggatgc gttcgccgaa tgcgcgcaca tgcgcaaccg ggtcttccac ggcgaccggc    192060
     acgcccagcg cgcgcgcgac gttccaggct tcggtggcgg cggcctggct gaccgcgctg    192120
     gcatgcggag catccagcac ttcgccgatg gtcaggccgg tcagcgtgca cggcgcgctg    192180
     taggcgacgt tgcagatcag cttttcccat tgcatggccg gcaggttgtc gaccgcctgc    192240
     gcgttgaagc ccgcgccgcg ccacacttcg gcgatgccat ccagcttctc ggcgccgagg    192300
     ccggcgtagg cgcccatgcg caccgccgac atgccgttgt ggtggacatg gcccggaccg    192360
     ctcagcgagg cgccgaaggc cgccgcgatg cccacggcca ggcgctcggc gccgatggcc    192420
     tcggccacgc tgtcggcgct gcccaggccg ttctggatgg tcagcaccag ggtgtcggga    192480
     ccgagcatgg cgcgcgcctg cgccgcggcg ctgccggcct gggccgcctt gaccgcgata    192540
     atgatcaggt ccacgggttc ggccggggcc tcccggtagg ctcgcaggcg cgccacgcgg    192600
     tcgccgctgg cgccttcgac gcgcaggccc tgttcggaca tggcctggac gtgttcggcc    192660
     cagcggtcga cggcgatgac ctcatggccg ttggccgcca gcaggccggc gtacaccgag    192720
     cccatcgcac cgcatcccat aattgcaatc ttcatgattt cttccttacg ccttgccgtg    192780
     cgccagtacg gagatgtacg gcgccaattc ttgtttctgt tccagcccga agcccggcgc    192840
     gtcggtcggc cgcacctggc ctgcgcccaa tgcgcacgcc gcggggtagc cgccgaaggg    192900
     ctggaacacg cccggatagg cctcgcagcc gcccagcccc aatccggcgg cgatgtgcag    192960
     gttgatcagg tggccgccat gcgggtgcag gcaggagcgc ccgaagccgg ccgcctcgac    193020
     cgccgccatc atgcgcaggt actcggtcaa gccgtacgac agccccgggt ccatctgcag    193080
     gatatcgcgg ccgggccgca cgccggcgaa atgcagcagg ttcctgacgt cgggcagcga    193140
     gaacaggttc tcgccggtgg cgatggtgcc cgcgtaggcc tgcgccacca ggctgttcag    193200
     gtggtaatcg agcgggtcgc cgatttcctc gtaccagcgc aagccatagg gctcgagcgc    193260
     gcgcgcatag gccagcgcgg tatccaggtc gaagcgtccg ttggcgtcga ccgccaggtt    193320
     ggcgccctcg cccgccacgc cgagcgcggc ctcgatgcgg gccaggtcgt cggccagcga    193380
     ggcgccgccg atcttcatct tgaacttgac gaagccctgg tcgagatagc cgcggaactc    193440
     gtcgcgcagc cgctgcagcg gatcgccgct gtcgtagtag tagccgccgg ccgcatagac    193500
     ctgggtggcg ccggcttgcg ccggccgtcc gacgtggcgc gcgatggtgc aataggcggg    193560
     ctcgtcgcgc agcttggcgt tcaggtccca gaacgccagt tccagcgcgc ccacggccgc    193620
     cgcccggtcg ccgtgcccgc ccggtttctc gttgcgcagc atgatggcgc tggcgcgcgc    193680
     cgggtcgaac gcctgcccgc cgtcatcgag cagctcgtgc ggcgcggcct gcagcaggcg    193740
     cgggatgaag cgctcgcgca tcagcccggg ctgggcgtag cggccgatcg aatcgaaggc    193800
     gtagccgatg agcggccggc cgtcgcgcac gacgtcgctg accagggcga ccagcgagac    193860
     cgtgtgctcg gcgaaactga ccagcgagtt ggagatgttg ccctgcaggg gaacggcgat    193920
     ttctcgtatg gcggtgatgc gcatggatac tggataggaa gggttactgg acggtgatgc    193980
     cggcggcctg gatgatctgc gaccagcgct gcgtatcggc cttgatgagt tcggcgaacg    194040
     ccgcctgggt atcgaccacg ggccaggcgc ccagctccac catgcgtttc ttcatgtctt    194100
     cggtctgcaa ggcgctggcc agggcggcgt ggatcttctc cagcacaggc gcgggcgtgc    194160
     cggccggcgc cagcaggcca taccagctgg gcgaatcgaa gtccttcacg ccgccttcgg    194220
     cgatggtggg caccttgggc gcgccgggaa aacgctgtcc cgaggtcacc gcgatggctt    194280
     tcagcttgcc gtcgcgcagg aacggctcgg ccaccgccag gccggtgatc agcagcggga    194340
     tctggccgga caccacatcg gagatggcct gggcgccgct cttgtaggga atgtgcgtca    194400
     tgctcatgcc agtggcgcgg ttcaggcgct cgcccaccag gtggcccatg ctgcccgcgc    194460
     cggcgctgcc gaagtccagg cgcgcgtcgg gcttgccgcc cagcttcacc agttcgggca    194520
     gcgtgtcggc cttgaccgcg gggttggcga ccagcaccag gggcacgacc gcgatgcgcg    194580
     agatgggcgc gaagtcgctt tcgggcttga atggcaactg gctgtacagc gtggggttga    194640
     tgaccagggt ggcgtcggcg gcgaacagca gcgtatagcc gtcgggcgcg gccttggcca    194700
     cggcgtcgct gccgatgttg ccgttggcgc cggggcggtt ctccacgatg acggtctgct    194760
     tgagggcctc gcccagttgc tggcccagca cgcggcccag gatgtcggtg gtgccgcccg    194820
     cgccgaacgg cacgatgagc cggatcgggc gctcgggata cggggtcgcc gcgcctgccg    194880
     cgggcacggc cgcggcccac aggcccagcg ccgcgaacaa ggcggcggtc ttgccgcgta    194940
     ctcgcttgat gctattcatg gttgtctcct cgctgtgtcg gcgctacgat gtttttctta    195000
     gtgcacacgt ttgcactggt cgaactataa ttagccagag ttagggcgtc aatacagcag    195060
     aacatactgg tttacccgat acatactgcc acgatgaaaa tttcatacgt gtgcaccaag    195120
     gaggcagaat gaccccgtcc accccgtccg gcgccgccag tgcgccgccg cgcaccctgt    195180
     tcgaccgcct gtgggacagc caccacgtgg ccgacctgcc cgacggccgc agcctgatcc    195240
     acatcgaccg gcacctgctg cacgatcttt ccagcccgca ggccttctcc gcgctgcgcg    195300
     cgcagggccg caccgtgcac agtccggcgc gcaacgtggc gatcgccgac cacatcgtct    195360
     ccaccgcgcc cgggcggcgc ggcgaacacg tggacggcag ccaggcgatg atcgatgcgc    195420
     tggccgccaa cgccgcgcgc accggcatcc gccactacgg cccggacgac cccgaccagg    195480
     gcatcgtgca cgtgatcgcg cccgaactgg gcctggtgct gccgggcatg acggtggcct    195540
     gtggcgacag ccacacctcg acgctggggg cgctgggcgc ctgggcctgg ggcatcggca    195600
     cctcggaggc cgagcatgtg ctggcgaccc agaccctggc catgcgccgc ccgcgcgcga    195660
     tgcgcctgac gctgcaaggc gccctgcccg ccggcctgag cgccaaggac ctgaccctgc    195720
     atgtcctgcg ccagctcggc gtgcgcggcg cggccgtggg gttcctggag ctggccggcg    195780
     agccggtggc ggcgctctcg atggaagaac gcctgacctt gtgcaacatg gccatcgagg    195840
     ccggcgcgcg cgccgcgctg atcgcgcccg acgacgtgac cctggactac ctgcgccgcc    195900
     atgcccccgc ggtgcgtggc gacgaggcgg cgctggcggc gtttcgcgcg ctgcgcagcg    195960
     acgccggcgc gcgctacgag tccgagcgcg cgatcaccct gggactgcag gcgccgcaga    196020
     tgacctgggg cgtgaacccg gcccaggtcg tggacgtgca cgaaccgctg cctgatccgg    196080
     ccgccgccga cgccggcgag cgcgccgcca tgcagcaggc ctatgactac atgggcctgc    196140
     gggcgggccg tccgctggcg ggcgtgccgg tgcagtgggc gttcatcggt tcatgcacca    196200
     acggcaggct gtccgacctg caagccgccg cggcggtggc gcgcggccgg cgcgtggccg    196260
     ccggcgtgcg cgcgctggtg gtgccgggct cgcagcgggt caagcgcgcc gccgaagcgc    196320
     tggggctgga ccgcgtgttc ctcgacgccg gcttcgaatg gcgcgaaccg ggctgctcga    196380
     tgtgcgtggg catgaacgcc gacaaggtgc cggccggcca gcgctgcgtc tccacctcca    196440
     accgcaactt cgaaggccgc caggggccgg gcgcgcgcac tcacctggcc agcccggcca    196500
     gcgccgcggc cgccgccatc gcgggcgcca tcgtcgatca cagggatctg gtctaatatg    196560
     caagccttca ttcgagccca cggcatcatc ctgcccatga accaggacca cgtcgacacc    196620
     gacgcgatca tcccgcagcg ctggctggta accgtcgaac gcgacgggct ggccgacggc    196680
     ttcatgggcg cctggcgcta tgacgaacat ggccagcccc gccccgagtg cgtgctcaac    196740
     cagcccgcct accagggcgc ggccatcgtg ctggcgcgcg agaactacgg ttgcggctcg    196800
     tcgcgcgaac acgcggtctg ggcgcaccag ggatacggca tacgcgccat cgtcgcggcc    196860
     agctatggcc ccatcttcca cgagaactgc ctcaagaacg gcctgctgcc ggtcaccctg    196920
     cccgcggccg acgtcgcgac gctgatggcc caggcgctgg ccgacccggg ctgcgcctgc    196980
     gaggtggacc tggtcagcca gcgcgtcatc ggcccggacg gccgcgccta tccgttcgag    197040
     atcgacgcgg gccggcgcca gttgctgctc gaaggcgtcg acgacatcga cctggcgctg    197100
     gcgcgcgcgg ccgacatcgc ggcgttccag cggcgccagc aacaggatca gccatggctg    197160
     gcatagcggc gcgcaccaac gtcaccatca aggacatcgc gacccgcctg aagctgtcgc    197220
     atgccacggt gtcgcgcgcg ctggccgacc atcccaagat cagcgccgcc accaaggcca    197280
     gcgtgcgcga ggcggcgcag gccatgggct acgtgcccaa cggcacggcg cagaacatgc    197340
     gcacggcgca cagcccggtg atcgggctga tcgtgcccga catccagaac gatttctacg    197400
     cggccgtggc caagatcgtg gccgacgcgg cggtggcgcg cggcttccag ctggcgctga    197460
     gcatcaccga ggacaacccc gagcgcgagt tcaacgactt gcgcgcgttc gtggtgtcgc    197520
     gcgcggccgg cgtgatcatc acgcccacca tcaagcccaa gcccgagacc atcgccctgc    197580
     tcaagggcgt gcgcgccatc cagctgatcc gccagcacgc ggcggtggcc gccgaagcgg    197640
     tggtgatcga cgaacgggcc gccacgcgcg ccgccgccga gcacctgatc cactacggcc    197700
     accggcgcat cgcctatgtc ggcaccacca cggacctgag cctgggcgaa gaccgcctgt    197760
     ccggtttcag cagcgccatg agcaaggccg ggctggacgc cagcctgacc gccgtcggcc    197820
     cgccgcgggt cgagttcgcc catcgcgccg tgcacggcct gatgagcggc cccaagccgc    197880
     ccaccgcgct gatcatcggc agctcgcgcc tgaccgtcgg cgcgctcaag gcgctgcgcg    197940
     gcctgggcct gtcttgcccg gccgatgtgt cggtggtcgg ctatggcgac cccgactggt    198000
     tcgaactggt gggcgatggc ctgaccacgg tgtcgccgcc ggtctatccc ctgggcgcct    198060
     acgccatcaa tctgctgctg gcgcgcatcc agggcgaggc cgtgccggcc gccgccgacc    198120
     cggcgcacgc gaccgcctcg cgctttcccg ccacgctggc catccgcggc tcgacgcgcc    198180
     cgctggcgcg ctgagccgcc ctgccccttc cctactgcgc gcggatgccc gccgcgccta    198240
     tcatctcgcg ccattgcagc gtgtcgcgct gcaggaactg ctcgaacgcc ttgcgatcca    198300
     tcacggtcgg cacatagccc aggtcgctga actggcggcg cagcgccgca tcgtccatga    198360
     cccgcgccag cgccgcgttg aggcggtcca ggatggctgg cggcaccccg gccggcgcga    198420
     tcaggccata ccagatctgc acgtcatagc cgggcgcggc ctgggccacc ggcggcagcg    198480
     tcggcatggg cggaaaggcc tgcgcggtgg agatcgccag cgccctcacc ttgccggcat    198540
     cgagcatcgg ccggctcgcg cccagcccgg cgaaggtgaa atccacctcg cccgtggaca    198600
     gcgccaccag cgccggcgcc gcgcccttgt aggccaccgc ggtgaggtcg gcgcccgaca    198660
     ggtgcttgag ccattcggtg gacatggcct gcaggctgtt ggggcccagc gacgcgtagt    198720
     tcatgcgtcc tggcgcttgc ctgctggcgg ccaccaggcc ggccatgtcc tggaccggcg    198780
     agccggccgg caccagcgcc agcatgggca cgccgaccag cggcgccacc gcggcgaact    198840
     gcgccggttt gtacggcagg ctggcgtcca gaacccagtt gatcgaatac gtgctggtca    198900
     ccaggcctat ggtgtagccg tccggcgcgg cccgcgccac gctgccggtg ccgatgatct    198960
     cgctggcacc cggcttgctt tcgaccacca ccggctgtcc cagctcggcc tgcagccgct    199020
     gggccaccgc gcgcgccacg acgtcggtgc cgccgcccgg agggtacggc acgatcaggt    199080
     gcaccggccg cgccgggtag tcctgcgccg tcgaggcagc ggccacgcag gcgaaggcgg    199140
     cgcccagcgc ccattgcagg atgttcggtt tcatgcgtgg gctccgtgtc cggtcgcggc    199200
     gatggcgccg caggcgtgca ggcgttcgat gtcctcggcg ccgaagcccg cctggaccag    199260
     gacttccagt gtgtgctcgc cgaatgccgg cggcggcgcg aaggcgctgt gattgtcgcc    199320
     atcgaaacgg atggcgcggt tggcggccgt caccggccca tgccgcggat gccgcagttg    199380
     ctggaacacc tccaggtggc gaacctgggc gtcgtcggcc agttcgtcga gcaggcgctc    199440
     cggggcggcc ggcacgtcgt gcgcttcgag cacgcgcatc cagtcggcgc gctcgcgctg    199500
     cgcgaacacc gcggccagtt cgcgcgccag cgcctcgtag ccgtcgacgc ggctggcgcg    199560
     gtcgggaaag cgcgccagca ggtccggccg ttcgatcgcc tcgaccagcg agcgccagaa    199620
     cttctcggga ctggacaagt gcaggccgat gcgcaggccg tcggcgcagg tcaggatgta    199680
     cgactgcgac agcgaggcgc ggccgtagtg cgccggccgc gcgcccttgg ccgacaactg    199740
     gcccagcggc tcgttggaaa aggcgatcag cgattccagc atggagactt ccaccttgcg    199800
     tccctgcccg ctgcgggcgc gttcgagcaa ggcggccagc acgcccatgg cggcgtacag    199860
     gccggtcagc gagtcggaca ccggcgggcc gggcacgcgc gggtcgctgc cctggtggaa    199920
     catcgacagc cagcccgaca aggcctggcc gacgttgtcg aaggccggcc ggtgcgcata    199980
     gggaccgctg gcgccgaagc cggtgatcga gcagtacacc aggcccggat tgagcgcgcg    200040
     caggctttcg tagtccaggc ccagcttgtg ctcggcgccc gggcgcatgt tgagcagcac    200100
     cacgtcggcc ccggcgatca gacggcgcag cgccgcctgc ccctcgggcg tggcgaactc    200160
     cagcgccagg ctgcgcttgt tgcggttgtg cgactggaag tgcgggccgt acagcccgcc    200220
     ctcgaaggcg cgaaacggat cgatggcgtc gcgcgactcc accttgacca cgtcggcgcc    200280
     cagctcgccc agcaactggc cggccagcgg cgcggtgatg aagcggccca ggtcgagcac    200340
     gcggatatgc gacagcagct tcatggacgc ggctcctgcg gggctggctt caggtgcgcc    200400
     gatacctcgg cgtcggtgcg cacccacagg cgctcggcaa tggggttgcg cagctcttcg    200460
     gcgatatggc ccaccaggcc gaccgcgcgg ccgatcacgg cgatgccgcg gcacagctgc    200520
     caggcaatgc ccagctcgct ggccagcgcc gccagtgcgc cggtggcgtt gaccggcagc    200580
     acgcccggct tgcccagcgc cttttcggcc tgcgccgaga gggcctgcat cagcgccaca    200640
     tagcgcccat ggaagccggt gcgctcggcc agcgcgaaca gcgccgtggt gcgcggatcc    200700
     accggcttgt gcaccgggtg gccgatgccg ggcagcatct ggcgcgccgc gcgctgctcg    200760
     gccacgatgc gctgcgcggt ggcgtcgatg tccagcgcct gctcgctgcc cagcggcagg    200820
     gcctcctgca gcaggcgcgc ggcgccctcg gccgtgccga cgaacttggt gcccatgccg    200880
     cacagcccgg cagcgatggc ggcctgcatg gattcgggcg cgcccaggta ggtcaggcgc    200940
     gccaccatgg cggtgggcgt catgccgtgc tcgaccagca cggccagcaa ggcgttgaac    201000
     agcgtggact cctgcggatc gggcttgcgg ccggtgatct cgaggaaggc gaagtcgccc    201060
     aggttgaggt ggccgatgat ctcgtggttc aggtcgtgcc cgcgcacgac gatggtgcgg    201120
     gcgtcgctcc agcccatgtc tgaagtcagt gcattcatgg tgagagtcct tgtgtgggga    201180
     aaatcagggt tggtccagct tgacgccggc cgcctgcacg cgttgggccg cgacgccgcg    201240
     gtccagctcg aggaaggcgg cgaacgcctg cggggtttcg cgcaccggtt cgaagccgat    201300
     ggcggtcagg ttgcgagcca cgaagtcggc gtcgctgacc accgcgccca cgtcgtcggc    201360
     caccttgcgg cgcacatcct cgggagtgcc ggccggcgcc gccagcgcga agtagaccga    201420
     cgcgtcgaat tcgggatagc cggcttgcgc gaacgtgggc acatcgggcg cgatcgccac    201480
     gcggtgcggc ccggccagcg cgatcgcctt cagcttgccg gtggccacgt gcggcatggg    201540
     gccgccggca atggcgaaca gcatgtccac ccgcccggcc atgacgtcct gcatggccag    201600
     cggcaggccc ttgtacggca cctcgctggt ctgcacccca tagagctggt tgaaccacgc    201660
     tccggccagg tgcagcacgc cgccgatgcc ggtgatgcca taggtgtact tgcccgggtt    201720
     ggccttcagg tgcttgatga gcccggccac gtcgtcggcc gggaaatcag ggcgcgtcac    201780
     cagcatcaac tgcgccgtga ccagccggct gaccggcgcc aggtcggccg gcttgtacga    201840
     cagcttggcg tacagctgcg ggttgagcga gaacgcggcc tcggagccca gcagcagcgt    201900
     gtatccgtcg ggggcggcct tgatcacggt atcggcgccg atgatctcgt tggcgcccgg    201960
     gcggttctcc acgatgacgg gctggcccca cttgtcgctc agcttctgcc ccaccgcgcg    202020
     catcagcgcg tcggccgggc cgcctggcga ataaggcacc accacgcgca ccggcttgct    202080
     gggaaagtcg gcggcctgcg cccacatcgg cgcgatcgcc ccggccaacg ccagcacgcg    202140
     caacagggtc gtgattcttt tcatggtcat ctcctcggtt gattcgcgct aagcgcgcag    202200
     gtagacggcg gcatcgaccg ccaccgcgcc gtgacggccc accgtcactg ggttgagttc    202260
     gatctgcgcc acttgcgggc cggcccgcac ggccgcctcg gccagggccg ccagcagccc    202320
     gaccgcctcg tcaaagcccg ccgcgccgcg aaagcgcgcg tgcagcgcgc gcccgaccag    202380
     cgtgccggcc agggcgtcgg ccagttcgtc gcggctggcc ggcagcgcgg cgaagcgcac    202440
     atccttgagc agttccaccc actgcccgcc cgaacccacc atcagcacct ggcccagttg    202500
     cggatgcgcc agcacgccgg ccaccagctc ctgcccgggc aaatagcgca tggccagcac    202560
     gcgctcgtcc ggccagccgg ccacgcgctc gagcgcctgc gccagctcgc cgtcattgcg    202620
     gatattcagg atcacgctgt cctggtcgga aatatgggtg tcggccgaat cggccttgat    202680
     gaccagcggg tagcccacct cgcgcgccgc ctcggccagg ccggcgcggg cacaggcgcg    202740
     cagcggcggt accgccacgc catgcccggc cagccattgc atggcctcgc tctcgcgcag    202800
     ggcgcgcagc gcgccgtcgg ccaccggcgc ggcggacgcg gcctgcatag gcgcgcgccg    202860
     gccggcggcg cggcgcagcc gctgcaggca ggctgccagc aaggcggccg aatggaacac    202920
     cggtatggcg gcctcgcgca ggatttcgcg cgaacgagtc tcgtacgagc cgccgttcca    202980
     caaggcgatc atggcgcagc gcgtcctggc gcgcacgtcg gccagcaggc ggcagacttc    203040
     cgtgtaatcg tccaccgtgg tcaggatggg cacgacggtg cgcaccgccg cgtcggtcag    203100
     cagcacgtcc agcacgtcgg catgcaacgc cggattctcg tagcccagcg cggtgatgtc    203160
     gatcgggttg tgcaccgaga tatagtccgg cagcaccgcc gccaggcgcg cctcggtggc    203220
     ggcgtccagc tcggcaaagc ccagtccgtg ggcatcggcc tggtcggcga acaaggtgat    203280
     gttgccgccc gatatgcaca gcgaggcgat accctcggca tgctcggcgc cgaagccgtg    203340
     gcgcaacagc tcgcacaggc ccagcgcctg gtccacgtcg tcggcgcagg caatgccgtg    203400
     ctgctcggcc acgtcgcgca ccaggcggta gtcgccggcc agcgagccgg tgtgcgacaa    203460
     ggccatgcgc gtgcccgtct gcccgcgccc cagcttgagc aggaccaccg gtttgcgcag    203520
     gcccagccgg tgcaccgcgt cgatcacctc gcaggcggcg cgctcggctt cggccacggc    203580
     cagcaccacg cgcgtggccg gatcctggaa catgtattcg atcaggtcgc tgtacgagac    203640
     gccagccgaa ttgccggtat tgacgatatg gctgaagccc agcccgtcgc gctgggcgta    203700
     gtacgccatc gttgcatagg ccagcccgcc gctttgcgac accagcgcca cgtcgcccac    203760
     gccctcggcc cgcttgagca cggccgaggg cgcggccatg acgcgcgccg tcaggttgga    203820
     aaagcccatg cagttggggc cgatgaaggt cagcgcgctg gccgcctcct cgagcgcgcg    203880
     ctgcgcctcg cgcccgtcgc cgctggcctc ggcgtagccc gaggtgtaaa tgctggcgcc    203940
     gggtacctgc ttggcgcagc aatcgcgcaa gacctgcggc acccgctcct tgccgaccac    204000
     gatcacgcag tggtcgacct cgtccggaat atcgccgacc gaggcgaagc agcgcaggcc    204060
     ggccacttcc tggtagcgcg ggttgacagg atagatggcg ccttcgtagc cgccttcgcg    204120
     cagcgccggg atcagctggc cggccagctt gttgggcgcc ggcgaggcgc cgacgattgc    204180
     gatgctgcgc ggattgagca gcttgcctat gcgctggacg gcgttcatgg acgcgctctc    204240
     ctcagtgtct ggaacaggaa tggcggcagc gcgggatcgc gcgtcgcgcc gggtacggcc    204300
     gggttttgca tggttctccc cttcagggcg ccgccatgtc tggcggaata ttgatgcacg    204360
     tttttgtagg acaataacgt tcggcaactt gtcgtacaat cagggttatc gcctatccga    204420
     atggacgcca tgacaggaac cagcaagccc aacgcaactt ccggcagcac gctcgagtac    204480
     gtggtcgata cgctgcgcca gggcatactc agcgggcgcc tcgtgcccgg ccagcgcctg    204540
     gtcgaggcgg acctgacgcg ccagctgggc gtcagccgcg gcccggtgcg cgagtcgttc    204600
     cgccgcctgt cggccgaggg gctggtcgag agcattccca accagaccac catggtgcgc    204660
     cgctattcga aggcggaaat gctggagctg ttcgagatcc gcgccgagct tgaggcgctg    204720
     gcggcccgcc gcgccgccga gtgcatggat gatcccgccg ccaaggcgcg tttcctgcag    204780
     gccatcgggc cgatctggga cgagcactcg ctggccgccg cgccttccta cttcgacgag    204840
     aaccggcgct tccaccaggc cattgccgat ctcagcgcca acacccagct ggccgagctg    204900
     atccgcaagc tgcagctacc gctgatcatg ttccagctgg gcggtgcgat cacgccgcag    204960
     gccatccagg cctcgatcga cgagcatcgc cgcatcgccc aggccatcgt cgacggcaac    205020
     ggccgcaagg ccgccgccga ggtcaaggcg cacctgaagc gcgcctgcga aatggtcgag    205080
     cgcatgccgc cggatatctt ccggccctga acgcgcgagg gattcagtcc gcggcgatgg    205140
     cctgggccag cgccagcacg cgctgcgcgt cctcgacgtg cagcgcttcc accagcatgc    205200
     cgtcgaccac ggtcacgccc gcgccgcgcg cctgcgcgtc ctgccaggcc gccatgatgg    205260
     cgtgcgcgcg cacgacctcg gcttccgacg gtccgaaggc ggcgttggcg ctgtcgatct    205320
     ggcgcggatg gatcagcgtc ttgccgtcga agcccaggtc gcggccttgc cggcaggcgt    205380
     ggcgcaggcc ttcggcgtcg gccaggtcca ggtgcacgcc gtcgagcgcc agcagtccat    205440
     gcgcgcgcgc ggccagcacc gtcatcgaca gcgccgcctg gacttcggcg cgcgccggcg    205500
     tgtggcgcgc atgcagcgcc ttgaccaggt ccgacgtgcc ggccaccagg gcccgcagcg    205560
     gcgcgcccgc ggcggcgatg gcgccgatat tgaggatggc cagcggcgtt tcgatcatgg    205620
     cccaccatgc caggcccggc gcgccggcct cggccgccag cgcggcggcg cgcgccagct    205680
     gcgcgggatg ttcgaccttg ggcagcagca tcgcatgcgg acccagcggc gccagcgccc    205740
     gcacatcgtc ctcgccccag ggcgtgtcca ggccattgac gcgcacgatg acgctgcgtc    205800
     gtccgaagcc gccctcgcgc aaggcgtgcg tcacctgcac gcgcgcctct tccttggccg    205860
     acaccgcgac cgcgtcttcc aggtcgagga tcagcgcatc ggcgtcgagt tcgcgggcgc    205920
     gcgccagcgc gcgcgcgttg gcgccggggg tataaagcac cgagcggaag gggcgcatgg    205980
     ggttcgtggt ttgcgtaggg ttcatggagg gggccgtggc ggggtccgga atcatggcgt    206040
     ggaggccggt tcgcgcaaca cctgcaaggc gtcgctgaac cggcgcagtt cggtcagcag    206100
     gccctgggcc atgctgtcgt ggatgggttg gggctggaag cggccggccg cgtccaggcg    206160
     ctcggccacc atcgggatgg ccacgtattc gaagatgggc accatgcgca aggtcgtcag    206220
     ggtctgcttc tcggcctgca cggcgcgcat gccgccggag acgccgccat agctgacgaa    206280
     agccgccggc ttgtagttcc actctttgta gacatagttc agggcattga ccagcgccgg    206340
     tggtggcccg tagttgtatt ccggcgtgac gaacacgaac gcgtcggcgc tggccacgct    206400
     gcggctccag gcgcgcgtgt gcgcatgttc gtattgctgc agcatggggt ggcgcggctc    206460
     gtcgtagagc ggcagcccga cctgcgccag atccaccagc gccacctcga agccgccatg    206520
     cgccagggcc tgggcatgga accagtcggc cacggccggc ccgacccgcc cgggccgcgt    206580
     gctgcagatg atgatgtgga gtctggccat gttcgaatcc tcgcgtgtcg ctgccccggt    206640
     tggcagcata gcagcaggca ctcgccagca tgctgccgaa gcgaaaatgc gggtagactg    206700
     cgattccggg ccgcgctgtc ctattttcag aactatcgag gggcgtccat gcaggatctc    206760
     aacgacctct attatttcgt acagacggtc gatcaccggg gcttcgcgcc ggccggccgc    206820
     gccctgggga tgccgaaatc caagctgagc cggcgcatcg ccgtgctcga agagcggctg    206880
     ggcgtgcgcc tgatccagcg ctcgacgcgc cacttctccg tcaccgacat cggccagacc    206940
     tattacgaac actgcaaggc catgctggtg gaggccgagg ccgcccagga ggcgatcgac    207000
     gcggcccagg tcgagccgcg cggcgtggtg cggctgtcct gtcccgtggc cctgctgcac    207060
     acccatgtcg gcgccatgct gggcgaattc atgctgcgct atccgcgcgt caccctgcac    207120
     ctggacgcca gcaaccgccg cgtcgacgtg ctgggcgaag gcgtggacgt ggcgatccgt    207180
     gtgcgtccgc cgccgctgga gaacagcgac ctggtcatgc gcccgttcgc cgaccgcggc    207240
     caatgcctgg tggccagccc cgccctgctc gcgcgccatg gcgcgcccgc cctgcccgcg    207300
     gacctggccg cctggcccag cctggcgctg ggcctgccga accagcccca cagctggctg    207360
     ctgaccggcc cgcaaggcgc gcaggccacg gtgcccctgg ccccgcgcat ggtcaccacc    207420
     gacatgctgg cgctgcgcag cgcggcggtg gccggcgtgg gcgtggtgca gctgccctcg    207480
     atgatggtgc gcggccagct ggccgacggc accctggtgc gcctgttgcc cgaatgggcg    207540
     ccgtgccgcg aattgatcca cgcggtattt ccgtcgcggc gcggcctgct gtcgtcggtg    207600
     cgcacgctgg tcgatttcct ggccgagcgc ttcgcggccc tgcaggaaga ctgaacccgc    207660
     catgcagcag ctcggcgcaa cgcggcgcta cgccgcctcg gacctggtgg gtttcctggc    207720
     ctgcgaacac ctcacccaac tggacctgcg cgcgctcgac gcgggccagg cgccggcggc    207780
     ggccgacgac gaacagatgg cgctggtgca ggccaagggc caggcgcacg agcaggcctg    207840
     gctggagcgc ctgcgcgccc gccaccccga cctggccgac gtcacgcgcg ccggtccgga    207900
     cctggcggcg cggctggccg ccacgcgcgc ggcgatggcc gcgggcgccc cggtcatcta    207960
     ccaggccgcg ctctgtcacg gcccctacgt ggggcatgcc gatttcctgt tgcgcaccga    208020
     gtgcccgtcg gcgctgggcg actacggcta cgaggcgctg gacacgaagc tggcgcgcag    208080
     cccgcgcgcc agcttcgtgc tgcagctgtc gttctacgcc tggttgctgg agcacgcaca    208140
     aggcgtcgcg ccgcgcagca tgcatgtggt gctgggcagc ggccgcgagc tggcgctgcg    208200
     cgtggccgac tacgcccatt acctgcggca ggtcctgagg cgcttcgagg ctgcgatcgc    208260
     cgccgagccg gcgccaccga cctatcccga gccctgcgag cattgcccgc agtgccgctg    208320
     gcgcgtggcc tgcgaagcgc gccgcgtcgc cgacgaccat ctttcgctgg tggccggcat    208380
     gtcgcgccag caggcccggc gcctgaacgc ccagggcgtg gccacgctgg cgcagctcgg    208440
     cgccctgccc gagcacgcgc aggtggccgg catcgaagcc ggcacgctgc agcggctgcg    208500
     cgcgcaggcc gccctgcaat ggcgcgcccg cgtcgatggc gcgcgccact acgagctgct    208560
     ggcggcgcag gacgagggac cgcggggcct ggcgcgcctg ccccgcccgg accccggcga    208620
     catgttcttc gacatggagg gcgatccgct cgaggacggc ggcctcgagt acctgttcgg    208680
     cctgtatgtc atcgacgacg gcgccgaacg cttcgtgccg ttctgggccc acgaccggcg    208740
     ccaggagaag caggcgttcg aagccttcat ggatttcgtg gccgaacggc tgcggcgcca    208800
     tcccgatgcg cacatctatc actatgcgcc ctacgaggcc acggccttga agaagctgat    208860
     gtcgctgcac ggcacccggg aagcggaggt cgaccacctg ctgcgcgccg gcaagctggt    208920
     tgacctgtac cgtgtcgtgc gcgaagggct gcgcatctcc gagcccagct attccatcaa    208980
     gtacgtcgag cgcttctacc tgccgcggcg cgcgggcgag gtcaccaatg ccggcgccag    209040
     catcgtgtac tacgagcgct ggaaagccac cggcgagccg cgcctgctgc aggacatcgc    209100
     cgactacaac cgcgacgacg tgatctccac ctggcgcttg cgcgactggc tgtgcggcat    209160
     ccgccccgcc gccctgccgt ggcacaacga ggccggccag caggacctcg acgccgcgcg    209220
     ggctgtcatc ggcgagatga ccgaggccga gcgccgcctg ctgccctacc gggccgcgct    209280
     ggccgacgat ctgccggccg acgaagccgc ctggtcgccg cgcgacgcgt tccgggcgct    209340
     ggcgtggcac ctgctggact tccaccggcg cgaacagaag cccgcctggt gggcctggtt    209400
     cgcgcgcgcc gaagccaccg acggcgagct gatcgaggac gccgaatgcc tgggcgggct    209460
     ggcgcgcgac gacgcggcgc cgcccgtacg gcaggcgcag tcgttgcgct atacctaccg    209520
     ctatcccgcg caggaaacca agctgcgcac cggcgcgcgc tgcaccgacg tgcgcaccgg    209580
     cgccagcctg gccaatctgg tggtcgaccc gcacgcgcgc ctggccagct tcacctgcag    209640
     cgcgcgcaaa cccgcgccgc cgccgcgcat ggcgctgggg cccgcggcgc cggtcaacaa    209700
     caaggagctg gtcaacgcgg tgttccgcta cggcgacgcg gtgtgccggg cgccggacgg    209760
     catgtccacg ccgatgcgcg ccgtggacgc gctgctgcgc cgcgagcccc cgcgcatccg    209820
     cggcctggcg cgcggcgcgc cgctggtcgc gccgcacgcc gagctgttgc cccaggtgct    209880
     ggatgtcgtg gcgcgcatgg acgaaaccac cttgttcctg caagggccgc ccggcgccgg    209940
     caagacctac accggttcgc gggtgctgct gcagctgctg cgcgccggcc ggcgcgtggc    210000
     cgtatcgtcc aacagccacc acgccatcaa caatctgctg cgcggcctgg agcggctggc    210060
     ccagcgggaa ggctttgcct tgcgcggcgc caagaaatcc accagcgccg gcgacgacag    210120
     ctgcctgggc ggcgcgcaga tcgaggatgt gttcgacaac aaggacgtcg atccggcgcg    210180
     ccatcaactg gtggccggca ccgcgtggct gttcgcccgc cccgagttcg agcaggcgtt    210240
     cgactatctg ttcgtcgacg aggcgggcca ggtcagcctg gccaacctcg tcgccatggg    210300
     ccagtgcgcg cgcaacatcg tgctgctggg cgaccagatg cagctcggcc agcccagcca    210360
     gggcacgcat ccgggccgtt cgggcgaatc agcgctggag tacctgctcg acggccaggc    210420
     caccatcgcg gcgtcgcagg gcgttttcct ggacacctcg taccgcatgc atccggagat    210480
     ctgcggtttc atttccgaag ccatctacga cggcaggctg cgcgcggcgc cggccaccgc    210540
     ggcccaccgc ctgctgctcg acgaggcggc cggccgcgaa ctgcccgcgc acggcatccg    210600
     ctacgtgccc gtgccgcacg acggcaatac gcaatccagc cgcgaggaag ccgcgcgtgt    210660
     ggccgaactg tgcgcgctcc tgctgcgcca gcgccatgtg gacgaagccg gcgcgcccgc    210720
     gccgctgacg ctggacgaca tcctgttcgt cgcgccgtac aacgtgcagg tcaataccct    210780
     gcgcgccgcc ctgcccgacg gcgcgcgcgt gggcacggtc gacaagttcc agggccagga    210840
     ggcccaggtc gtgatcgtct ccatggcgac ctccagcggc gattacctgc cgcgcgacct    210900
     ggagttcctg ttcagccgca atcgcctcaa tgtggcgata tcgcgcgccc gcacgctggc    210960
     catcctggtc gccagcccgg cgctgacggc ggtgcgctgc cgcagcgccg agcagatggc    211020
     cctggtcaac accttgtgct gggtagccga gacgggcagc gcgtcgcctt accaggtgta    211080
     gcgcatcccc agctgcgccg aagcgccgcg cagatactgg ctgtcgatgc tggtggcata    211140
     ggccagcctg ccgtagaggg ccaggctgcg ggccagcgtc acgctggcgc cggccgccag    211200
     ttcgagcgag gtcgcgccgc gccgggtatc gatgctgtct tcgcccagca cgacggtgtt    211260
     ctcgccgctg aaggtgcgcc agaaattcag cgccgcgtag gggcgccaca cctgcgcggc    211320
     ggccgcgtac tcgccctgca gccgggcgcc caggcgggcg gtcagcgcgt tgtcgtcgcg    211380
     gatgcgcacc tcggatacgg cgtcagagaa gtcgtccacg cgcgtgtgct ggtagatgag    211440
     ctgcgcctgc ggctccagcg tccagcgctc ggacagcgcc agcgggtagc cgctttccag    211500
     cgaagccgtc aacgcctggc cgcgcgtatc ggcgtcgcgc ccggccttgg agtcggtgtc    211560
     gatgtccatc caggtgttgg ccagcacggt atccacgtac cacccgcgcg ggccgacata    211620
