(data stored in ACNUC1104 zone)

EMBL: AL123456

ID   AL123456; SV 3; linear; genomic DNA; STD; PRO; 4411532 BP.
XX
AC   AL123456; BX842572-BX842584;
XX
PR   Project:PRJNA224;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 10)
XX
DE   Mycobacterium tuberculosis H37Rv complete genome.
XX
KW   complete genome.
XX
OS   Mycobacterium tuberculosis H37Rv
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
XX
RN   [1]
RC   Erratum:[Nature 1998 Nov 12;396(6707):190]
RX   DOI; 10.1038/31159.
RX   PUBMED; 9634230.
RA   Cole S.T., Brosch R., Parkhill J., Garnier T., Churcher C., Harris D.,
RA   Gordon S.V., Eiglmeier K., Gas S., Barry C.E.III., Tekaia F., Badcock K.,
RA   Basham D., Brown D., Chillingworth T., Connor R., Davies R., Devlin K.,
RA   Feltwell T., Gentles S., Hamlin N., Holroyd S., Hornsby T., Jagels K.,
RA   Krogh A., McLean J., Moule S., Murphy L., Oliver K., Osborne J.,
RA   Quail M.A., Rajandream M.A., Rogers J., Rutter S., Seeger K., Skelton J.,
RA   Squares R., Squares S., Sulston J.E., Taylor K., Whitehead S.,
RA   Barrell B.G.;
RT   "Deciphering the biology of Mycobacterium tuberculosis from the complete
RT   genome sequence";
RL   Nature 393(6685):537-544(1998).
XX
RN   [2]
RX   PUBMED; 12368430.
RA   Camus J.C., Pryor M.J., Medigue C., Cole S.T.;
RT   "Re-annotation of the genome sequence of Mycobacterium tuberculosis H37Rv";
RL   Microbiology (Reading, Engl.) 148(Pt 10):2967-2973(2002).
XX
RN   [3]
RX   DOI; 10.1016/j.tube.2010.09.008.
RX   PUBMED; 20980199.
RA   Lew J.M., Kapopoulou A., Jones L.M., Cole S.T.;
RT   "TubercuList--10 years after";
RL   Tuberculosis (Edinb) 91(1):1-7(2011).
XX
RN   [4]
RP   1-4411529
RA   Parkhill J.;
RT   ;
RL   Submitted (11-JUN-1998) to the INSDC.
RL   Submitted on behalf of the Mycobacterium tuberculosis sequencing and
RL   mapping teams, Sanger Centre, Wellcome Trust Genome Campus, Hinxton,
RL   Cambridge CB10 1SA Unite de Genetique Moleculaire Bacterienne, Institut
RL   Pasteur, 28 rue du Docteur Roux, 75724 Paris Cedex 15, France E-mail:
RL   parkhill@sanger.ac.uk
XX
RN   [5]
RP   1-4411532
RA   Lew J.M.;
RT   ;
RL   Submitted (18-DEC-2012) to the INSDC.
RL   Lew J., Ecole Polytechnique Federale de Lausanne, CH-1015, Lausanne,
RL   Switzerland, and the Swiss Institute of Bioinformatics, CMU - Rue
RL   Michel-Servet 1, 1211 Geneva 4, SWITZERLAND
XX
DR   MD5; 57b12ff2773c5fd3a0f879972f176e50.
DR   BioSample; SAMEA3138326.
DR   EnsemblGenomes-Gn; EBG00000313313.
DR   EnsemblGenomes-Gn; EBG00000313314.
DR   EnsemblGenomes-Gn; EBG00000313315.
DR   EnsemblGenomes-Gn; EBG00000313316.
DR   EnsemblGenomes-Gn; EBG00000313317.
DR   EnsemblGenomes-Gn; EBG00000313318.
DR   EnsemblGenomes-Gn; EBG00000313319.
DR   EnsemblGenomes-Gn; EBG00000313320.
DR   EnsemblGenomes-Gn; EBG00000313321.
DR   EnsemblGenomes-Gn; EBG00000313322.
DR   EnsemblGenomes-Gn; EBG00000313323.
DR   EnsemblGenomes-Gn; EBG00000313324.
DR   EnsemblGenomes-Gn; EBG00000313325.
DR   EnsemblGenomes-Gn; EBG00000313326.
DR   EnsemblGenomes-Gn; EBG00000313327.
DR   EnsemblGenomes-Gn; EBG00000313328.
DR   EnsemblGenomes-Gn; EBG00000313329.