     ggtccagtag ccgccgacgc tgtagccgtc gatggtcagc cggccggtag cggcgtcgcg    211680
     ctcgccgccg gccgagccgt gggtgtcgcc gcgcgcgtgg ccatagccgc cgaacagccc    211740
     gaagcggtgc tgtccgccgt ccgggcgcac gctgctgtag aggtcctgcc ccagttgcac    211800
     accggccagg cgggcgtcga tgccgggttg cgcatcgccg tcgagcgcct gcttgctgtt    211860
     gccgccatag gcgcgcgccc aggccgcgac gcgttcgccg tcgcgcgcca gcagcgcctg    211920
     gttgccctgc cgttcgtgga aggtgcccag ctgggccagg cccatgcgcc gcgccagcat    211980
     gggaatgctg ctgtacagcg ccacctcggg ccggtacagc ggcgtgtcct cgatgctcgg    212040
     ccgctcgccg gtgcgccggc cgatgtcgtc ggcgatcgcc tcggcttcgg caaggctgcc    212100
     ggccagttgg tcctcgacca gataggcccg cgagcgcagg taccagctgt ccggcgcggc    212160
     gcccgtggcg tcgccgcggt acagcctgta ctcgtatgcg ccggcgttga ggggcgcggc    212220
     cagcgagaag gcgccggcgt ccgagcttgc gccattgatg gcctggacca ccaggatgcc    212280
     gtcggccgcg gtcagcgcgc cctgcccgcc ccggttggcc accgtgaccg gggtgctgcc    212340
     gccggcgtgc ccgccatcga tgaccagcct gtccgaggcg gccccgtcgc cggccagcac    212400
     cgtgttgacg cgcagcgcgc cgcccgcgcc ggtgtaatcg ccgcgcaccg tcagcgcgcc    212460
     gtagccgctg ccgtcgttcg ggccgggccg gatttcgccg gcgttgcgca atgcgccggc    212520
     cagcgtgccg gtgccggcca gcaccgcgcc ggcggccagg cggttggccg ggctggcgag    212580
     cgtgccggca agaaagaatg tgccggtgcg caggtccacg ctttcggtga acgcggcgtc    212640
     cgaggtccag cgccagtcgg cgccgcgcat ggtcagggtg cggaagttgg cgaaccggtt    212700
     gtccaccgtg ccgctgccct ccagatacgc atggctggcc gccccgccgc cgtcggccag    212760
     gccggcgatg gccgagccgg tgcgcaggat cagcgtgccc gtgccctggg ggcccatgta    212820
     gacggccgtg tcgcggccgg ccccgccgtg cccttgcagg tagccggcgt tgatgaaggt    212880
     atcgttgccg ttctgcccgc gcagcgcata cgagtgatcg ctgaggatgc gcccgccggg    212940
     caggttctcg acgcgggcat gaaagccgtt ggcgttggtg gtgttcacat gcacgccgtc    213000
     ggggccgaat atgccgttgc tgctggcgcc gcgcgcatgg atggtgccgc tgttgaccag    213060
     tacgttggcc gcggggctgc cgccttgcag atacacgccc ttggcgtcgg tgccgttgac    213120
     ggtgatggcg ccgctgttct ggacgcggtt gcccgggccg ttgatggcga tgccgtgcgc    213180
     gctggcgccc tgggtgcgga tgctgccgct gttgtcgacc agcgtcccgg tactgccgac    213240
     gttgggcacc gagatgccgc gcacgccgct gcccgatgtc gtgatcgatc cgcggttgat    213300
     caactggttg ttgtcgccga aacccaccat ggcgccgcgc gaggcgccgg cgccgccggc    213360
     catctggatc gtgccctcgt tgacgatacg gctgcggtca tcgaccgaca gcgcccgcgt    213420
     cgcgttggtc gagaacagcg cgccgggcgc caccgtgatg gttacgttct ggctgccggc    213480
     cgccgcctcg accgactggt tgaccacggc gccgtcgcat tgcacgctct gcccgctggc    213540
     tggcgccagc gtgggcgcac aggccgcggc cgcgggcgtc gcgcccaagg attgcagcag    213600
     gccggcggcg gccagcatgg ccggcaacgg ggcaagtcgt gctggggtac ggcggcgggc    213660
     gctacgcatc ggggctccag ttcgcaacat cttgcatagt ttgtgcgaga gtagcggctg    213720
     gatacgcgag agatgtgtgc aatttgtaaa aattacgcca ttttctgtcg cttttgcaag    213780
     ggcgcgcgcc cggcgccccg ttgcgtcgat gtcacaaggc cggcgtcggc tcaatcatgc    213840
     gtttcgtgca cggccgcctc gccgcgcttc cagtagctgg cggcgcggat gcggcttttg    213900
     tccagcccgt gcgtgtcgac cagcgcctgc cgcaccgcgc gcgcaacggc cgcctcggcc    213960
     gcggcccagg cgtagccttc gcccggcggc aggcgcagcg cgcgcacggc ctcgggcaga    214020
     cggctgccgg ccggctcgcg cagcagccat tgcacgctgg cctgcgcgcg ggtcgacagc    214080
     gccagccggg ccgcggggtc ggcgacctcg atcagggcga tgacgggctt gccgggcggc    214140
     aattcctcga ggcggcgcgc gatcgccggc aaggcgcttt cgtcgcccac cagcaaatgc    214200
     cagtcgtatt cgagcggcac cacgaacgag ccgcgcggcc cggccacgcc cagctgctgc    214260
     ccgggctgcg cccgggccgc ccagctggcg gccggccctt cgccatgcag cacgaactcc    214320
     aggtcgagct cgccggcgcg cgcgtcgtgg cggcgcggcg tgtaatcgcg catgggcggg    214380
     cggggttcgc cctcggcgaa caccaggccg tccggcccca gttcgggcag gaccggccgc    214440
     gccgcgccag gcggcgggaa gaacaccttg acgtggtcat cgaacgatgc cgagacgaag    214500
     tcgcgcagag cgtcgccggc cagggtgatg cgcgccagat gcggcgtggg ccgcgtcacg    214560
     cgcttgactt cgagcaggcg cattttcagc ggatggcgta cccgctgcac gttcagttcg    214620
     gttgggagca ttgcaggtct tccagggaaa tttgtgtcag gacgacaggt cgtccagttc    214680
     ggcggccgcg cgcgccagga tggcggccaa ttgccgctgc cgcgcgggcg tggcgtcggc    214740
     gtggcgcgcc agcgcctgtt tcagcgccat gcgcgcctgc acgtactcgg gcagccagcc    214800
     ggtggccagg tcctcgcctt cggaaccggt ttcgatgggc tgcccggccc aggcgcgccg    214860
     catccactcc atcttgcgcc cgacatgggc cagttgcgcc atcagcagcg tgacgcgctc    214920
     gcggttggcc tgcagatgcg cgcggcccgg ttcggccagg tggtagtgct tgcgcgcgcc    214980
     gtcctggctg accgtggcgt ggccggcctc ttccagccag gtcagggtcg gatagaccat    215040
     gcccgggctg ggcgtataga agccgcggct gcgcgcgccc agcgccttga tgagctcgta    215100
     gccatggctg gggccttcgt cgagcagcgc caggatcatc aactgcaggt cgtcggccga    215160
     aaacttgcgg ccgcgccgcc agtcggggcc gtcgccgccg gcgccgtggc cgccgccgtg    215220
     ccgtcccccg gcatggccgc cgccgcggcc gccgtgcgcg gacatggcaa agacgtgaaa    215280
     tggatgcata gggtcaccta tatcgtaaga tatatgtctt acgatatatc gaccgccgcg    215340
     gaactgtcaa gcagcgtgta gaaagcgccg ccccggcaag ccgcgcgcag gcgccgtcag    215400
     gagagcagga agcgaaccga ggccgccagg cgcctggcgg gatcgcccgg cgcgtcgggc    215460
     ggcggcaggt cgatatcggg atcgtcggta tccgggtcga ccggcaggtc cccgggcggc    215520
     gaatcgggcg ggatgggatc gggtttgggg ggtacgtgac agcgcagcgt ggcggacatc    215580
     gtcgtctcct tggggcgggc gcgaaccatc gggaaccagc gtagcgcaag cgtcgtgccc    215640
     gcgccatcgt gtggcgggca cgcggtttgc tgggctgcgg catctcgccg tccggagcgc    215700
     ccatgccgcc agaaccgatc cggctcagga tcctgaccgt caatgcacac aaaggcttca    215760
     ccagcttcaa ccgccgtttc atcctgcacg aactgcgcga ggccctgcgc gaggcacggc    215820
     cggatctcgt gttcctgcag gaagtgctgg gcgaacacca gcggcacgcg gcgcgccacg    215880
     cgcgctggcc ggcggtctcg caatacgagt tcctggccga caccctgtgg agcgcctatg    215940
     cctatggccg caacgccgtc taccccgatg gccaccatgg caacgccgta ttgtccaagt    216000
     atccgatcgt ctcgcaccgc aacgaggacc tgagcgtggg cgcggcgcac gagccgcgcg    216060
     gcatgctgca ctgcgtgctg gacgtgcgcg acgcgcccgc gcccctgcat gcgctgtgcg    216120
     tgcacctggg cctgcgcgag gcgcatcgcc aggagcagct gcggcgcctg tgccagtacc    216180
     tgcgccagca cgtgccggcg caggccgcgg ccctgctggc gggggacttc aacgactggc    216240
     gccagcgggc cgacgcaacg ctggcgcgct gcgggctggc cgacgtccac cggctggcgc    216300
     tggggcacgc ggcgcgtacc tttccggccg cctgcccgct gctgcggctg gaccgcatct    216360
     acgtgcgcaa cgtcgccgga tccgagccgc gccgcctgag ccggcgtcca tggtcgcggc    216420
     tgtccgacca tgtgccgctg gccgccgagg tgacgttgtg agcacgccct ggcgcgacgg    216480
     caaccgcttc gccattctcg agaatggcgc cagctatttc ccgcgggtct acacagccat    216540
     cggcaaggcc cgcgaggaaa tcctcatcga gaccttcatc ctgttcgacg acgcggtcgg    216600
     gcgcgaactg cgcgaggcgc tgatggcggc ggcgcggcgc ggcgtgcgca tcgacgtcac    216660
     ggtcgacggc tatggctcgg acagcctgcc gccggacttc atcgccggcc tggtcgaact    216720
     gggcgtgggg ttccatgtat tcgatccgcg cccgcgcctg ctgggcatgc gcaccaatct    216780
     gtttcgccgc ctgcaccgca agatcgtcgc catcgatggc acgctggcct acgtcggcgg    216840
     cctgaatttc tcggccgatc atctcgacga ctacggcccc cagtccaagc aggactacgc    216900
     catcgaaatc gccggcccgc tggcggccga catccgcgat ttcgcgcgcg ccgcgctggc    216960
     cgccgtgccg cggcggcgct ggcgccgcgc gcggccggcc gcgccgccgc aggccgccgg    217020
     cccggcgcgc gcgcgcctgg tggtgcgcga caacgaccag cacaccaacg atatcgagca    217080
     aagctaccgc gtggcgatcc gggccgcgcg ccgcgacatc gtgatcgcca acgcgtattt    217140
     ctttcccggc taccgcttgc tgcgcgacct gcgcgcggcg gccgcgcgcg gggtgcgcgt    217200
     gcgcctgatc ctgcagggcg agcccgacat gcccatcgcg cagctgggcg cgcgcctgct    217260
     gtacgacgcc ctggccgagg ccggcgtgga aatcctcgaa tactgcgagc gtccgttgca    217320
     cggcaaggtc gccagcatcg acgacgagtg ggccacggtc gggtcgagca acctcgatcc    217380
     gttcagcctg gcgctgaacc tggaggccaa tgtcgaggtg cgcgacagcg ccttcgccag    217440
     cggcctgcga gagcggctgg aacggttggc gatcgaccat tgccgcccgg cgccgcaaag    217500
     cgatggcgca gggcgccagc tgcggcggct gttcgccggc gcgctggtct accacttcct    217560
     gcggcgcttt cccgcctggg ccggcagcct gcccgcccac aagccccgca tccagaccct    217620
     gcggcccgat ggccagggcc aaccggacga ggcgacatga agcacgcgca ccatcatgga    217680
     caccgccggc gccgcctggg cgcctggctg gccggcatcg tcggcctggc cgtcgtcggg    217740
     gtattgctgt accaggcgcg ccgcatcgac tggcacgcgg tggcgcgcgc cgcccacgat    217800
     atccccggcc cggccgtggc gctggccgcc gcgctggcgc tggccggcta cctggcctac    217860
     gccggcttcg acatcctggc gcgccgctat gccggccacc gcctgcccgc ctggcaggtg    217920
     gcggccatcg ccatgaccag ctatgcgctc aacctgaacc tgggcgtcct gctgggcggg    217980
     gtcgccgtgc gcctgcggct gtacgggcgc cacggcttgc gcaccgcctg cggactgcgc    218040
     gtggtggcgt tcgccaccgc caccaactgg gtgggctacg cctggctggc cggcgccctt    218100
     ctactggccg gccagatgcc cacgcccgcc ggctggcacc tgggcgccgg cctgctgcgc    218160
     accgtgggcg cggcgctgct ggccggcgcg ctggcctacc tgtacctgtg ccggtacgcg    218220
     cggcggcgcg cctatacctt gcgcggccac cgctgggtgc tgcccgacct gccgaccgcg    218280
     ctgcggcaga tgggcctggc cggcgtgtcg tgggccatca tgggcggcat catctacgtc    218340
     ctgctgcagg gccgcgcgcc gtatccggaa gtcctggcca tcctgttgtt cagcagcatc    218400
     gccgcgctgc tggcccacat tccgggcggg ctgggcgtga tcgaggccct gttcgccgcc    218460
     gcgttggcca cccgcatgcc ggccagcgaa agcctgggcg cggtgctgat gtaccgcttg    218520
     ctgtatgcgt ggataccgct gtgcgtggcg ctgccggcct acctgggcgc cgaatggcgc    218580
     caccggcgcg cggcggccgg ttgagcccgg gcacggcgct tgctgctgcg gcgctgttcc    218640
     cgcttccgga tccgcccatg aaccctgccg ccgccgtacc gcgccgtccc gtcgatctgg    218700
     tggtcgccca tcccggccgg cgcgacgcgc cgcgccacga gcgcgccagc ctgcgcgcgc    218760
     tgggccggga catcgccgag ctgctgggct gcgagtacgc cgacgcgctg cctgcggcgg    218820
     cgcgcgaccc gcgcctgcgc gtgtattacg tacccgcgcg caccctgctg gacggccgcg    218880
     cgctggcctt gggcatccag ggcccggacg acctgttcgg cggcgtcgcg ccgcatggct    218940
     tcgtcgccac caaggcgatc acccatgcgt tgccgcatga cggctgcgcc gcccctgcgg    219000
     cctggtcgcg cgaactgggc gcgcggctgt ccgactgcgt gctgcccggc tgcacggtct    219060
     tcgcgctgga cgaggcgcgc caggccggcg tacggatgct gcgcaccggc gcgctgcgcg    219120
     tcaagccggt gcgcgccacc gccggccgcg gccagcgcaa ggtcgccgac gcggcggcgc    219180
     tggaccaggc gctggccgaa caggatgccg gcgaggtgcg ccgctatggc ctggtgctgg    219240
     aggaacacct ggaagacatc tcgacctaca gcgtcggcgt ggcgcaggtg ggcgtccatc    219300
     tggccagcta tatcggcacg cagtcgctga cgctggacca cgcgggcctg gaagtctacg    219360
     gcggctcgga cctgtggttc gtgccgggtc ccctgcccgc cctgctgcag ctggaactgg    219420
     acgcgccgcg gcgcgccgcg ctggagcatg ccatgcgtta cgacgaacag gcgttcgcct    219480
     gctatccgcg cctgtacgcg tcgcgccgca actatgacgt ggcgcgcggc cgcgatgcgc    219540
     agggccgctg gcgcaccggc gtgctggaac aatcgtggcg ggccggcggg gccagcctgg    219600
     ccgagatcgc cgcgctgcgc gcgttcgcgc aggatggcgg cctgcggcgc gcgcacgccg    219660
     ccaccagcga acactacggt ccggacccgg cgcacccgcc cggcacgcgc atcgtattcc    219720
     acgcccacga cgccgaggtc ggcttcattt ccaaggccgg cggcatgacg caagacaacg    219780
     gcacggacga tgacgacaca tagcgaaacc atcacgatcc ccgtgttcga cacgcaggtg    219840
     gccggcaccc tgctcacgcc gcgcgccaag ctgcccggcg tgctgttcgt ccatggctgg    219900
     ggcggcagcc agcgcttcga cctgagccgc gcgcgcgaca tcgccgggct gggctgcatc    219960
     tgcctgacct tcgacctgcg cggccatgcc gccaccgagg cgcagcggcg ccaggtcacg    220020
     cgcgaggaca gcctgcgcga catcatggcc gcctatgacg cgctgatcgc ccacccagcc    220080
     gtcgatacgt ccgccatcgc ggtggtgggc agcagctatg gcggctatct ggccgccatc    220140
     ctgaccacgc tgcgcgcggt gcgctggctg gcgctgcacg tgccggcgct gtaccgcgat    220200
     gacgaatggg cccagcccaa gctgcagctc gaccgcgccg ccatctccgc ctaccggcac    220260
     gccaccgtgg cgccggaggg caaccgcgcc ttgagcgcct gctcgtcgtt tcgcggcgac    220320
     gtgctgatcg tggaggccga gcacgacgac tacattccgc actcgaccat catgagctac    220380
     cgcggcgcgt tcctgcattc ccactcgctg acccatcgca tcgtcgacgg cgccgaccac    220440
     gcgctgagcg acaagcgctg ccagcaggcc tattcgtcca tcctgctgaa ctgggccacc    220500
     gaaatggtgg tgggcgcgcg ggtgggcgcg ggccggcccg cctgagcgcg cgggcacgcc    220560
     gcttgccgcc cactggccac gcagacgcca tgaacccatt gcaacgcctg ccgcattgtc    220620
     acgccctgcg gcgcgcggcg ggcaacccgg agccctagac catgaaaccc acccccacgt    220680
     cccaggaccg caagcaggat gacgacaccc aacgcgaagc gcagcgcagc cacggcagcc    220740
     agcaggcacg caccaagaag gacggccatg tatcgcagat aggcagcaac caggatcagt    220800
     ccagccaacg caaccggggc cagggcgcgc gccgctcgtg agccccgcgg cgcccgccgc    220860
     gctgcgctat gtggacgaca gccgtcccgg cctggcgcgc cgccggctac ccggcggaaa    220920
     gttcgcctac tacgatgcga acggccgccg ggtacgcgac cctgccacgc tggcgcgcat    220980
     cgcggcgctg gccatccccc ccgcctatcg cgaagtgtgg atctgcgcgc gcgcggacgg    221040
     ccatctgcag gccaccgggc gcgacgcccg cggccgcaag caataccgct accaccccga    221100
     ctggcgggcc tggcgcgacg cggccaagta cggccagctg cgcgagttcg gccgcgccct    221160
     gccgcgcatc cggcgccgcg tggcgcgcga cctgtccagc cgcggcctgg cgccggacaa    221220
     ggtcgccgcc acggtggtgc gcctgctcga aaccacgctg gcgcgggtcg gcagccgcgc    221280
     gtacgcgcgc gagaacggct cgttcggcct gaccaccgtc acgcgccgcc atgcctggct    221340
     gcagggcagc cggctgcgcc tgcgcttcac cggcaagagc ggcgtggcac acgatgtcac    221400
     cgtacgcgac cgccgcatcg cgcgcgtggt caagcgctgc ctggacctgc ccgggcaaca    221460
     gctgttccat tacctggacg aggacggcga gccgcgcccg gtggactcgg aactgatcaa    221520
     cgcctatttg cgcgaggccg gcggcggcga tttcaccgcc aagcactacc ggacctgggc    221580
     cgcctccgcg ctggcgcttg cgctgctggt gcgctggccg gccacggacg ccgcggcgcg    221640
     ccgcgcggcc gtggtcgagg tcgtcaagct ggtggccgcc cgcctggcca acacgccggc    221700
     ggtgtgccgc gcctgctaca tccatcccgg catcgtccag gcctacctgg acggcgcctt    221760
     gccggcgcgc ggcgccgcgc cggccgggcc gcgcgggctg gccgccgacg aacgccgcct    221820
     gctggccttc gtggcggcct ggccgcactc agaagatcga tgaacgcgcg ttcctggcgc    221880
     gtggctgcgg cgccgcacca tcggcccagt tggactcggt ctggttgtcc accgccggcc    221940
     cgtgcttgtc cgcctgcgcg cgcgccggcg gcttgggcgg caggttgggc accagcaccg    222000
     ggccgcgcgg cggcagcacc ttggcttgat cgagtgacgg atcatcgtgc gcgtcggcgc    222060
     cgcgcgcggg tttgggcttg gacatcttgc acctcgcgca agagattgcg tacagtgcat    222120
     ggtagtgggc ggcgcggcgc gccgccatca cggctggtct ccatttgcaa gcaagtctga    222180
     gcgcggcgcg ccaggctcgc cgcttgcggc atgcgtggtt tgcccccagg agatggtcat    222240
     gctcaatact cacgttgtcg aatgcctgca ggcctgcggc cgttgcgccg cggcgtgcga    222300
     ttactgcgcc agcagctgcc tgcgcgaagg ccacggcgcc gatatggccc gctgcatcgc    222360
     gctggacctg gactgcgccg ccgcctgccg cctgtgcgcc gccatgatgg cgcgcgaaag    222420
     cgaattttct acagacatgt gcaccttgtg cgcgcgcatc tgcgaagtgt gcggcgacga    222480
     gtgcgcccgc cacgagccgc gccactgcca ggaatgcgcc acggcctgcc atgcctgcgc    222540
     cagcgcctgc cgcgctatgg cccggccctg aggccacgcc ccaccggctt cgtcccgccc    222600
     caaccccttc ccccaaccgg agcagcccgc catgcctact tccaagcgcc ccgccaactt    222660
     ccccgccgac ccgaccgcgc ccatgtccgc cggcgcgcgc cagcgctggc tcgatgaaat    222720
     ccacgccacg ctggacgatc cccaatacgc cgatatcgaa gaactgaagg cccgcctgcg    222780
     gcaacagctg gacgcggcgc gcgaagcctg gtcccagctt gccgacacca ccagcagcct    222840
     ggccagcgaa gcggccgact gcgccgacga gttcgtccat gcgcggccct ggcaggcggt    222900
     tggcgtcgcg gctggcgtgg gcatgctggt cggcgtcctg ctgtgccgac gctgacctgg    222960
     cacgggcacg ccgtttgctg agcctgccgt cccgacaagg aggcatgatg gccagaatcg    223020
     tctggaaagg cgcgatcgcg ttcgggctgg tgcacgtgcc catcgtggtc catgcggcaa    223080
     gccgccccag ccggctcgat ttcgactgga tcgaccggcg cgacaatgcg ccggtgggct    223140
     accagcgcat caacaagcgc accggccgcg cgatcgatgg cgaacatatc gtcaagggct    223200
     acgaatacga gaaaggcgaa tacgtctaca tgaacgacga ggatttcgcc cgcgccaacg    223260
     tcgccgccac gcagaccgtg gagatcctcg acttcgtcaa ggccgaggaa gtaccgctgt    223320
     attacttcga cacgccgtac tacctggcgc ccgaccggcg cggcgggcca ggctacgcgc    223380
     tgctgcaccg cgccctgcgc gacagcggcc gcatcggcat tgcccaggtc gtgctgcaca    223440
     cgcgccagca cctggcggcc gtgatgccgg tgggcgaggt gctgatgctg gtcaccatgc    223500
     gctacgccga cgagatcgtg ccggccgagg aattcggcct ggatgacgcg gccacgcacg    223560
     acaggcccgg cgcgcgcgaa ctgcgcatgg ccatgcgcct gctcgacgac atgacgtgca    223620
     agtgggaccc cgcgcaatac cgcgacgcct atcgcgacga cctgctggcc gccatcgaca    223680
     ggaaagtgcg cgccggcaag acgcatgagc tggccgagcc gggcgaagcc gcgccgcgcg    223740
     ccagcgccaa ggtcatcgac ctggcggcca tgctgcaaca gagcctggag cgcggcaagc    223800
     ggcgcgccgg cgcgcccgcg cccccggcga aaaaggccgc gccggcccgc aaagccacgg    223860
     ccaagggcgc cgccgccaag cgggcgcgca agacgcccgc gcggcgcgcc ccggcccgca    223920
     aggcggcctg acaggagggc accgcgccca tgacacagcc actgcggcag taccgcgaga    223980
     agcgcgattt ccgcgccacc gccgaaccgg ccggcgccgc ccggcgcccg cgcgcggccg    224040
     cccgcgcaag cgaaggcctg tccttcgtca tccagcgcca tcaggcgcgc cgcctgcatt    224100
     acgatttccg tctcgaaatc gacggcgtgc tggtgagctg ggcggtgccc aagggcccgt    224160
     cgcgcgatcc ttccgtcaag cgcctggccg tgcatgtgga agaccatccg ctcgagtatg    224220
     gcggattctc cggcgacatt cccaagggcc agtacggcgc cggacatgtc gacatctggg    224280
     acagcggcgt ctggatcccg cgcggcgatc cgcgccaggg cttgcggcgc ggcaagctgc    224340
     atttcgcgtt gcgcggccgg cgtcttgccg gcgactgggt cctggtgcgc atgagcggcg    224400
     agcaggacca atggctgctg cgcaaggaag acgacgaggc ggcggtgccg ggcgatgacg    224460
     ccgaacgcgc gccggccacc ccgccgcccg ccccggagca cgccccggcg gccacgccgc    224520
     gcgggcgccg cgccgcgatg ccgcacacgt tggcgcccca gctggccacg ctggtggaca    224580
     gcccgccgca tgggccgggc tggtcgtatg aggtcaagta cgacggctac cgcatcctgg    224640
     cggcctgctc ggccggcggc gtgcgcctgg tcagccgcgg caacgaggat tggcaggctc    224700
     gcatggcgcc gctggcgcgc gcgctgggcg cgctgaagct ggggcgcggc tggctcgacg    224760
     gcgaggtcgt cgtgctcgac gaacgcggcg tggccgattt ccagctgttg cagaatgcgc    224820
     tggacggcca ggccgaaggg ctggtgttcg tcgcgttcga ccttcccttc tggaatggcg    224880
     aggacctgcg cgccctgccc ctgcaagcca ggcaagagcg gctcgaggac ctgctgcggg    224940
     aggtgcccga ggacgcgccg ctgatgctca cgcaacgcct gccggtggcc gacgacaccg    225000
     aaggcaaggc ggcctggaac gaagcctgcc ggctgagcct ggaaggcctg atctgcaagc    225060
     gcctggacgc gccttaccgg tccggccgct cgcagggctg gctgaagctg aagtgccgcc    225120
     cgcgccagga attcgtcatc ggcggctata ccgaaccggc cggcgcgcgc cgccacctgg    225180
     gcgccttgct ggtgggcctg cgccaaggcc gccaattgcg ctatgcgggc cgcgtgggga    225240
     cgggcttcgg cgcggccacg ctgcgcacgc tgggccagcg gctggcggcg ctgcgccagg    225300
     atgccaagcc gttttcgggc gacgtgccgc gcggccgcgg cgacgccgcc atacattggg    225360
     tcagccccga gctggtggcc gaagtgaatt atgcgggcat cacgcgcgac ggcctgctgc    225420
     gccaggcttc gtttgccggc ctgcgcgccg acaagcccgc cagcgaagtg cgcggcgagg    225480
     tggccgcgcg gccgccggcg gccaaggccg ccacgccgtc gcgccgcgcc ggcgatggcc    225540
     gcgccgaggt ggccggcgtg cgcatctcgc atccggaccg gctggcctat cgcgagcccg    225600
     actacaccaa gttgcagctg gccgagtact acgcggccat cggcccgcat atcctgccgc    225660
     acctgcgcca gcgccgcgtg gccctgttgc gctgtcccga cggcgccggc acgacctgct    225720
     tcttccagaa gcacctgagc cagtcgctgc ctgccggcgt gcggcgcgac ggcgggcacc    225780
     tggtgatcga atcgctgccc ggcctgatcg cgctggtgca gtatggcgcc atcgagttcc    225840
     atacctgggg cgccgatacc cgccatcccg acacgcccga ccggatcacc ctggacctgg    225900
     accccggccc cggcgtggcg tggccggcca ttgtcgaagg cgcgcagatg gcccgcctgc    225960
     tgatgcagga agtcgggctg gaaccttttc tcaagacgac cggcggcaag ggcctgcacc    226020
     tggtggcgcc gctgcggccc acgcagccct gggacacggt caaggatttc gcgcgcgcgc    226080
     tggcgcgcca gctggccgtg gccctgcccg accggttcac cgccaacatg gccaaggccc    226140
     ggcgcgaacg gcgcatcttc gtggactacc tgcgcaacgg caacggcgcc accgcggtgg    226200
     ccgcgttctc ggcgcgggcg cgcgacggcg cgcccgtttc catgccgctg tcctgggacg    226260
     cgctggacgc cggcgacgat ttgcgcggcg cgcgctggaa catcgccaac gcgctggagc    226320
     aggcccggcg caagcccgac ccctgggccg attatgccgc cagccggcgc acgctgggtt    226380
     cgcgcatgca ggcgcggctg ccgcgcgatt gaccgcaggc atgcgcgttg cggatcggcg    226440
     gcgccgcgcc tcgcggcgca gtcacgcatc aggagccccg tcatgcccaa gaccccatcc    226500
     gacgcttccc ccaaggcccg gcaggccgcc gaccggaccg ccgaacgcca gcgcgccatc    226560
     cagcgcgagc aagaccagcg cgaccaacgc aagcccgcgg caggccggcc aggcgaggcg    226620
     ccgcgcaccg gcgcgcgcga ccatcccgaa ccgcccatgc cgcgccagca tctggccaaa    226680
     cccggcaacg aagccgacat ggcgctgcag ccgcagttcc tggcgccggc ctaccgcggc    226740
     agcggcaagc tggaaggcct ggccgcgctg gtcaccggcg gcgactccgg tatcggacgc    226800
     gcggtcgcgg tgctgtatgc gcgcgagggc gccgatgtcg cgatcgtgta cctgcaggag    226860
     cacgacgacg cccgggaaac cgcccgccac gtccaggccg aaggccggcg ctgcctgctg    226920
     atcgccggcg acgtgcgcga cccggtcttc tgcgaggagg ccgtcgcgcg cacgctgcgc    226980
     gagttcggca agctggatat cctggtcaac aacgccgcct accaggagca cgcttcgtcg    227040
     ttgcaggaca tcaccgacga gcgcctggac gaaaccttcc gcaccaatat ctacggctac    227100
     ttccacatgg cgcgcgccgc gctgccccac ttgaaggaag gcgccagcat cgtcaacacc    227160
     ggctcggtca ccggcctgcg cggccatccc acgctgctgg actactccag caccaagggc    227220
     gccattcatg ccttcacctg gtcgctggcg gccaatgtgg ccgagcgcgg catccgcgtc    227280
     aacgcggtgg cgcccgggcc ggtgtggacg ccgctcaacc ccgccgacca ggcgcccggg    227340
     cagatcaagg acttcggcgc caggaccgcg ctcaagcgcg ccgcccagcc cgaggaactg    227400
     tcgcccgcct atgtgttcct ggccagcccg gcctgcgcca gctacatcac gggcatcgtg    227460
     ctgccggtga cgggcacccc gggcgagtaa ggccctagcg gcccgggcgc gtggcgtcga    227520
     tggacggcgg cgcgctcggc gaggccggcg aaggcggcgc gggctcgccc gggccgcccg    227580
     gcggcagctt gcgcggttcg gcctgcggcg acggccgggc cagccgccgg gcgtcttgca    227640
     gcaggttctg cagcatgggc agcgtatgca cggcgaactc ccgcaccggc gccgcttgcg    227700
     cctcgtcggc cgcctgccgg tagtgccgca gcgtttcctc gcccagggcc acgccggccc    227760
     aatgcaggta catccggtcg aaggcggcct cgcgctgctg cgccagttcc tgcaaatggg    227820
     tgcgttgcgt cacgtcgggg ccggccggca gcgtcaccgc ctgcgcgtgc gccacgtcgg    227880
     ccagttcgcg gcccaggtct tgcagccggg cggccgcctg gcgcgcatag gcctggacgt    227940
     cgccgctggc gccgtgctgc cgcgccaacg cggcggcttg cgccgaggtc tgcgccagtt    228000
     gcgcggcgcg ccgcagccat gcttcgtcgg ccgccgggct ggcctgcgcc gcccatatcc    228060
     ccaggcacag caggccggcc agccaacggg cggccagggc tagccgccgg ccgccagttg    228120
     cggcggttgc aagggatcga agtcttccca tttgccgtcc acccagcgcc cttgggcgcg    228180
     ttcgagatcc tggccgccgg catcgcgcag aagggccagc gtccgttcgg cctgcacacc    228240
     gtccacatgc aaggccagca tcacgccggc atgacgcacc ggcgcgtgtt cgtcggcgcc    228300
     cggcgggctg gctgccggac tggccgtggc cggccgcaac ggccggcggc cgcgcccggc    228360
     cacccacagc gcgccgaaca gcgcgcccac ataggcgccc acgcccaccg ccgcgaccag    228420
     cgccagcgaa gtggccgcca gggcgctggc caccacgccg gcgatcgcgc ccagcgccag    228480
     cccgcccacc gcggcgcccg tgatggcgcc gtactgcgcc ggcccggcat cggggtcggc    228540
     gcgccggtcc ccgcccaatg ggtagcggtc gtgcgcgccg gcgctgttga cgtagaacgt    228600
     atggatatct tcctgcgaaa cgcccgccgc ctgcaagcgc ccggcggcgg ccgcggcggc    228660
     atcgaaagtc atgaaacggg cggcgacgat catcgacatg gtccgtcctc ctgtatccgg    228720
     ggctgccagg cccgcaagcg gcatgcccgc ggtgctcatc cggcatccgg ccggggccag    228780
     gtcaggcgcc agtagcgctc cggggccgca tcgtcgccat gcccaggcac cagtcccaag    228840
     ggttcgagct ggctgtggta ggcggccacc gcccgcgtct tgctggcgcc gcgggcatcg    228900
     cccggcaggg ccaccggcgt ggcatacacc ttgcgcccgt gcaactgggt cagccgtgcc    228960
     tgcaccgcgc cgcggcggcg ccggtacagg acctcctcgt aggccagcca gtcgcagcta    229020
     tcgaacaacc cgcgcaccgc cagcgcggcg tcggccaccc gcacgtggtc ttcatcgaac    229080
     agacccaggg gaatcagcaa ggcgccgggc ctgatcgact ggacggccgc cgccaggact    229140
     gtgggcagcc gcgccagcat cgcttcgctg cccggatact ggctgtcgag caggtccagg    229200
     cccaggcctg acgcgcccag ttcggccagc gcgttgcgat cctccgcctg gcgcgcctgc    229260
     atggcctggt cggcgcgttc gaaaccgcag cgccggtccc agtccggcaa ggcggcagcg    229320
     acgctgggca cgccggaaaa caccgtcagc accgtggcgc cgggcgtggc cgccagcagg    229380
     ccgccgcaac tgaatacggc atcgtcgaaa tgcggggaca ccaccagcag gcgttgcgcc    229440
     atggccgtgc ccgggtcagg gccgacaagc cggcgccatc ccgctccatg gtccatcgac    229500
     ggcgcgcaca cgggtcgcgc cgatggcccg tggaacgggg cgcactgccc gtcgggcgga    229560
     gtgagagtat tgctcgaaca tgatcgcagc tcctgaacga gtgcgcaggc cgcaaacgcc    229620
     gtgcccgtgg cgcccgcgcg agccggcggg cgccgccgcg ccgcaggcac gccgcttgca    229680
     gggcatgagg catcccccac tccggagagc catcgtgccc aagcgttcac tctggcccgt    229740
     ttcccctccc gatgccgagc cccgccccgg cctgggcccc agcgactcat cggactccgc    229800
     cagcgacctg cccgacgcgg cggccgagac cgacagcgat accggcggca ccggcgagcg    229860
     ccccggcgtc gagtatgacc ggcaaccgcc cgacggcgcc gatatcgcgc ccgacacgca    229920
     gaccgacgcc ggacatgccg gggtttcccg ccatcgcccc gactccgtgc gcaacggcgg    229980
     gccgccggac cagccttgac ccggcgtgta gaaaatccac ttcggcccca ggcctgcaca    230040
     ggagcgcatc atggacgtgg actggaacgg cgtgttcgcg ttgaccgtac cgcctctgga    230100
     gctgttcctg cgcggaacgc tgatctactg gttcctgctg gcgctgttgc ggctggcggg    230160
     acggcgcgac atcggctccc tgggcgtggc cgacatgctg gtgctggtgc tgatcgccga    230220
     cgcggcgcaa aacgccatgg cgggcgaata caagtccgtc accgacggcg ccatcctgct    230280
     gctgaccatc gtgggctgga ccgtggccat cgaccgcgcc agttatttcc tgcccgcggt    230340
     gggccgcgtg ctggcgccct ccacggtctg cctggtgcgc gacggcgagt tgcagcggcg    230400
     caatatgcgg cgcgaataca tcaccgaagc cgaactgatg agcgagctgc gcctgaaggg    230460
     ctacgacagc ctggacgacg tacaccgcgc ctatatggaa cccgacggca acatcagcgc    230520
     gttgcgccgg cacggttgag caggccggcg ccgggcgcgg ccgtcccggc gtcggccggc    230580
     aggactggcc taccagtacg gccgctggtc gtaataatcg tagagctcct cggcccaacg    230640
     cttgtccgcc atgcccggcc agtcgttctt gtcgaagccg ccagcctgcc tgaggtggtc    230700
     cttggggatg tcgagcacga agcatttatg gtcggtatcc agcaccagcg cgctccaggg    230760
     cagcgcgaac agcttgtcgc ccatgcccag cacgccgccg aacgacagca ccgcgtaggc    230820
     gacgcggcct tgcggcacgt cgatcatgat gtgctgcacc gaaccgagat gctcgccctg    230880
     ggggttcagc acgcggttgc cctccagcgt gtcggcggcc atgatctgcg ggccggggcc    230940
     gacggcgctg aactttgcgc ggccgacgat gcgcgtcggc ccgctggctg cggcggccgc    231000
     ggccagcggc gcctgtcggg aagagatgtc catgtccggc tccttgttca tggcgcgttc    231060
     gtgggcgcga cgacgcgaat gcggttgtcg atgtcggcca cgcccaggca gtcgtccgcg    231120
     cagttctcga tggcgtactt gtcgcgccgg cgggctaccg tcccgctcag ttcgacctgg    231180
     ccgtctgtca ccgagaccga tacatcgctg acatccaggc cgctgtgcgc caggcgttcg    231240
     cagacatcct cgcgcaagcg ctcgtccgag cgggtgtagc ccttgggcag gatgcggcgg    231300
     ctgcctgcgc ggtgcccggc gccggccagg ccggcccatt cgccgccgtc gccgtggtag    231360
     ccgccgtagt cgccggccag cgggccgtca tggaattgct gccgctgcca gcgcgggtcc    231420
     tcgtcgcgga acccgccata gctgctctgg cccggatcgg cgctgcggct ggtgatcggt    231480
     tcgttccatt gcgcgcggcg cgtgccggga taaggtccgc cctgctcgta ttgcgggccg    231540
     cggcggttcg gctggccgcc cgttgcgcga ttggggcgtt cgccgtaggg acggccgtag    231600
     tccggttctt cggcccccca gcggccgctg ccgcgactgt agtcctgcgc ttcgggacgg    231660
     tcgttgccat gccacgaagg cctgccttgc cggacgtcgc ggccgcccag ccggaagtcg    231720
     cgctcgaatt cgtcatgggg gccgaaatcg tcgtcgccat acggcggctg gcgtcggttg    231780
     tcgttacgca tcgccttctc ctgcgttgtg ggttgcggat cgggccggcg gcgcgccgcc    231840
     gccgggcttc gtatccgctg cggcgcgcaa gtgctgtgcc ggccttgccc ggcatggcgc    231900
     gaaggcgggc aaggcttgcg cgaagcacgc aacgagagcc gcgtacgcaa tccgctgtag    231960
     ccgggcgctg tccgggacgc tagcgtctgc gcccgcggtc ggacatggcg caggcgccca    232020
     gcagcgcgcc cagcacgatg gccaccccga tcagcttcca gctgttctcg tgcacgtacc    232080
     cgtcggcgac gcgcgaggcg cgctggtagc gctcgacggc gctgcgttcc cagccgccgg    232140
     cctggtcgcg cgccgcttcc agttggtgct tgagccggtc gcgcaccgac tcgagttcgg    232200
     agccgccgta cgacgcggtc gaacgcagca gcgcctcggc gccggcgatc aattcatgca    232260
     ggccggattt gacctgctgt ttcgattcgc gcatgcgggc gcggtcttcg gtatgtgcat    232320
     gcatgacgtc tccttgcaga aaatgccggc gccgccgagg tggcgaacgc tcgccggccg    232380
     cagtgcgcaa gtcgcgtgcc gccccgcggc agggccgttg cggtccctgt cacagctccc    232440
     gcgtggcccg ccgccagacc gcctcgaaat cgttgtcgga ccagcgatcc atgcccggcg    232500
     tgttctgcgg gctcagccct ggcatggggt tggcgatggc gccggactcg cccggactgc    232560
     cgtcggcctg ctctacgcgc ggccgcggct ttctgggcgc gggcgtctcg tcgcggcgtg    232620
     gcgcggacgg tttggacgat ggagtatcgt tcgatgcttt catgatgcgg ctcctgctga    232680
     tggcggaaag aaaacggcat gtcggccggc ctcagccggc ccaccattgc ttgagggtgg    232740
     cgcgcagcgc cgcgccaccg gccgggtccg cccgcagcgc ctgcacgtag gcgcgcacct    232800
     ggcgcgccgg gatgtgcggc ggcagcggcg gcatctcggg gtcggtcatg acttccagca    232860
     ccgccgggcg gccggcggtc agcgcctcgc cccaggccgc gccgagatcc tgcgcgcgct    232920
     ccacgcgcaa gccatgcagg cccagcatgc gggcgtaatc ggcataggcg aacggcggca    232980
     ggcgttgcga atcctcgaag cgcggatcgc cgcccatcac gcgctgctcc caggtcacca    233040
     ggttgagatc gccattgttc agcaccagga ccaccagcgt ggggtcggcc caggcgcgcc    233100
     agcggtcggc gatggtgatc agctcgttga tgccgttcat ctgcatcgcg ccgtcgcccg    233160
     ccagcgccac caccggccgc tcgggatagg ccagcttggc cgccagcgcg taaggcacgg    233220
     cgcagcccat cgtggccagc ccgcccgaca gcgacgccat catgccctcg cgcagcttca    233280
     cgtcgcgcgc ataccaattg gccgccgagc ccgagtcggc cgtcacgatg ctgcggtccg    233340
     gcaggcgctg cgagagctcc cagaacacgc gttgcgggtt gaccggcgag gcgtccacca    233400
     tggcgcgcgc ctcgacggta cgccaccagc gcgccaccga cgcttcgatg cgttcgcgcc    233460
     agcgcgcccg cggcttgttc tcgagcagcg gcaacaaggc ctgcagggtc tggcggctgt    233520
     cgccggccag gcccacttcc accggatagc gcaggttcag gttgcggccg tcgcgatcga    233580
     tctgcaccgc gcgcgcctgg ccttcgcgcg gcaggaactc gctgtacgga aaggccgtgc    233640
     cgaccatcag caaggtgtcg cattcgttca tcatctccca gctgggctgc gtacccagca    233700
     ggccgatggc gccggtcacg tagggcaagg cgtcgggcaa ggcggccttg cccagcaagg    233760
     ccttggcgac cccggcgccc agccgctcgg cgaccgcccg caagggctcg gccgcttcca    233820
     gcgcgcccgc gccggccagg atggcgaccc gctcgccgcg attgagaatg tcggcggcat    233880
     tgcgcagcgc cgtatccggc ggcacccccg catgcgaggt gacgccgatg ccggtcggca    233940
     cgctgccatg ttcgcgcggc agttcacgca ccgccggcag atcctgcacg tcattgggca    234000
     ggatgacgca ggtcacgcag cgccgctcca gcgcaatgcg cagcgcgcgg tcgatcaggt    234060
     gccgcgcctg ctcggcgctg gcggcctgct gcacgaagtc gtgcgcgaca tccttgaaca    234120
     gcgaaaccag gtcgacttcc tgctggaagt cgccgcccag cgcgcggcgc gcctgctggc    234180
     ccaccagcgc caacacgggc tggtggtcca gcttggcgtc gtacaggccg ttgagcagat    234240
     ggatcgcgcc cggccccgag gtcgccatgc agacgccgac ctggccggtg aacttcgcat    234300
     gcgcgcaggc catgaaggcg gccatctcct cgtggcgggc ctgcacgaac tccagcggct    234360
     ggcgcgtgcg cccgaatgcg cccatcaggc cgttgatgcc gtcgccagga tagccaaaga    234420
     tgcgccggat gccccattgc gcgagacgct ccagtacgaa gtccgatacg gtttccatgc    234480
     ctgcccccga aaagtgccgg cgcccctggg gcgcctggct ggcgggtcag catgtgccat    234540
     gcccgtgcgg gtctcagtgc tgcgcgcgcg gggctgctcc ctcttcgttg gccgcggcgt    234600
     ccggcggtcc tgcctcgcca tactcttcca gccggttgta gagcgtcttg gcgctgatgc    234660
     ccagcatcgc cgcggtctgt ttcttgacgc cgccgcaacg ctgcaaggtg gccaggatca    234720
     gacgccggtc cgcctcggcc agcgtcgagc ccaccggcac gatcacctgc ccgccgccag    234780
     ccgcgtcgct gggtgagatc tgcggcgtga gcgcgctggc gtccagcgtg tcggattcgg    234840
     ccaggatgaa cgcgcgccgc acgaagttct tcagttcccg cacgttgccg ggccaggcgt    234900
     actccgccat gctctgcagc gcctgcggcg cgaagcgctt gctcttgccg tactcgcggt    234960
     tcagtccgtc gaggaaacgc tcggccagca tggcgaggtc gtcgccgcgc tcgcgcagcg    235020
     gcggcaactc gatgggaaac acgctcaggc ggtaataaag gtcttcgcgc agcctgccgt    235080
     cgcgcaccgc ctgctcgggg ctgcggttgg tggcggccac cacccgcacg ctgcaggata    235140
     tctcgcggtt ggtgcccacc cgcatgaagg cgccggtctc cagcacgcgc agcagcttga    235200
     cctgcaagtc cagcggcatt tcggtcactt cgtccaggaa cagcgtgccg ttgtcggcgc    235260
     gttcgaaata gcccttgtgc tggcgctcgg cgcccgtgaa gctgccccgt tcgtgcccga    235320
     acagttcgct ctcgatcagg ttgggcgaga tcgcgccgca gttgaccgcc acgaaggggc    235380
     cggcgcgccg cgcgctgagc tcgtgcaccg cgtgcgcggc cagttccttg ccggtgccgc    235440
     tctcgccgat cagaagcgtc gtgacctcgg tgggcgccac gcgcgagatc tggcggtaca    235500
     gcgcctgcat gggcgccgac gcccctacca ggcgtccgaa gcggccgtcc tgctggaacg    235560
     gctgggaggg gtcccagtcg ccgtcctgcc ccgccgacgc cacgcgcgca agaatctgtt    235620
     cgaggcgttc catgcagatg ggtttgacca ggtaatcggt ggcgccggcg cgcagcgctt    235680
     cgatggcgtt ttccatgctg ccgtagccgg tgatcaccac cacctcgacc ccggcatgcg    235740
     aaatgcggga gaacaggtcc atgccggtgg cgccgggcag gcgcacatcg gtcagcacca    235800
     ggtccggcaa ttgccgttcc acctggatca gcgcgtcgcg caccgtcgcg gcctgcgcca    235860
     cggtatagcc gtgctcgcgg ccgatctcga ccaggctttc gcgtaccgca tcgtcatcgt    235920
     caacgatcag caagtgaggc atcgttcccc cgcaatgcaa gaattgcgca cggcgccgcc    235980
     agccgccctg ccgtgcagtc agtgtgcatg agtgaagtac ccgtgctgcc ttgatagcgt    236040
     agcgtggcgg ggtcgatatg gcggtaacaa caccctacgg cgcaacattt ttttccaacc    236100
     tttgcatctg gtctcacccc ttgcacggtc ggcgcatgac aatggacccg tcgcctggtt    236160
     tcttgccgcg aggctgcatc gtgcccaacc aaaccgtaac tccggctgca acgatttccg    236220
     acgccctcga acgccttgcg gcgctgggcc ccagcgcatg catgcgcaag ctggccgcca    236280
     gcatcgagcg cgccgccgac agcgacgcca ccgtactgct ggtgggtgaa agcggcaccg    236340
     gcaaggatgt gctggcccgt gccatccatg acctgggcgc gcgccgcgac gcgcccttca    236400
     tggccatcaa ctgcggcgcg atcagcccga cgctggcgca tgcgcagctg ttcggccacg    236460
     agaaaggcag tttcacgggc gccctgtcgc acaacgccgg ctacttcgag aacgccagcg    236520
     gcggcacgct gttcctggac gagatcaccg agatgccgcc cgacatgcag gtgcatttcc    236580
     tgcgggtgct ggaaaccggc gcgtaccgcc gggtcggcgg cgtagagctg ctgcacgcca    236640
     acgtgcgcat catcggcgcc accaaccgcg acccgcacgc cgcggtggcc gagggccggc    236700
     tgcgcgagga cttgctgcat cgcctgctgg tgctgcccct gcgggtgccg ccgctgcgcg    236760
     agcggccgca ggacatccgc ttcctggccc agcggtttct cgacgaactc aatgcgcgcc    236820
     acggcaccgc caagcgcttt tccggcgcca tgctcgacgc gctggccgcc cacgactggc    236880
     ccggcaacgc acgcgagctg cgcaacgcgg tgcagcgcgc ctatatcctg caagacggcc    236940
     cgatcggtcc gcaggcgctg gccgatacgg tgttgcgccg cccggcccgg caggatgccg    237000
     atacgttggc ctttcctgtg ggaactcccc tcgaatgcgt ccagcgcgag ctcatcctcg    237060
     ccacgctggc gcgcgcaggc ggcgacaagc ggcgcgccgc ccgcaccctc gcgatcagcc    237120
     tcaagacgct ctacaaccgc ctcaacgcct atggcgtggg cgccggcgcg gacccggaaa    237180
     aaaatacggc gacgttgtaa ctcctggctc cgccgcgcgc cgccgtaacg ccgcgccccg    237240
     agagaagcgc tggctggcac cgatcttgcg tactcctctg gtatgttccc gcgcccaggc    237300
     gcgtccctgt cggaggaaaa cttgagccac gtcctgcagg atctgcggct gcgccagcaa    237360
     accacgctgg cgccacgcct gcagcagtcc attcatttgc tgcaaatgtc ggcgctggag    237420
     ttcaccacga cggtgcaaca ggccctggcg accaatccgt tcctggagga cgccgacgag    237480
     accgaagcgc aggacgacgc gccggcgccg cccgcagcgt ccgagccgcc cgcgacatcc    237540
     gagccgccgc ccgagccgcc ctcctatgcc ggcgactatc ccacgcgcag cgccgccgcc    237600
     cagcctggcg tggccagcga cgcggcggcc tgggtgccgg ccaccctgag cctgcacgaa    237660
     cgcctgtcgc aggcgctggg cgcctatgtg ctgagcgaac gcgaccgtgc gctggccgag    237720
     ttcatcgtgg atggactgga tgacgacggc tacctgcggc aggaattggc ccaattggcc    237780
     ggcgtcgccg atttcgaccc gccgcccgag gccagcgaat ggcaggcggc gctgcacctg    237840
     gtccagcaac tcgatgcgcc gggcctggcc gcgcgcgacc tgcccgaatg cctggccctg    237900
     cagatccgcg cctgtagccg gctcgatccg gccgtgcgcg acgccgccct ggccatcgtc    237960
     gccgcccacc tgccgcgcct ggcgcgcagc gattaccccg gcatgcggcg cgcgctgcgc    238020
     tgcagcgaac cggtgttgcg ccaggcgtgc ggggtgatcc gcggcctcga ccccaagccc    238080
     ggccgccgct atgcgcacga accgcccagc tacgtcgtgc cggatgtggt ggtcagcaaa    238140
     cagcgccagc aatggctggt ggtgccgaat cggggcgcca tgccgcatgc ccggctgcac    238200
     caggcctatg ccgacctgtt ccggcgcgcc cgcatggacg agcgcagccc gatggcgcag    238260
     gagctgcagg aagcccgttg gctggtgcgc aatgtcgagc aacgctacgc caccatccgg    238320
     cgcgtggccg aggccatcgt gcagcgccag cagatgttct tcgagttcgg ccagatcgcg    238380
     ctgcggccgc tgatgctgcg cgaggtggcc gacgagctgg agatgcacga gtccacggtc    238440
     tcgcgcgcca ccgccaacaa gtacatgtcg acgccgcgcg gggtgttcga gttccgccat    238500
     tttttctcgc gcgaactgag caccgagtcg ggcggcacgt gttcggccgc ggccgtgcgc    238560
     gcgctgatcc gcgaatacat cgacgcggaa gacccgcgca tgcccttgtc ggatgtgacc    238620
     ctggccgaac ggctggccgg cgacggcatc gtggtggcgc gccgcacggt gtccaagtac    238680
     cggctgcagc tgcgcctgcc cgccgccgac gcgcgccgcc agtactactg acgcgcgccg    238740
     gcgcggaccg gtcccgccgc tacttcgatc cgcccgtgtt ggggtatccc ggcggcggcg    238800
     aagcgccctg cgccggcgtg gccggcgggt tgtcgttgat gtcgggctgg cgccgcggca    238860
     tgtcgccgcg cgtgtcgttg ccgcgctgct cgttcatgtg ctgctgcggc gtcttgggca    238920
     tcccgtcgtg ggtggtggtg ccgggcgcgg gcggcacctg gcccggcggc accggccggt    238980
     tcggcggcac ggccgtcgaa tcgttgggcg tggtcgaagg cgtggtcggc gcggtgccgc    239040
     tttgcgccag ggcgccgcca tgcgccagca gcgcggccat ggcgccggca accaggtaaa    239100
     tcaggcttcg ttgcttcata tcgatgtcct ccaggtaagg cccctccatt tcgcaagcgg    239160
     cgtgcctgtc ggccacgcgg cccgtcgcct gcgttgcagc gcatcactgc tggcggcggc    239220
     gaacattgcg cgccgaccga cgaggcggaa ttaccggcgc atgcaacaac ggcgcagcgc    239280
     cggcagcgcg cgccccgccg atacgcgggc tcgcaacggc cgccggcgac cggatacggc    239340
     tggcgaacaa cccgggcacg gcgcttgcgg aaccagcgca tcggcccgat cacgtccctg    239400
     tttgcggcgc gggcatcctc tcagggagct tgcatgacga ccatacgtac cttggtggtg    239460
     gccgcggagg cgtttccgct ggccaagacg ggcggcctgg gcgacgccgt ggcgggcatg    239520
     gtgcaggcgc tgggccaccg gccgggcggt gtggacgtgc agtgcgagtt gctgatgccc    239580
     gcctatcgcg gcacgctgga caggctgtac cggccgcgca cggtcgcgcg gctgggcgga    239640
     ctgcccggcg gcccggccag tctggtgcgc ggccattgcc cgggctcggg attgtcggtg    239700
     ctgctgctgc gcaacgacgc gctgtacgac cggcccggca tttacgtgga cgacagcggc    239760
     cagggctacc cggacaatgc ccgccgctat gcggccctgg cccacgcggc cgcccggctg    239820
     gcgcagggcc tgcccgggct gcggccgccg cacgtggtgc acgcgcacga ctggcatgcc    239880
     gcgctcgcgc cgctgctcat ccacgcggcc ggactgcact acgtcaagac gctgctcacc    239940
     attcacaacc tggcgttcca gggtacgttt ccggccgagc tggccagcgc gctgggcatc    240000
     ccgctggcgt gccggcacga cgacggcgcg ctgtccgatg accgagtgaa tttcctcaag    240060
     gccggcatcc gttatgcgac ccgcgtcacc accgtcagcc gcgcctatgc gcgcgagatt    240120
     ctcacgccgg cgttcggttg cggattgcac ggtttgctgc gcgcgcgcgg cgccgacctg    240180
     agcccggtgc ccaatggcat cgacaccgcg ctgtggaatc cggccgccga cccgcatctg    240240
     ggcggcctgc gcttcgacgc gctggatatg cgcaacaagg cctgttgcaa ggccgcgctg    240300
     caggccgagc tgggcctgca gctgcgcgcg gacgcgaccg tgctggccat gggcagccgc    240360
     ctgaccggcc agaagatggc cgacgtggcc atcgccgccc tgcccgccct gttggaggcg    240420
     cacgaacact tgcagttcgc gctgatcggc cgcggcgagc cggacctcga agcggcgctg    240480
     cgcgccctgg cggcgcgcta cccgggccgc tgcgcggtcc acatcggcta cgacgaaccg    240540
     cttgcgcacc ggctgcacgc cggcgccgac ctgctgctgc acggcagccg cttcgagcct    240600
     ttcggcctga ccccgctgta cgccatgcgc tatgggaccc tgccggtggc ctcgcgggtg    240660
     ggcggcatgg tcgataccat ccgcgacccg ggcccggcga tcgaagagtc ctgcgccggc    240720
     cagggcacgg gtttcctgtt cgatggcagc gagcccgccg acatgcggca ggccgtgacg    240780
     cgtgcgctgc gcgcgctggc caagccggcg gtgcgcgacg ccatgcgccg caatgccatg    240840
     caggccgatt tcagctggcg cacctcggcg caggcttatg cggggctgta cgccaatctg    240900
     gccagcgggc cgcagcgcgg ccgggtgccc gcgcccacgc tgccgctgct ggccaacgcg    240960
     gcctgaggca cggcgccatg gttcgccgcg ccgccgcccg cctcgatcgc gacgccgaac    241020
     tgctggcttt tcacgccgcc gcgatcgcgc tggcgcgcgg cgcgcgcgcc agcccgtacg    241080
     cggcatggca ggcgctgtgc acgcggctgc gccgctgcgg cttcaacgcc gtgtgcctga    241140
     cgccgccgtg gcaatgtcgc gacgacatcc agggcgcgcc ggccgacgtg gaccatgccg    241200
     atgcgcgctg gggcggcggc gccatggacg ccaccctggc gcgcctggcg cgcgaggccg    241260
     ccgcgcaggg cctgacactg ctgctggacc tggagcccga ccgggtggcg cgcgacgccg    241320
     cgccgcgcac cgcgcaggcg caatggctgg agagcccggc cgacgagccg gccggcgacc    241380
     cgcgccagcc cgctgcgcgg cacggcgtgc gctatgtgcg cggccgcccg gcgccggccg    241440
     ccttcctgca ggcctggcag tcccgcctgg ccggatggct ggacgccggc gtggccggct    241500
     ttcgctgcac cgcgccgcag cgtctcgatc cttccgactg gcgcgccctg ttcgaaccct    241560
     tgcgggccag ccggccggcg ctgcggctgc tggcctggac cgcgggcctg acgccggcgc    241620
     aatcggccgc cctggccggc gcggggttcg acggcgtatt cggctcgatc ccctggtggt    241680
     cgcccgacgc cgcgtggctg gacgccgaat cgcagcgcct gcgcgagata gcgccgctgc    241740
     tcgccgcccc gctcgccccg gccggcggcg cgccgctggc gcccgccagc gcggccgcgc    241800
     acgccgcgct gcgcgccctc tgggtggccg cgctgtgggg cgacgggctg ctggtgggca    241860
     gcgaactgca gcgcatgatg cccgccgtgg cgcgcgcgct gcgctggcgc cgccaggccg    241920
     cgccgcgcgg ccggccggtc ttgctgtgcg ggcgcgatgg ctgggccacg ctgatcatcc    241980
     gcccgggccc gcccggcacg agccatgtgc tggcgctgga tccgcaggcc gcgcatgagc    242040
     cgcgggtcga ctggagcgcc ggcgccgcgt tgctgccggc cggcgtgcct aggcacctgg    242100
     ccgacccggt cgaacactgc gcgctgtacc gcgttgccgc cgagcgtccg gtgcgcgcca    242160
     cggcgggcgc gctgttgccc ggcccgccct cggcgtgcga ccgcgacgcc cgcgtcgtct    242220
     tcgagcacgt cgcgccttcg gtggcgcacg gcagcctggc cgccaaggcc ctggcccatg    242280
     tgccggtcga agtcggcgtc gacctgatct cggacggaca cgaacagctg gccggcgagc    242340
     tgcaatggcg ggccgtcgac caggccggct ggcacggcgt gccgctggcg ccgggcgaca    242400
     acgaccgctg gcacgcgcgc ttcgcgccgc gccgggtcgg cctgcatgag ttccgcgtgt    242460
     gcgcctggcg cgacacctgg ctgactttct gccgcgagct gcgcctcaag cacgaggccg    242520
     accaggacat cgcgctggac ctcgccgagg gcgccgcgca cctgcgggca gccctggcgc    242580
     ggcgccaggc gcgcggcgac gcgcgccgcg cgcccatcga agcggccctg tccatgctga    242640
     atggcgggcc ggcgccggcc gacgccgtgg ccgccctgct gcgcgacgga ctggcccagg    242700
     ccatgcgcgc gctggccgcg cggcccttca tgcacaccag cgcaagccga ccgctctggg    242760
     tcgaccgcgc ggccgccggc cacggcagct ggtacgaact gttcccgcgg tcgcaggccg    242820
     tgcccgccgg cgcgcacggc accttcgacg acgtgatcgc gcgcctgccc gcgctgcgcg    242880
     ccatgggttt cgacgtcctg tacctgccgc ccatccaccc catcggccag tcgcagcgca    242940
     agggccgcaa taacgcgctg caggccgccg ccgacgaccc cggcagcccc tacgcgattg    243000
     gttcgcccga cggcggccac gacgccatcc acccgcagct gggcacccgg gccgacttcg    243060
     cgcggctggt gcaagccgcc gcggcgcatg gcatggaagt cgcgctggac ttcgcgatcc    243120
     agtgttcgcc ggaccatccc tggctgcaac gccaccccga ctggttcgag caccgcgccg    243180
     atggctcgat ccggcacgcc gagaacccgc ccaagcgcta tgaagacatc gtcaatgtca    243240
     gcttctacga ccaggccagc ggccgcccgc gccgggcgct gtggcgcgcg ctgcgcgatg    243300
     tgctgctgta ctggatcgac gccggcgtgc gcattttccg cgtcgacaat ccgcatacca    243360
     agccgctgcc gttctggcag tggctgatcg ccgacgtcca cgcccgccac cccgacgtgg    243420
     tgtttctttc cgaagccttc acgcgcccgc gcatgatgta ccgcctggcc aagctgggct    243480
     tcacccagtc gtatacctat ttcacctggc gcaatacccg ccatgagctg gacagctatc    243540
     tgcgcgaact gtcgcgcccg ccggtctgcg agtggttccg gcccaacttc ttcgtcaaca    243600
     cgcccgacat caatccgtat ttcctgcagg cctcgggccg ggccggcttt ctcatccgcg    243660
     ccgcgctggc caccgccggc agcggactgt ggggcatgta cagcggcttc gaactgtgcg    243720
     aggcccagcc ggtgcccggc aaggaggaat acctggactc cgagaagtac cagttgcgcc    243780
     agcgcgactg gcatgccccc ggcaacgtga ccgccgagat cgcggcgctc aatcgcatcc    243840
     gccgcgccaa cccggcgctg cacagccacc tgggctacgt gccgctgcag tgcgccaacg    243900
     agcaggtgct gacgttctgc aaggccacgc cgaaccgggc cagcgtggtg ctggtggcga    243960
     tcagcctgga cccctgggcg ccgcaatcgg tccgggtggc cctgccgcgc tggctgttcg    244020
     gcctggacga cagcgccgac ctgcacggcg aggacctgct cgacggcgcg cgcgcaagct    244080
     ggcgcgaggc cgcgctggac ctggaattga cgccgcaacg tccataccgg ctgtggcgcc    244140
     tgtggtcccg acccctgtca tcctgagcgt accgatcatg cctgccaccc atcccgctcc    244200
     cgacccgctc tggtacaagg acgccgtcat ctaccagttg cacgtcaagt ccttcttcga    244260
     cgccaacgac gacggcgtgg gcgacttcgc cggcctgctg gccaagctgg actacatcgt    244320
     cgagctgggc gtcaatacca tctggctgct gccgttctat ccgtcgccgc gccgcgacga    244380
     cggctacgac atcgccgact atcgcggggt gcaccccgac tatggctcgc tggccgacgc    244440
     ccggcggctg gtgcgggcgg cccacgcgcg cggcctgcgc gtcatcaccg agctggtcat    244500
     caaccacacc tccgaccagc acccttggtt ccagcgcgcc cgcgccgcgc ggccgggttc    244560
     ggcgcaccgc gcctattacg tctggtcgga cgacgacaag gcctatgccg gcacgcgcat    244620
     catcttctgc gacacggaaa agtccaactg gacctgggac ccggtggccg gcgcctattt    244680
     ctggcaccgc ttctattcgc accagcccga cctgaactac gacaatccgc aggtgctgcg    244740
     cgaagtgctg ggcgcgatgc gctactggct ggacatgggc gtggacggcc tgcgcctgga    244800
     cgcggtgccc tacctggtcg agcgggaagg caccaacaac gagaacctgc cggaaaccca    244860
     cgccatcctg cggcgcatcc gccgcgtcat cgacagcgag tatcccggca ggatgctgct    244920
     ggccgaggcc aaccagtggc ccgaggacgc gcaagagtac ttcggcgccg gcgacgaatg    244980
     ccacatggcg ttccactttc ccctgatgcc gcgcatgtac atggccatcg cgcaggagga    245040
     ccgcctgccc gtcaccgaca tcatccgcca gacgccgtcc atcgcgccgc aatgccaatg    245100
     ggccattttc ctgcgcaacc acgacgagct gaccctggag atggtgacca gccgcgaacg    245160
     cgactacctg tggaacgtct acgcggccga gccgcgcgcg cgcatcaacc tgggcatccg    245220
     gcgccgcctg gcgccgctgc tcgagcgcga ccggcgccgc atcgaactga tgaacagcct    245280
     gctgctgtcc atgccgggca cgccggtgct gtactacggc gacgagctgg gcatgggcga    245340
     caacatccac ctgggcgacc gcgacggcgt gcgcacgccc atgcaatggt cgcccgaccg    245400
     caacggcggc ttctcgcgcg ccgaccccga gcgcctgccg ctgccgctgc tgatggggcc    245460
     gctgtacggc tacgaggcgg tcaacgtgga ggcgcagcag cgcgacccgc attcgctgct    245520
     gaactggacc cgccgcatgc tggccaagcg ccgccagagc catgtgttcg gccgtggcga    245580
     actgtcgttc ctgtatccgg gcaaccgcaa gatcctggcc tatctgcgca cctgggaaga    245640
     cacggtggtg ctgtgcgtgg ccaacctttc gcaggcggcc cagccggtcg aactgcacct    245700
     gtccgagtac gccggccgcg taccggtgga aatgctgggc ggcaccgcct ttccgcagat    245760
     cggcgagctg ccctatctgc tgacgctgcc gcctttcggc ttctactggc tggacctgag    245820
     cgccggcgcc gcgccgcccg cgtggcacag cgagctgccg ccgcaaatgc cggaatcgat    245880
     caccctggtg tcgcgcggcg cgggcgcggc gctgcgcctg accgaggcat cgcgccgcca    245940
     gctggaagcg gacgtgctgc cggcctacct gcagcggcag cgctggtatg ccgcgcgccg    246000
     caagcccgga gtcatgcggc tggcctacag cgtgccgctg aacgacgacg tggaaagcta    246060
     ttacgaagcc gagatcgaag tcagcgacga cggaccgccg cgccgcttcc atacgccggt    246120
     ggcgctggcc tggcaggacg ataccgccgc ccagtatccg ctggcgcgcg tgcggcgcgg    246180
     cgcgcagctg ggcacgctca ccgacgcctc gctgcagccc ggctatgcgc gcgtgctgct    246240
     ggcggccctg acggccggcc gcgatatcca ggccggcggc gagcccgccg tgcggctgcg    246300
     cttcctgccc gagccgggcc tggccgacct ggcgctgcgc gatgacagcg aggtgcgcgc    246360
     gctcagcgcc gaccagtcca acagttcgct gctggtcggc gagcgcgtcg tgttcaagct    246420
     gctgcgcgag ctgcatgccg gcccgcaccc cgaagccgag atgacgcgct acctcaccca    246480
     ggccggctac gcgcatacgc cggcgctgct gggcgaggtc gtgcgcgtgc agggcgacca    246540
     ggcgccccat acgctggcgc tggcccacgc ctacgtcgtc aacgaaggcg atgcgtggaa    246600
     ctggaccgtg gcctacctga agcgcacggt cgacgccgcc atgctgaccg gcgccagcgc    246660
     cgacgactac cagcaggaac tggccggcta cgaagtgctg gccggcacca tcgggcaacg    246720
     cctggctcag atgcactcgg tgctggcgcg tgccggcgaa ctgccgggct tcgcgccgcg    246780
     gccggccagc gagcgcgacg ccgccctggc gggcgagcac gcggtggcgc agctggaccg    246840
     cgcgctgcag gccttgcggg cgtgcgagag cgggctcgcc cctgcatcgc acgcctgcgc    246900
     gcaatggctg ttcgagcatc gcgaccggct ggcggcccac atcatgacac tggcgcaggc    246960
     cgaaaccggc gcgctgcgca tccgcgtgca cggcgacttc catctcggcc agatcctggt    247020
     cgcgcagacc gacgcctacc tgatcgattt cgagggcgag ccggcccggc ccatggccga    247080
     gcgccggcaa ctgagcagcc cgttcaagga cgttgccggc atcctgcgct cgttcgacta    247140
     tgcggtggcc gaactcagcc gcgacgatcc gctgggcggc gcgccgcgcg acttcaacac    247200
     cggcgtggcc gagccggccg acccggccag cgcgccccgg gaaacgcgcg aggcgctgct    247260
     ggcgcgcttc cggcagcgcg ccggcgcggc cctgctggcc agctatggca atgccatcga    247320
     ccccgtgctg gccttgccgc ccgagcgtgc ccaggcgctt acctgcctgt acctgctgga    247380
     gaaggccgcc tacgaaatct gctacgagtc ggcctaccgg cccgagcgcc tgccggtgcc    247440
     catccatggc ctggccgaaa ccgcccgcgc cgcgctgctg gcggccgccg tcgaccacga    247500
     tgaaggaccg gcgccatgat gcgagattcg ccttccatcc agggcacgct ggacgcggcc    247560
     acccagcacg cgctgctggc cggccgccat gccgatccgt tttccgtgct ggggccgcac    247620
     caggccggcg cgcataccgt ggtgcgcgtg ctggcgcccg gcgcgcgcac cgtgatggcc    247680
     gtgctgcccg gcggccagcg cacacccttg ctgcccatgc agcccggcct gttcgaaaac    247740
     accgtgccgg gcctgcagcc gggcgcgccg gcagcctacc gactgtgcat cgaatgggag    247800
     ggaggcatcc agcacaccgc cgacccctac gcattcgggc cggtgctcga cgccgcccag    247860
     ctcgaccatt gcgcggccgg cggctggcgc tacctggccg gcctgctggg cgcgcacgcc    247920
     gccagcgtgg acggctgcgc gggcacccgc ttcgcgctat gggcgcccaa tgcccggcgc    247980
     gtggcggtgg tgggcgattt caacggctgg gatggccggc gccacgccat gcgcctgcgc    248040
     tatccggcgg gcgtctggga gctgttcctg cccgacgtgg ggccgggcgc gcgctacaaa    248100
     ttccaggtgc tgggcgccga cggccatacc gtgctcaagg ccgacccgct ggcgcgccag    248160
     gccgaggcgc cgcctgccac cgcgtccatc gtccccgacg aacgcccctt cgcgtggacc    248220
     gacgaggcct ggatggaaca acgcgcggcg cgccagcgtt gcgacgcgcc gatctccatc    248280
     tacgaagtgc atgccggctc ctggttcgac gacgccggcg cgccgcgctg gcaaagcctg    248340
     gccgcccgcc tgcccgaata cgcgcgctcg ctgggcttca cccatatcga gctgctgccc    248400
     gtgatggcgc atcccttcgg cggttcgtgg ggctaccagc cgctcggact gttcgcgccg    248460
     gcggccgcgc acggcgcgcc ggccgacttc gcgcatttcg tcgaccgttg ccacgaggcc    248520
     gggctgggcg tcatcctgga ctgggttccg gcccacttcc ccgacgacgc gcacgggctg    248580
     gcgcgcctgg acggcacgcc gctctacgag cacgccgacc cgcgcgaagg ccgccatccc    248640
     gactggaaca cgctgatcta caactacggc cgccgcgagg tgcgggcctt tctcatcgcc    248700
     agcgccatcc actggctgcg ccattaccat gtagacgggc tgcgcgtgga cgcggtcgcg    248760
     tccatgctgt atcgcgacta cagccgcccg gccggccagt ggatccccaa ccgccacggc    248820
     gggcgcgaga atctcgaagc catcgacttc ctgcgcgaac tcaacgccgc cgtgggcgtc    248880
     cagtgccccg gcgccatcac cgtggccgag gagtccaccg cctggcccgg cgtgaccgcg    248940
     ccggtggcca acggcggtct gggcttcgac tacaagtgga acatgggctg gatgcacgac    249000
     acgctgcgct acatgcggcg cgatccgatc catcgccgcc atcaccacca cgatctcagc    249060
     ttcggcatgg tctatgccta tgccgaacgc ttcgtgctgc cgctctcgca tgacgaagtg    249120
     gtgcacggca agggctcgct gctgggcaag atgccgggcg agcgggccgc ccagctggcc    249180
     cagttgcggc tgtactacgc cttcatgtgg gcccatcccg gcaagaagct gctgttcatg    249240
     ggcggcgagt tcggccagca aggcgagtgg aaccacgacg ccatgctgca gtggtcgttg    249300
     ctggacgatc cggcccatcg cgggctgcag cgcctgatcg cggatctcaa ccacgtctac    249360
     gccaccctgc ccgaactgca ttgccgcgac gccgacccga gcggcttcgc ctggatcgtc    249420
     ggcgacgacg cggacaacag cgtgctcgcc ttcgcccgcg tggacgccag ccattgcctg    249480
     gtggccgtgt gcaacttcac gccggtgccg cgaccgggct atcgcttcgg cgtaccccac    249540
     gcgggcgact ggcgcgtacg cgtggacacc ggggcgacgc gctacggcgg cgccggcggc    249600
     ggtccgccca tctgcctgcg cagcgaaccc atcccggccc atgggcaccc gcaatcgctg    249660
     gtcctggacc tgcccggctt caccgcgctg tacctgcgcc actcggagta aagccatgta    249720
     tccgtcgctg cccgaccgac tgctgcccgg cctgcccgcc ccgctgggcg ccaccagcga    249780
     cggcctgggc gtgaatttcg ccgtgttctc ggccaacgcc gcgcgcatcg agctttgcct    249840
     gttcgacgcg cgcggccgca aggagctggc gcgcctgccc atgcccgaat gcaccgacga    249900
     ggtgtggcac ggctacctgc ccgacgcgca gccgggcctg gtctacggct atcgcgccca    249960
     cggaccgtac aacccgcgcg ccggccatcg cttcaatccg cacaagctgc tgctcgaccc    250020
     gtacgccacc gccctgaccg gcgcgctgcg ctggtcggac gcgctgttcg gctaccgcat    250080
     gcagcacccg cgcgccgacc tcagcatgga ccggcgcgac agcgccgccg gcgtgcccaa    250140
     agccgtggtg accgagccgg cgttccactg gggcgcaacg cggcgccccg ccacggcgtg    250200
     ggcgcatacg gtcatctacg aagcgcacgt gcgcggcgtg tccatgctgc gcagcgacct    250260
     gcgcgaaccc atccgcggca cctgcgccgc cctggccgac ccccgcttca tcgaccatct    250320
     ccaccggctg ggcgtcaccg cgctggaact gatgccggtg catgccttcc tgcaggaccg    250380
     caccctggtc gaacgcgggc tgcgcaacta ctggggctac aacaccctgg cgtacttcgc    250440
     gcccgagccg gcctatctgg ccgacggcca gccccacgac ctgcggcgcg ccatccgccg    250500
     cctgcacgcg gccggcatcg aagtcatcct ggacgtggtc tacaaccaca cctgcgaagg    250560
     caacgaactc ggtcccacgc tgtcgtggcg cgggctcgac aacgccagct attaccggct    250620
     ggtgcccggc gacgaacgcc gctacatcga cgacacgggc accggcaaca ccctcaacct    250680
     gtcgcatccg cgcgtgctgc agatggtcat ggactcgctg cgccattgga ccacgcacta    250740
     ccgcgtcgat ggctttcgct tcgacctggg cgtgaccctg ggccgcgagg gtaccggctt    250800