DR   EnsemblGenomes-Gn; EBG00000313330.
DR   EnsemblGenomes-Gn; EBG00000313331.
DR   EnsemblGenomes-Gn; EBG00000313332.
DR   EnsemblGenomes-Gn; EBG00000313333.
DR   EnsemblGenomes-Gn; EBG00000313334.
DR   EnsemblGenomes-Gn; EBG00000313335.
DR   EnsemblGenomes-Gn; EBG00000313336.
DR   EnsemblGenomes-Gn; EBG00000313337.
DR   EnsemblGenomes-Gn; EBG00000313338.
DR   EnsemblGenomes-Gn; EBG00000313339.
DR   EnsemblGenomes-Gn; EBG00000313340.
DR   EnsemblGenomes-Gn; EBG00000313341.
DR   EnsemblGenomes-Gn; EBG00000313342.
DR   EnsemblGenomes-Gn; EBG00000313343.
DR   EnsemblGenomes-Gn; EBG00000313344.
DR   EnsemblGenomes-Gn; EBG00000313345.
DR   EnsemblGenomes-Gn; EBG00000313346.
DR   EnsemblGenomes-Gn; EBG00000313347.
DR   EnsemblGenomes-Gn; EBG00000313348.
DR   EnsemblGenomes-Gn; EBG00000313349.
DR   EnsemblGenomes-Gn; EBG00000313350.
DR   EnsemblGenomes-Gn; EBG00000313351.
DR   EnsemblGenomes-Gn; EBG00000313352.
DR   EnsemblGenomes-Gn; EBG00000313353.
DR   EnsemblGenomes-Gn; EBG00000313354.
DR   EnsemblGenomes-Gn; EBG00000313355.
DR   EnsemblGenomes-Gn; EBG00000313356.
DR   EnsemblGenomes-Gn; EBG00000313357.
DR   EnsemblGenomes-Gn; EBG00000313358.
DR   EnsemblGenomes-Gn; EBG00000313359.
DR   EnsemblGenomes-Gn; EBG00000313360.
DR   EnsemblGenomes-Gn; EBG00000313361.
DR   EnsemblGenomes-Gn; EBG00000313362.
DR   EnsemblGenomes-Gn; EBG00000313363.
DR   EnsemblGenomes-Gn; EBG00000313364.
DR   EnsemblGenomes-Gn; EBG00000313365.
DR   EnsemblGenomes-Gn; EBG00000313366.
DR   EnsemblGenomes-Gn; EBG00000313367.
DR   EnsemblGenomes-Gn; EBG00000313368.
DR   EnsemblGenomes-Gn; EBG00000313369.
DR   EnsemblGenomes-Gn; EBG00000313370.
DR   EnsemblGenomes-Gn; EBG00000313371.
DR   EnsemblGenomes-Gn; EBG00000313372.
DR   EnsemblGenomes-Gn; EBG00000313373.
DR   EnsemblGenomes-Gn; EBG00000313374.
DR   EnsemblGenomes-Gn; EBG00000313375.
DR   EnsemblGenomes-Gn; EBG00000313376.
DR   EnsemblGenomes-Gn; EBG00000313377.
DR   EnsemblGenomes-Gn; EBG00000313378.
DR   EnsemblGenomes-Gn; EBG00000313379.
DR   EnsemblGenomes-Gn; EBG00000313380.
DR   EnsemblGenomes-Gn; EBG00000313381.
DR   EnsemblGenomes-Gn; EBG00000313382.
DR   EnsemblGenomes-Gn; EBG00000313383.
DR   EnsemblGenomes-Gn; EBG00000313384.
DR   EnsemblGenomes-Gn; EBG00000313385.
DR   EnsemblGenomes-Gn; EBG00000313386.
DR   EnsemblGenomes-Gn; EBG00000313387.
DR   EnsemblGenomes-Gn; EBG00000313388.
DR   EnsemblGenomes-Gn; EBG00000313389.
DR   EnsemblGenomes-Gn; EBG00000313390.
DR   EnsemblGenomes-Gn; Rv0277A.
DR   EnsemblGenomes-Gn; Rv0947c.
DR   EnsemblGenomes-Gn; Rv1150.
DR   EnsemblGenomes-Gn; Rv1792.
DR   EnsemblGenomes-Gn; Rv2023A.
DR   EnsemblGenomes-Gn; Rv2098c.
DR   EnsemblGenomes-Gn; Rv2099c.
DR   EnsemblGenomes-Gn; Rv2427A.