     cgatgccggc agcggctttt tcgacgcctt gctgcaggat ccggtgctgg cgcgcgtcaa    250860
     gctgatttcc gaaccctggg acgtcggccc cgacggctac cagctgggcc gccacccgcc    250920
     cggcatggcc gagtggaacg accagttccg cgacaccgcg cggcgcttct ggcgcggcga    250980
     cccgggcatg gccggcgcgc tggcgacgcg cctgaccgcc tcgcgcgacg tgttcgacca    251040
     ccgccaccgg cggccctgga gcagcatcaa tttcgccgcc gcccatgacg gcttcacgct    251100
     gcaggacgtg gtcagcttcg ccgagcgcca caacgaggcc aacggcgagg acggcgccga    251160
     cggccacggc gagaactaca gcagcaactg gggcgtcgag ggagccgcca gcagcgcggt    251220
     catccgcgaa acccgcgccc gggtgcagcg cgccctgctg gccaccgtca tgctggccga    251280
     cggcacgccc atgctgctgg ccggcgacga gttcggcaac agccagggcg gcaacaacaa    251340
     cgcctactgc caggacggcc cgatgggctg gctggactgg gccgtcgccc agagcacgcc    251400
     gggccgcgcc ctgaccgcct acgccgcacg gctggcgggg ctgcgccgcg cccacccgag    251460
     cctgcgcgcg acgcgctacg gcgaccccgc gcaccaatgg caggaaggcc tgggcgccat    251520
     cgactggttc aatgggcggg gcgcgcccat gacgtccgcg gactgggacg cgcccgaagg    251580
     ccgtctgctg gtcctgcgcc gcgccctgcc ggacccggcc cagcctggcc gcgtcgacgt    251640
     caccctgctg ctgtgcaacg ccgcggccga gccgcggccc tgcgtcctgc cggcgccgac    251700
     gctggcctgg accctggcgc tcgacagcgc ctcgcccgag gcgccggccg cgccttgcga    251760
     tgggggcgaa gcgatcgtgg gcgcgcgcgc cgtgctgctg ttgacggcgt cggtcgacgg    251820
     cgcgcacgcg ccatgaacga gccagcgccc cacggcgcga ccgtctgcgc gcccggcaag    251880
     atccgcttcc ggctctgggc ccccagcgcg ccgcccgcgc tcgccctgga gatcgaaggc    251940
     cgcgcgccca tcgccctgcg gcccggcccc gacggctacg cccaggccat cgtggacggc    252000
     gcgcccggcc tgcgctatcg ctatcggctc gccgcggatt gcgccgtacc ggaccccgcc    252060
     tcgcggctgc aggacggcga cgtgcacggc cacagcgtgg tggtcggacc cgaccgctat    252120
     ccgtggcgcc acaccgggtg gcgcggccgt ccctggcagg acagcgtcat ctacgaagcg    252180
     catgccggcc tgtgcggcgg ctacgccggc ctgcgccgcc gcctgcccga ggtggcgcgc    252240
     ctgggcgtca cgctgctcga actcatgccc atcgcggatt ttcccggccc gcgcaactgg    252300
     ggctacgacg gcgtgctgcc gtacgcgccg gacaccgcct acggcacgcc cgatgaactg    252360
     aaggccctca tcgacgcggc gcacggcctg cagatgggcg tcatgctgga cgtggtctac    252420
     aaccacttcg ggcccgacgg caattacctc catcgctacg ccgccgactt ctttgacgcg    252480
     cgcgccgaca cgccgtgggg cgcggccatc gactatcggc agcaggccgt gcagcgctac    252540
     ttcatcgaca acgcgctgta ctggctgcgg gaatatcgtt tcgacggcct gcggctcgac    252600
     gccgtgcacg ccatgggccg caccgactgg ctggccgggc tggcccgcga ggcgcgcgcg    252660
     gcctgtccgg accgccgcgt ccacctcgtg gtggaaaacg acgccaacca ggccagcctg    252720
     ctggcacaag ggttcgatgc gcaatggaac gacgacgccc accatgtcct gcaccatctg    252780
     ctgaccggcg agcggcaagg ctattacgcc gactacgcgc aggcgcccgc cgcgctgctg    252840
     gcgcgcgcgc tcggcgaagg ctacgtgtac cagggccagg ccgcgcccac gcgcggcggg    252900
     cgcgcgcgcg gcgagcccag cgcgcacctg ccgccgtggg ccttcgtgct gttcctgcac    252960
     aatcatgacc aggtcggcaa ccgcgccgac ggcctgcggc tgacctcgct gctcgctccc    253020
     ggctcgccgg ccctgcgcgc ggccatcgcg ttgcagttgc tggcgccgca cattcccctg    253080
     ctcttcatgg gcgaagagta cggctcgacc gcgcccttct tctacttcac cagccacggt    253140
     cccgagctgg ccgccgcggt gcgcgcgggc cgggcgcgcg agttcgcggc gtcgatgcat    253200
     gattgcgatc ccccgcccga tccgaacgat ccggacactt accgccgctc gtgcccctgg    253260
     ccgccgcccg gcgccgaacg ccaggcctgg ttcgagtact accgcgaact gctgcgcctg    253320
     cgcgcgcgcc tgctgggcgg gcgcctgact ggcgcgcgcg cagacggcgc cgcggcgttg    253380
     ggcccggcgg cggtgcgcgc cgcgtggcgg ctgggcgatg gcgcccggct tacgctgtac    253440
     gccaacctgc tgcccggcag cgtcatcgtg cccgcgccgc cggcgggcca gctggcctat    253500
     gccacactgg ccggcgcggg ccaggacctg gccgccggcg tgctgcgcgg cggctgcgcg    253560
     ctggcgctgt gggagcccgc gccatgagcg agaaccaggc cctcgcccgg ctgtgcgcgc    253620
     tggcgggcgt ctcgccgcgc tggaccgatg tatggggccg cacgcgtgac gtcgccccgc    253680
     cggtcttgcg cgcggtactg gccgcgctcg acctgcccgc ggccacgccg gcccagaccg    253740
     ccgacaccct ggcgcgctgg cgcgcccggc ctcccgccat gctgaccgcg cgcgccggcg    253800
     ggatgttgcg cgtgcccggc gacaccgcca cgcgctatgc catcgagctg gacgacggcc    253860
     aggtggcgca cggcctggcc gagcccgatg gcgccggcgg cctggcgctg cgcgcaccca    253920
     ggcaacccgg ctaccacacg ttgcggctgg gcagcgcgtc catcgccttg gcggtcgcgc    253980
     cgccgcgcgc gcccacgctg gcgcgcctgc tcgccagtcc acggccgcgc cgctggggcg    254040
     tggccgcgca gatctacagc ttgcgcggca cggccgaccc cgatggcggc catggcgatt    254100
     tcggcgcgct ggccgaactg gcggtcgccg cggcgggcca cggcgccgac gcggtggcgc    254160
     tcagccccgc acacgcgctg tttgccgccg ctccgcggcg ctgcagcccg tactcgccct    254220
     ccacgcggct cttcctcaac atcctgtacg cggacccgct cgacaccttc agcgacgccg    254280
     aatgcgccgc cgcgcgccgg ccctcgtccg gcgccgacgg ccccctgatc gactggccgc    254340
     aggccgcggg cgcgcggctg gccatgttgc ggcgcctgca ccgcggcctg gccgccgacg    254400
     acccgcgcgc cgccgaactg gcgcgctttc gcgccgaagg cggccaggcg ctgcgcgacc    254460
     acgccctgtt cgaggccttg cacgcggcca atggcgccac cgactggcgc ggctggccgg    254520
     cggcgtggcg ccgccccgcc gcggcgctgg ccgccggctg cgcgcgcgaa catgcgcgcg    254580
     agatggattt ccacgtcttt gcccagtggc tggcgcggcg cagcctggcg cacgcccagg    254640
     ccgccgcgcg cgcggcgggc atgggcgtgg ggctgatcgc ggacctcgcc gtcggggtgg    254700
     acccggccgg cagccagacc tgggcccagc ccgacgccat gctcggcggg ctgaacgtgg    254760
     gcgcggcgcc cgacctgcgc caccccggcg ggcaggactg gcgcctgacc gcctgctcgc    254820
     ccgccacgct cgccacgcaa ggctacgcgg cctacatcga catgctgcgc cgcgcgctgg    254880
     ccagcgccgg cggcgtgcgc atcgaccacg tactcggcct ggcgcgcctt tgggtcatcc    254940
     ccgagggcgc gccgcccgac cagggcgcgt acctggcctt tccggtcgaa gacctgctgc    255000
     gcctggcggc cctggaagcg tggcgccacc gcgccgtgct catcggcgag aacctcggca    255060
     cggtgccgcg ggacttcaac gcgcgcctgc gcgcgcacgg cgtgctcggg atggacgtac    255120
     tgtggctgca gcgcgagacc gggccaggcg gcgcgggacg ctttcgcccg ccgggccgct    255180
     ggcccgccag cgccgtcgcc atgaccagca cgcacgactt gcctaccctg cgaggctggt    255240
     ggcaggcgcg cgatctggac tggtgcgtgc ctgcgcacga ggccgacgcg cagcgccggc    255300
     agcgcgacca ggaccggcgc gccctgtggc gccaggcggc cccgcccggc ctggccgcta    255360
     cggcgccgcc cgccgagccg ccctgcgccg ccctgctgtc ccatgtggcg cgcagccgtg    255420
     cgccgctgat gctggtgccg ctcgaggatc tggcggggct ggccgaacag cccaacgtgc    255480
     cgggctgccc ggaccatccc aattggcgcc ggcgcatgcc cgcaaccgcc gcggcgatgc    255540
     tggcgcagcc ggccgcgcgc ctggcgctgg cggcgatcgc cgcgcaccgg ggacggccat    255600
     gatccgcgcc accgtccgcc tgcagttgca tgccggcttc acgctcgacg ccgccgccgc    255660
     ccagctggac tactacgacg cgctgggcat cagccatctg tacctgtcgc cggtcgcccg    255720
     cgcgcggcgc ggctccaccc atggctacga cgtgatcgac cacgcccagg tcaaccccga    255780
     actgggcggg ctggcggcgc tgcggcgcct ggccggcgcg gcgcgtgcgc gcggcatggg    255840
     cctgatcctc gacatcgtgc ccaaccacat ggccgcccat ccggacaatc gctggtggcg    255900
     cgaggtgctg cgcgacggtc cggccagcgc ctatgccgac tggttcgaca tcgactggcg    255960
     cccccccggc cggaccttgc gcggccgggt gttgctgccc gtgctcacct gcggcgcgcg    256020
     cgccgcgctg gccagcggcg agatcgggct gcgcgccggc tccgacggca cgccggcgct    256080
     gcatgccaac gggctggacc tgccgttggc gccggcgagc ctgcccatgg ccgcgctgct    256140
     gctgcaccat ggcggaacgc ccgcccaatg gcatgccttg ctgcgggcgc aggcctaccg    256200
     cctggcatgg tggcgcagcg cggcgcaggc catcaactgg cggcgcttct tcgagatcgg    256260
     cgatctggtg ggcgtgcggg tcgaacggcc cgaggtattc gacgccgtgc atgcactgcc    256320
     cctggcgctg taccgcgcgg gcctgatcga tgggctgcgc atcgatcatg tcgatggcct    256380
     ggccgagccc ggcgcctatt gccgccgcct gcgcgccgag ctcgcgcagg ccggccaggc    256440
     gcgcgccgcg cgcggcctga gcgccgaacc ctatgtggtg gtggagaaga tcctcggcga    256500
     caaggagacg ctgcgcgccg actggccggt ccagggcacc accggctacg acttcatgaa    256560
     cgaagcctcg gcctggctgc acgacgcgcg cggcgccgcg ccgctggccg cgttctggcg    256620
     cgacaatgcc ggcacctggc cacactggcg cgaacaattg cggcggatac gtctacggtt    256680
     gttgcggcgc cacttcggcg ccgagcggcg cgcgctggcg cgcagcctgg ccgacttgcc    256740
     cgaactgcgc gcctcggcgg ccgccatcga ccctgtgctc acgcaatggc tggcctgctt    256800
     tcccgtctac cgcacctatg ccgaaggcgg cgccggccag gccgccgacc aggcctggcg    256860
     ccagacggcg cagacccgcg ccaacgccca cctcgaccct gcccagcagg cgctgctggc    256920
     cgcgctctgc ctggctctcg acggacgcat ggcggacgcg ccgcaccgtc tggcgctgcg    256980
     gcgcctgcag caactcaccc cgcccctggc ggccaaggcc ctcgaagata cctggttcta    257040
     ccgcgacggc accctgctct cgcgcaacga agtcggcgcc gcgccggccc agttcgcgct    257100
     gggcggcggc gcgctgcgcc gcagtgtggc cgcgcgcgcg cgccgccatc cgcaagcctt    257160
     gctggccacc gccagccacg accacaagcg cggcgaggac gtgcgcgcgc gcctggcggt    257220
     gctgagcgaa atgccgcaac aatggtgcga ctgggcccgg caatggctgg ccgacgccgg    257280
     cggcagcgcc gccccgcccg cctgggccga ccgctacatg ctgctgcaga ccctggtggg    257340
     cgcctggccc gccgacctcg cgcccgacga ccaggccggc atggccgcgc tgttgcggcg    257400
     cgtggccgcc tggcaggcca aggccctgcg cgaagccagg caacgcagca gctggacctg    257460
     tcccgacctg gcctacgaaa ccttgtgcgc gcgctatctg cgcgccctgg ccgacgatgg    257520
     cgcggcgctg cccgccgtcg ccgccctggc gcgccggctg gcgccggccg gactggtcaa    257580
     cagcctggcc cagaccgcgc tgcggctggg cctgcccggc gtgccggatc tataccaagg    257640
     ctgtgaaatg tgggacctca gcctggtgga cccggacaac cgccgcgccg tggactacgc    257700
     cgcgcggcgc ggcgcgctgg ccagtctcgg caacggcgcg ctggcgttgc ccgagctgtg    257760
     gcgcgacggc cgcgccaagc aggccctggt ggcccgcgcc ctgcaatggc gccgcgagca    257820
     acccgcgctg ttcgaacacg gcgcttgccg ctggctgcgc gtcagcggcg cgcgcgcccg    257880
     gcatgtgctg gcctgcctgc gcacccgcgg gccgcaacag gccctgatcg tcgtgccgcg    257940
     cgccagcgcc ctggcgctgg ccgggcagac cggaccggac cgggacgccg ccgcgcattg    258000
     gcgcgacacc tgcgtacacc tgccggccga cgccccgccc tggcgcgaca tccttaccca    258060
     cgccggccac cagggccgcg ccctggcgct gagcgaactg ctcgcgcgct ggccggtgac    258120
     gctgtgccgc gttcagtcct gactggcagc cagcaagcgg cacacgcggg cggtcagctc    258180
     cccgggcgag aacggcttgc gtatcaggct gatgtcgcgc tcctgccggg cccagccatt    258240
     ctcgcgttca tcggcgtagc ccgtcatcag aatgatgcgc agggccggcc gcagcgcccg    258300
     cgcggcctgc gccagcgcgt ggccgttcat gccgggcagc cctacatcgc tcaacaacag    258360
     gtctatcctg gcgtcgcttt gcagcaggcg atggccggcg tcgccgtcgg ccgccgtcag    258420
     cacggtcagg ttcagctcct ccagcgccgc gcgcaccatg tcgcgtacat gctcatcgtc    258480
     ctccaccagc gccaccaccg ccgcatgcgc gggcgcggcg ggcggctcgg acgactcggg    258540
     cgccggcagg gccacgggct cgcccacatg gcgcggcagg aacagccgca ccgcggtgcc    258600
     ttcggcctgc acgctggcta tcgtcaccat gccgccggcc tgctgggcga aaccataaat    258660
     catcgacaac cccaggccgg ttccctgccc catcggcttg gtggtgaaga acggctcgaa    258720
     cacgcgcgcc agcacgtccg gcgccatgcc gcatcccatg tccgagacac agacctcgac    258780
     gaactcgccc gcctcggcgc agggattggt ctgcaccgcc gccgcgtcca gttcgcggtg    258840
     ggcgacctcg atctccagat cgccgccggc cggcatggcg tcgcaggcgt tgatcaccag    258900
     gttcagcacc gcgttctcga actggttcat gtcgcagcgc acccgccacg actgcgccgg    258960
     cagcttcagc gtcaggcgca cctgctcgcc cgtatagcgg cgaaacagct catccatgga    259020
     acgcaggata tcgcccggat cgaacacctg cggatcgatg gcctgctggc gcgagaaagt    259080
     cagcagccgt tgggtcagcc gcgcggcgcg gtcggtcgat tcctgggcgg tgcgcacata    259140
     cttgccgacc tcctccggct tgccgcggcg cagcttgcgg tctatcaggt acagcgcgcc    259200
     ggagatgccc tgcagcatat tgttgaagtc gtgcgcgatc ccgcccgtca gccggcccac    259260
     cgcctccagc ttctgcgact gccgcagggc gtcctccgtc tggcgcagca cttcggcctg    259320
     cgccttcagg tcggtgtcgt cgcgcccggc caggtacaca ttgccctcgg cccgcgacag    259380
     gctccaggta atccagtgat agctgccgtc cttgtgcagc aggcggcttt ccaggtgccg    259440
     caccggctgc atgccctcgg cgggctcggc ctccagcgtg gcctgcatcg acgccaggtc    259500
     ctcgggatgc acgccctcgt ccagccccat cgccaggaac tgttcgggcg accagcccaa    259560
     tatggcgcgc actgccgggt tcaccgatac cagccgtccg ccatggtcgg ccaccgccag    259620
     cagttcgggc gacaggcgcc agatgcggtc gcgctcggcg atggcgtgct cgacgcgttg    259680
     ttccagcacg cgcgcgtact gcgaacgttc gatcgcttcg cacatacgct cggccgcttc    259740
     ttcgataaaa gcgatgtccg tgcccttgag cggatgggtc ggatcgggcc gcaccagcaa    259800
     ggtgccgtcg gcgcggcccc agcggcgcag cgggaccacg atggccgaag gctgctggtt    259860
     gcccgccggg ccggccagat acggcgacag ataggccgtg cgccccttgc gcaccgcctc    259920
     gtagtaatcg ggcgtgagcg gcgcggactc cagcatcgac cgtccatcgt agggcggccg    259980
     cggcccccag cttgcggcga tgcggtcgcc acgctgcggc acggattcca ttaccgccac    260040
     cgcgcccagt tccaggtgcc ggcccaactc ctcgcacacc atctgctcga tctggtcctg    260100
     ctggtggatt tcgcgcatgc gatcgcccag ggtcagcagg aaattcttgc ggtactgccg    260160
     ctcccacagc tcgctctcgg ccagcttgcg cgccgtcaca ttgagaaaca aggccgccac    260220
     ccgatcatgc ccttccttgc cggcgcggca ttcgtagcag gcctgcggcg gcccgggcgc    260280
     ttccacttcg aactgcgccg gctcgccgct ctcgatcacg cccacgaaga tccgcatgat    260340
     gctgtcggcc gcggccggac tcatgacgcg cagcatgggg cccagcgtct ggccgacggc    260400
     cagcccgctc tgcgtctcga atgccgggtt gatctccagc agcgtgaaat cgtccacgct    260460
     gcccgtgctg tcgcgctgcg cctcggccag gaagaaaccc tcctgcatgc gctcgaacat    260520
     gccgcgccag cgcacgctgc tgttgcgcag cgcctgttcg gtcaggtggc gctcgatggc    260580
     cagcgccgcg gtgcgcgtca ccagcgcgat cgcctcgatg tcctcgcgcg tgggcaggcg    260640
     cggctggcga tagtagttgg agaacacgcc cagggtgcgc ccgtcggtcg ccttgatcgg    260700
     cgtggaccag caggcgcgca agccgtgctg cgtcgccgcc tcgcgccagg gcggccaatt    260760
     gggatgcacg gtcaggtcct cgacatagac cggcgtgccc aggaacgccg ccgcgcccca    260820
     cgacgccacg cccgggccga tcgccgcgcc atcggtggcc tgcacatagg ccgccggcag    260880
     gctgggcgtc gccacatggc gcaggcgcat gcccgagtca tctacgaacg cgatcgaggt    260940
     gagcagctcc acgctggact gcgcctcgac cgcctgcatc acgtgcagca gcacatcggt    261000
     caagggcacg cctgcggcga tgcgctgcag catcacccgc tcgtcctcca gacgcgccag    261060
     cgtattcgtc cacgggctgg aaacccggtc tcccttgcgc agcatcgcgg tcctcgtgtg    261120
     gcggccatgg ccggctgccg ccggcccgat gaaccactgt attgcaggcc gcgccggtca    261180
     taccactacg cgaggtaaca cgacgctacc tgagcggccc cgccagcagc agctccccgc    261240
     agcccgcctc gcgcgtgcgt tccagcgcct cgatgacctg cagggcggcg cggcgcgcgg    261300
     cctcggccac cggctggccg gccagcaggt ggccggtaag cgcagcaccg aacatatcgc    261360
     cggttccctt gggcgccgtg tcgacatggg catgctccag cacctgcgcg tcgtcgtgcg    261420
     tgaccaccgc cacgcgcacc cggcccggcg gccaggtggc cggcgccgcg ctggtcacga    261480
     tcacccagcg ggcgcgcccg cccagcaggg tgcgggctgc ggcgatggtc tgctccatgg    261540
     tgccggtggg cagcccggtc aggcattcca gttcgaagcc gttgggcgtc aagccctgcg    261600
     ccagcggcag cagatgatcg cggtacgccg cgaccatgcc gggcgccacg tacacgccgc    261660
     tgtcgtggtc gccgatcacc ggatcgatgt gcacgcgcag gtcgggacgc accgccacca    261720
     agcccgcgat ccagcggccc agcgcctcgg cctgcgccgg cccgcccagg tagcccagct    261780
     gcaccacccg cacccctgcc agcgcgccgc gcgcgcccag gtcggccaga taaccctcga    261840
     accaatccag cggcacggcg ccgccatgca tgctcggata gtgcggcgta ttgctcagca    261900
     ccaccgtggg caccgccgcc acccgcaggc cgaagccatt gaacaccggc acggccacgc    261960
     tgttgccgac ctggccgtac accacttgcg actggatcga caccacgtcg atgggcagcg    262020
     gcgcaagcgc ctgcggattg ggggccgcca gcttcatcat tcatcctccg ccctgtccgc    262080
     cgcgccgctg tcaggccagt aataatcgtt gggcaaggcg cgcgcgccat agatcgcctg    262140
     gccgacccgc accacggtgg cgccttcctc gatggcgatc tcgtagtcgc ccgacatgcc    262200
     catggacagc tcgtccaggc tcacgccggc cggcgcttcc tgccgcaggc ggtcgcgcaa    262260
     ggtacgcagc agcacgaagc actgccgtac gcgcgcggcg tcggccgaca gcaccgccag    262320
     cgtcatcagc ccgcgcacac gcagcgcgcc gtagctcggc agttggcgga tgaaggccgc    262380
     cgcctcgtcc ggatgcaggc cgtacttgct ggcctcgccc gaagtattga cctgcacgta    262440
     cacatccagc gcgcgcccct cggcctgcag gcggcgctcc agcgcctcgg ccaggcgcac    262500
     gctgtcgagc gcctggaact cggccgcgaa gcgcgccacc agcttggcct tgttggtctg    262560
     cagatggccg atcaccgacc agcgcaagtc ggccaggtcg gccatggcct cccatttcct    262620
     gtaggcctcc tggaccttgt tctcgcccag ctcgcggcag ccggcggcat acgacatgcg    262680
     gatgcgggcc tcgtccaccg tcttgctgac cggcaacagc cgcacgccgg ccgggtcgcg    262740
     cccggcccgc tggcaggccg ccgccatgcg ggcccgcacc gccgccaggt tgtgctcgaa    262800
     atcggccacg ctgtcggcgc gggggtaacg cgccgccgcg tcgggcgcat cctgggcagt    262860
     atcggcgtgc atggctgttt cgaatcctat agaatttgtc ctatgacaaa gtatataacg    262920
     acccaggcca gatgagcatc accggcgcca gcgcggccga gatcttcgac agcgtgcgcc    262980
     agctggcgca ggcgcgccgc ctgctgcccg gccaggcgct gcccccggtg cgcgagctgg    263040
     cgcagacgct gggggtcaat cgcaataccg tggccgccgc ctacaagcgg ctggtcggcg    263100
     ccggcctggc gctcagccag ggccggcgcg gcaccatcat ccgcggcccg tccgagccgg    263160
     gcgagcagga cggcgcgcat cccggttcgc ccctgatcga cctggccagc ggcaaccccg    263220
     accccgcccg cctgcccgat ccgctggcca tcatggccgg acgcgccagc ccgccgcgcc    263280
     tgtacggcga agccacggtc gacccgcgcc tgcaggccta tgcaagccag tggtatgccg    263340
     gcgactgccc ggccgccttc gaggtcgatc tcacccacgg cgccatcgac gccatcgagc    263400
     gcctgctggg cgccaacctc gccgcgggcg acacggtggc ggtcgaggct ccgggctttc    263460
     tcggcagcat caatgcgttg cgcgcgctgg gcctgcgcgc cgagggcgtg gcgctggacg    263520
     ccgccggcat gctgcccgac gccctcgagc gcgcgctggc cgacggcgcg caggccgtgc    263580
     tgctgacacc ccgcgcacag aacccgaccg gcgccagcct cacccgcgcc cgcgcgcggg    263640
     cgctgcgcca ggtgctgcaa cgctacccgc atgtcatggt catcgccgac gaccacttcg    263700
     cccacctgtc ggcctcgccc tatcacagcc ccattcccgc cgccgccctg cgctgggccc    263760
     tggtgcgctc ggtttccaag gcgctcgggc ccgacctgcg gctggccttc gtcgccagcg    263820
     atcccgacac ctcgcggcgc ctgcgcctgc ggctggccag cggcacgacc tgggtcagcc    263880
     acctgctgca ggacgtcgtg gcgggctgcc tggcatccgc gccggtgcaa gcgcggatgg    263940
     cccaggcgcg cagggcctac gcccaacggc gcgcctggct ggccgacgcg ctgcgcgccg    264000
     aagggatcgc cgcgcagtgg ccggccgacg gcctgaacct gtgggtgccg ctggcccagg    264060
     acagccccgc gctgctgctg gagctcgcgc atcgcggctg gcgcttgcgc aacggcaggt    264120
     ccttcggcgt acgccaggac gtccatggcc tgcgcatcac catcgccacg ctggagcacg    264180
     ccacggcgcg ccgcctggcg cgcgacctgc ggctgtgcct ggacgcgcgg gacggactta    264240
     agaaatatcc tacgcttctg taaataaagt cctgaccaca tcaaccaggc gacttcccat    264300
     aatggggcgg ttattttccg aacgccctca gatgtcgcgc accagcctct cttctctcgc    264360
     cccccgcccg caccggctcc tgtccctggc ctgggcggcc acggtcctgt cgctgcgagt    264420
     gggcatgggc ataagcggac tgttctgcgc ctggcgctac ctggtcgact tgcggccggt    264480
     tcgcccgctg ttcgatggcg tggccgccgg cgccacgccg ctggcgctct acgccgcatt    264540
     cgaagcgggc tgcgcggtgc tgctgatggc cggcgcctcc acccgcatcg ccgccgccgg    264600
     catgaccgcc gcccatatcg ccggcgtcgc gctggccctg ccggcccatg gcctctggat    264660
     acccctgccc tcggccctct ggctggcctg cctggcgctg ctgtggtgcc acggcccggg    264720
     cccgtgctcg gtggatgcct gcctgcaccc ggcggccatc gcccccttgt cgccgccccc    264780
     cgatgacccg gcgcaacggc cgatttagcc tgctgttcca gcgattcgcg atcgggccct    264840
     catatatagt gcgcgccatg tcgaagttct cccgcatcgg cctggccggc gtggtgggcg    264900
     ccgcgctcca tgccatcctg gccaaccacc ttgcgccggc cgtgcagcag cggctgccca    264960
     tcggccgggt gagcctcaca ttctttctcg ccctgctcag cgccctggcc gccggcgccg    265020
     tgctggcgcg cctggccccg cgcgcgcggg tggcggccct ggccgtggcc gcactggcat    265080
     tcctgctgct ggccgccgcc acgacctggc tgcagcaatg cacgccggcc cagctcgccg    265140
     ccatcgatgc cgccacgccg ctgggctgca acctcggcct gtacaaccgc gcccgcgccc    265200
     acctgccgcc cgatggccgg ccggccgagc tcgcgccggg agtctggttc gaccgccacg    265260
     gactgtccta cgcctgtctg ccccccgaag cgcaagccac ccacctgcgc gtcgcgctgg    265320
     ccgattacgc cctggcgctg gtgggcatga gcctgggcgc cttgctgggc gccaggcaac    265380
     gcaggcgccg cgaccaggat tgattcctgt caatgcgctg aaaaaggcga taacctatgc    265440
     tgaaccatgg acaactctca acacagaggc tgatatgctg aaaatcctgg ttcccgtgga    265500
     cggttccgaa tgcgccgtgc gcgccgtgcg tgaagccatc aaggtcgcca acgacagcaa    265560
     gggcgcccag ctgcatctgc tcaacgtgca gctgccgctc atctccggcc acgccaagat    265620
     gttcctgcgc cacaacgagc tgcaaagcta ctaccaggcc gaaggcgaag ccgccctggc    265680
     caccgtcctg cccgtcgtcg ccgagtccgg catcccgttc gaatccgaaa tgcgcaccgg    265740
     gcagtacggc gagaccatcg ccaactacgc caaggagaaa cagtgcgacc gtatcgtcat    265800
     gggcacccgg ggcctgggcg cggtcggcgg cctgctgctg ggatcggtgg cgcgcaaggt    265860
     gatccacctg gccgacgtgc cgatcacgct ggtgaagtag gtcccgcgcc ccgcccggcc    265920
     gagtacctgc ccatgagccg ggcgcgcttc ctgcgcctgg ccggcgcggc tgccctcggc    265980
     ctggccgccc cgcgcgtgcc ggccgcgccc agtctgctga cgcggccggt cccggccgac    266040
     ggctccccgc tgcccgtgat cggctgcgga acctacatcg gtttcgacgt cgcccggccc    266100
     tcggccgagt acgacgccct cggcgaggtc gtgcggacct tgttcgccgc cggcggcacg    266160
     gtattggaca gctccccgat gtacggacgc gccgaggccg tcaccggccg gctgctggcc    266220
     gaagccggcc tgcgccagcg cgcctttgtc gccaccaagg tgtggaccag cggccgcgcc    266280
     gccggcctgg cgcaaatgca ggcgtcgctg cgccagctgg gcggcgagcg catcgacctc    266340
     atgcagatcc acaacctgct cgactggcgc acccacctgc cggtgctgcg cgaatggcag    266400
     gccgccggcc gcatccgcta cgtcggcatc agccattaca cggcgagcgc gtatgacgaa    266460
     gtcgaggcgg tgctgcgcgc cgagcggctg gacttcctgc agatcaacta tgcgctggac    266520
     gaccgccagg ccgcgcagcg cctgttgccg ctggccgccg accgtggcgt ggcggtgctg    266580
     gtcaaccggc cgtttggcgg cggcggcctg ctgcgccgcc tggccggccg gcccctgccg    266640
     tcctgggcgg ccgacatcgg cgcaaccagc tgggcgcaag tgttgctgaa gttcgtgctc    266700
     agccatcccg cggtcacctg cgcgataccc ggcaccggcc gggccgccca catgcgcgac    266760
     aacctggccg ccggcatggc ggcgccgccg ccgctgtcat tctggaacga caaagcctag    266820
     gctcagcgcg ccggcgcgct gcgccacagc cataccaggt cgtgcggcgc cagctcttcg    266880
     ggcacgtcga aacgcaaggg ttcggcgcgc gacccggcgc caaaatgcac ctcgacgcga    266940
     aaatagcgct ggtctccttg cccgcatgca tcgcgcgcct gtccggccgc gctgtgcagg    267000
     gcggcatcga tctgcgcgcg cagggttgcc gagcacgccc ccagctcgaa gcgccgggtg    267060
     cggaccaggg ccggcacgaa cgccacgccg ccttggcgcg acacgcgcac ttccgcggcc    267120
     tgctccagcg atggcagcgc aatcatgtca gtacccctac atcggtccag gcctgccgca    267180
     ccgccgcctg ggccgcgcca tggcggccgg cctgttccac cgacaggcgc gcgaacaggg    267240
     cgaaatcggc ctgcggcgtc agcgccggca ggcgcaaggt gtcgtaccag atccggccgg    267300
     ccacctccca ggcatggccg cccagcgcgg tggcggccag atggaatgca cggttgggaa    267360
     tgccggaatt gatatgcacg ccgccattgt cctcgccggt ctgcacgaag tcccgcatgt    267420
     gtcccggctg cgggtcgcgg cccagcaggg gatcgtcgta ggcgctgccg ggctgcgcca    267480
     tcgagcgcag cgcgcgcgcc cgcaccttgg cggtgaacag ccccgccccg atcagccagt    267540
     ccgcctggtc ggcgcgctgg cccgccacat gctgcttggc cagcgaaccg aacacatcgc    267600
     acagggattc gttcaacgcg cccgactggc cttcgtagcg caggccgcct tcgtggtcga    267660
     tcaccccgtg cgtcagttcg tgggcgacga tatcgaccgc gatggtgaag cggttgaaca    267720
     cgtcgccgtc gccgtcgccg aacaccatct gcgcgccgtt ccagaacgcg ttgtcgtatt    267780
     cctcgccata gtgcacgctg gccaccagcg cccgccccgc gccatcgagc gaatggcggc    267840
     cgtaggcctg ccagaacagc gcataggtcg cgcccagatg atcgtaagcc tcgttgaccg    267900
     ccacgtcggc atgcgcgggc tgcccttcgg accgcaccag cgcgcccggc aattgcaggc    267960
     cgccgccggc atcgtgcacc tgcctgtcga cctgcccggg cgggcgcgcg gacgcgggcg    268020
     ccggcggcgc ggcaagccgc acggcgcgct ggctggtgtc gatgcgcaag gtgttgacgg    268080
     cgcgcgcgct cagccgcgcg tcggccgcct gcgccagccg gtccagcaag taaggcggca    268140
     ccacgctcgg gcgcgcggct ttcgaggtag gtcgcttcat cgcattcctc ctgccaggct    268200
     gcggggcgcc cgattctcgc cacgggcgcg cgtcccattc cagcaacttt atcctaccta    268260
     ttcactcttg tattctgcgc ggaatttgca ataattagcg cgcttgtaag gaagttttcc    268320
     taactctttt tcttgcccct tacgctcctg tacgccgatc aacttctgga acatagagat    268380
     ccccatgatt aaatctgacg acgccggcaa gctgattctt cgccttgcgc tgggcattct    268440
     ggtcatcatg cacggtctgg ccaaactgag cagcggcgtg ggcggcatcg ccggcatgct    268500
     gtcttcgcat ggcttgcccg gtttcctcgc ctacttcgcc tacgtcggcg aaatcgtcgg    268560
     ccccctgctg atcatcctgg gcatctattg ccgcctgggc gccctgctgg tcgtgctcaa    268620
     catggtggtg gccattctgc tggcccacat gggccaactg ttctccatca gcaacaccgg    268680
     cggctgggcc ctggagctgc agggcatgtt cctgttcggc gcgctcgccc tggccttcat    268740
     gggcgcgggc cgcttcagcc tggccgggtc gggcggtcgc tggaactgag cgccgcgccg    268800
     ccgcgccgcg atcgcagggc cgcctcgggc ggccctgttt ttttggacgc ttggtaatca    268860
     actgtcacgc ttgttgtgtt tccaacccgt tacgctggcg aaccccaagg ccgaaacgac    268920
     ggcctaatcc tgacatcggg atttatggac gccgctcgcg gcggattgcc atgcatactg    268980
     ccaaagcccc tctcgccgcc ctggccctgg ccctgggcgt gagtacgcca cctgccctgg    269040
     cgcaggtcgg ctacgaccct gaaccggcct acgacgagcc cgccggcgcc gaccccgccg    269100
     ccgccaacct ggcccccgtc gaagtggccc gcgaggcccc gccgcccctg ccggtctacc    269160
     agcaaccgcc cgtgccgggc gacggctaca tctgggtgcc gggctattgg gcgctcaacg    269220
     ccctggggtt ctactgggtg cccggcgtct ggatgctggc gccctacccg ggcgcgttgt    269280
     ggacgccggg ctactgggcc tacgatgccg gctactaccg gtggcggcgc ggctattggg    269340
     gtcggcacat cggcttttac ggcggcatca actacggcta tggctacatc ggcttcggct    269400
     acgtaggcgg ctactggaac cgcgaccgct tctattacaa ccgcgccgtc accaatgtga    269460
     acatcacgcg cgtcacccac gtctacgaac gcagggtggt cgtccagcac atcgacagga    269520
     gccgcgtcgg ctaccacggc ggaccgcgcg gcatccagcg gcgcgccgac ccgcgcgaga    269580
     tggccgccgc gcgcgagcgc cacacgccgc ccaccgacat gcaacgcgac cacgcccgcc    269640
     aggccggccg tgaccgcgcc caattcgacg gcggcgcgcg ccgcggcccg gcccgcaccg    269700
     cgctcgaaca cccgctgtcc gagcgcagcc gcgaccaggc cgcgcctgcg cccggtgcgc    269760
     gggggccggc cggacaaggc cgccccggcc aggaccgcgc ggccggacaa ggcggcccgc    269820
     gcgccgacga tgtttccgcg ccgcgccggg acgcgcgccc cagcccggac agcgtcccgc    269880
     gccaggccgg cgcgcgccag gaaaataccc gccaggaaaa cgtccgccgc aaccaaagca    269940
     cgccgcgcca ggaaagcgcc ccgcgccagc acaacgcgcc gcgccccgag cgcgcgcggc    270000
     cggccgaacc gcggcgcgac gccggcagcc ctcccgagcg gtcatcgcgc cccgcgccgg    270060
     cgccgcgcgc cgaatcgcgc ccccaggcag agcgcgccgc ctcgcagccg cgcgcgcctg    270120
     gccgccagga cggcgggggc aaggccgaac gcggcccggg cgagcgcggc aacggcggcg    270180
     gacgcgggcg cgacggctag gtccttccgt cctgctggac cgatccgccg cgaggccgct    270240
     acagtaaggg catcggcccg cctcgccggg ccctgcccat ccggagttca tcatgtcacg    270300
     ccccgcactg ctgttggccg ccctcctgtc catcgcggcg cccgccgcgc acgccgccct    270360
     gccggtgggc gcgcccgcgc ccgatttcag cgcgcaggct tcgcaaggcg gcaacacctt    270420
     caccttcgaa ctggcgcagg cgctgcgcca ggggccggtg gtgctgtact tctatccggc    270480
     ggccttcacc cagggctgca ccatcgaggc ccgcaatttc gccgaggcca tcgaccagta    270540
     tcgggcgctg ggcgccaccg tcatcggcgt ctccggcgac gacatcgaaa ccctgcgcaa    270600
     attctcggtc agcgaatgcc gcggcaaatt tccggtggcc gccgatgcag acggcgccat    270660
     catgaaggcc tacgatgccg tgcacgacag gcggcccgaa tacgcccagc gcatttcata    270720
     cgtgatatcg ccgcagggcc gcatcgtcta cgagttcacg gacatgagcc cggaccgcca    270780
     cgtcgccaac accctgcagg ccttgcgcga ctggcaggcc aggaagaaat agacgcccgc    270840
     gcgcatccgg ccgtcaacga aagcggcctg gcgcgtcttg ccgcgccagg ccgcaatcac    270900
     tcgccctcaa tcgggcgcgc aggttctgaa gccgccgcct acggcaggat ttcgcgcacg    270960
     ctctcggccg ggcggcacag gcgcgcgccc cgctcggtga cgacgaaagg ccggttgatc    271020
     aggatggggt tgtcgaccat ggcatcgagc aggccctcgt cgtccacgcc gtccaggccc    271080
     agttcctggt agatcggctc cttggcgcgc accgcctcgc gcacgctcag cccggactgc    271140
     tggatcaggc cggccagcgt ctggcgcgac ggcggcgtct tcaggtattc gatgatggtg    271200
     ggctcgatgc ccgcgtcgcg cagcatttgc agcacgttgc gcgacgtgct gcaacgcggg    271260
     ttgtggtaga tggtggcaga catgcagact cctcggtgga acatcaggcc accctatagt    271320
     ctacccgcgg ccgcctgcat tcagcgaaac ggccacacgg tcgggtgcga acccggtggc    271380
     atggccggcc gcgtccagcg cgccggcgtc aacgagaact gcgccgcgtg gcgcacggcg    271440
     gtcagctcgc cgaaccccga ctcctcggcg tacagcagct cctcgatcgg cggcatcgga    271500
     caggcgagcc cgtcgggcac gcgtcccagc tcgcgcagcc agcgcgccgt gctggccagc    271560
     gacacgcgca cgtgccagct gccgccctcg atacgctggc gcgccagcgc ggccagcgcg    271620
     ccgaaggcca tcaggtagcc gctggcatga tcgaggatct gcacaggcat ggccttgggg    271680
     gcttcctgcc cggccgcctg ggcctcggca tggttgaagc cggtggccgt ctgcaccagc    271740
     gagtcgaagc cgcgccggcc ggcccacgga ccgctatcgc cgtaggccga cagcgacacg    271800
     tacacgatgc cgggacggat gcgcgcggcg tcctccgggc cgaaacccag cgcctgcagg    271860
     ccgccgggcc ggtagccctg cacgaacaca tgcgcgctgc gcaacagatt gcccagcgca    271920
     atgcggccgt cggcggtctc gaggtcggcg tgcaccgaca gcttgccgcg gctggtgtcg    271980
     atgatgttgt cgatattggg cagatgcggc gaattgatca gcatcacgtc ggcgccgtag    272040
     gcggccagcg cgcgtccgca taccgggccg gcgatgatgc gcgtgagatc gagcacgcgg    272100
     atgtcctgca gcggcgtggc ctcgtgcccg tacttgggca gaggccgcgg atcggcgttg    272160
     tcgatgcgtt cgatgcgcac caccggctgc gaagcggtcg ccaggccttg cggatggcgg    272220
     tcccattgat cgaagctgcg catggcggcg accaccatgc cggcatcggc ggcgacttgc    272280
     tcgaaatcgc ccgcgcgcca gcgcgccagg gcgcgctcga ccatttcgcg ggtcgcggcc    272340
     tcgccgggcg gacagcccag cagcgccagc gcgccgtcgc gatggtgcgg gaaattggca    272400
     tggatgcgca cccagccgcc gtcgccgcat gggtagacgc cggtgatctt gtcccagata    272460
     ttgggcgtca cgccgttgat cttgaagtag ctgcggcact cctgcgccgc gtggcgcatg    272520
     tccaccgcca cgcgttggcg ctgcccgccg cgcagatgcc agatctcggc cgcggccagc    272580
     gcggcggccg cgatgctggc ctgggcggcc gtgccgacgg cgaacgacga gggcagcacc    272640
     ggctcggcgc catgcagctc gacgtggtcg agcgcctcgt cgggcaggcc tgcggcgccc    272700
     cacaggttct gcagggctac ccgggccccc ttggcggtat gtgcttgccc tcgcgccacg    272760
     ggcgggtgga gatccttcag gtttcccatt gcagtcttcg gtgctcacga gctgatgagg    272820
     cgattacatg tccagccctg ggttgcgtca agatgcgggc gccgcgacgg tgtttcacga    272880
     attgaccgcg ccggcgggcg ccactggccg cgtccatggc gccggcgtca catctgtttg    272940
     taaattttac atagggtgtg gcgcggtcgc cgcgccctag ccgccgtgct gcgcgtcttc    273000
     gcgcgccaat cgccgcagga aaacctgcaa ttccttgacc acttgctggt cgccgcgcga    273060
     ctgcgcggcc gccagtccgc tttcccaggc ctggcgcgcg ccggcgcggt cgccctgtcc    273120
     ctgcagcgtc ttgcccagcc acttccaggc gaccgagtac gtgggatcga aatcgagcgc    273180
     cgcgcgcagg tgcggcaagg ccgcgtcgaa ttgttcgtgt tcggcgtagg tcttgcccag    273240
     cgtgaaacgc aacaacatgt tgtcggtacc ctgcgccagc atggcttcca ggcgctcggt    273300
     catggcttgc ataaggccct ctccggcaaa ggcgccccag ggcgccgcgt tcgttcatga    273360
     taggccagct cccgccgcga cgcccgcatg tccgcgttcc gacaggggaa aaccgtctgt    273420
     gtcggtgcgt atcaaatcga tgtgcagggc gaattattcg gccatagtgc gatccgatac    273480
     ctgaacaatg caggaaccca ctgtgccatc gatcgtgctg tttccatcgt ggatgaaagt    273540
     ctggcgccgg ctggcctgcg ccgccctgct ggccggcgcc gccgccagcg cgccggccgc    273600
     gccggccgcc gcgcaagccg ccccggccgg cccgcaacgc ctggccgccc aggtcgaccg    273660
     cgtcagctgg ggcgtcaccc ccgccgaact ggcccgcgcg cagcggctga gctggaccgt    273720
     ctatctgcag gagcagttgc ggccgcggcc ggccgcgctg ccgccggcgg tgcaggcccg    273780
     gatcgacgcg ctgtcgatca cgcgcgtgcc ggcgcgcgac gcgctgctgg cgcaacgcgc    273840
     gcggaccgcg aaaatccgcc agatcgaaga ccccgcccgc aagctggcgg cctcgcgcga    273900
     gaaccgcatg gtgtcgcgcc agcgcgccaa cgaaaccatg cagcgcgccg tctggctggc    273960
     gctttattcc cccaaccagt tgcaggagca gatgacctgg ttctggatga accacttcag    274020
     cgtctacgcc ggcaaggcca acgtcggcac ggtgctcgac gcctacgaag accaggccat    274080
     acggccgcat gcgctgggca agttccgcga cctgctggcc gccaccgccc gttcgcccgc    274140
     catgctgatc tacctggaca acatccgcaa cagcgccggc cacatcaacg agaactacgc    274200
     gcgcgaactg ctggagctgc acaccctggg cgtgcaaggc ggctacagcc agcgcgacgt    274260
     gcaggaactg gcgcgcgtgc tcacgggcgt gggcctgaac cagaccggcg aggcgccgcg    274320
     cgtcaagccc gcgcagcgcg agcagctggt cgaagacggc ctgttcctgt tcgatccggg    274380
     gcgccatgac cacggcgaca agaccgtgct gggccacacc atacgcggcg ggcgcggcct    274440
     ggccgaactg gacgaggcgc tcgacctgct ggcgcgccat cccgccacgg cccgccacgt    274500
     cagccgcaag ctggcgcagt acttcgtggc cgaccagccg cccgatgcgc tggtgcagcg    274560
     gatggcgcgc gcgtttcagg gcagcgacgg cgacatcgcc gccacgctgg ccgccatgtt    274620
     cgagtcgccc gaattcgagg cttcgctggc gcgcggaaaa ttcaaggacc cggcccacta    274680
     cctgtactcg gccctgcgcc tggcctacga cggcagggaa ccgctgcgca atcccgacgc    274740
     cgcgctggac tggctcaagc gcatgggcca gccgctctac cagcggctga cgccggacgg    274800
     ctatcccatg aacgaatccg attgggccgg ttccggacag atgaccacgc gcttcgaggc    274860
     ggcgcgcgcc attgccgccg cgcccgcgac cttctaccgc gccgaccgcg acgacaggcc    274920
     gcgcgtgccg cccctgccgc ccctggtcca ggcctatggc gccggcgcgg ggccgttctc    274980
     ggcgctgtcg ccggccacgc gccgcgccat cgaatcggcc cccaacgtcc gcgacgccaa    275040
     tacctacctg ctggcctcgc cggaattcat gcgccgctga acgcccgcat tccaggaatc    275100
     gccatgcacc gacgccaact gctcaaactg gccgccgccg ccccgctcac cctgtacggc    275160
     acccgcctgc tggccgccgg cccgcccgac acccgcctgc tggtggtgtt catgcgcggc    275220
     gcctacgacg ccgccagcct gctcgtgccc acgaccagcg agttctatta cgagtcccgt    275280
     ccgcacatcg ccattgcccg cgacgccgcc gccgcgctgt ccgacggctg ggccctgcac    275340
     ccggccgtca aggacagcct gctgccgttc taccagcgcg gcgagctggc cttcgttcct    275400
     ttcgccggca ccgacgacgc cagccgcagc cacttcgaga cccagaaccg catcgagctg    275460
     ggccgcgccg gcggcagcgg cgccgcgccc gcctccggct ttctcaaccg gctggccgcc    275520
     cagctcgacg gcaaggccgg caggccggcg gccttcaccg aggacgtgcc gcagatcttc    275580
     cgcggccagg cgcgcgtgcc caatatcgac ctgggcgggg ccaagcgcaa gtcgcgcctg    275640
     acggccgaca gcagcagcgc catcgcccag atgtaccagg gcaccggcct ggatgcctcg    275700
     gtcaacgaag gcctggccgc catgggccag gcgcgcgccg cgctggaggc cgaaatgcgc    275760
     gaggccaacg gcggtgccgg cagcaccgag aaactggagc aggaggcgcg ccgcatcggc    275820
     actttcatgg ccgagcgcta caacctcggc ttcgtggacg tgggcgggtg ggatactcac    275880
     gtcggccagg gcgcggccaa cggcgtgctg gccaccaagc tgggccagct gggacgcgcg    275940
     ctggccgcct acgcgcaggc gatgggcccg gcctggcgcc ataccaccgt ggtcgtcatc    276000
     agcgagttcg gccgcaccct gcgcgagaac ggcaacaagg gcaccgacca cggccatggc    276060
     agcgtgtact gggtgctggg cggcggggtg cgcggcggac gcatcgccgg cgagcaggtg    276120
     gcggtcaagc gcgacacctt gttccaggat cgcgactacc ccgtgctgac cgactaccgc    276180
     gcgctgttcg cgggcctgtt cggccgcctg tatggcctcg acgcgcaacg cctgcaggcc    276240
     gtgtttccgg gcgcgcgtcc gctcgacctc aagctggtct gacgcgcacg ccacggacgg    276300
     cgcgctggcg ctacactggc cacgcaggcc gctgcggcct gaaccgtccc cctggagagc    276360
     ctgcatgaac accatgtacg acttcagcgc ccccaccata acgggcgcgg aacgcgcgct    276420
     ggccgatttt cgcggccagg tggcgctggt ggtcaatgtc gcctcgcgct gcgggttcac    276480
     gccccagtac tcgggcctgg aagaactgta ccgctcgtac cgcaacgaag gctttgtcgt    276540
     cctgggattt ccgtgcaacc agttcgggcg ccaggagccg gacgacgagg ccgccatcgc    276600
     gcagttctgc gaaacccagt acgccatcag cttcccgctg ttcgccaaga tcgacgtcaa    276660
     cggcgcccac gcccacccgc tgtaccgctg gctgaaggca cgcaagcccg gcctgctggg    276720
     cacccgcgcc atcaaatgga atttcaccaa attcctggtc gggcgcgacg gcctgccgct    276780
     gcggcgctac gcgcccgccc acacgcccga atcgctgcgc cacgacatcg cgcgcgcctg    276840
     cgccgcgccc ggcccgacgc cctagcggcg cccctgcccg acccgctgac gtggacatgg    276900
     cgcgcccgcg cggcgcgacc cgctatcatg acggctgccc gccggctccg cccggcattc    276960
     gctcaggacg cgccatgatc gatctctact actggacgac tcccaacggc cacaagatca    277020
     cgctctttct cgaagagacc ggcctgcctt accgcataca ccccgtcaac atcagcaagg    277080
     gcgagcagtt ccagccggaa ttcctggcca tcgcgcccaa caaccgcatc ccggccatcg    277140
     tcgatcaggc gccggccgat ggcggcgcgc cgatcccgct gttcgagtcc ggcgccatcc    277200
     tgctgtacct ggccgagaag accggccaat tcatccccgc cgacctgcgc gggcgcgccg    277260
     acgtgctgca gtggctgttc tggcagatgg gcggactggg ccccatggcc ggccagaacc    277320
     accacttctc ggcctatgcg cccgagcgca tcccctacgc catcgagcgc tacgtcaagg    277380
     aaaccaaccg cctgtatggc gtgctcgacc gccagctggc gcagcgcgag ttcgtcgccg    277440
     gcgactactc gatcgccgac atggcggcct atccctggat cgtgccgcac gagcgccagg    277500
     gccaggacct gaacgagttt ccgaacctca agcgctggtt cgaggccatc ggcgcccgcc    277560
     cggccacgca gcgcgcctac gcgctggccg accggatcaa caccaagccg tcggtcgaca    277620
     ccgaggagtc ccgccgcgtg ctgttcggcc agaccgccgc caacgtgcgc cgctgagcga    277680
     ggccgccatg accgccacgc tcagcttccg ccgcgccgcc gcgaccgacc tgccggccat    277740
     catcgcgctg ctggccgacg acgccctcgg ccagcagcgc gaagaccgga ccatgccgcc    277800
     gcagccggcc tatctggcgg ccttcggcgc catcgaccgc gatcccaacc agttcctggc    277860
     ggtggtcgag cgcgccggcc agatcatcgg ctgcctgcag ctcagcttca ttcccgggct    277920
     gtcgcgccgc ggcctgtggc gcgggcagat cgaaagcgtg cgggtggcgg ccagcgagcg    277980
     cggcgcgggc accggccgcg cgctgttcga gtgggccatc gcccagtgcc gcgacaaggg    278040
     ctgcggccta gtgcagctga ccaccgacaa gcagcgcgcc gacgcccggc gcttctatga    278100
     atccctgggt ttcaaggcca cgcacgaggg catgaaactg gacctggcat gaaaggaatc    278160
     ccggccatgc atggcgaata caaagttccc ggcggcaagc tggtcgtcat agacctggag    278220
     gtcgcgcagg gccgcctgcg ccaggtgcgc ctgtcgggcg acttcttcct cgagccgccc    278280
     gaggcgctgg aggccatcaa ccgcggcctg gacgggctgc cggccgacgc cggcgccgaa    278340
     ggcatcgcgc aggccgtgcg cgctgcattg ccggccgagg ccgagctgtt cggcttcagc    278400
     cccgaggcgg tggccgtggt cgtgcagagg gcgctgtcat gaaccgcacc gcctggaccg    278460
     actacgactg gcaactgatc cacccgggcc cgctgccgcc ggcgctgcac atggcgctgg    278520
     acgccgccat caccgacgag gtcggcgcgg gccagcgtcc gcccacgctg cgcatctggg    278580
     aatggtcgca gccggccgtc atcatcgggc gcttccagtc gctcaggaac gaggtggacc    278640
     ccgacggcgc gcgccgccac ggcgtgaccg tggtgcgccg cgtcagcggc ggcggcgcga    278700
     tgttcgtcga gccgggcaac accatcacct attcgctgag cgtgccgcag gcgctggtgg    278760
     ccggcatgag cttccaggaa tcgtatgcct tcctggatgc ctgggtcatc cgcgccctcc    278820
     acgagctggg catcaaggcc tggtaccagc cgctcaacga catcgcctcg gacgcgggca    278880
     agatcggcgg cgccgcccag gcgcgccgcg ccggcgcggt gctgcatcac gtcaccatgt    278940
     cgtacgacat cgacgccgac aagatggtcg aggtgctgcg catcggccgc gagaaactgt    279000
     ccgacaaggg cacgaccagc gccaggaagc gcgtggaccc gctgcgcagc cagaccggcc    279060
     tggctcgcga taccattatc gaacgcatgc tgcagacctt tgccggcatg tgccgcctga    279120
     cgcccgccga gatcggcgcg gccaccctgc aggcggcgca acgccaggcc gaggaaaaat    279180
     tctccagccc cgagtggacc gccctcgttc cctgatgcct tccgccctct tggagcaacg    279240
     cccatgaagt accgcgcgac cgcgctgccc ccgccccgcc tgaaactgct ttgcgccgcc    279300
     ggcgcgctgg ccttgctggc cgcctgcggc agcgcgccgc cggccgacat cacgctggcc    279360
     ggcgccgctc ccgccgcggc cggcgccgag ccggccacca tcggcgacgt gcgcaccgag    279420
     cgcatccaat gggccagcgc caagccgggc tgcaccggcg aatgcccgcg cgtcgagatc    279480
     gacagcgtgt ccttccccgg catcccggcc ctgagcgagc tggtcgaccg ccagctggcc    279540
     gccatgaccg gcgtggacca gaacctgcgc ggccgctacc agacgctgtc cgaatacacg    279600
     cagtacttct ggaaaaccgc ccaggcgcgc gacgccacct acttcaaggc cagcgtcaag    279660
     gacgtggtgg gcgacatcgt cgccgtcgag ctgggcacca cccagttcct gaccggcgcg    279720
     gcgcacggca tccccgccac gcattacctg aactggcaac gcagccaggg ccgcccgctg    279780
     acgctggacg aggtcctgat ccccagccgc aaggccgagt atgtcgtcgc catgcgcgag    279840
     gcacaccagc gatggctggc cgccaacgaa gacgcgcagc gcgaccgcgc cgcctacgac    279900
     cgcatgtggc cgttccagga aaccaccaat ttcgccctca cccgccaggg gctggtggtc    279960
     aagtacgacg cctataccat cgcgccgtat tcgcacggac agccggaaat cctcattccc    280020
     tacgagcgcc tgcgcggcgt tctgcgcccc gagttcatcc cggcgggctg agcgccggcg    280080
     gcgggcgccg ccgaacaacg cggcgcaagg cccgttgttc gcgcctttgc cgcgcgccgg    280140
     ccgcgcctat catgcggctg ccgcgcagcg agcgcccctc tacgaccgca ccgcccatga    280200
     ccgaatccgc ccgtcccacg cccgccacca tcctgctgta caccgaggag cagcgcggca    280260
     accaatgggt cgagtccatc gtcgtgggca tgctttcgga tatctcgggc gccgacaagc    280320
     tggtggtcat caaggatccg cacagcggca tcaagttcgt ctatcgcgtc gaacacgatt    280380
     gcaacaacct ggacgcggcc gccatcaccg agctcgacga gacccatttc gacggcaagc    280440
     gcaccaccgc catcaacggc atgaactacc ggatgggcaa ccccgacagc gccatgaagc    280500
     tgctgcgcgc caagccgcgc tggatccagg acaagggcgc cgtgctgtcg gtgctgttgc    280560
     gcaacgccgc cgcgcgcagc accagcttcg tcagccgccg catcgaccgc gagcgcctga    280620
     cgcgcgtgcc ggccgacgtg ccggtcgagc gcctgcccca gccctgacca acgcgggcgc    280680
     gcgcccattc cacgttacaa ttgccgcctg tcgccacgga cgccgcgcgc ggcccgtctg    280740
     tatccgttcc caccagtgcg gcgcctgccc ggcgccgttc gccgaaccca tacatgcctt    280800
     tcaaagacca gctttttctc gccagccagt atctcgctcc gcatcacctg gtctcgcgcc    280860
     tgatgggccg cgcggcggat tgccgcgccc ccgaaatcaa gaaccgcatg attgcgcgct    280920
     tcgtacgccg ctacaacgtc gacatgagcg aagccctggt cgaggacccg ctggcctacg    280980
     ccagcttcaa cgacttcttc acgcgcgcgc tcaagccgga cgcccgcccg ctggacgacg    281040
     agcccggcgc ggcgctgtgc ccggccgacg gcgccatcag ccagatcggc gccatcgaca    281100
     acggccgcat cttccaggcc aagggccaca gcttcgggct gaccgacctg ctgggcggcg    281160
     acgccgagcg cgccgcgccg tttgccggcg gccagttcgc caccatctac ctgtcgccgc    281220
     gcgactacca ccgcgtgcac atgcccctgg ccggcacgct gcgcgaaatg gtgcacgtgc    281280
     ccggccgcct gttttccgtg aacccgctga ccgcgcgcag cgtgccggaa ctgttcgcgc    281340
     gcaacgaacg cgtggcctgc ctgttcgaca ccgagcatgg ccccatggcg ctggtgctgg    281400
     tcggcgccat gatcgtcgcg tccatcgaaa ccgtctgggc cggcctggtg acgccgcaca    281460
     agcgccaggt gcgcagcgtc cgctacgacg ccgccgcccg tgcgcccatc catctggaca    281520
     agggcgccga aatgggccgc ttcaagctgg gctccaccgt catcgtgctg ttcggcccca    281580
     agcgcttgcg ctggctggac ctgccctcgg tacgcgggcc ggtacggatg ggcgaaaccc    281640
     tggcattgcc cgccagcacc gccatttcat ttccagaaag cgaataaaca tctcataata    281700
     aattcgcttt atcgatacat gagggcttgc tagattgcgg cctggccatc gccgccgttt    281760
     ctggagctct catgtcgtct tccgcactgc ccctgtccgc cgcctccgcc gcccgcgccg    281820
     ccgccgttcc cgcctcgctg cgcaagctgc tgtcgctcaa tgacttcgaa gcggcggcgc    281880
     ggcgccgcct gccgcggccg attttcggct acgtggcggg cgcggccgag gacaaccagg    281940
     cacacgacga caaccggcgc gccttcgccg aatacggatt cctgccgcgc gtgctggtgg    282000
     acgtctcggc gcgccatacg cgcaccgagc tcttcggcca ggaatgggcc gcgccctttg    282060
     gcgtcgcccc catgggcatc agcgccctgt cggcctaccg cggcgacatc gtgctggccc    282120
     gcgcggcgcg cgcggcgggc atccccgcca tcatgagcgg atcgtcgctc atcccgctcg    282180
     aggaagtggc gcgccaggcg ccgggcacct ggttccaggc ctacctgccc ggcgaccccg    282240
     cgcgcatcga cgcgctggtc gagcgcgtgg cgcgcgccgg ctaccggacg ctggtgctga    282300
     ccgtggatat tccagtctcg gccaaccgcg agaacaatgt gcgcacgggc ttctccaccc    282360
     cgctcaagcc tggcctgcgg ctggcttggg acggcctgag ccgcccgcgc tggctggccg    282420
     gcaccttcct gcgcaccctg ctggcgcacg ggatgccgcg tttcgagaac tcgttcgcca    282480
     cgcgcggcgc gcccatcctg tcggccaacg tgctgcgcga tttctcggcg cgcgaccacc    282540
     tggactggag ccatgtgcag cgcatccgcc ggtcctggcg cggcgagctg gtcatcaagg    282600
     gcatcatgca tccgcgcgac gccgccctgg cgcgcgccca tggggccgac ggcatcatcg    282660
     tctcgaacca cggcgggcgc cagctcgatg gcgcctgcgc gcccctgcgc gtgctgcccg    282720
     acatcgccga ggcggccggc gccatggccg tcatgatgga cagcggcatc cggcgcggcg    282780
     gcgacgtgct caaggcgctg gcgctggggg cgcgcttcgt gttcctgggc cggcccttca    282840
     actatgccgc cgcggtgggc ggcgaagccg gcgtggcgca cgccatcggc ctgctgcgcg    282900
     aggagatcga ccgcaacatg gccatgctgg gcgtgacgcg ctgcaccgcc atggcgcccg    282960
     ggctgctgcg ccgtctgtaa ggcgcggtcc cctcactccc aggggaagtc gatcagttcg    283020
     ccatacaggc ggcgcagggt cgccttgacc tcgggcgagg actggtagat gcggatgaag    283080
     gccagcaagc gcggatcctg cgcccgctcg ggcgtggcga cccagcggat ggcgtagcgg    283140
     cgcaccgtct cggggtcggt gttgtcgaat gccagcccgt ccttttcgtc gatgcccgcg    283200
     tgcttggcga aggtggtgta ggtgaccgag gccgtcacgt cgtcgaaggt gcgcgccgac    283260
     tgcgagcctt ccagctgcac cagcttgatg cgccgcggat tgtcggtgac atcctgcagc    283320
     gtggcctggt gcccggcgcc gggcttgagc ccgatcagcc cgatcgaggc cagcagctgc    283380
     agcgcgcgcc cggtattgac cgggtcgttg ggcacggcga tggtcgcgcc ctgcgggatg    283440
     gcatcgcctt tcttcagttt cttcgagaac aggccgatgg tggtggaata accgtacgcg    283500
     atcggcgtga ggtgcgtgcc ccggctgcgg ttgaacaatt gcaggaaagg ctcgtgctgg    283560
     aagaaattgg cgtcgatcga gccttcggcc gcagcgatgt tgggcatgac ccagtcgttg    283620
     aactcgatca gcttgacctc cagcccctgc gcccgcgcct gcgcgatggc gatctcggtg    283680
     gcctcgttgg ccacgctggc gatcacgcct atgcgcagcg gcgcctgctg ggccgcgccc    283740
     gcgccggcca ccgcgcacca cagcgccagc gcgcccaacc attgcatcca gccgcttcga    283800
     atccgcattg ccgcctcgcc ttgcgccaaa aatcccattg tgccgcacgg gccgcgcggc    283860
     cgggccggta gccctgcgcc cggcaagggg atcaggctgc cgcgggacgg gtacaggacg    283920
     tggcgccgcg gggcatggcc ctcactggcg cggcccgccg ggcgccaggc gcggatcgta    283980
     gatgaacttc tcgcgccgcg ccacccgcac gctcgcggca tcgcgatgct gcggattgat    284040
     cagcagattg cagtccggca ccccgcggca cggcacgatg gcgctgggca gctgcagcag    284100
     ggccgagccg ttgccgcgca cccaggcgtc gccgatgcgc tgcgacactt cggcaaacgg    284160
     caccgcgtcc cagaagggat ggcgcttgtg cagcgcgtcg acctccagga cctggcgcgc    284220
     ctcgtacacc gcgcgcggca ccacgatctc gatcaggtaa cggttggcct gcgcggtggc    284280
     cggcgcggcg aaatgcacca cggtctccag caccgccagc gccacgcagg acgaggtgta    284340
     caccacggcg gtgcccggac tgttgtagcg cccgcccacc gccgccgcgc cggcgccgct    284400
     caggtcgtcg gcgcggtact tgcccgccgt ggtggcgatg cgccacagcg atacatggct    284460
     caagcgtaga ccccggcggc ggcgcgggcc agggtatcct cgacgatgcg gctgctggcg    284520
     tccgaggtca gcagcgacag cggcttgacg ttgcccaggg cgggcaccgg cgtattgagc    284580
     cattgcaccg cttcggcgtc gccgcccagc acctggcgcg ccaccttggt cacgcgcgcc    284640
     acccgcgcca ggcggtccga ctcgcccagg ggcagcgcct gcccgtcgcg catccagcgc    284700
     gacagcgagg ctgccttcac ctcggtgatg gccatgatct cggacttggg cacttgcagg    284760
     taatcggccg cgtcgtcgag caggcgcggc gacagcccgc gctgcacgcc gtgcgccatg    284820
     gcgatcaagg gactgtcgac caggtcggcg aaggaatcga cgcgcgcctc ttcctcgagg    284880
     gcgcgcttgc gcgccgccgg cgcgcgccgc ttgggcgcgc cccgggcggg gcttttctcg    284940
     gcgatggcaa tgctcatggc ggcctcctgc acaggacagt taattccatt tagaacatat    285000
     tatattccat atgaaacccc atcgcaagac cgggcgcgcc gcgcgcggga gcgccggccc    285060
     cttatcatag gcatctttcg tatcccgcaa tgcaaggaaa cctcatgacg gatcggcaac    285120
     tcatcgtgct ggcggcgctc aatatcatgg tcgccgtagg cgccggcgcg ttcggcgcac    285180
     acggcctcag gcgcgtggtc gaccccaccc tgctggccat ctggcacacc ggcgtgctct    285240
     atcacctcat ccacgcgctc ggcctgttcg tcgtcgccct gctgggcgcg cgcttcggct    285300
     cgccgctgct gtcgatggcc ggcctggtca tgttcatcgg catcctgctg ttctgcggca    285360
     gcctgtacgt gctggtgctg accggcaccc gctggctggg cgccgtcacc ccgctgggcg    285420
     gcgtggcgtt cctggcggca tgggcgatgg tcgcctgggc ggcctggcgc gcgcccgcat    285480
     gatcgcaacc gcgaacacgc gcgccgcctc gccgctgatc ggcatcgcct gcgtcgcggt    285540
     gggcatcttc tgtcttaccc tgagcgacgc ccaggccaag tggctgggcg agcgctacag    285600
     cccggtgcag atcctgttcc tgcgcgccct gatcgccatg cccgtcgtgc tggcgctgac    285660
     cgcgtcgctg ggcgggcggc gcgccctgcg cacgcagtat ccgctggtgc acctggtgcg    285720
     tggcgccatc aacgtcatct cggccacttt tttctacctg ggcctgcagg cgctgccgct    285780
     ggccgagaac gccgccatcg cgttcgcggc gccgctgttc gtcaccgcgc tgtcggtgct    285840
     ggtcctgaag gagcgcgtgg acgcggcgcg ctggctggcg gtggcggcag gctttgccgg    285900
     cgtgctggtc atcgtgcgcc ccggctcggc cagcttccag gccgcggcgc tgtggccgct    285960
     ggccacggcg ctgctgtacg ccgtgatgat gctgaccgcg cgcgccatcg gccgcggcga    286020
     aagcatgctg accacgatgt tctacatcgt ggcaggccaa ctggtgtgca gcgccgtggc    286080
     cgtggcctgg ttctggacca cgccggtctg ggccgacctg ccctttttcg ccggcgtggc    286140
     gctgttcagc acgctcggcc tgacgctgat cacccagggc tttcgcatcg ggccggcttc    286200
     ggtggtcgcg ccgttcgact acaccggact gctgtgggcc acgctgctgg gctggctgtt    286260
     ctggcacgaa acgccggacc tgctcgactg cgtgggcgcg gcattcattg ccggcagcgg    286320
     cctgtacatc gcctggcgcg ccaccagccg gcgccgcagc taggcgccgg accggctatt    286380
     ccagcggcgg gtcgaaatgg cgccgcagca cctgcgccac gttgggctcc tcggccgcgc    286440
     ggcgggccgc cgccgccagc ctgggacaga cgctctgaaa ccatggcggc cccggccgcc    286500
     agcgcgtcat gaccacgaca tacaggtcca gcgcgctgaa acggcggccc agcacgtgcg    286560
     gcgcgccagc cccgcgttcg atctcctgcc acagctgcgc gcgccggtcg tgcacgcgcg    286620
     tgcgcagcag ttcggccgca tcgcccggca aggtccactt ggccggatcg tcgccgtagg    286680
     tgaaggtggc atacacgccc gccaccaggc gcaccagcgt gttccagaag cgcgcccgtt    286740
     cggcgctgcc gggcggcggc gccaggccgg cagccggcgc cacatcgtgc aggtgcatga    286800
     cgatggccgc gctttcggtc atgacttcgc catcgggcag caccagcgtc ggcacctggc    286860
     cggtcacgtt caggctcaac agccggtcgc ggcccggccc cggcttcaga tagggcaagt    286920
     ccgtcagggt atagggcaca ttggccagcg ccagggccat ctcgacgatg gccgacccgc    286980
     acccgcgcga gccgatcagt tcgtacgtgc tcatgatccg cctcctgaaa ccgcggccgg    287040
     cgcgacgcgc catagcgcgc ccttggccgc atcggtcaac acatagatcc cgccgtcggg    287100
     cccctggcgc acatcgcgga tgcgcgcctt gcgctcgccc agcaggcgct cctcggccac    287160
     gactcgctcg ccgtcgagct gcagccggat cagttcttcg ctgcccaatg cgccgatgaa    287220
     cagcgaaccg cgccattgcg gataccggtc cgaggtgtag aacgccatgc cgctgatggc    287280
     cggcgagcgc cgccaccagt accgcggctc ctgtccgccg ggcagcgtgt cccccttggc    287340
     ctccggaatc ggcaggcccg agtaattgat gccgtgcgtg gccagcggcc agccgtaatt    287400
     ggcgccgcgc accaccacgt tgatttcgtc gccgccgcgc ggaccatgct cgtgctccca    287460
     cagctggccg ttccagggat tgagcgccat gccctgcgga ttgcgatggc cgtacgacca    287520
     gatttccggg cgcgccccgg cgtggcccac gaagggattg tcggccggga ccgatccgtc    287580
     ggcatgcagg cgcaccacct tgccctgcag cttgtccagg tcctgcgccg tgggccggtc    287640
     attgttctcg cccagcgcga cgaacaggaa cccctggcgg tcgaacacca ggcgcgcgcc    287700
     gtagtgctgg ccgcgcgaca gcttgggctg ctggcggaag atcacggtga agtcgtccag    287760
     ccgcgtcagg tcggccgaca gcctgccacg cccgaccgcc gtgccgctgc ggtcctcgcc    287820
     ggcctcggcg tacgacaggt agaccaggcg gtcacgcgcg aaatccggcg acagcgccac    287880
     atcgagcagg ccgccctgcc cctgggccgc gaccttgggc acgccctgca gcggcgccga    287940
     cagcgcgccg ccgggcgcca ggtggcgcag gcgcccgggc cgctcggtga tcagcatgcc    288000
     gccatcgggc aggaaggcca gggaccaggg atgctcgagc ccgtcggcca cctcggtgac    288060
     gcgggcatcg gcccgcgtcg gctcggacgc gacctgcgcc gccgtggccg gcgcggccag    288120
     ggcggccagc agtgccggca ggacgccatg gcgcatgatc gtggcagcaa gtacgcgcaa    288180
     catcgaagcc tccccgcgac aggtggttgg tgtatgcgac aggcgggccc gccgggggcg    288240
     ccatcgaact ggcgtaccat acccgggccg gggcgcggcg cgcgccccgc tacggagacc    288300
     ctctacgatg aaactgtact acatggccgg cgcctgctcg ctggcggccc atatcgtgct    288360
     ggaatggatc ggcaagccct acgagacgca tgcgctgtcg cgcgaagcgc tcaaggagcc    288420
     ggcgttcctc aagatcaatc cgctgggcgc ggtgcccgcg ctgaccgaag gcgattgggc    288480
     cctgacgcag aacgccgcca tcctcgaata cctggccgaa caggcgcccc agctgaatct    288540
     gctgggcgac ggcacggcgc gctcgcgcgc cgaggtgcgc cgctggctgg gtttcatcaa    288600
     ctccgacgtg cacaagacct tctcggcggt gttcggcccg cagcgcttcg tggccgacgc    288660
     cgcggcgcag gaggaagtgc gcgcctcggc cgccgccatg ctgcgcggcc tgttcggcca    288720
     gctcgacacc catctgcagg gccgctcttt ccttgcgggc gcccgccctt ccatcgccga    288780
     cgcctacctg tacgtggtcc tgcgctgggc ccacggcaag cagatcgacc tttccggcca    288840
     ggacaacctg gcggcgttct tcgagcgcat gcaggccgac ccggcggtgc aagccgcgct    288900
     gaaggccgaa gggctttcgt aatacgcctg gcgcccgcgg ggtatgatgc gggctccgat    288960
     tcacagatcg accaccctgg cgcgcacggc gcgcgccggt gggcgtcgcc gcgattgcgg    289020
     cgccctgcgg aagtacagat gacagccccc acgcaaagtt gttacctggg cgtactcggc    289080
     ggcatgggac ccatggccgg cgcggcattc gcgctgcggc tggcggccct gacccctgcc    289140
     cagtccgacc agcagcacat tcccacgctg ctgctcaatg accctcgcat tcccgaccgc    289200
     agcaatgccc gcacgcaggg cggcgaagat cccctgcccg ccatgatcgc gggcatgcgt    289260
     ttcctgcgcg aagccggcgc gcgcctgatc gcgatcccgt gcaacacggc ccatctctgg    289320
     tacgagccgc tggccgcggt ggccggctgc accgtgctgc acatcatcga agccgtggcg    289380
     caggacctgc gccgccaggg cctgcacggc ggacgcatcg gcctgatggg cacctcggcc    289440
     acgctggcgc tggggctgta ccagcagacg ctgcagcgcc agggctacag ctgcatcatt    289500
     cccgagcccg acgaagtcga gcgctactgc atgggttcga tccgcgccgt caaggccaac    289560
     cgcctggacc tcgcctacga gccggccgcc gaatgcatcg cccgcctgaa agcgcgcggc    289620
     gccgatgccg tggtgctggg ctgcaccgag ctgcccctgg ccgtcccgca cgccctgcgg    289680
     ccgggcctgg gaatcaggct gaccgactcc atcgacgcgc ttgccctggc cgccatcgaa    289740
     cactacgagg ccgaccagca ggcgcagaag ctggtcgcgt aacgctgcgc gcgggtgcct    289800
     gtcccggcgg ggacagatac cgtcttcgat ggcacacgcg ggcagacgcc atgaaatcct    289860
     gcaggcgcca gtcccccatg cgggaagcga cacctcggcc tacccgccca gataggcctt    289920
     gcgcacctgg tcgttgacca gcaggttggc gcccgtgtcg tgcagcacca cccggccgtt    289980