DR   EnsemblGenomes-Gn; Rv3021c.
DR   EnsemblGenomes-Gn; Rv3022c.
DR   EnsemblGenomes-Gn; Rv3128c.
DR   EnsemblGenomes-Gn; Rv3216.
DR   EnsemblGenomes-Gn; Rv3324A.
DR   EnsemblGenomes-Tr; EBG00000313313-1.
DR   EnsemblGenomes-Tr; EBG00000313314-1.
DR   EnsemblGenomes-Tr; EBG00000313315-1.
DR   EnsemblGenomes-Tr; EBG00000313316-1.
DR   EnsemblGenomes-Tr; EBG00000313317-1.
DR   EnsemblGenomes-Tr; EBG00000313318-1.
DR   EnsemblGenomes-Tr; EBG00000313319-1.
DR   EnsemblGenomes-Tr; EBG00000313320-1.
DR   EnsemblGenomes-Tr; EBG00000313321-1.
DR   EnsemblGenomes-Tr; EBG00000313322-1.
DR   EnsemblGenomes-Tr; EBG00000313323-1.
DR   EnsemblGenomes-Tr; EBG00000313324-1.
DR   EnsemblGenomes-Tr; EBG00000313325-1.
DR   EnsemblGenomes-Tr; EBG00000313326-1.
DR   EnsemblGenomes-Tr; EBG00000313327-1.
DR   EnsemblGenomes-Tr; EBG00000313328-1.
DR   EnsemblGenomes-Tr; EBG00000313329-1.
DR   EnsemblGenomes-Tr; EBG00000313330-1.
DR   EnsemblGenomes-Tr; EBG00000313331-1.
DR   EnsemblGenomes-Tr; EBG00000313332-1.
DR   EnsemblGenomes-Tr; EBG00000313333-1.
DR   EnsemblGenomes-Tr; EBG00000313334-1.
DR   EnsemblGenomes-Tr; EBG00000313335-1.
DR   EnsemblGenomes-Tr; EBG00000313336-1.
DR   EnsemblGenomes-Tr; EBG00000313337-1.
DR   EnsemblGenomes-Tr; EBG00000313338-1.
DR   EnsemblGenomes-Tr; EBG00000313339-1.
DR   EnsemblGenomes-Tr; EBG00000313340-1.
DR   EnsemblGenomes-Tr; EBG00000313341-1.
DR   EnsemblGenomes-Tr; EBG00000313342-1.
DR   EnsemblGenomes-Tr; EBG00000313343-1.
DR   EnsemblGenomes-Tr; EBG00000313344-1.
DR   EnsemblGenomes-Tr; EBG00000313345-1.
DR   EnsemblGenomes-Tr; EBG00000313346-1.
DR   EnsemblGenomes-Tr; EBG00000313347-1.
DR   EnsemblGenomes-Tr; EBG00000313348-1.
DR   EnsemblGenomes-Tr; EBG00000313349-1.
DR   EnsemblGenomes-Tr; EBG00000313350-1.
DR   EnsemblGenomes-Tr; EBG00000313351-1.
DR   EnsemblGenomes-Tr; EBG00000313352-1.
DR   EnsemblGenomes-Tr; EBG00000313353-1.
DR   EnsemblGenomes-Tr; EBG00000313354-1.
DR   EnsemblGenomes-Tr; EBG00000313355-1.
DR   EnsemblGenomes-Tr; EBG00000313356-1.
DR   EnsemblGenomes-Tr; EBG00000313357-1.
DR   EnsemblGenomes-Tr; EBG00000313358-1.
DR   EnsemblGenomes-Tr; EBG00000313359-1.
DR   EnsemblGenomes-Tr; EBG00000313360-1.
DR   EnsemblGenomes-Tr; EBG00000313361-1.
DR   EnsemblGenomes-Tr; EBG00000313362-1.
DR   EnsemblGenomes-Tr; EBG00000313363-1.
DR   EnsemblGenomes-Tr; EBG00000313364-1.
DR   EnsemblGenomes-Tr; EBG00000313365-1.
DR   EnsemblGenomes-Tr; EBG00000313366-1.
DR   EnsemblGenomes-Tr; EBG00000313367-1.
DR   EnsemblGenomes-Tr; EBG00000313368-1.
DR   EnsemblGenomes-Tr; EBG00000313369-1.
DR   EnsemblGenomes-Tr; EBG00000313370-1.
DR   EnsemblGenomes-Tr; EBG00000313371-1.