     ctccagcacg tagccgcggt cggccacttg cagagccttg ttggcgttct gctcgaccag    290040
     gaacaccgtg acgccctgct cgcggatggt gcggatgatg tcgaagatct gcgcgatgat    290100
     caacggcgcc aggcccagcg tgggttcgtc cagcagcagc agccgaggct gcgtcatcaa    290160
     ggcgcggccg atggccagca tctgctgctc gccgcccgac atggtgccgg cgcgctggcc    290220
     ggcgcgctcc ttcaggcgcg gaaacagcgt gtagacgtgc tccaggccgg cgtcgacttc    290280
     ctcgcgcctg gagaaaaagc cgcccatcat caggttctcg gccacggtca ggtccttgaa    290340
     gacccgccgc ccctcgggcg agatggcgat gccgctgcgc atgatgtggt gcgtctcggc    290400
     atgcgtgatg tccttgccct cgaaggtgat gacgccttcg cgcgcgcgcg ggttgccgca    290460
     taccgtcatg agcaaggtgg tcttgcccgc gccgttggcg ccgatcaggg tgacgatctc    290520
     gccctgcttg acctccaccg atacgccgtt gagcgcctgg atggccccgt agtaggtgtg    290580
     gatgttttcc agcttcagca tttattcttc ccccaggtac gccttgatga cgcgcgggtc    290640
     gttgcgcacc tcatcgggga tgccggtcgt gatgggcttg ccgtgttcca tgacaaggat    290700
     gcggtcggat attcccatga tcaggctcat gtcgtgctcg atcagcagca ccgcgacgcc    290760
     gaactcgcgc cgcaactgat cgatcagcga ctgcaggtcg cgcttttcct gcgggttcag    290820
     gccggcggcc ggctcgtcga gcatcagcag gcgcggcttg gtgatcatgc agcgcgcgat    290880
     ctccaggcgg cgctggtggc cgtacgccag gttgcccgcc tcgcggttgg cgaattcgcg    290940
     caagcccatg aagtccagcc attgggccgc tcgcgtcagc gcctcggctt cggcctgccg    291000
     gtaggatttc agcttgagca ggcccggcag caggcgcgcc tcgacctggg tgtgctgcgc    291060
     caccagcagg ttctccagca cggtcagctg cttgaacagc cgcacgttct ggaacgtgcg    291120
     caccaggcca tggcgcgcca ccttgtggct gggcatgccg gtaatcggct tgccgtccat    291180
     cacgatctcg ccggcggtcg gcttgtagaa gccacccacg cagttgaaca ccgtggtctt    291240
     gcccgcgccg ttggggccga tgatggcgaa cacttcgtcg cgcctgacct cgaaggccac    291300
     gctgtcgacg gccagcaggc cgccgaagcg catggtcagt ccggatactt tcaacagggt    291360
     ttcgctcatt tgcgcagctc cacatgcgga cgcttcatgg gcagcaatcc ctgcggacgc    291420
     cacatcatca tcaataccat caccaggccg aacatcagca tgcggtattc ggcgaactcg    291480
     cgcgccagct ccggcagcac cgtcagcagg atcgccgcca ggatcacccc gatctgcgag    291540
     cccatcccgc ccagcaccac gatggccagg atcagcgccg attcgatgaa ggtgaacgac    291600
     tcggggttga ccatgccctg gcgggccgcg aagaaggcgc cgccgaaacc ggcgaacatg    291660
     gcgcccagcg tgaaggccga cagcttgatg cgcgtggggt tcaggcccag cgagcggcag    291720
     gcgatctcgt cttcgcgcag cgcctcccag gcgcgcccca ccggcatgcg gatcagccgc    291780
     gtggagacga acagcgtcgc cagcgccaac gccagcgcca tcaggtacag gtagatcacc    291840
     atgtgctggt tctggaaggt ccagcccatg atctcatgga aggtctggcc gccttccgtg    291900
     ctggcgcggc gcgccatttc catgcccagc acgctgggct tgggcaggcc ggatatgccg    291960
     tccgggccgc cggtcagcat gttcaggttg atgagcagca ggcggatgat ttcgccaaag    292020
     cccagcgtga cgatggccag gtagtcgccg cgcaggcgca gcaccggaaa gcccagcacg    292080
     aagccgaaca gcgccgcgac cgcgcccgag aacggcagcg cttcccagaa gctccagccg    292140
     ccccagtggt aaagcaaggc gtaggtatag gccccgaccg cgtaaaagcc cacgaagccc    292200
     aggtcgagca ggccggcgaa gccgaccacg atgttcagcc ccaggcccag catgacgtag    292260
     atcagcacca gcgtggcgat gtccaccgag ctgcgcccgc tgaagaacgg ccagatcacc    292320
     gcgacggcga tcagcagcac gaccagccat ttgtggccgc gcgccggcgc cgacggcagc    292380
     gtcggcaggc ctgttttcag cgccttgaag ggcttggaaa tccatgggcg caacagttgg    292440
     aacgcaaaaa ccagcgcgca ggccagcgcg accaggtccc agcgcggctc catcagggtg    292500
     cgcgcgccct ggcgcaccag ctgcaggccg aagatcggcg tcacgatgac ggcggtcatg    292560
     accgcagcga tcgtggcatt cttgagagga ctttgttggg tcatcagact ttttccacct    292620
     caggtttgcc gagcagcccg gtgggacgga acagcaggat cagcaccagc agcgcaaaag    292680
     ccacgatgtc cttgtattgc gatgagatgt aggcggccgc gaaggtttcg gccaggccca    292740
     gcagcacgcc gcccagcatc gcgccgggaa tgctgccgat gccgcccagc accgcggcgg    292800
     tgaacgcctt gatgcccgcc aggaagccga tgaacggatt cagcttgccg atggtgatgg    292860
     cgatcagcac gcctcccacc gcggccagca tggcgcccag cacgaaggtg aaggaaatca    292920
     cccggttggt gtcgatgccc agcaggttgg ccatgtgcat gtcctgcgag caggcgcgcg    292980
     aggcgcgccc catgcgcgaa tacttgatga acagcgtgag cgccaccatc agcaccacgg    293040
     tcaccacgat gatcatgatg cgcgaatacg gtacggtgac gtcgaagctg gaacccatgt    293100
     ggaactgcac cgcgcccgag accagcgccg gcacggccat gtcgcgcgcg ccctgcccga    293160
     gagcgaccca gttctgcagg aagatcgaca tgccgatggc cgagatcagc gccaccaggc    293220
     gggggctgcc gcgcacgggc cggtacgcca cgcgttcgac gctatagccg tagacgccgg    293280
     tcacgaagat ggcgaccacc agcatggcgg cgatgatgaa aggcagcggc aggccgctgt    293340
     tggtgccgat ggccgtcagc gtgaccaggc cgacgtaggc gccgatcatg tagatctcgc    293400
     cgtgggcgaa gttgatcata ccgatgatgc cgtagaccat tgtgtagcca atggcaatca    293460
     acgcgtagat cgcccccagg gacagtccgt tgaagaactg ctgggtaagt tgtgggatga    293520
     ggtctgacat gtttactcgt gctccaaatg gctccggctc cggtagtgcg acccggagcc    293580
     ggaaacctgg gcgtacgttg aggcgccggc ggatagccgg cccgtcgcgt gtttacagct    293640
     gggtcttctt gccgttcttg tcccacttga agacggcgaa ctcgaagtcc ttcaggtcgc    293700
     ccttggcgtc gtactcgacc ttgccgatgg cggtgttgaa ggtgttcttg tgcaggtggt    293760
     cggccacctt ggcggggtct tcgcccaccg cgttgatgct ttcggccagc agttgcaccg    293820
     cggcataggc cggcatctgg aacgcgccgt cggggtcgcg cttggcgtcc tggaacgcct    293880
     tgaccacccc ttcattgcca ggcagcttgg tgaagtccga cggcagcgtc accagcagcc    293940
     cgtcgatggc cgggccggcg atggccacca ggtcctggtt ggcggtgcct tccggtccca    294000
     tgaactgcac gttcaggccc tgttcgcgcg cctggcgcag cagcaggccc agctcggggt    294060
     ggtagccgcc gaagtagacg aagtccacgc cggccgactt cagcttggtg atgatggccg    294120
     agtagtcgct gtcgccgacg ttgatgccct cgaacagcgc cacgttgacc ttgttgcgct    294180
     ccagcgtgtc cttgacctgg gtcgccacgc ccgagccgta ggtctgcttg tcgtgcagca    294240
     cggccacctt cttgggcttg atcgtgttgg cgatgtagcg ggcggcgaac gggccttgct    294300
     ggtcatcgcg gccgatggtg cggaagaaga aatgcggctt gatggtgtcg gtcaccagcg    294360
     gcgaggtggc gcccggggtg atggcgacga tgccttcctg ttcgtagacg ttgaccgcgg    294420
     ccaccgtcac gcccgagcat gcatgcgcca cggcgaactt ggcgcccgag ttgaccacgc    294480
     ggttggccgc cggcacggcc tgcttcggtt cgcagccgtc gtcgatcagg atgggctcca    294540
     gcttcttgcc cttcacgccg cccttggcgt tgatggtttc gatcgcggtg agcgcgccgg    294600
     cctggatctg gtcgccgtat tgggtattgg gaccggtcat gggctgggga atgccgatct    294660
     tgatcgtgtc ggcggcatgc acggcgcccg caaaggcgag tgcgccgagt gcaacggcaa    294720
     gcggggtaaa gcgttgcgaa aacttcatgc ggaattctcc cggctagagg ttttgagcgg    294780
     ctttgcatcg gactgcgcaa cagggtgggc tgcgcatcgc aacgggcatt gccggcttct    294840
     tgggcaaaaa agcaatgtgg ccggtattct gcgagctagg aagaagcgtg tcactgcgtg    294900
     taatccccaa tgtttgggac cccgtcgaaa tgcgtgacac atgacgccgt gaattgccgc    294960
     gcgagcctta tacgacgcgg ctttcacgaa acttacgccg cgtcgtccca gacccggttc    295020
     aacgccccgt cgaggcctgg gcgggccgcg cctcggccgg ccgcgccagg ttccacatca    295080
     gcgcccggaa cggcgccagc atgctgatat tgacggccag cttgatcgcc aggtcgccca    295140
     gcatccaggt gacccagggc gtatcggagc cggcgaacgc cacgctgaag aacaccgccg    295200
     tgtccgccac cgccccgatc acgccggaga tcagcggggc gcgccaccag cgctggtcgc    295260
     gcagccggtc gaacacccgg atgtcgatca actgcgcgca caggtaggcc aggcccgaag    295320
     ccagcgcgat acgcggcgag gccacccaga ccgacaccgc cagcgccgcg gcgaagccga    295380
     accaggccac ccggcgcgcc gcgtccggcc cgtagcgccg gttcagcacg tcggtgacca    295440
     ggaatgccac cggataggac aggccgcccc aggtcagcca gtcgttcagg ggcacctgca    295500
     ccaggatatt ggaccccacc accaccaggc ccatgcaaaa caccgccagc aggaacgggc    295560
     cgctgcgcag cggctcgtag cggcgcgacg ccgaactcat cggccgaact cctcggccag    295620
     ctcgcgcgac cggcgcgcgg cggcctgcat ggcgcgctcg accaggccgg cgaagtcgcc    295680
     ctgggcgtac acgtccagcg cggcggcggt ggtgcctccc ttggaggtga cccgctcgcg    295740
     cagcacggcc ggcggttcat ccgattgcgc tgccagccgc gtggcgccgg ccagcgtgcc    295800
     cagcgccagc tggcgcgcct gctcgtcggt cagcccgacg gcgcggccgc cggcgatcag    295860
     cgcctcgatg aacaggaaca cataggccgg gccgctgccc gacagcgcgg tcacggcgtc    295920
     cagcccggcg tcgccgtcga cccagaccac ctcgcccacc gaagtgagca gctggccggc    295980
     cagttcgcgg tcctgcgggg tcacgcccgg caaggcggcc aggccggtca tccccgcccc    296040
     caccagcgcc ggcgtattgg gcatgcagcg caccaggcgc tgccatggct ggcccggttc    296100
     gcccagccag ccggccagcg tatcggcgcg gatgcccgcc gccacgctga cgatcagcgt    296160
     gtccgggcgc agccacgggc gcgtgccggc cacggcctcg cgcatatgct gcggcttgac    296220
     cgcatagacc cacacccggc agcctgccag ggtggcgtcc ggcgccgccg cggcgctcat    296280
     gccgcgggcg cgccagccgg cgtgcgagtc cgcattgatg tcgacgacat ggatattggc    296340
     tgccgggcag accttgccgg ccaggccgct ggccagggcg gcggccatgt tgccgccgcc    296400
     gatgaacgcg atggagagat cgtttttcat agtgccgtga ttgtaaaccg ccgccccagg    296460
     atgcagaatg gcctcaccgg gcgatcggcc ctggaaggca ggccgggcgc ggcccggcgt    296520
     ttgacagcac cgggctgtgg tgtaaaagtc acgcctttgt cacaaacaat tcataaggtg    296580
     tcacactttc gcattgcgcg aaccgccgat gcgatggtct acaaccggag gaaccccttc    296640
     atgagatccc aacgtctagc gctcactttc gccgccgtca tggccgcgtt cgccggtgcc    296700
     tcggcgcacg ccgccactga aatccagttc tggcactcga tggaaggcgc gctcggcgat    296760
     cgcgtcaacg gcctggtcga ggagttcaac aagcagaacg ccgactacca gatcaaggcg    296820
     gtctacaagg gcaactacgg cgaatcgatg aacgccggca tcgcggcctt tcgcgccggc    296880
     aacgcgccgg acatcctgca agtgttcgaa gtcggcaccg ccaccatgat gtacgccaag    296940
     ggcgccatca agccggtgca gcagatgtcc gaggaagtgg gcgaccccat cgatcccaag    297000
     caattcatcg gcgcggtcgc ggggtactac tcgtcgcccg agggcaagct ggtatccatg    297060
     cccttcaaca gctccaccgt ggtgttctac tacaacaagg acgccttcaa gaaggccggc    297120
     ctggacgccg acaagccgcc caagacctgg gaagagctgg ccgccgccgg ccagaagctg    297180
     aaggcagccg gccaggaatg cggctacacc acctcctggc cgtcctgggt gcagctggag    297240
     accttctcgg cctggcacaa cgtgccctat gccaccaagg acaacggctt cgccggcctg    297300
     gacgcccgcc tggcggtcga cacgcccctg cacgtgcgcc atctcgacaa cctcgccaag    297360
     ctggccaagg aaggcatctt catgtacggc gggcgcggcg acgagcccaa ctcgctgttc    297420
     atcagcggca agtgcgccat gatcaccggc tcgagcggcc tgcgcgccaa catcgccaag    297480
     aacgccaagt tcgagttcgg cacctcgacc ctgccctact acagcgacgt gcagggcgcg    297540
     ccgcagaaca ccatcatcgg cggcgcctcg ctgtgggtct tcgccaacaa gaaacccgag    297600
     acctacaagg gcgtgaccaa gttcttcaag ttcctggcca gccccgagat cgccgcccgc    297660
     tggcaccagc agaccggcta cgtgccggtg accaaggccg cctacgaact gacgcagaag    297720
     cagggcttct acgacaagaa tcccggcacc gacgtcggcg tcaagcagct gaacgtggaa    297780
     accaccgcgc agtcgcgcgg cctgcgcctg ggctacctgc cgcagatccg cgagatcgag    297840
     gacgccgaga tcgagcgcat cgtcgcgggc aaggtgccgg ccaaggacgg cctgcagagc    297900
     atcgtcaagc gcggcaacga gctgctggag aagttcgaga aaagtgtaaa gtagcgggct    297960
     tttcgcccgg cgccaggcgg cctggcgcat gatgcgtcat gcgccgccgc aaacgggccc    298020
     tgacttcgcg gcatgagcgg gttcggagcc tcgtgcgttt ggcctgtgcc tgtagcggcc    298080
     ggccggcatt accggccggc cgcctgtatt ctcacctgga cttccgctcc atggaaaaac    298140
     gcgtcgtatt cggccacaag acactgccct acctgctgct ggcgccgcag atcatcatca    298200
     ccatcgtctt cttcttcctg ccggcgggcc aggccatgtg gcaatccctg cgcctggaag    298260
     atgccttcgg actgtcgtcg gagttcgtcg ggctggccaa cttcgccgac ctgttctcgc    298320
     agcaaagcta tctggactcc ttccgcgtca ccgccgtgtt ctcggcgctg gtggccttcg    298380
     tcgggctggc ggtctcgctg ctgctggccg tgatggccga ccgcgtgctg cgcggcgccg    298440
     gcctgtacaa gaccctgctc atctggccct acgccgtggc gccggcggta gtgggcgtgc    298500
     tgtggctgtt cctgttctcg ccttcggtcg gcatcctggc cgtggcgctc aacggcatgg    298560
     gcgtgaactg gaacccccgc ctcgatggcg accaggccct catcctggtg ctgatcgccg    298620
     cggtgtggaa gcagatctcg tacaacttcc tgttcttcct ggccgggctg caatcgatcc    298680
     cgcgctcgct gatcgaggcg gccgccatcg acggcgcctc gcccgcgcgc cgcttctgga    298740
     ccatcgtgtt tcccctgctc tcgcccacca ccttcttcct gctggtggtc aatatcatct    298800
     acgcgttctt cgatacgttc gcggtcatcg acacgaccac gcagggcggc cccggcacgg    298860
     ccacttccat cctggtctac aaggtctaca gcgacggctt ccgcgggctg gacctgggct    298920
     cctcggcggc gcagtccgtc gtgctgatgg ccatcgtggt ggcgctcacc gtgctgcagt    298980
     tccgctacat cgaccgcaag gtccagtatt gaaagcagaa ggtcaacaac catggtagaa    299040
     cgtcgtccct ggctggacat cctggcccac ttcatcctgc tgtgcggggt ggcgctggtg    299100
     gccttcccga tatacgtcac cttcgtggct tccacgcaga cggcgcagga agtcgcctcg    299160
     gcgcccatgt cgctgattcc cggcaagcat ttcgtcgaca actacatgca ggcgctgttc    299220
     gccggttcgg gcggcggctc gtacggcgcg ccggtgggcc gcatgatgta tgtaagcctg    299280
     atcatggcgc tggcgatctc gctgggcaag atcgccatct cgctgctgtc ggcgttcgcg    299340
     gtggtgtatt tccgcttccc cggccgcatg ttcttcttct ggatgatctt cgtcacgctg    299400
     atgctgcccg tggaggtgcg catcgcgccc acctacaagg tggtggccga cctgggcctg    299460
     ctcaacagct acgccggcct gacgctgccg ctgatcgcct cggccacggc caccttcctg    299520
     ttccgccagt tcttcctgac cgtgcccgac gaactggtcg aggccgcgcg catcgacggc    299580
     gccggcccga tgcggttctt ccgcgacgtg ctgctgccgc tgtcgcgcac cagcatcgcg    299640
     gccctgttcg tgatccagtt catctatggc tggaaccagt acctgtggcc gctgctgatc    299700
     accacccagg aagacatgta tcccgtggtc atcggcatca agcgcatgat cagcgggggc    299760
     gacagcgtca ccgaatggaa tatcaccatg gccaccgcga tcctggccat gatcccgccc    299820
     gcgctggtgg tcatcctgat gcagaaatgg ttcgtcaagg gtctggtcga caccgagaag    299880
     taagccgccg cccgcccgcc ttccgcccca gaatcacgca gacgattaca tccgtatggc    299940
     tactctcagc tttcgcaacg tcaagaaaac ctatgccggc aacgtgccgg tgatacacgg    300000
     catcgacatg gacgtcgccg atggcgagtt catcgtcatc gtcggcccgt cgggctgcgg    300060
     caaatccacc ctgatgcgca tggtggccgg cctggaaacc gtcaccgagg gcgagatcct    300120
     catcgacgac aaggtcgtca acacgctgga gccggccgag cgcgatatcg ccatggtgtt    300180
     ccagaactat gcgctctacc cgcacatgag cgtgttcgac aacatggcct acggcctgaa    300240
     gatccgcagg ctgcccaagg acgagatccg caagcgcgtc gaggccgccg cgcagatcct    300300
     cgagctgggc aagctgctgg accggcgccc gcgcgccctg tccggcggcc agcgccagcg    300360
     cgtggccatg ggccgcgcca tcgtgcgcga acccaaggta ttcctgttcg acgagccgct    300420
     gtccaacctg gacgccaagc tgcgcgtggc gatgcggctg gaaatcctca agctgcatcg    300480
     ccgcctgaac accaccagcc tgtacgtcac gcacgaccag gtcgaggcca tgacgctggc    300540
     gcaccgcatg gtggtgatgt accagggcgt gcccgagcag atcggcacac cgatggaggt    300600
     gttcgagaag ccggcctcga ccttcgtggc gggcttcatc ggctcgccgc ccatgaatct    300660
     gctggaagtc gccgtgggcg gcgacggcat cgtgcatacc agcgatggca tcgcgctcga    300720
     catttcgccg ctggccgtgc cgcagcaggt gcgcggccgc aaggtcgtca tgggcctgcg    300780
     tcccgagcac atgctgctca acgcgcaggg cctggccgcc gaaatcgaaa tgatcgagac    300840
     actgggctcc gagcaactcg tccatggccg ctgcggcaag cacatggtgg tggtgcgctg    300900
     cagcacccgc cagttttccg agacgcccgc ccgggtcggc gacacgctga ccatcggccc    300960
     cgacggccgc caccccctgc actggttcga ggccgatacc ggccgccgcg tcgaagggct    301020
     ctgacgtatt cggtgcctgt ccccgccggg ccgaggtgcc tgccccggcg ggccaaggtg    301080
     cctgttcccg ccgggccaag gtgcctgtcc ccgcggggac aggcaccctt gccgcagcgg    301140
     ggacaggcgc ccgtgcgcgg cgagccgcgc gcatgcgcct tacttgtacg acgtcttgct    301200
     gccgtccttg tgccaggtga acacctcgaa ctcgaacgcg ttcaagtcgc cctgcttgtt    301260
     ccacgaggtc ttgccgatcg gcgtctggaa actgttggcg tgcaggtact gggccacctt    301320
     ggtgggatcc tcgctgccgg cgcccttgat gccgtcggcg atcacctgcg tggccgcgta    301380
     ggcggtcagc tggaacgcgc cgctggcgtc gcgcttcttg tccttgaacg ccttgacgat    301440
     ctcggcgttg gccgggttga gcgtgaagtc ggccggcaag gtcagcagca tgccttcgac    301500
     ggcgggaccg gcgatggcgt tgatgtccgg gttgcccacg ccttccggcc ccatgaactt    301560
     ggcatccagg ccctgctcgg cgccctggcg cagcagcagg cccatctcgg ggtgatagcc    301620
     gccgtagtac acgaagtcga ccttggcggc cttcagcttg gtgatcaccg ccgaataatc    301680
     gctgtcgccg gcgttgatgc cttcgaagat gacgaccttg gtgccgttct tctccagcgt    301740
     gtccttgacg gcggtggcga tgccctggcc gtacgactgc ttgtcgtgga tcacggccac    301800
     cgtcttgggc ttgatcttct ccaggatgaa cttggccgcc gccgggccct gctggtcgtc    301860
     gcggccgatg gtacggaaga tgaactcgta gttcttgccg tcggtgaccg ccggcgaggt    301920
     ggccgaaggc gtcaccatga ccacgccttc attgttgtag atctcggtgg cggcgatggt    301980
     cgcgcccgag catacgtggc ccaccacgaa gccgatcttg tcgttgacca cgcggttggc    302040
     ggccaccggg ccctgcttcg gttcgcagcc gtcatcgatg accacggcct ccagcttctt    302100
     gccgttgacg ccgccggtgg cgttgatacg ctcgatcgcc gtatccacgc cctcgcgcac    302160
     catgtcccca tactgggtga cctggccggt ggtggggccg accacggcga tcttgatcgt    302220
     ctgcgcgtgg gcgccggccg acatggcgat acctgccgcc atgcccagcg ccgcgatcac    302280
     cggcgtgaaa cgaaatgcct tgttcatatg cctgctcctt ggcttttaat cattgatatc    302340
     gaccggcctg gcgcgtggac cggcaatgcc cgcccgcgcc cggcctatag cagggcaagc    302400
     atacactgaa aggccctgtt tccgggcatg ttgcggcgcg tcccggaagc ctcgcgcagc    302460
     cgttcgttat acccgcgcgc gtatatgcaa tggagcattt cttcgtttgc gttcataagc    302520
     ggcgacggca tcatcaggcc catgagactc caacccatca tcgtccccgg atggcaaggt    302580
     tccggccccg gacactggca gacgcactgg agccgcacgc tgccgcatgc cgtgcggctg    302640
     cagcaacgcg actggcacca gccgcagcgc gccgaatggg tcgcggccct ggccgccgcc    302700
     gtcgacgccg cgcctacgcc ggtgctgctg gtcgcccata gcctgggctg cctggtcagc    302760
     gcggcgctgc cgatcgcgct gcgcgccaag gtggcgggcg ccctgctggt ggcgccggcc    302820
     gatgtcgagc ggcccggcgc gcccgccgcc atcgccgcct tcggcccggt gccgcggcaa    302880
     tcgctgccgt accaaagcgt ggtgatcgcc agcgacgacg atccctactg ccggctggag    302940
     cgcgcgcgcc agttcgccca ggactggggc agtcggctgg tggtgctgca gggcgccggc    303000
     catatcaacg ccgacagcca attgggcgca tggccgcagg gcttgaaaca actggccgcg    303060
     ctgcgccggc gcgcctgctg gcgcatcagc ccgccagccg agaaaatccc gccagtgccc    303120
     gccggcatca tggtgccgcc gcgctacggc tagcgcacgc gcgcgcggcc tgccgatatt    303180
     aacggacgcc tggcgtccgt taatattttt gcgcacggaa aaaatagcct ggcaagcaga    303240
     atcgataatc cgggaattaa taaatccggc gatccgcgac gcggcgccgc aaacacggcc    303300
     gcgctacagc attatttccg cggcgggcaa cgtgtaagcg caaggataac catgtaagca    303360
     gccgtaccgc actgcaacct catatgcgcc gcgtgactac ggcacacgct ccaggctaat    303420
     caggcgacgc aacattggca ttgagaatgt cggggcttga aatatttgtc gacaggccgc    303480
     cctctagaat cctccgcagc tctccgcttc cgggcgggat ggcgcgccgt ttcaacggca    303540
     tcggcgccag gccctgcccg ataacggctg cctgatcggc cataacccgc cgcgcggcct    303600
     ggatttatcg ttgtgcagtg cgcaattcct acgctctgcc gcaccgcggc ggagcgcgcc    303660
     cattaatggc ccgctgtcag acagcatgct agaaggatgt tcaatggcaa agcgtattgc    303720
     cgtcatcgga ttgtcgttcc gattcccccg caccaatacc gccgattact ggcgcgacct    303780
     gctccagggc aaggatctgg tctcccaggt cgacgaatcg cgctggtcca gcgatgccta    303840
     tttccacccg cagcgcgatc atccgggcac cgcatatacc cgcagcgcgg gctcgctcgg    303900
     cgacatttcc ggcttcgatg cggatttctt cggtatctcg ccacgcgaag cagccttgat    303960
     ggatccgcag cagcgcctgc tgctggaact gtgctgggaa ggcttcgaaa atgccggcct    304020
     gcggccgtcc cgggtacgcg gcagcgattg cggcgtatat atcggcatcg ccagcgcgga    304080
     ttatgcctac cggctggccg acgatctgga ggtggtcgat gcctccatcg ccaccggcaa    304140
     taccagcagc atcgccgcca accggctgtc ctacgtgttc gacctgcgcg gccccagcat    304200
     ggccgtcgac accgcgtgct cgtcgtcgct ggtggccttt caccaggcat gccgcgccat    304260
     cgccgccggc gacgccacca tggctgtggc cggcggcgtc agcctgcacc tgcacccgta    304320
     cgggttcgtg accttctcca aggcttccat gctgtcgccg cgcggccgtt gccgcgtgtt    304380
     cgacgccagc gccgatggct atgtgcgcgc cgaaggcggc ggcctgttca tcctcaaaga    304440
     ctatgacgcc gccctggccg acggcgaccc catcctggcc gtggtggcgg gcaccgccgt    304500
     caacaccgac ggcaggaagt ccggcctgac cgtgcccagc gccgacgcgc aggccaggct    304560
     gctgagccag gcctatgcgc aggccggcat cgacccgcgc cagatcgatt acctggaagc    304620
     gcacggcacc ggcacgccgg tgggcgaccc catcgaaacc cgcgccatcg gcatggcgct    304680
     gggccggcag cgggcggccc acgcgccttt gcccatcggt tcggtcaaga gcaaccaggg    304740
     ccacctggaa gcggcctccg gggtcgccgg cctggtcaag gcgctgtact gcctgcgcca    304800
     ccgggaagtg cccgccacca tcggcgtgga cgagatcaac cccaacatcg attgcgccgc    304860
     ctggaacatc gacatcgtgc gccagcggcg cgccctgccc gaacgcggca cgctgaccgt    304920
     gggcgtgaac tcgttcggct tcggcggcgc caatgcccac gtcatcctgc agacgccgcc    304980
     ggacgagccg catgcgccgc ttgccacact ggccaccacc tcggccatcc cgctggtcat    305040
     cagcggcaag cagcccgccg cgctcaaggc ggccgcgcgc gacatggcgc ggcacctgcg    305100
     cagccagccg tcgcgcgccc tctacgatat cgcctaccag gccgcgctgc gccgcgactg    305160
     gcacgaagag cgggccgtcg tgtatggcgc cacttccgaa gccatcgccc aggccctgac    305220
     cgccttggcc gacgaaagcg ggccgcgccg gctggtcgcc agcggccgcg ccgtgcccgc    305280
     cgcccaggga ccggtgttcg tctactcggg caatggctcg cagtgggccg gcatgggcga    305340
     gcgcctgatg cacaacccgg tgttcgccga agcggtgcac gagatcgacg cctacttcca    305400
     tccgctggcc ggctacctgc tgggcgatgc gctgcgcgcc gccccgggcg attgccgcta    305460
     cgacagcacc gaatatgcgc aacccgcgct gttcgccatg caggtgggca tgacccgcat    305520
     gctgaaccaa cgcggcatcg tcgcgcacgc ggtcgccggc cacagcgtcg gcgaagtcgc    305580
     ggccgcctgg gccagcggcg cgctgacgct ggccgacgcc gtgcaagtga tcttccatcg    305640
     cagccgcctg caagggttga cgcgcgggcg cggcgccatg accgcggtgg gcgtggacgg    305700
     cggcgccgcg ttggcgctga tcgccgaact gggcctgtcg cgcgtgctgt gcgtggccgg    305760
     ccacaacagc agccgcggcg ccaccatcgc cggcaacccc gatgcgctgg cggtgctgga    305820
     aaatgccctg cgcgagcggc gcgccttcca gcgccggctc gacctggact atgccttcca    305880
     cagccccgcc atggacggca tcagcggcgc gctgcacgaa gcgctggccg gcctgacgcc    305940
     cggcgaggcg gaaatcccgt tctattccac cgtcgccggc gcatgcatgg ccggcgccgc    306000
     gctggacgcc aactactggt ggcgcaacgt gcgccagcca gtgcgtttcg accaggccat    306060
     ggccgcgctc atcgaacagg gcgagaacat cttcgtcgag atcggaccgc acccggtggt    306120
     gcgcggctac atcaacgatg cgctcaagca ggccaacgtc gaaggccgcg tcatcgtcac    306180
     cgcgacgcgc ggcgaggacg acccgcagcg cgtgcacgac gccgccggcc aggtggtggc    306240
     cagcggcgcc gcgccccagt ggcaaacgct gttcccgtgg ccgggccggc atgtcgagct    306300
     gccagcctac gcctggcagc gcgaacgcca ttggcatccg ctcacgccgt ccggcatcgg    306360
     actgctggag cgccgccgcg tgcatcccct gctgggctac ccgctgcgcc agcatgaatc    306420
     gacctgggaa aaccagctcg attgcagcac ccatccggcg ctggccgatc acgtcgtggg    306480
     ccaggccgtg gtgttcccgg gcgccggatt cgccgagatg gcgctggcgg cggcgcaggc    306540
     ccggcacgag gatggggagt acgtcgaact cgaagacctg gaaatccacg cgccgctgct    306600
     gctggccgca ggcgctgcca aggtgacgcg ctgcgccgtc gacccccagg acggccgctg    306660
     gcacgtgcgc gcgcgcgacc agggcagcga cggcgcctgg accacgcatg ccaccgcgcg    306720
     catcctcagc gagcccggcg ccgccctgct aggcgagcgt gcgcccgcct tgcccgaacg    306780
     ccccgccgat ttcgacgccg ccagccatct ggcgctgacc gaaagcgtgg gcctgagcta    306840
     tggcccggcg tttcgcgccg tggagcgcgg ctggctgcag gacgacggcg acatcgtcgc    306900
     gcagctgcgc atgcccgagc ccatcgccac ggaactggcc gcgcaccatc tgcacccggc    306960
     ggttttcgac agcgtgctgc agctcatcat ccactggttc cgcgacgacg cgcaacgcga    307020
     cagcgggctg acctacgtgc cggcccgcat cggccgcctg gcctggcggc gcgccgccgg    307080
     cccggtgcat tcggcgcgcg tgcggttgct gcgccgcaac ccgcattccc tgatggccga    307140
     attcgcgctg ttcgacgccc gcggcaagca gatcgcccac gcgcgcgaag cgcggttccg    307200
     cagcatccgc ctgcgcaagg gcgccggcga ggcgctcgat ttcctgcatt acgtcggcgt    307260
     gccgcggccg cacccacaca ccgacgcgcc gccgccgctg caggtggccg acggcgaacg    307320
     cgcgatcctg caggccatcg atgccgactc cctcaaacgc tatgcgtacg aggtcgatcc    307380
     gctgctcgac agcctgtgcc ggcagttcac ctgcgaagcc ctgcacgcgc tggccgacga    307440
     cgacggcttg ctgtccgcgg cgaccgtgac gcgctgccgc gaagccgccg atggcggcgc    307500
     cccgctgctc gagcaattgc tgcgccaggc ccaggaggac ggacagctcg acgccacgcc    307560
     gtccggctgg cggctgcgcg ccgccgaccc gcaggagccg cgcgccaccg atatctggaa    307620
     cgcgctggtg cgcgagtacc ccgagcactt ccgcgtcgcc caggcggtgg gccgggtggg    307680
     cctcagcctg cctgcgctgc tgcgcggcga acgcaccctg gacgaagtcc atccgcctgc    307740
     gcttacgccg ggctcgctga ccgcgcaact gttgcctgcg ggacaacagc gccgcctcgg    307800
     ccagcacatc gccggctggc tggcgacggc cgtggcgcag ttgcgcggcg acgcgcgcct    307860
     gcgggtgctc gaatgcggcg ccgacggccc cgccttcggc ctggactact accaggccct    307920
     cgacgacgac cgcatcgact gcgtctaccg cagctcgcgc agcgcggcca tcgacgaggc    307980
     cgaacggctg cgcgagcgct gccccgatct gagcgtgcag gccatcgacc ataccgaacc    308040
     gccggcaggt cgcttcgacc tggccatcct gcatgccaac tggccgacgc tggacgaggc    308100
     gcgccaggcc ctgggccacg tacgccactg cctggcgccc ggcggcgtgc tgttgttgct    308160
     ggccaaccag cccaccgcgt ggctggactt catcttcggc gcgcgtggcc agtggtggag    308220
     cgcctcggtc gcgggcgagg ccacgcccgc gctgcagccg gccgccttct ggcgccgcga    308280
     actgcaggcc ctgggctgcg cctgcgagcc ggcggccgac ttcctgccgg acacccgcag    308340
     cggcccctac ctgctggcgg ccaccgtggc cacggtggcc gacggcgaca gcggcgatac    308400
     ggtagacgcg ccgcccgcgc gccgctggct gctgctggcc gacgcggccg acgccgccgt    308460
     ggccaggccg ttggcggccc aactgcgcgc cgctggccag caagtgatca cggccggcga    308520
     tgcccccgag gacgacgccg gtctggccct ctggctgcag gaggccgcca agagcggtcc    308580
     ggtcgatggc gtgatccacg ccgcgggact ggccgccacc gcccacatcg acgccgccgc    308640
     catgctgcgc caccaggtgc gccgctgtgc cctggccgcc gccacgctgc aggccgggcc    308700
     gccgcttgcc gacgcgccgc tgtggctgct gacgcgcggc gccgcccagc acctggccgg    308760
     cgacgacgcc gtcgcccctg ccgccgacag cgcgctgtgg ggctacggcc gcacgctgat    308820
     gaacgagtcg aacgctgtgc gcatgctgga tctgccgcgc aacatggccg acttgcccct    308880
     ggatgcgctg acgcgcgaac tgctgtggcc cgacaccgag caggagctcg tcctggccgc    308940
     cggcggcagc cgctacgcgc cgcgcctgcg cctggcgcag ccgcccgcgc cgcgcgccga    309000
     ctgcccggcc caagcgccgc aggacgccgc ggcggtgcag ctgggcttcg agctgcccgg    309060
     gcagctgcgc gccctggcct ggcgccacgc gccgctgccg gcgccggccg ggggccagct    309120
     ggaagtggcc gtggccgcca ccgggctgaa cttccgcgac gtgatgtacg cactgggcat    309180
     gctgtccgac gaagcgatcg aaaacggctt tgccggcccc acgctgggcc tggagttcgc    309240
     cggcacggtc acgcgcgcgg gcgcccaggt ccagggctac gcggcgggcg acgcggtggt    309300
     cgggttcgga ccggccagct tcggcgaccg cgtgctgacc acgcccgccg ccgtggcccg    309360
     cgtgccggcc ggcatgtcgc tggaggcggc cgccacgata ccgagcacct tcttcaccgc    309420
     ctactacgcg ctgcatcatc tggcgcagct cgaacccggc gagaaagtgc tgatccacgg    309480
     cgccgcgggc ggcgtgggca tcgcggcgat ccagtatgcg caatggcgcg gcgccgaaat    309540
     ccacgccagc gccggcacgc ccgacaaacg cgacttcctg cgcctgctcg gcgtgcagca    309600
     tgtctacgat tcgcgcaccc tctcctacgc cgacgaggtg ctggccaaca ccggcggcgc    309660
     cggcgtcgac gtggtgctca actcgctggc cggcgaagcg atccatcgca acctggtggt    309720
     gctcaagccc tttggccgct tcctggaact gggcaagcgc gacttctacg agaacacgcg    309780
     catcggcctg cggccgttcc gcaacaacat cagctacttc ggcatagacg ccgaccagct    309840
     gatggcgcgc cgtcccgccc tgacccagcg gctgttcgcc gacatgatgg cgctgttcga    309900
     ggccggcgcg ctgcatccgc tgccgtacac ggtgtttcat gccgaccagg tggtcgatgc    309960
     cttccgccac atgcagcagg cccgccagat cggcaagatc gtggtcgccg gcatggacga    310020
     ggtccgcccc gcgcctgcca cggcggcgcg gccggacgcc gcgctcgccc tcgatccgcg    310080
     cgccagctac ctggtgaccg gcgggctggg cgggttcggc ctgcgcacgg cgcagtggct    310140
     ggccgacaag ggtgcgcgcc atctggtgct ggcaagccgg cgtggcgcca ccgaacccga    310200
     tacgctggcg gcgctggccg ccctgcgccg ccagggcgtg gccgtgcacg ccgtcgcctg    310260
     cgacgtcacc gaccgcgccg ccctggcggc gctgctggcc ggcattgcgg ccgagacgcc    310320
     gctgcgcggc atcgtgcacg cagccatggt gatcgacgac gccctggtgc gcaataccga    310380
     cgcggcgcgc atcgaacgcg tgctggcgcc gaaactgctg ggcgcgcaac acctggacgc    310440
     gctgacggcc gggctggcgc tggacttctt cgtctgcttc tcctcggcca cgacgctgtt    310500
     cggcaatccc ggccagagca actatgtcgc cgccaacgcc tggctcgaag cattctgccg    310560
     cgcccggcgc gagcgcggcc tgccggccac ctgcgtagcc tggggcgcgc tcgacgatgt    310620
     gggctatctg gcccgcaacg tcaaggtcaa ggacgcgctg gccggacgca tgggcggcca    310680
     ggccttgcgc tcggacgtgg ccctgcaggc gctggaggac atcctgttgg ccgatcgcag    310740
     cgacctgggc gtgctggagc tggactggaa cgcgctggcg cgcttcctgc ccagcgcggc    310800
     cagtcccaag ttcggcgatg tggcgcgccg ccgcgcccag gccggcggcc ccgacctgaa    310860
     cgacgaggac atccgccacc tggccgccac gctggacgac gccgcgctgc aggcccgcct    310920
     ggtcgagatc ctgaaagcgg aagtgggcga aatcctgcgc gtgccgatgg accgcctcga    310980
     cgcgagccgt tccgtgtacg acatgggcct ggactcgctg atgggggtcg aactgatggt    311040
     ggcgctggag aaccgttgcg ggctgaaatt gccggtgatg gcgttgagcg aaagtcccac    311100
     catcgaacag ctggccgaac gcctggtcgc gctgctgcgc ggcgaatccg acatgccggc    311160
     cgacgcgacc gccgcgcagg tgcggcaagt ggcggcgcaa cacgcggccg acgtgccggc    311220
     agactccctg gcggagttcg ccgccgatct cgacgccacg gcgcctcgcc agaaaatgat    311280
     ccattgaatc ccatgacgca cagcaagacc ctgcccggcc tggcggccgg catcaaacag    311340
     aagctgatcc agcaagcgct gcagcgcaag ctgcgcaacg cggcgccggc cacggcctcg    311400
     ccgttggcgg ccggtgcgcg cgtcgccgtg ggcgacgccc attgccgctt cgaccagcat    311460
     ccggcctacc agcagttgcg catcatcaat gacggcgccg cgcggctggg catcgacagt    311520
     ccgttcttca agctgcacga aggcagcgcc ggcgcgacca cccgcatcga cggccagccc    311580
     tacctgaact tcgccagcta caactacctc ggcctgtccg gcgacgcgcg cgtcaacgag    311640
     gccgccaagc aggccatcga ccgctacggc acgtcggtct cggccagccg cgtggtatcg    311700
     ggcgagcggc ccgtgcatcg cgagctggag cgcgaactgg cgcggcttta cgaagtcgat    311760
     gacgcggtcg ttttcgtcag cggccacgcc accaacgtat cgaccatcgg ccatctgttc    311820
     ggcgccaacg acctggtgct gcacgacgaa tacatccaca acagcgtgct gcaaggcatc    311880
     cagctggccg gcgcgcggcg cctgtccttt ccccataacg attgggccgc gctggacgcc    311940
     ttgctgaacg aacagcgcgg ccatttcgaa cgggtgctca tcgtgctcga aggcatctac    312000
     agcatggacg gcgactaccc ggacctgccc cgcttcatcg aggtcaagcg ccgccatcgc    312060
     gccttcctca tggtggacga ggcgcattcg ctgggcgtga tgggcgcacg cggacgcggc    312120
     atccgcgagc acttcgacct ggccggcaac gacgtggata tctggatggg cacgctgagc    312180
     aagacgctgg ccggctgcgg cggctacatc gctggcgaac acgccctggt cgagcacctg    312240
     aagttcctcg cgcccggctt tctgtacagc gtgggcatgc cgccggcggt cgccgcggcg    312300
     gccctggcgg ccctggcgcg catgcgcgaa atgcccgaac gggtcgccac cctgcaggcg    312360
     cgcggccgcg acttcctgcg gcaggcgcgc gcgcgcggca tcgacaccgg cagcagcagc    312420
     ggcctggccg tcatacccgc catcgtcggc aactccatca aggccgcccg gctgtcggcc    312480
     gcgctgttcg cgcgcggcat caacgtgcag cccatcctct accccgccgt ccccgagcaa    312540
     tcggcgcgcc tgcgcttctt catgtcggcc cagcacagcg aggccgacat ccgccaggcg    312600
     gtcgacaccc tggccgagga aatcgaccgc gcctagccgg gcggggccaa ccccatgtgc    312660
     cgcaggaaca cctgcgccag ctcgtcgacg cggcgcaggc cgggtgcggc gccgccctgg    312720
     ccgccggcct gccagatcag gtaatcggta cggccgtccg gctcgcccag gcgccggtac    312780
     acctcggcca tgatgggcac atggtcgcca tacacgcaca ggcctgccgg gcgcgacagg    312840
     ccgcgcatgg ccgccgccag tccggtgaac atggcgtcgg cattgcgcag atgccgcgca    312900
     tacgccacca ggtcggcgca gccaggcgca agcggcccgt ccagcaccgc cgcggcgtcg    312960
     gccgcgtcga cgctttccca atgcagcgga ccatggttct ccatggtgat gacatgcacg    313020
     tacaacggct ggctgccctg cccggccagc cgctcggcca cgtagcgcgc cagcgccgcg    313080
     tcggccacat agggcccggc gcgcggcgcg tcggcgaagg cgtccaggtg cacgaactcg    313140
     tcgaagccca gccagggcat gacccggtca cggccgtaga agctggcgtg gaagggatgc    313200
     acgcacaccg tgcggtagcc gcgctggcgc agatggctgg ccaggctggg ctgcggctgg    313260
     cgcaggcgcc ggtacgggtt gtagcggtgc acgcccagcg ccgacgcggc cagcccggtc    313320
     aggaaggcga attcggtgcg caccgtattg gcgccccagg ccgccacctc gagctggccg    313380
     tgctccaggg cctcggcgcg cagcgcatcc aggccggcca gcacctcggg cttgagcgtc    313440
     ccgaacacgc gccgcgcgtc gaagaatgac tcgctctgca cgctgaccag gtgcggcagc    313500
     gggccggcgc ctgccgccgc gggcgccgcg ccgaacggac cggatcgcat ggcgggcgtc    313560
     caaggctggc gctcggccct tccatacagc cacagggtgg ccaccagacc caggcgccgc    313620
     aagtcctgat ccgcctcgta ggtcagcccg gcgtcgcggt ggccggccag cacagccagc    313680
     gccgcgccgg cagccgccag cgccagcgtg gcgccccaga acggggccgg cgcagcatgg    313740
     gcggcccagg ccgccgtgcg cgccccggta gccgagggct ccagcgccag tccggcccac    313800
     aacgccaggc cgtacccgca cgccagcagc agcgccgccg gccatcccag gaacggcagg    313860
     tacaggcgcg gatggcgcag cgcatcggtg aagtattcga aatcgctgta gacgaacggc    313920
     tcgcgcagca cgcgcgcctt ggcggcgctg accagcacca gcaccgcctc gatggccaat    313980
     acgttgatcg cgccgaagta cggccggcga aacagggcca gctcgagcgc gaacagcagg    314040
     gtccagacgc cggcatgcag cagcagcgtc caggccggcc gccgccatgg cggctgcacc    314100
     ggcggacgca gcaatgcctc cagcgcccac gacagcacca gtccgccggc ccaggcgggc    314160
     gccaatgcca gccagaacgt ctcagccacc gtagcccagc cagcgcagca ggcggctgga    314220
     gaccgccggg tgcgcgagcc ccaggaacca gcagcccagg ttgagcggaa acggaaagct    314280
     gatgcgcgcg cggttggccg ccagcccgcg ccgtatcgcg cgggccgctt tcccgggcgg    314340
     ccacaggaat ggcttgggcc ctggcatggc cgcgcacatc ggcgaggcca cgtagcccgg    314400
     catgatgaca ttcacccgca cgccctgcgg cgccagccag tcgcgcaacg cctcgccata    314460
     cgccttgacc gcggccttgc tggcgctgta gctgggcgtg tcgggcaggc cgcgccaggc    314520
     ggccagcgag ctcatcagcg cgatctgccc ctggccgcgc gcgcgcatgg ccggcagcag    314580
     gccatgcacc gtcgcctggg ccgcgcgcag attggtgtcc atcaccatgc acacgtcttc    314640
     ccagcgctcg ccggcgcgat cgggcccgat gtcgatattg acgcccgcgt tgatgatggc    314700
     caggtcgggc gggtgcgtag cgttcacctc ctccagccac gccagcaggc gctcggtggc    314760
     gcggatgtcg aaagccgcca cgctgagggt ggcgccgcgc tcgcggcaca gcccggccag    314820
     ctcgtcgagc cgccccaggc gccggccttg caggatcagc cgcacgccgg gcgcggcgta    314880
     ctccagcgcc agcgcccggc cgatctcgcc gctggcgccg gtcagcagca cgcatgccgg    314940
     ccagttcgat ctcatagcaa ttcctccagg gccgagcgcg gcgccgtcag gcgtcccacc    315000
     gcattggcca ccgccaggtc gatgcccggc gcgcaataaa agccgccgtt gacctgggtg    315060
     gcatggatca ccacggcctg gaacgcggcg aacagggccg cctgtggcgg cgtggggtcg    315120
     cgccagaaat cgtccagcgt gtgctggcag gtaagtcccg gcatggcgta gatgggctgg    315180
     ctcagcgcca gcgtagcgca gccggccgcc agcgccgcgc tgcccacggt gctgttgacc    315240
     gtcaccacgc cggcggcgtg cgccagcaag ccgggcagat gcccggtctc caggtagcgc    315300
     acgcgccgct gcaggccgtg gcgccgggcg gtttccgcgg taacccggcg ctggtcgacg    315360
     aagcccggat cgagcgggtg gttcttgacc accagcaggc agtccggcgg cgcgtggcgc    315420
     gcgaacgagg ccatcaccgc atcctggacc tcgcgcatat cgccgtaggg agagtggtcg    315480
     cggatctgcg cgtcgctgtc cagctgcagc ggcagcagga agaagcgcgc gcgccgcgcc    315540
     gccaggtcgg ccatggcgcg ggcgtcctcg gcgcgccggg cgcgcaagcg cagggcccgc    315600
     cgcacatagg cggcgtactc gcgcgccgcg ccatgcggcg cgtgcgtgcg atagcgcgga    315660
     aacagcagcg ggttccaggc gttgcatgcg tggtaggcca cgtcgtgcca ggcgcgcagc    315720
     cagaacggcg acctgaacgc gcgcgggctg gcctgcggca cgcgcgcggc gctggcgcga    315780
     taccacgccg gatcgcgcgg cagcgacgaa tgcgcgttca cgccgccgcg ctccagcgtc    315840
     acccagtgcg gccggaaata accctcttcg aacacatgca cgcgcacgcc gctcgcgcgg    315900
     gccagcgcga ccgccggccg atgcaccggc cggcggtcgc cgaacagcac gatgtcgctg    315960
     acggcgtggc gctccagcaa ttcggcgtag aaatcgccgc aggcctgcgc cgcgccgcga    316020
     taagcgtacg cctggccgcc gcgccagtac gccgcgtcgc ccaccgtgta gttgacgcgg    316080
     cgcaccgcat ggccgcgttc gcgcagcgcc cgccccaggc gatcgaagaa cggcgaacag    316140
     acgccctgca ggaacaggaa cgaggcgctc atgccatgct ccggctcatc gggccagcca    316200
     caatgtctgc agcttgcgca cctggcggcg cgcatagccg gcgcgcagcc cttgcaggcg    316260
     gccttcgcgc tgcaggcgtt cgcgcgtctc gaaaatatgc gtcagcaccg cctcgcacgt    316320
     ggtgtatccg cgcagttccc aatcccagta cagcggatag cgcagcagcg tgccggcgac    316380
     cagctcgtcc aggctcagcc ggcgggtgcg ccggccgcgc ggccaatcgg cggcgcggtc    316440
     ctcggtcagg ccccagccgg catagaacgg cttgccgtac gtcaccacgc gcttgccgcg    316500
     cagcaaggcg tcgaagcccg tcagcgaggt catggtgtgc accacgtcgc acgcctggat    316560
     gcagctgacc accgacagcg cggactcgac atgatcggca tggcggcgcg cctcgcgcag    316620
     cgccacgcgg ccgcggcggt tgcggctgac cacgtccgga tgcggcttgt agacgatgta    316680
     ggcgtcggga tgcgcggcgc gcgcggccgc cagcaggtcc aggttggtgc ggacttcgtc    316740
     gcagcccagc cgcaccgacg catcgtcctc gacctggccg ggcaccagca cgatctcgcg    316800
     cccgcgcgcc ggccagtcgg ccggctgggg ctgcgccacg ttgtacttgg tgatgccgtg    316860
     ggcgaccacc agcgcgcgga tgcgcgccgc gctggccagc tctcccgggc tgaacccgcc    316920
     ccggttcaat tcatgctcca gatcgctggg ctggcggggg tcgaagtaga tgccccgccc    316980
     gtccagcgcc aggctcagcg gccggatcag gtccgacccc aggccgaccg accgcaggaa    317040
     gccatcctcc acggccagca ccgcgcaacc gctctgttcg gccagctcgg ccacgccggc    317100
     gggcgcccgg gcgccccaat gcaccagggc gtcgcccgcg gccggccgca ggtcccgcgc    317160
     gcgggcggcg tcggcggcga acaccgcctg gccgggcttt aacgccagaa tgggcgccag    317220
     cgcggccgcc ttccagcggc gcatgcccac gccgatcacg cgcgacggca ggcgctgcgc    317280
     catgtcgcgc tggcgcgtca gccagtcgat cacgtcgaag atcgtgccgc ggcgatgcag    317340
     caccggatcc aggtagcggg tgtagtggaa atacgcgccg gcgaacagct cctcgacgct    317400
     gcgcgcgcgg ccgcgccgct cgcagcgctg gcgatcgtcg gtcacgcccc agccggcata    317460
     ccagggcatg ccgaagcagg tcacgggctt gtccagcatc agggcttcga accccatctg    317520
     cgaactgacc acatagaccc ggtccatctg ttccagcaag gccaggggat tcatgtcgtg    317580
     gcgcagcgcc accgtatcgg cgtcgtcggt aacccgcgac agatagcccg acttgtcgcc    317640
     ggccgccacc tcgggatgcg tcttgacgca gatcagcgcg ccagggttct ccgcccgcgc    317700
     cgccgccagc atggcctcga aggtggccgc ctcggcgcaa cccagggtca cgctcatgtc    317760
     gccttcggtc tggtccacca ccagcacccg gcgccggccg tcggccggca cgccggtggc    317820
     caggaagccg ccctggttgt acttcgacag gcggcgttcg cgcaccagct ccatggcttc    317880
     gggcacggcg tcctcgatgc cgtcgagcag cgtgcgcgac gacgccagca ggcactccag    317940
     ctcggattcg cgcgtcgcgt cgtagtagat gcccaggcga tcgaccacca gcgacagagg    318000
     cggaaaatgg cgcccggtgc cgaacgagcg caggaaaccg tcttccagcg caatgtaggg    318060
     cacgcccagc gaacgggcgc ggcgccgcgc cggcgcggcg ctggggcgcg cgccccatcc    318120
     cgccaccgcg cgcggcgccg cgccgcccgg cggccagaag cgccggtagc gggtgaccgg    318180
     cgcgcccagc agctccgtca ggtacggaat acgcgcgatg cctgacgaat gaagctcgat    318240
     catcgcagga actgcttgta ccagggcatg gcggcttcca gcccgcgcag gatgtcgtag    318300
     gccggctcgt agcccagcag cttgccggcc ttgccgatgt cggcctgcga gtggcgcacg    318360
     tcgccggcgc ggaattccgc gtacaccggc gccttctcgt acgacacgcc ctgcccggcc    318420
     agcgcgcgcc gcaggtgctc gaacagctcg gtcagcgtcg tgcgcgcgtt gtacgccacg    318480
     ttgtagacct ggttcgcgcc ttccggtgcg gccatcgccg ccagcaggtt ggcctgcacc    318540
     gcgttctcca cgaagcagaa gtcgcggctg gtctggccgt cgccgttgat cacgacgtcc    318600
     tcgcccttga tcatcgccgc cgtccacttc ggaatcaccg ccgcgtacgc gccgtccggg    318660
     tcctggcgct tgccgaacac gttgaagtag cgcagcccca cgctggaaaa cccgtacgag    318720
     cgcgcgaaca cgtcggcgta cagctcgttg acgtacttgg tcaccgcgta cggcgagagc    318780
     ggattgccga tgcggtcctc gaccttgggc aggtcgggat ggtcgccgta ggtcgagctc    318840
     gaggccgcat agacgaacgc ctggacctgc gcgtcgcgcg cggccaccag catgttcagg    318900
     aaaccgccga tgttgacctc gttggtcgtg atcgggtctt tcagcgaacg cggcaccgaa    318960
     cccagcgcgg cctggtgcag cacccggtcc acgccctgca cggcgcgctg gcaggccgcc    319020
     aggtcgcgga tgtcgccttc gatgaaggtg aagcgcgccc attgctcggg cgtcaccgcc    319080
     gcgcgcacct cgtccaggtt gtgctggtgc cccgtggcga agttgtccag ccccaccacc    319140
     gcctggtcca gcccgagcag cgtctcgagc aggttcgagc cgatgaagcc ggcgcagccg    319200
     gtcaccagcc atttttccgg cgcacgcggc agggtcgcgc gcaaatcctc gtatcgtgtc    319260
     gtcatggctg tgttctcctt acagacgcag gtcggcctgc tcgggaggca gcacgtactt    319320
     caggtcgtac aggatgtgct cggccttgcc gaacttgcgg atcgcctcgg cgcccatctc    319380
     gacgaactga tggtgcgaca ccgccaggat gaccgcgtcg tacgccccgg cggccggctt    319440
     ggccaccggc gtgatgccgt actcgtgctc ggcctcggcc gggtccaccc acgggtcgta    319500
     cacgtccacg tcgacgtggt actcgcccag ctcgcgcacg atgtccacca cgcgcgtgtt    319560
     gcgcaggtcg gggcagtttt ccttgaacgt caggcccatc agcagcacgc gcgcgccctc    319620
     gacgtggatg cggcgcttgg ccatcgcctt gaccagctgc gagaccacgt agccgcccat    319680
     cgagtcgttc aggcggcggc ccgccaggat gatctcgggg tggtagccga tggcctgcgc    319740
     cttgtgcgtc aggtagtacg gatccacgcc gatgcagtgc ccgcccacca ggcccggacg    319800
     gaacggcagg aagttccact tggtgccggc ggcctgcagc acggcctcgg tgtcgatgcc    319860
     catcttgttg aagatcagcg ccagctcgtt gatcagcgcg atgttgacgt cgcgctgcgt    319920
     gttctcgatc accttggcgg cctcggccac gcggatgctc gaggctttgt gggtgccggc    319980
     cgtgatgatc tcgttgtaca gctggtcgac cagctcggcg acttccggcg tcgagcccga    320040
     ggtcaccttc ttgatggtgt tgacgcggtg cgccttgtcg cccgggttga tgcgctcggg    320100
     gctgtagccg gcgtagaagt cctggttgaa cttcaggccc gacacgcgct cgagcaccgg    320160
     cacgcagtct tcctcggtgg cgcccgggta cacggtcgat tcgtagatca cgatgtcgcc    320220
     gcgcttgagc accgcgccga tggtctcgct ggccttgacc agcggcgtga ggtcgggctg    320280
     cttgtactcg tcgatcggcg tgggcacggt gacgatgaac acattggcct tgcccagttc    320340
     ctcgcgctcg gcggtgtagc tgagctgccc ggcctgggcc agttcgtcgt cctcgacttc    320400
     cagggtgtga tcgtggccgg ccttgagcgc ggcgatgcgg cgctcgttga tatcgaagcc    320460
     gatcaccggg cgtttcttgc cgaactccac ggccagcggc agcccgacat accccaggcc    320520
     gacgacggcg agatgaacat ctgcaggatt ggaaaacttc ttcggcattg gtgctacctt    320580
     ccagtgaaaa ttagtaagta cccacgcgtt ggcccacgat caggacctgc acgataggcg    320640
     taatgatctt ttcccattcg tacatgggtg cattactgac atacaccacg tcctccggca    320700
     gcagctcgaa ttgcttggcc aggaacatgg actccggatt gcgcatgttc agcctgaaca    320760
     ccgtgggccg cgggcggcca tcggcgttgc ggccgtccag gcgaaaaacg aataccccgg    320820
     tggcgtcggc tgcgcggtcg ttcaggcctc cggccacgcc cagggcgtcg agcagattgg    320880
     tctggttcga cggcagttcg tgcaggcccg gcttggtgag ggcccccatc gccacaaaac    320940
     gcttcaggtt cggttcgacc accagttcgg agcgcggctc caccgccacg ttgcggccgt    321000
     tgagcaattg ctggtaagga atgcgctgca ccttgctgcc agtccggatc accacgtcgg    321060
     cctggtaggc cggcagggtc gagccgcccg cctgcgtgat cgcatccagc gccgtcagcg    321120
     ggcccttgtt gccgccgaag cgtcccgggc gcggcaccgc cccggccacc agcaccgaat    321180
     tggagcggtc gtcggccaga tccaccatga cctgcggctg caccgccgcg gtattgcgca    321240
     ggctgccctt gacgagctgc tcgatctgcg ccagcgactt gccctgcact ttcaggcggc    321300
     ccgcataggg cagcgagatg ctgccgtcgg ccgcgacccg cacggcttcg aacaccgtgc    321360
     cgccggcggc cagcggcgcg aacagtccgg tctccatgct gtcggctacc aggatgcgca    321420
     gcacatcgcc cggcatcacg cgcatattgc ccacgtagcc gtccgaggtg gcgccatcct    321480
     tggacaccgc cttgaccagc acatagggcg caatggtgtc ggcgcgcagg tccaccaggt    321540
     cgtaggagcc gggcttggcg ccggtcgcgt cggtcgaccc gccgtccatg atggccgatc    321600
     gcgtcgggcc cgacccggag agaatgctgc agcccgacag cagggccagc agcgcgatgc    321660
     tcaggcaacg tatgagtcta tggttcatgg tccgtcttgg tactccggta gaaactggga    321720
     aggcgccagc gcgccgctcg aagcggccag cgcggcccgg atgcgcgtat gcatgtaccc    321780
     ggccagcacc ggctcgaact ccggcgaata atggttcatg tcggcgccgt cgctggccag    321840
     caggcgcgct gaaggccaat cgggcgcggc atccagcggg tcgatcacgt gcacctggtg    321900
     cagtccgcgc gcggcggcct tgatgcgcgc cacgtggcgg acccgcgcgg cgatgcggcg    321960
     cccgtcggcg cgctcggcgt cgacgtgggt caccaccagc acgggcttgc ccaggcgcag    322020
     cgccaggtac atcaggtcgg cgcgcaccac ggcctcgctg tcctcggcgc agcgcgcctc    322080
     gcgcagcacg cgcaagccgc ccgccagcac cgtctcctcg gcctggtctc ggtacaggcc    322140
     ggccacggcc tcgtaggctt cgggcgccac ttcgccggcg cgcaccagcg agcgccacca    322200
     gttgcggcct tcgtcgccca gctcgcgcac caggtgcttg accaccaggt tcttctgcag    322260
     gaacacgcca ttgacgctca cgctgcgctc cgaagccgcc tcgaccagca ccgcgtcggc    322320
     ctgcgccagt tcgtcggcgc gcgccggcgt caccacgggc gtgcggccgg ccggaaacat    322380
     gaacggcagc agctgggagt cgggacgcgt ccggtcggcc agccattgca cgcgctgcac    322440
     cgcctcgcgc gtactgtgga tgtagccgct tatcccggcc gtcagcggct gcaccaggcc    322500
     gccgtcgtgc agcaggcgcg ccggccggtg cacacggcaa ctgcccagca cgaagagttt    322560
     gggcggcatg gtcatggcat ctggtagcac cggaccgtcg atgcaatcat ctggttgagc    322620
     gaaaaacgcg ccgaggccca gtcggccgcc ttgcgcgcga tccccgggtc ggccgcgcac    322680
     atgtcgtgga tgcgcgccag cgcctcggcc acgtccggcg cggtcaccgt gtcggccggc    322740
     agggtaagcc ccgtcacgcc ttcctgcacc gcctcgccgg cgccgccggc cagcgtcgtc    322800
     accaccggca cgcccgagaa ctgcgcctcg atcagcacat tgggcagccc ttcgaagcgc    322860
     gacagcagca ggaacgcgtt gaactgcgtc agccagtagc ccacccgcct ggacaggccg    322920
     gtaaacagga tgcgctcgcc catgcccagc cgctgcgcga actcccgcac cgactccagc    322980
     agcggcccgc cgcccaccat gatgaagcgg acatgcgggt ggctggcggc aaagcgctgc    323040
     gccgcctcca cccacaggaa cgggcgcttg ttgtcgtcga cccgcatgac cgtgccgaca    323100
     gtaaagcgcg cgtccgaagt gcgggcgtcg aactgcgcca tcatggcggt gcaggcgtcg    323160
     tcctgcaccg acttcagcgg cgccagcccg ttgtagacca ccggaatgcg tcgctcgtcc    323220
     acgcccagcc agtcggcata gcgatgcgcg gcgaattgcg aattggaact cagcgccacg    323280
     ccgcgcatct tcagcagttc cgaataaatg atgtcgtact cgacgcgata gcggtccggc    323340
     cggtccaccg gcggcatggt gcgcaccgac agcacgatgc gcggcacgcc ggccagcagc    323400
     gccgccagcg cgcaggcgaa gatcgaaccg tcctgccaga tatgcaccac gctgggcacc    323460
     gacgaccgca tcacgtcggt cagcttggtc gttccctcga tgatctgctt gggcaggaag    323520
     cgcaggtact cgcggtacgg cgccagcagc gacgagaact cgcagccgcc ccatgcctgc    323580
     atgtccgaat agacggaaac cgggatgccg gcgtcgtgca gcgtggcggc aaagaaatcg    323640
     gcgccttcgc ggctgcgcag cgagcggcac acgacctgca ccggacccag caccccgtag    323700
     ccggcaatcg attgcccctg ctggatggcg ctttgcaggg ccacggcggt gttgacgaat    323760
     tgacgctcgg cgccgccggc gcccagcgag ccattgatca tcagcaccgg accgacgaac    323820
     gattccggcc cggcatcgta ttccgcattg cggcgccggc cgatctcctg cagcattttc    323880
     tccagcacca ggatgctgac cggcacatcg cgcccatcgc cctccacgcc caggcgccgc    323940
     aacgcggcca ggtcggcatt caggtccacc agccgccgcg tcagcttgcg cgcgccgtcg    324000
     ccgatggcgt ccagccccgc ctgcagcaca tcgcgggcgc gccacagcgc gccgcggcgc    324060
     gtcagcgact gcgcccagcc gacatagccg ttctcgaact cggggtgttg ccgggacagc    324120
     cgctcgaagc aggcgtcggc ctgctcgctc tgcccgatct cgtcccagct cttggcttcc    324180
     agcaggatct cccgcgcgct gctgctgccg ccggagaagt acagttcgat ctcggcgcgc    324240
     ccggcttcga tgccctgctg gcgcttgacg ccgcgcagca tgaggatgaa agcctcggaa    324300
     gagtcgggaa agcgctgatg gatgccgcgc cataccgcca ggccttcatc gctgcggtgg    324360
     gccgcctcca gcgcccgcgc caccagcacc tggaacagct cggtatgcgg ataacgccgg    324420
     acgtaatcca gcagttcggg caaggcggcc gccggcttgt ggaccgccgc atggcgctcc    324480
     agcacctggc gcgcctgctg caacagctcg cggccggctt cttccgactc gcccggctcg    324540
     gccagcgcgg cctcgagcag gtcgagaatc gtcggcccgg acgccgggcc gccggtcggg    324600
     ccggccgcgg tatcggcgcg gcgcggcttg cggatgcggg acagaaacga aaacatggcg    324660
     tgatctcgtt gacggttgaa cgatggctca ggcgtggtcc ttgacggcgt aaaccaccag    324720
     caccgccacg atccacagaa tgaaaagacc cagcaggccc agcgcggtat cggtgaagcg    324780
     gcgcgggtac agcgactcgt cggccagctg cggctgcgag gcgatcaccg tgtacagcac    324840
     ctggcgcgcc gccaggccgc gggcgtcctc gagggttttc agggcgccgg tgtagtacgc    324900
     ctcggcgaat tgccgctcgg tctcggccga ctcgtactcg cgcagcagct tggacagcgt    324960
     gttgccgttc tcgctgcgcc caccgctgat ctgatggtca ttgaggtcct tgagctggcg    325020
     catcagcgct tcgtggcgcg ccttgacgcg ctcgtaggcc gggccgctgc gcagcccgcc    325080
     acgccccatc gcgtccagtt ccgcggccgc ggtggccacg tcgccgcgca ccttggccgc    325140
     cagctgcaga ttggcctccg cctccttgac ggggtccagc acgcccgtgc gggcccgcag    325200
     gtcctggacc tgcacccgtg cctgcgccag gcgcttttcg gcgatgccga cctcgacgcg    325260
     ggcgaagtcc acgctgtcct cgcgcgactt ggccgacatc tggttgacca gcttctcgct    325320
     ggcctgcagg atcgcctggg ccagttgcag cgattcctcc ggcgagaagg cccgcacccg    325380
     caggatgatc gcgccggtgg acatgtcgaa ttcgatgtcc accatgcgat tccattgccg    325440
     ccacaggcct tcctcggtct cgtcctggtt catgccgtac cagaaatcga tcatcggctt    325500
     ggaccacatc tcgcgcaggt tcagttcctt gtccagctcc tgtacgatct ggcgcgattt    325560
     cacataatcg accacggcga acgaatcgac gaacagctcg gtcgccatcg cgccgctgcc    325620
     catcgacgaa tgcccgtcgc ggttggcgct ggcctgctgc atctgcgagc ccgcgcgcag    325680
     cccgaagcgc gcctccgaga catactggtc ggacgcaatg aagaacaggt acaaggccag    325740
     cagcacgccg ggaatgccga tcagcgcgat ggccgaccag cgcaggtaat tggcgggctt    325800
     gcccggcgtc atgccgggca ggcgcggccc tgtataggtt ttctccgtac tagtcatagt    325860
     cgcttctgga ttcaggtgaa ttgccgatcg aatcgggctc aggattgctc agcgtcgacc    325920
     gtgtcgacgg ccggctcggc ctcggccgcc ggcgcgggcg cgctctgcgt gtagcgcgcg    325980
     atggtttcgt ccaaggggcc gtagtgcgcc atggcgccgt gctgcatgat cacgccgtgg    326040
     ctgcagaagc gccgcaccgt ggtgggcgcg ttggccgcca tgatgatggt ggcgccgcgc    326100
     gagcgctcgg cgaacacctc gagacatttg cgcttgaagt tcacgtcgcc gaccgcggcc    326160
     atctcgtcga ccacgtacac atcgcagcgc agcgccatcg atatgccgta ggacagccgc    326220
     gcgcgcatgc tgttggcgta ggtgaccaca ggcaggtcga acgaccgccc cagttcagag    326280
     aagtcgtaga cgaagcgctc cacgtccggg acatcgcagc cgtagatgcg cgcgatgaag    326340
     cgcacgttgt cgcggccggt catgttcgaa ctgatgccgc cggcgaaccc cagcggatac    326400
     gaaatgctga ccgcccgctg caccgtgccc gagtcgggca gctccatgcc gcagatcatg    326460
     cgcagcagca ccgattttcc cgagccgttg ccgcccagga tggccaggtt ctcgccgccg    326520
     cggaaatcga acgacacgtc atcgagaatg cgcctgatgc ctttcttgga gcgatagccc    326580
     ttgcagacat tgcgcagcga aatgatggtg tcctggtcca tggccgtctc catcaacggg    326640
     tgtgcagccg gcggcgcatg gcgcgctcca ggcacagccc cagcaccacg ctgcccacgg    326700
     cccacttgat cagatagccg cggtccagcg tcagcgagct gaaatgggtg aaatacccgg    326760
     cgcggaacca ctcgatggca tgcaccagcg gattccagac cagcacgcgg cgcgcctgct    326820
     ccggcaacgc atccaccagg tagaagacgc ccgacagcag gtacagcggg cgggtcagcg    326880
     ccgaataaag gtgctcccac gacttgaaca gcatgttcag caccgcgttg atcaggccca    326940
     cgccgaagcc cagcaggaat gtgaacagcg cggcggcggc gcactcttcc aggcgctgcg    327000
     gcaggatcag cttgccgccc agcatcacca ggaacagcag gatggcgaac accgccaccc    327060
     aggtcagcgc ctgcagcaag gccttggcga acacgatgtc catgttggtg atcggcggca    327120
     gccgcagcag cgacgcattc gacgaaatcg accgtgccag ccgcgacgac gtgtggctga    327180
     acaggaagaa cggcatgatg ccggtgatga agaacatctg caggttgccg accggcgcct    327240
     gccggcccca caccacgtag atggtggaca gcaccgccac gtgcaggatc ggctcgatca    327300
     gcgcccacag ataacccagg cgcgtgccgc cgaagcgcac ccgtgtttcg cgaaatatca    327360
     aagacccgat cacccgcgcc tgtaccgtca gcgccgagct caaacctggg ctcccgatgc    327420
     ctgcatcctt cgctcccttg cggcgcgctt aataacccga tggattatcg gcgcgccact    327480
     tccatataaa caaaaacaaa accgcccaaa atgtcggacg gcagtcggaa cgggagaatg    327540
     ataatttcgg ggcaccggcc gttgatttca acatatatca aatcaacacc atccatgcgg    327600
     cgatcaatcg cttcacaaaa atggtgtatt ggcggcctat aatccaggtg catcacaacc    327660
     gggattttcc cggcaaacca atgccgcgca tccgtcgacg gccgggcggc acacttgcaa    327720
     ggccgccatg ctgcgcaccg cactgcttaa tatttatcag aaaagagtac aagcgcttac    327780
     cagccgcctg ccgctggcgc agttgctggc gcgcgccgcc gataatcccg ccctgctcaa    327840
     ccggctgggt ctgttccaga gcgccgcggc cgtcccggcg cgcggcgccg aacagggact    327900
     gtgccgggcg cgggccgcgc tggaatgcag ccacgcggcc cgccgccccg atcccgcgcg    327960
     gctgcgcgcc cgcgtctccg accatgcgcg gcgccaatac gccctgacgc tggcgcgtca    328020
     cgaccccgaa agcgcgcgcc aatggctggc gccaaccgac tgggaactcg atctcgccct    328080
     ggacctggct gccggccgcg ctgacctggc cttacacaag gcaaggaaat ctgcgagcaa    328140
     tattagtaaa tcaaagaatt tgcatgaaat tcttgctgca gcgcacactt gcctggggga    328200
     tttctctgcg gccagaaata atttatcgca gctactgaca gattcgcgca tttccgtgcc    328260
     gcccggcgac acgccgctgc ggcccgccga tttcattggc ctggcgccga tttccccccg    328320
     gcccgtcgcc gccggcgccc cgctgataag cgtcataatc tgcgcccgcg acgccgcgcc    328380
     ttatatcaac aatgcgctgc aatccataca ggcgcaaacc tatcctaata ttgaaatcat    328440
     tgcgatagat gacggctcga ccgataacac atttcaacat ctgagcgccg ccgccgctca    328500
     aaatccgcgt ataaatatcg ccaggacgaa aaaccacggc gtatatgcgg ctcgcaatat    328560
     ggccctgcag cgggcaaaag gcgaattcat tacctttctc gatgccgacg acataatgct    328620
     ggccacccgc ctgcaggatc aggcggccct gctgcaggca agcggcgcct gcgccgccgt    328680
     cagccgcctg ctgcgcctga cggccgacgg acaactggcc gccccgcgcg tgtttccctt    328740
     cgtccggcac aacccctgct cgctgatgat ccggcgcgac gcgctggccg tcatcgggca    328800
     gttcgaggaa atgcgcttcg gcgccgatga ggagtacgag catcgcatgc aggttctttt    328860
     gggtttccac agcatcgccc gcagccgcgc ggtccagacc gtggccttgc accggccgca    328920
     gtcgctgacc cagcacggcg cgaccggcct gggctccgac cagggcagac agcggcggat    328980
     cgcctaccgc gagacctgga tgcggcgcca cgccagcctg gcgccgctac gcacgccctg    329040
     acgccacgca ccactttctt tgcgcccatg gaacacgaca acaataccgt acgccacatg    329100
     cccgccccgg ccgctcgccg ggcggccgcg ccggaccgcc tgcgccagct gacccaggag    329160