DR   EnsemblGenomes-Tr; EBG00000313372-1.
DR   EnsemblGenomes-Tr; EBG00000313373-1.
DR   EnsemblGenomes-Tr; EBG00000313374-1.
DR   EnsemblGenomes-Tr; EBG00000313375-1.
DR   EnsemblGenomes-Tr; EBG00000313376-1.
DR   EnsemblGenomes-Tr; EBG00000313377-1.
DR   EnsemblGenomes-Tr; EBG00000313378-1.
DR   EnsemblGenomes-Tr; EBG00000313379-1.
DR   EnsemblGenomes-Tr; EBG00000313380-1.
DR   EnsemblGenomes-Tr; EBG00000313381-1.
DR   EnsemblGenomes-Tr; EBG00000313382-1.
DR   EnsemblGenomes-Tr; EBG00000313383-1.
DR   EnsemblGenomes-Tr; EBG00000313384-1.
DR   EnsemblGenomes-Tr; EBG00000313385-1.
DR   EnsemblGenomes-Tr; EBG00000313386-1.
DR   EnsemblGenomes-Tr; EBG00000313387-1.
DR   EnsemblGenomes-Tr; EBG00000313388-1.
DR   EnsemblGenomes-Tr; EBG00000313389-1.
DR   EnsemblGenomes-Tr; EBG00000313390-1.
DR   EnsemblGenomes-Tr; Rv0277A.
DR   EnsemblGenomes-Tr; Rv0947c.
DR   EnsemblGenomes-Tr; Rv1150.
DR   EnsemblGenomes-Tr; Rv1792.
DR   EnsemblGenomes-Tr; Rv2023A.
DR   EnsemblGenomes-Tr; Rv2098c.
DR   EnsemblGenomes-Tr; Rv2099c.
DR   EnsemblGenomes-Tr; Rv2427A.
DR   EnsemblGenomes-Tr; Rv3021c.
DR   EnsemblGenomes-Tr; Rv3022c.
DR   EnsemblGenomes-Tr; Rv3128c.
DR   EnsemblGenomes-Tr; Rv3216.
DR   EnsemblGenomes-Tr; Rv3324A.
DR   EuropePMC; PMC101927; 10894733.
DR   EuropePMC; PMC1266029; 16159395.
DR   EuropePMC; PMC128180; 12117918.
DR   EuropePMC; PMC1326169; 16387854.
DR   EuropePMC; PMC135229; 12142426.
DR   EuropePMC; PMC135457; 12446641.
DR   EuropePMC; PMC141938; 12486050.
DR   EuropePMC; PMC1471987; 16614253.
DR   EuropePMC; PMC1475714; 16789813.
DR   EuropePMC; PMC1482720; 16677374.
DR   EuropePMC; PMC1482959; 16740934.
DR   EuropePMC; PMC1590026; 16901339.
DR   EuropePMC; PMC193761; 12949087.
DR   EuropePMC; PMC193791; 12958298.
DR   EuropePMC; PMC2168543; 17898156.
DR   EuropePMC; PMC2228276; 18081934.
DR   EuropePMC; PMC2358910; 18394163.
DR   EuropePMC; PMC240732; 14569030.
DR   EuropePMC; PMC2413405; 18560597.
DR   EuropePMC; PMC2430213; 18507851.
DR   EuropePMC; PMC2440308; 18584054.
DR   EuropePMC; PMC2442614; 18505592.
DR   EuropePMC; PMC2553098; 18793412.
DR   EuropePMC; PMC2615007; 18439872.
DR   EuropePMC; PMC2634755; 19146672.
DR   EuropePMC; PMC2687942; 19478010.
DR   EuropePMC; PMC2689228; 19442300.
DR   EuropePMC; PMC2693488; 19217827.
DR   EuropePMC; PMC2724981; 19578178.
DR   EuropePMC; PMC2738538; 12453367.
DR   EuropePMC; PMC2799434; 19951445.
DR   EuropePMC; PMC2884946; 17259624.
DR   EuropePMC; PMC2976163; 20805400.
DR   EuropePMC; PMC2978697; 21085642.
DR   EuropePMC; PMC2995261; 20825248.
DR   EuropePMC; PMC2998474; 21083941.
DR   EuropePMC; PMC3028861; 21134965.
DR   EuropePMC; PMC308900; 14638775.
DR   EuropePMC; PMC3089889; 21584191.
DR   EuropePMC; PMC3101871; 21516081.
DR   EuropePMC; PMC3165319; 21709103.
DR   EuropePMC; PMC3207917; 22072964.
DR   EuropePMC; PMC3232757; 21930879.
DR   EuropePMC; PMC3317155; 22294518.
DR   EuropePMC; PMC3318526; 22189117.
DR   EuropePMC; PMC3347062; 22389481.
DR   EuropePMC; PMC3401130; 22911768.
DR   EuropePMC; PMC3488197; 22984115.
DR   EuropePMC; PMC3497527; 23002228.
DR   EuropePMC; PMC3517044; 20217870.
DR   EuropePMC; PMC3573601; 23287127.
DR   EuropePMC; PMC3577857; 23437175.
DR   EuropePMC; PMC3592388; 23332401.
DR   EuropePMC; PMC3635867; 23496945.
DR   EuropePMC; PMC3650330; 23345537.
DR   EuropePMC; PMC3664454; 20662102.
DR   EuropePMC; PMC368364; 15006795.
DR   EuropePMC; PMC3695354; 23819037.
DR   EuropePMC; PMC3697671; 23616454.
DR   EuropePMC; PMC3738908; 23929492.
DR   EuropePMC; PMC3756804; 22522804.
DR   EuropePMC; PMC3814196; 24115728.
DR   EuropePMC; PMC3861185; 24348997.
DR   EuropePMC; PMC3885621; 24416324.
DR   EuropePMC; PMC3898074; 24268774.
DR   EuropePMC; PMC3912914; 23927792.
DR   EuropePMC; PMC3937605; 24578269.
DR   EuropePMC; PMC3951610; 24417450.
DR   EuropePMC; PMC4014681; 24812213.
DR   EuropePMC; PMC4068501; 24687490.
DR   EuropePMC; PMC4099304; 25025225.
DR   EuropePMC; PMC4117774; 24957601.
DR   EuropePMC; PMC4118072; 25081269.
DR   EuropePMC; PMC4132623; 25125647.
DR   EuropePMC; PMC4136221; 24891105.
DR   EuropePMC; PMC4137073; 25048541.
DR   EuropePMC; PMC4153649; 25184567.
DR   EuropePMC; PMC4161259; 25028426.
DR   EuropePMC; PMC4179564; 25279265.
DR   EuropePMC; PMC4191392; 25217589.
DR   EuropePMC; PMC4192383; 25301651.
DR   EuropePMC; PMC4200149; 25323711.
DR   EuropePMC; PMC4342168; 25719196.
DR   EuropePMC; PMC4348518; 25734518.
DR   EuropePMC; PMC4354982; 25336729.
DR   EuropePMC; PMC4368680; 25794037.
DR   EuropePMC; PMC4384740; 25732036.
DR   EuropePMC; PMC4405938; 25857493.
DR   EuropePMC; PMC4409578; 24888866.
DR   EuropePMC; PMC4425900; 25879806.
DR   EuropePMC; PMC4440964; 25999550.
DR   EuropePMC; PMC4457063; 26044426.
DR   EuropePMC; PMC4473240; 25972414.
DR   EuropePMC; PMC4504505; 26181760.
DR   EuropePMC; PMC4505224; 26033726.
DR   EuropePMC; PMC4540937; 26179309.
DR   EuropePMC; PMC4575197; 26382066.
DR   EuropePMC; PMC4576106; 26195530.
DR   EuropePMC; PMC4619333; 26496891.
DR   EuropePMC; PMC4626898; 26391209.
DR   EuropePMC; PMC4647672; 26573524.
DR   EuropePMC; PMC4652870; 26583774.
DR   EuropePMC; PMC4672993; 26542222.
DR   EuropePMC; PMC4713439; 26752297.
DR   EuropePMC; PMC4770551; 26923687.
DR   EuropePMC; PMC4777479; 26938641.
DR   EuropePMC; PMC4894389; 24755960.
DR   EuropePMC; PMC4939790; 27389273.
DR   EuropePMC; PMC4992850; 27261264.
DR   EuropePMC; PMC4997829; 27324769.
DR   EuropePMC; PMC5037696; 27618895.
DR   EuropePMC; PMC5080463; 27812529.
DR   EuropePMC; PMC5084853; 27789629.
DR   EuropePMC; PMC5136537; 27994580.
DR   EuropePMC; PMC5178084; 28003022.
DR   EuropePMC; PMC5238942; 27798628.
DR   EuropePMC; PMC5293778; 28223967.
DR   EuropePMC; PMC5312242; 28031352.