     aacgagctgg cctactcccg cctggaacag gagcgcgccg cgcgcgtgca ggccgagaaa    329220
     gacctcgccg gcgtcaaggc gctgctgcgc gaaaccaacc agcagctcgc caagcagcgc    329280
     cgcacgctga cctggcagtt cggcgaggcg gtcacgcgcg cgcgcacgct gaaggattac    329340
     gtgctgctgc cctaccgcct gatcaagctg tccgaagacc atcgccgcca gagccgccac    329400
     gcgcccgtgg tgcgcaagca cgcctcggcc gcactgcccg ctgaaaccgc cagcgccatc    329460
     aaggaggcgc tggagtacgt caagcgggtg cgcagccccg aggtcatcct gtggatcgga    329520
     cgccagccgt ggccggccga agtacgcgcc aaggtcttct gcgaagtggc caaatgggcc    329580
     cgcaccagct atccgcagat cgccgaacaa atcgtccagc aactgctggg gctcgacccc    329640
     gccgcgccgc acgtgcgcca gctcgcattc agcctctatg acgccggcat cgtcgacgcg    329700
     tcggcccagc tgctgcgcgc cgcccgcacc gccggggcca ccttcagcac ggccgagcgc    329760
     ctgcgcgccg agcgcatcga acatgcgcaa ggcatcctgg cccaatccat cgaacccgcc    329820
     gcgcgcggcg actacacctt cgatttcgac gcgcagggcc ccatcgtcat cctctcgccc    329880
     gtctccatcc tgcaaggccg caacgccgcc agcaacgcgc tgcaccgctt cgcgctgagc    329940
     atgcaggccc gctacggcga caccatggtc atcagcctgg ccgctcagca cgccgaatcc    330000
     gccgacgccg cgcccggcca gcaggccgac gccgcgctgc atgcgcgcac cgggctggtc    330060
     gtcgatggcg tcgcgtaccg ccatgcgccg gccatatcgc gccagacgcc gtcgttccag    330120
     gacgtgtgcg cggccatggc cgagacggtg ctggccgcca cggtgcgcca gcagccgcgc    330180
     gcggtgctgg cctgggacga cgcctattgc gcgctggggg ccagcgcggc ggcccagacc    330240
     ctgcgcgtgc cctatggact ggtgctgcaa agcctggact tcttccagaa gacggcggcc    330300
     aaccatctgc tgtccgagcg cgcgcgcgtc gacctcaatc tgttgaccct ggcggcgcgc    330360
     caggcggatc tgctggcctt gggctccccg gcgctgcaag gcgcgctgga gaacctgctg    330420
     gacggctcgc gcccggtcgc gctggtgccg ccgctgcccc tgccgccgat gaatcaccgc    330480
     aaggaagctc ccccggacct ggccgccacg ctgcgccgcc tggagggcaa gcgggtgttc    330540
     gccgtgaccg aggacgagcc ggccgtggcg acggcgcgcg cgctgatcga tctgtatgcg    330600
     gaaatctcgt tcgtgcagcc cgatgccgtc ttgctggtca tgtccaacgg caaggctgcc    330660
     gccgcgatgc gccaccatgc cgtggcgatc ggcctgcagg aaggccaggt ggtattcgct    330720
     ccgccggcca gcgacgccat ctcgcgcgaa caattgctgc ggcgcgtcga gatcgccctg    330780
     ttcccctacg tcgacaaccg cgccgaagtc agcctggtgc cgtcggccgc ggccctgctc    330840
     gaatgcatgg cgctgggcgt gtgccccgcc gtcggcccgg cgcccgccta cgccgcccat    330900
     gtggaggctg gccgcaacgg cgtgccgatc gacctgaacg cgcccgccgc cgaaaccgcc    330960
     gcgcacctgc agcaggtgct gggcgaggcc ggcgagctgg gcaagcgcgc gcgcgaaagc    331020
     gtgcagcgcg atctgccctg gcacgactac gacgaggcca tcggcgccct gctgctgcag    331080
     gccgccacgc cgcagccgca catacccggc cggcgcgccg aaccgcaatt gctgcacctg    331140
     aaggtgtcgt aagccatgcc agccccgagc cccgccatgc gtcgcgccgg accggcccaa    331200
     ggcaaaagcc cgtccagcac gacggcgccc gcgcggcggg cacggcgcgg ggcctctttt    331260
     tccctgctgt taagaaggag tattgacccg tgattatttc aacaataggt tcgtgccgcg    331320
     tggccggccc cgtgaccaag ctccaggcgc agcgtagttt cgtactggat aaccggctgt    331380
     tgtacggatt cacccacaac accaaggaaa ccatccaggc catccgcttc atgcgcggcg    331440
     agctgcgctt gcccgaaagc ctgtggccct tcatttctga ccagccgttt cgcaacggca    331500
     acagcacccc gcccccccag ggcgcccatt acgtggtcga gatcagctcc gtgaaggtgc    331560
     tcgagctcga cggcctgtac ctgcagctgg tgcgcttcaa ggaagcgctc agcgtctgcc    331620
     cggacctgcg caagatcttc ttcgaccacc ctggcgccga tcagcgcggc cagcgcctgc    331680
     agctgctgca ggccacgccc tcgttcgccc gcctggccac ccacatccag catgccctga    331740
     cgcacaccgt cgtgcgcagc cagaccgccg ccgagatcga ggaagacctg cacgccatcg    331800
     cccagctgct ggggccgaag ctggtgctgg tgacgcattg caatgccaag aacgccaccg    331860
     gcgaactgat cgccgaacgc gccaagatgg tggcccgcgt ggcccaggcc gccgcccgcc    331920
     tgggcctggt ctcggtcgac ccgggcgcgc tgctggccgg cttcggccag gaacgcggca    331980
     tgcccgacga aggcctggac accgcccact acacaccggc cttcgccaag ctggtgggca    332040
     aggaaatcag cgacaagctg ctcggccccg ccatcaccga cgatgccgcc gacagcctgc    332100
     acaacctgga cttccgcgcg tgcatggagc gctccaagca gtcggcccag gcgcacgaat    332160
     gggacctcgc gctgctcttc gccaaccgcg ccatcgagct caagcccggc agcggctcgg    332220
     cctacgtgct gcgcgcacgc gccgtcacgg cgctggacca gaccgaggac atgctcgaag    332280
     cctggtcgct ggccctggcc accgacagca accgcacccc gtacgtgctg cgccaggccg    332340
     ccgaggccgc gttctacatg cgcgaccatg agcgcgcccg cgaatgggcc gaagcctcgc    332400
     tgcagaaaga ggacgacgac aagaccgccc tgctgctggg ccgcatctat acccgcctgg    332460
     gcatgaacac gcaggccgaa caggtgttcc gccgctgcgc cgccagcgat ccggcccgca    332520
     gcctgcgctt cgccgcgcgc gcccataccc cgctggccga cgccgccagc atggtcaatg    332580
     ccctgaccac cacgccggcg gccgatcccg gcagcgtcga cggcgtgcgc cagacggtgc    332640
     tcaagcgcgc cacgcgcgaa gtccggcacg ccggacgcgc cggcgccctg ctgccctcgc    332700
     tgggcgcctt ctacgccgtg cgcaccctgc cctcggaaca tggcgccgcg cacgacgccg    332760
     acctgatcaa ccaggcctac cgccgcctgc tgcgggccta cgaggacacg cccgagtacc    332820
     agaacagcga cgaagccatc gcgctgcttg ccgacctggc ggcgctgccg gaggtcgatc    332880
     cgcgctacat ccagcgcgcc gccaagatgc tgcacgcgca cggccgcaag caggccgccg    332940
     ccaagtgctg ggagcacctc gccggcgccg agctgccggc cggccgcgat accgtggccc    333000
     tggccgccag caagctgtcg caactcgagg cgcaccgcac cgccgcctcc gtgtaccgcc    333060
     gcctggccaa cagcggcgcc atggacacgg ccacggccca ggagtacatc gacaaatgcc    333120
     tgcgcgccct ggcccgcagc gtgcgggcat gcatcaccga ggaacgcctg cgcgacgccg    333180
     agcaggcctt ggcgtcgatc cgcgaaatcg accccggcta cgccggcctg acctcactgc    333240
     aacgctcgct gtccgaagcc cacaagcgcg aattccgttc gcagcgggcg caggaggcca    333300
     ccccggcaga cctcatggcc agcgcccagc gcatcatcga ggccagcccg ctggaccgcg    333360
     acgccaacat cgagcttgca gtgcagaacc tgcgcaccgg caatttgagc gaaagccgcc    333420
     gcatcctgga gcgcttcctg caaagcgcgc ccgcctgagt cctggctcgg cgcgttcgtc    333480
     ccccatgcgg gggcaggcgt gaagtttgcg ggtgccagtc cccatgcggg gacaggcacc    333540
     cggcaagaaa aaagccggca tctctcgatg ccggcttttc ttctgcgcgc cgcgcgttac    333600
     tgcagcaggc tgcgcagcat ccaggcgttc ttctcgtgca cgtccagccg ctgcgtgagc    333660
     agatcggcag tgggctggtc gttggccgcg tcggccttgt cgaaggccgc ccgcgccgtc    333720
     ttggccacgg cttcgttgcc cttgaccagc atgcgcacca tctccagcgc gtcgggcacg    333780
     gaatcgggct cggcgatcga cgacagcttg gcgtactccc gatacgtgcc gggcgcgtaa    333840
     tggcccagcg cgcggatacg ctcggcgatg ctgtccagcg cgttccattc ttcggtgtac    333900
     tgcgccatga acatgttatg cagcgtattg aacagcggcc cggtcacgtt ccaatggaag    333960
     ttgtgcgtca tcaggtacag ggtgtacgag tcggccagca gcttggacag ttcgccggtg    334020
     atggcagcgc ggtccttgtc ggaaatgccg atattgatac gcggcgcggc gctgctgttc    334080
     ttggtcggtt ttgccatgta gtgctccttg tccaggggat ggaaacatgt caagaatacc    334140
     accgaggaac gcgacaaggc agcccggcgc ggcgcccggc cgcgccggcg cgcgctcagc    334200
     ccgaacgggg catggcgaac gacatcccgg cggccttggc ggcccagcgc tgcatcacgc    334260
     tcttctggcg cgtgtagaag cgcacgccct cttcgccgta cacgtgcaga tcgccgaaca    334320
     gcgactgctt ccagccgccg aagccctgcc aggccgccgg caccgggatg ggcacgttca    334380
     cgcccaccat gcccacctct atgccctgca cgaaggcgcg cgcggccgtg ccgctatcgg    334440
     tgtacaggct gacgccgttg gcgaaatcat ggccgttgat caggtcgatg gcctgctcca    334500
     gcgtctccac gtgcacgcac gccagcaccg ggccgaagat ttcctcgcga tagatgcgca    334560
     tcgagggctg gacccggtcg aacaccgtgg gacccagcca atagccgttg ccgcagccct    334620
     cgccgcagtc ggccgcggcg atctcgcggc cgtcgagcag caggctggcg ccctcatcga    334680
     cacccgaggc gatatacgcg gcgatacggt cgcgcgccgc cgcgctcacg atggcgccca    334740
     tctcggcgtc ttcctgcatg ccgcgccgga ccttcagcgc gcgcgccttg cgcaggatat    334800
     gcggcatgac cgcctcggcc gcgccgccca cgaataccgc gaccgagatc gccatgcagc    334860
     gctcgcccgc gctgccgaac gccgcgccca ccagcgcgtc ggcggcgccc tccggatcgg    334920
     cgtccggcat caccaccaga tggttcttgg ccccgcccag ggcttgcacg cgcttgccct    334980
     cgcgggcgct gcgctcatag atctgacgcg ccaccgcggt cgatccgaca aacgagaccg    335040
     ccttgacatc ggggtggtcg atcaaggcat tgaccgcctg cacgccgccc tgcaccacgc    335100
     tcgccacgcc cgccggcagg cccgcctggc ccagcatctc ggccagcgcc agcgacggcg    335160
     atgcgtccag cgggctgggc ttgagcacga acgcgttgcc ggtggccagc gccatcggca    335220
     tcatccacaa aggaaccatc accgggaaat tgaacggcgt gatgccggcc accacgccga    335280
     gcggttcgcg ctgcacccag ttgtcgatcc ccccgcccac gttgatggac atcgcccctt    335340
     tcatgagttc gggcgcgccg caggcgaatt cgaccacttc gatcccgcgc atgacttcgc    335400
     cgcgcgcatc cgagatcacc ttgccgtgct cgcgcgaaat catgcgcgcc agcgtctcct    335460
     tgttgtcttc cagcaaggcc aggaagcggt tgagcacccg cgcccgatgc agcgggctct    335520
     tggccgccca ggccggctgc gcggcacggg ccgccgcgac ggcttgcgcc accgtgtcgc    335580
     cgccgcccag ccccacctgc gccgccacct cgccggtggc cggatcatga atgtcctgca    335640
     ggccatgttc ggcgccatac gcggcttgtc cgccgatcca atgcgccacc tgcgcggtct    335700
     gattcgccat gcttcgctcc cactgagaaa gaagcctcag tctaggcaag acacgccgcc    335760
     gcagtaatcc cttatagttg gaaagactgt ttatctggtt aaacaataat gagcacccct    335820
     gctttcgacc ggctggccga cctgaaaatg ctggcggtat tggccgacac gcgcagcttt    335880
     accgcggccg cccagcgcct gggcgtctcc aagtccctga tcagcctgcg catgaaggcc    335940
     ctggagcagg agctgggggt cagcctgctg ctgcgcacga cccgctcggt gcatccgacc    336000
     gaagccggag ccctgctggt cgagcgggcc cgcccggcgc tggacacgct ggaggacagc    336060
     ctgggcgaag tgcgcaatct cgcccgcgca ccgcgcggcc gcctgcgcct gaccgccccc    336120
     gtggcattgg gccgccagca cctgggcatc tggctggcgc gcctgggcca acatttcccg    336180
     gacatcgcgc tggaagtcta tttatcggac cgcttcgtca acctgcgcca ggaagggtac    336240
     gacttcgcct tgaggcacgc cgaccaggtc tccgatgcct acgtgagcaa gcgcctgtgc    336300
     gccacccgtg cccacctggt ggccagcccc gcttatctgg cccgccatgg ccgtcctgcg    336360
     cacccatcgg aactggcccg ccatcgctgc ctgctgtacc gcggcgacga gcgcagcccg    336420
     cagtggtcgt tcgcccccag gcaggggcgc ggcgcggccg tgcacgtcaa accggtggac    336480
     tgcctcagcg tcaacaacag cgagctgctg cgcgagagcg cggcccacgg cctgggcatc    336540
     gccatggtgc cggacttcag cctgggcgat tgcgcggacc tggagccggt cctgccgcag    336600
     tgggactgct atgcgggatt cgggcgctcg ctttacctgc tcaagccgtt ctcggccacg    336660
     cccaccgagg cgcaccgcgt ggtcgagcaa gccctggccg agcatttccg gccgggcttc    336720
     gccacgccgg cctgaccagg ccgctgccct caatccacct gcgcgctggc ggcctcttcg    336780
     tcgagcatgc gcacgcccgg caggccacac gcatacaccg cctgggccag cgcctcgatg    336840
     gccgccaggc gcggaaaact gcgccgccac gccagcacca cgcggcgctc gggcgtctcg    336900
     ccatcgaacg gcaggtagcg caacaggctc ttgggctgcg gcggattcgg caccgcggtg    336960
     aacggcagca ccgtcacccc gatcccggcc gccaccatgt ggcggatggt ctccagcgag    337020
     gagccttcga aggtgcgctg gatgccgtcg ctggaagcgg aaaagcgcga cagctccgga    337080
     cacacttcca gcacctggtc gcggaaacag tggccgctgc ccagcagcag catggtctgc    337140
     tgcttgagat cctgcgcgtc gatggccttg cgctgcgccc attcgtggtc atgcggcacg    337200
     gccaccacga acggttcgtc gtacagcggc tgcatgacca ggccggcttc gggcagcggc    337260
     aaggccatga tggcgcaatc gatctcgccc tggcgcagca gctcgaccag ccgcaccgtg    337320
     aagttctcct gcagcagcaa gggcatctgc ggtgtgcgcg cgatctgctc gggcaccagg    337380
     cgcggcagca ggtacgggcc gatggtgtgg atcacgccca cccgcagcgg cccggccagc    337440
     ggatcgtggc cctggcgggc gatctccttg atgctggcgc tttcctccag cactttctgc    337500
     gcctgcgcca cgatgcgctg gccgatgggc gtcacgccca cctcggtgcc gccgcgctcg    337560
     aacagggtca cgcccagctc gtcctccagc ttgcggatcg ccaccgacag ggtcggctgg    337620
     ctgacgaaac aggcctcggc cgcacggccg aaatgccgtt cgcgcgccac cgcgacgatg    337680
     tatttgagtt cggtcagtgt catagcgcca ctcgctccag gtatgccgcg ccgccccgtg    337740
     tcggcgccgg cccttcaagt acgtagaaaa tcctcgcgcc cccgcatcca gcgcgccagg    337800
     tgggcggcca ccgcctcggg atgcttggcg cgcagccaca ccgccgcctc gcgcgcctgc    337860
     tcggcgatgg ccacgtcggc ctccaggtcg gcaaagcgca gcaaggccaa cccggactgg    337920
     cgcgtgccga ggaattcgcc cggcccgcgc tgctccagat cgcgccgcgc gatttcgaat    337980
     ccgtcgctgg tctcgaacat ggcgcgcagc cgctggcgcg ccacctgcga caacggcgcc    338040
     tggtacagca gtacgcagat cgactcggcg gtgccgcgcc cgacccggcc gcgcagctgg    338100
     tgcagctgcg ccagcccgaa gcgctcggca tgctcgatga ccatcagcga cgcgttcggc    338160
     acgtcgactc cgacttcgat gaccgtggtg gcgaccagca ggtcgatctc gccctcgcga    338220
     aacgcgcgca tgacctcggc cttctcggcc tgcggcaggc gtccgtggac cagcccgatg    338280
     cgcaggtcgg gcaaggcggc gcgcatcgcc tcgtgggtat cgaccgccgt ctgcagctcc    338340
     agcgcctcgc tctcttccac caggggacag acccagtacg cctgccgtcc ctggcgcgcc    338400
     gcatgggcga tatggccgat gacctcttcg cgccgggcat cggccaccag cttggtgacc    338460
     accggcgtgc ggccgggcgg caattcgtcg atcaccgaga cgtccagatc ggcgaagaag    338520
     gtcatcgcca gcgtgcgcgg gatgggcgtg gcgctcatgt tgagctggtg cggcacgatc    338580
     accccgcgcc cggtctcccc cttgcggctc agggccagcc gctggcccac gccgaagcgg    338640
     tgctgttcgt cgacgatgga caggcccagc cgctggaaca tgacgtgatc ctggatcagc    338700
     gcctgcgtgc cgaccaccag ctgcacgctg ccatcggcca cggcggcggc agcctcgcgg    338760
     cgcgccttgg cgctcaggct gccgctcagc caggccacgg ctacgcccag cggctccagc    338820
     cagcccacca gcttgcggaa atgctgttcg gccaggattt cggtgggcgc catcaacgcc    338880
     acctgggccc cgcaggctat ggcctgcgcg gcggcgatgg ccgccaccac ggtcttgccg    338940
     ctgcccacgt cgccctgcag caggcggtgc atcggataag gctgcgccag atcggcggcg    339000
     atctcggcca ccacgcgctg ctgcgccccg gtcagcgcaa acggcaaggc ctcgtacagg    339060
     cgcgccacca gcccgtcctc gtcctggctg gccggcaagg gctcggcgcg cttgacccgg    339120
     cgcgccgcgc gcgcggccgc cagcgacagt tgctgcgcca gcagctcgtc gaacttgatg    339180
     cggcgccagg cgggatggat gcgctccatc agctcgtgct cggccgcatc cggcggcggc    339240
     gcgtgcagca ggcgcacggc gggcgcgaat tcggccaggc catagcgccg gcgcgcctcc    339300
     tcgggcaggg tatcggagag atcggcccgc gccagcgcct ggccgatggc cttgcgcagc    339360
     gtgggctgcg gcaggccgtc ggtgctggga tagaccggcg tcagcgacgc cggcaatggc    339420
     tggtcggcgc tgctcatgcg cgggtgcacc atctcgcggc cgaacaatcc gccgcgcact    339480
     tcaccgcgcg cccgcaggcg ccgccccacc gtcagctgct tctgctggct gggatagaag    339540
     ttcagccagc gcaactgcaa ttcgcccgag tcgtcggcca gtacggcagt cagttgccgg    339600
     cgcggccggt acagcacctc ggagcgcagg atctcgcctt cgacctgcgc ggcgaacccc    339660
     ggccgcaagg acgataccgg cgtcacgcgg gtctcgtcct cgtagcgcaa cggcagatgc    339720
     agcacgaaat cctcgggcac gaccaagccc agattatgga gcttgcgctc ggtatctgtg    339780
     ggtcgggccg cgccgctggc cttggcggcc ggcttgggcg cggcaggcgc gtcgttactg    339840
     ctgatgggcg gctcccggcg ttacagcacc agcaccgctt ccacttcgaa ctgggcgccc    339900
     ttgggcaggc tggccacgcc taccgtcgag cgggccggga acggctgcgg gatcagctcg    339960
     gccatgatgg cgttggcggc ggcgaacttg ttcaggtccg tcaggaacag cgtcagcttg    340020
     acgatgtcgt ccagcgtgcc gcccgcttcc ttgatgaccg cctgcatgtt ggcgaacgcc    340080
     tggcgcacct gggcgtcgaa attctcggac accaggtcgc cggtgcccgg ctccaggccg    340140
     atctggcccg acaggtagac cgtcttggcg ccggtggcgg cgaccgcctg ggagtacggg    340200
     ccgaccgcgg cgggcgcggc gtcggtatga atgatctgct tgctcatggg gacagtcctc    340260
     gtgataggga acatcgacta tcggagttta atcagcaata ggcatttgcg aaagtggccc    340320
     gccctcaacc atttggacga gcctcgcgcg ccattgcgcc atgagcggat ggtacagagg    340380
     ccgggcagcc gccggcaatg cgcgaccgcc attgcggacc ggtttaccaa gcgtagcggt    340440
     aacccagctg cacggtccac ggcaggctga gcctgggtcc gtgcgcgtac tcgtacgacg    340500
     cgtacagatt gtggcccttg cccagcgcgg ccgccacgcc cagtcccagt tcgacgcggc    340560
     ccgcgcccag gtcggtacgg tgcgcgatgc cgttggtgcg caccgtgctc acgcccttga    340620
     gttcctgcac ccaactcagc tgcgcgtagg gctgcaccac cgcgccgccg cgcaagtcga    340680
     agcggcggcc ggcttgcgcg cctacccgcg cctgcagcga cgtgccgccg tcatcctcga    340740
     tacgcaggcc attgctggcc gtgtacgtac cgccgccggc acgaaaccac gccagttcgg    340800
     cctgcggctc gacgaaccag tgccggtcca gcgccagacg ccggccggcc tccagcgtca    340860
     cgcccacgcc attggcgcgg tagctgccgg acacggtgcg ccccgcccag ccaggtacgt    340920
     cgaacgaatt ctcgaagcgg ctggcgcgca gcgtggcatc ggcgtacacg ccattggcgc    340980
     cgatataggt ggcatagccg cccacgtgca cgctgtcggt gtgccccttt ccctggccgg    341040
     aaaacccgcg tgacgcgcgc gtgtagccca gcaacccgcc cgcatgccaa cggccgccgg    341100
     ccacgggcca ggcccggtcg gcgcccagct cgatgccgct gacgccttgc tggaaatgcc    341160
     ggcccgcgcg cggactgatg cgctggcgct ggctgaacgc ccggccccag gcgccgccgg    341220
     cgtccgggtt caggcgcaat tcgcccatgc gcttgcccaa cgcgttggat tcggcatacc    341280
     acaacccctg caccgcgccc agtccgccgg tatccagcgc cgcggcggcg gtggacgaat    341340
     accccgtcct gaccaggccc caggcgccgc ccggctgctg cgccagcccg tagcgatagg    341400
     tgccgaagtc ggccctgccg tcgctgccgt cgagttcgaa actggccttg ccgtctgcgg    341460
     gcgcgcgcac cagcacggcc tgtgccttcg acggctcggc gccggccggc gcgcgcaacc    341520
     acacgcgatg ccgcccttcg gcctggtcgg tcaccaccag ttgatcggca tgctccaacg    341580
     cggcgtccgc acgcatctcg aacgaaccgg cgcccgccag ggtgcgcacc gtcagcgttt    341640
     gaaaacccgg tccggccgca tcgccgaaca cgacggccgc gccaggctcc atgctcagtt    341700
     cgcccacgct ggatgccgcg ctcatgcgcc attggccgcc cgcgcccagg gccagcctgt    341760
     caagcgactg agtcgcgcca tgccactgcg cgccgtcggc cacatcgagc tcgagcggcg    341820
     cctggtccag cccgacgcgc aagcccggcc gcacgggcgt gccgaaccca tccttctccg    341880
     gcgccgtctc gggcgcgcgc acgacatcgc cctgcgcgac cgccgcgccg cgcaggacga    341940
     gccgcaccgg caccggcgtg gtctggcgca acagctgcgc gccgccgacc ttggcccccg    342000
     acaaggtgac ggtaaccgca ggcatgccgt cctgcggcgc ggccttcgct ggccgcagaa    342060
     aaacattcgc cgccgccagc accgcatcgt aggcgcccgt gacgaatacc ggcgcctggc    342120
     ccgcgtttac cgttccaccc gcgacgccga gcgctcccgc gaccagctcg acggccggcg    342180
     agccggccgt acgaacatcc accgtgtcca gccttgcctg cccgccaccg agtgacagtg    342240
     ccggcgcgtg cgcgccggcg accgaaatcg aaccacccac cacacgcagc acaggatccc    342300
     ggcgcgcagg cgaatcgccc gcggaatcgc cggccagggt cgaaaccaga tcgatggcgg    342360
     gcgccccttg cgcgctcact tccacatcac gcaattgccc ctcgacgcca ccgtacagat    342420
     caagggcgga tccgttgctc gccgccagcg acccgccact caggtcggcc cgcccaccgc    342480
     tactcagaag caggcccgag cggccgctga accgggtgtt gcgcgccgcc agctcgccat    342540
     cgccatccac cctggccgcc cgctcgccca gcacctcact gtcagccaga ctggccttgg    342600
     cggcgtactt gatcgacaag cccgtggcat gcaggccacg cacggtactg cgcacaatat    342660
     ccgcccgggc cctgctgacc agctgcatgc cctgctcccc ttcgaccgtg ctgtcggaca    342720
     ggatcagcga cgcatccggg ccggcgacac gcaaggccag cggccgacgg ctccagtcgc    342780
     cggcactcga accgtaccgg ttgcggatgg tcgtgccgcg cgcggtcagc gcgccggccc    342840
     gcaccatcac cgtgccgcgc ggctgataac tgctatccag gccgaggtcg ccgctggaag    342900
     tgatcgcggc ctcctccagc gtcagcgaaa cgccggtctt gtccagcaat acgcccaccc    342960
     ctcgcgcgcc ggtggtttcc accgtcatct tgcgcgcgac ccagggcccg gtatgcaagg    343020
     ccgcggtctt gtccggaacc tcgatgccga tctcgccctg gccggtcttc ttgatcgtgg    343080
     cgccggacca atgctccgca cgggccagcg gcgccccgat catcgcgccg cccagcgcca    343140
     cggcaagcac cggccgcgct gcgcttgcga ccattcggac cggttggcgg cgcccggaaa    343200
     caggcaagga aaacaacggt gaaacagacc tgagcatggc atcctcttgc gaacgctgca    343260
     tccctcatgc agcaatccgc gcagtctgcc gaccgtccat atacaggcct atcagctctt    343320
     accgtggcat ctggcgaaaa gccccaacgt ctcgcctgtc ttgccagcaa ccctggaaca    343380
     tttcccagca ctccgatcgt tcagtcccac gccggagcca ggccctcggg atcgacttcg    343440
     cgaccgttac gctccagcgc ggcaatccgc gccatgtcgt cggcgtccaa cgccaggccg    343500
     cgggccagca gattgctcgc caggttctcg cgcttggtcg aggacgggat caccgcatag    343560
     ccctgttgca gggcccaggc cagcgccacc tgcgccacgg tcgaccgatg cttgtccgcg    343620
     atccgcgcca gcaccggatc cttcagtacc ttgccgtagg ccagggtcat ataggaagtc    343680
     acggcaatac cctgctccct gaggaaagcc gtcagcctgg cgctctgcag ataggggctg    343740
     agttcgatct ggttggtggc gatctcgccc tgtcccaccg ccgcgatggc ctgcctggtc    343800
     agcgcgatgt tgaaattgga aataccgatc cggcgcgtca ggcccagcgc cttggcctcg    343860
     gccagcgcct ccatgtattc gggcaaggcc acgccgttgc ccggcgcggg ccagtggatc    343920
     agcgtcaggt ccacgtagtc ggtgcgcagt ttttccaggc tggcgcgcag gctgggcagc    343980
     agcttggccc gggcgtagtt gtcggtccag atcttggtgg tcacgaacag ttcggaacgc    344040
     gccacgccgc tttcggcgat agcctggccg acctcggttt cattgccgta gatctgcgcc    344100
     gtgtcgacgg cgcgatagcc caggtcgatg gcgttgcgga ccgagtcgat cacggtctgg    344160
     ccggtcaggc ggaaggtacc cacgccaaag gaagggatgg tcatgcgaag actccttgaa    344220
     tgcaagacgg atgaatatga aggttgtcga cggcctgccg gcggcgccgg cccgctcagg    344280
     cgccctgcgc cacccggcgg cggccggcat tgcccagcca gaccaggccc aggccgccgg    344340
     cggccagcgc cgcgccgacc aggggcacgg atgcatagcc caggccctgg ccgatggccg    344400
     cgccgcccag cgccgcgccc agcgcgttgc ccaggttgaa cgcgccgacg ttgaccgacg    344460
     aggccaggcc cggcgcctgg gccgccgcct gcatgacccg catctgcacc ggcggaacga    344520
     tgccgaaggc cgcggccgcc cacaccacca gcccgatggc cgcgcccgca tgggtggtca    344580
     gcagcagcgg cagcacggcc atgatgaccg cgagcagccc caggatcagc ttggtggcgc    344640
     cgtcgagcga ccagtcggcc aggcggccgc ccagcgtatt gcccagcgtg aagccgatgc    344700
     cgatcagcac cagggcgaag gccacgaagt tggggctggc gtgggtcagg tcggccagga    344760
     ccggcgccac ataggtgtag agcgcgaaca tggcgcccgc gcccagcacc gtggtgccca    344820
     tggccagcag gacctccggg cgcgtgagca cccccagctc gcggcgcacg tccggacgct    344880
     tgccgggctc gcccttgggc agcgccagcc acagcgcggc gatggtgacc aggcccaggg    344940
     ccgccgtccc gccgaaggca agccgccagc ccacctgctg cccgatccag gtcgccaccg    345000
     gcacgccgcc gatattggcc agggtcaggc ccatgaacat ggccgcgatg gcgctggcct    345060
     gcttttcgcg cggcaccagg ctggccgcca ccacggcccc gatgccgaag aaggcgccat    345120
     ggttgaggct ggtgatcagg cgcgacagca acagggtcga gtagctcggc gcgaacgccg    345180
     agagcaggtt gccgacggtg aagatcagca tcagcgacat cagggccgcg cgcttgccga    345240
     aacgggcaaa cagcagggtc atgaccggcg ctccgagcat cacgcccacc gcgtaggccg    345300
     agatcagcat gcccgcgctg ggaatgctta cctgcacacc gtcggcgatg acgggcagca    345360
     gccccatcgg cgtgaactcc gtggtgccga tggcgaatgc gccggtggcc agggcaaaca    345420
     atgcggccga ggatttcatc gccgcttctc cttgaaaaag tccaatggcg acagtgtgcc    345480
     gggtttatat ttgcggatta agctctgtat gaaccaaatt cttttgattt gaattcaaca    345540
     atgaaaacca ccctggacga attgcaggcc ttcgtggccg tcgtggacac gggttcgatc    345600
     accgcggccg cggaacagct cgggctgacg gtctcggccg ccagccgcac gctgggccgg    345660
     ctggaggaaa agctgcagac caccctggtg cgccgcacga cccgccggct cgagctgacc    345720
     gaggaagggg ccgctttcct gcagcatgcg cgcgccatcc tggcctcggt cgacgaggcc    345780
     gaggaacaga tggcggcccg ccgcatgcgc ccggccggac ggctgcgggt cgacgcggcc    345840
     actccgttca tgctgcatgt gctggtaccg ctgatagcag gctttcatgc ccgctacccc    345900
     gaggtggagc tggagctcaa ttccaacgaa ggcatcgtcg atctgatcga aaagcgcacc    345960
     gacgtggcgt ttcgcatcgg cgtgctgaaa gactccaccc tgcacgcccg cgccgtcggc    346020
     accagccgcc tgcgggtgct cgccagtccc gcctacctcg agcgtcgcgg cgcgcccacc    346080
     cgcaccgcgc aactcgcgca acatgccctg cttggcttca cccagcccga gacgctgaac    346140
     gactggccct tgcgcgatgc ggacggcgcc gtcctgcgca tccggccgac catcgcctcg    346200
     tccagcggtg aaacgctgcg ccacatggcc ctggcgggcc tgggcatcgt ctgcctgtcg    346260
     gacttcatga ccggcgagga ccgccgcgcc ggcgcactgg tgcaactgtt cgccaggcag    346320
     actctggacg tgcgccagcc ggtcaacgcg gtctactacc gcaacaccgc gctggccgcg    346380
     cgcatcacct gcttcgtgga ccacgtgatc gagacgctgg gcgcccggcc gttcgacgca    346440
     tgaacggcgc cggcgcgcgg ccaaagaaaa accgcccgaa ggcggctttt cctggcggcg    346500
     cacggcctta tttgtccacg aacgcgcgct cgaacacgta gtcgcccggc tcgcccacgc    346560
     ccggcgaaac ctcgaacccg cgcttgtcca gcatggcgcg gatatcggcc agcatgtgcg    346620
     ggctgccgca gatcatggcg cggtcgaccg ccgggtccag ctgcggcagg ccgatgtcgg    346680
     cgcacagctt gcccgagtcg accagctgcg tgatgcggcc ctggttgcgg aacggttcgc    346740
     gcgtcacggt ggggtaatag accagcttgt cgcgcacgat gtcgccgaag aactcgttgc    346800
     cgggcagttc cttctcgatg aaatcggcat aggccagctc gctggcccag cgcaccccgt    346860
     gcaccagcac cactttctcg aaccgctcgt agacctcggg atccttgatg atgctcatga    346920
     acggggccag gcccgtgccg gtgccgaaca gatacaggtg cttgcccggc ttgagatcgt    346980
     cgaccaccag cgtgcccacc ggcttgcggc tgaccaggat ggtgtcgcct tccttgaggt    347040
     gctgcagccg cgaggtcagc ggcccgttct gcaccttgat gctgaggaac tcgaggtttt    347100
     cctcgtaatt ggcgctggcg atgctgtagg cgcgcatcaa cggcttgcct tcgatttcca    347160
     ggccgatcat gacgaaatgg ccattgtgaa agcgcagcgc cgcatcgcgg gtggtggtga    347220
     aggagaaaag ggtgtcgttc cagtggcgca cgctgagcac gcgctcggta ttgaaagctg    347280
     ccatgtcgtt gtaaattacg gcgccttcca gcgcacaaag gaagaaacgg gaagaggcct    347340
     cgccgcgcgc aacgcatggg cgaacctagg gttaatcctg attttaacgc aagtagctga    347400
     gaactgctct tattaatcgt aatacccata tgccgtttga tcggggtcaa tccccacccc    347460
     gccgcgcccg caaactgacc tttcaagaag ttgaacagcg gtccgcttcc tgttattgtg    347520
     cccgtctcag ttgataatca ttttcgttag cgcacgcaac tgcaatccgc atcggcgtgc    347580
     gttcctgtcc tgccggagtc attccatgcc gtcgaccaag cgttcctccc tgatcccgct    347640
     gctgcgcgcc ctggcgctcg cgggcgttgc cacgttctcc gcccaggcgc tggccgccga    347700
     tgaggtcagc ctctacacca cgcgcgaacc caagctgatc cagcctctgc tcgacgcctt    347760
     cgccaaggac agcggcatca aggtcaacac cgtcttcgtc aaggacggcc tgctcgaacg    347820
     cgtcagggcc gagggcgaca agtcgccggc cgacgtgctg atgacggtcg acatcggcaa    347880
     cctgatcgac ctggtcaatg gcggcgtcac ccagaaaatc cagtcgcaga cgctcgacag    347940
     cgtggtgccc gccaacctgc gcggcgccga aggcagctgg tacgccctgt cgctgcgcga    348000
     ccgggttctc tacgtcgaga aagacctcaa gctggacagc ttccgctacg aagacctggc    348060
     cgaccccaaa tggaagggca aggtgtgcat ccgctcgggc cagcacccct acaacaccgc    348120
     gctggtggcg gccatgatcg cccatgacgg cgccgaggcc accgagaaat ggctgcgcgg    348180
     cgtgaaggcc aacctggccc gcaaggcggc cggcggcgac cgcgacgtgg cgcgcgacat    348240
     cctcggcggc atctgcgaca tcggcctggc caacgcctac tacgtcggcc acatgaagaa    348300
     cgccgagccg ggcaccgacg cccgcaagtg gggcgacgcc atcaaggtag tgcgcccgac    348360
     cttcgccacc gccaaggatg gcggcaccca cgtcaacatc agcggcgccg cggtcgcggc    348420
     gcacgcgccc aacaaggcca acgccgtcaa gctgctggag tacctggtct ccgagccggc    348480
     ccagacgctg tacgcccagg ccaactacga gtacccggtg cgcgccggcg tcaagctgga    348540
     cgcggtggtg gccagcttcg gcccgctgaa ggtcgatacc ctgcccgtgg ccgagatcgc    348600
     caagtaccgc aagcaggcca gcgaactggt cgacaaggtg ggcttcgaca actgagccgc    348660
     gctacactca cgcccgccac gccattgcgg cggcgcgggc gttgcc                   348706
//

If you have problems or comments...

PBIL Back to PBIL home page