DR   EuropePMC; PMC5330813; 27919643.
DR   EuropePMC; PMC5379054; 28348398.
DR   EuropePMC; PMC5392487; 28416956.
DR   EuropePMC; PMC5393005; 28415976.
DR   EuropePMC; PMC5395877; 28424085.
DR   EuropePMC; PMC5469733; 28611407.
DR   EuropePMC; PMC5473266; 28619797.
DR   EuropePMC; PMC5473816; 28623303.
DR   EuropePMC; PMC5502846; 28684565.
DR   EuropePMC; PMC5557973; 28811595.
DR   EuropePMC; PMC5558980; 28813434.
DR   EuropePMC; PMC5571295; 28630205.
DR   EuropePMC; PMC5648229; 29049400.
DR   EuropePMC; PMC5660062; 29109705.
DR   EuropePMC; PMC5676744; 29116204.
DR   EuropePMC; PMC5694780; 29188195.
DR   EuropePMC; PMC5786717; 29167288.
DR   EuropePMC; PMC5786718; 29142049.
DR   EuropePMC; PMC5884559; 29617456.
DR   EuropePMC; PMC5925711; 29540456.
DR   EuropePMC; PMC5989629; 27613236.
DR   EuropePMC; PMC60189; 11691918.
DR   EuropePMC; PMC6035060; 29681517.
DR   EuropePMC; PMC6056398; 30027700.
DR   EuropePMC; PMC6062541; 30050166.
DR   EuropePMC; PMC6071665; 30010947.
DR   EuropePMC; PMC6094979; 30140675.
DR   EuropePMC; PMC6116439; 30157763.
DR   EuropePMC; PMC6116745; 29952084.
DR   EuropePMC; PMC6125532; 29941636.
DR   EuropePMC; PMC6158078; 30224802.
DR   EuropePMC; PMC6204671; 30158196.
DR   EuropePMC; PMC6279915; 30547031.
DR   EuropePMC; PMC6299973; 30567498.
DR   EuropePMC; PMC6364042; 30583062.
DR   EuropePMC; PMC6397444; 30823869.
DR   EuropePMC; PMC6436429; 30117297.
DR   EuropePMC; PMC6459853; 30976025.
DR   EuropePMC; PMC6473227; 30744192.
DR   EuropePMC; PMC6550372; 31166945.
DR   EuropePMC; PMC6572207; 31137811.
DR   EuropePMC; PMC6593218; 31239393.
DR   EuropePMC; PMC6594935; 31243306.
DR   EuropePMC; PMC6616192; 31333625.
DR   EuropePMC; PMC6620280; 31292443.
DR   EuropePMC; PMC87843; 11230397.
DR   EuropePMC; PMC94148; 10542185.
DR   EuropePMC; PMC95520; 11698368.
DR   GOA; P0CW33.
DR   GOA; P0DMQ7.
DR   GOA; P0DMQ8.
DR   GOA; P9WKY5.
DR   GOA; P9WLC9.
DR   InterPro; IPR035172; DUF5302.
DR   InterPro; IPR035197; DUF5313.
DR   SILVA-LSU; AL123456.
DR   SILVA-SSU; AL123456.
DR   StrainInfo; 104411; 1.
DR   UniProtKB/Swiss-Prot; A0A089QKZ7; Y155A_MYCTU.
DR   UniProtKB/Swiss-Prot; E2FZM4; SOCA_MYCTU.
DR   UniProtKB/Swiss-Prot; E2FZM5; SOCB_MYCTU.
DR   UniProtKB/Swiss-Prot; I6WXS6; VPB51_MYCTU.
DR   UniProtKB/Swiss-Prot; I6YD99; Y2386_MYCTU.
DR   UniProtKB/Swiss-Prot; P0CW33; VPB25_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DMM2; Y028A_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DMM3; Y3202_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DMM4; Y572A_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DMQ7; 2003A_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DMQ8; Y2742_MYCTU.
DR   UniProtKB/Swiss-Prot; P0DN33; Y609B_MYCTU.
DR   UniProtKB/Swiss-Prot; P9WKY5; HAT_MYCTU.
DR   UniProtKB/Swiss-Prot; P9WLC9; Y2306_MYCTU.
DR   UniProtKB/Swiss-Prot; V5QPS4; 3098B_MYCTU.
XX
CC   On or before Feb 1, 2013 this sequence version replaced
CC   gi:41352722, gi:38490165, gi:38490207, gi:41353619, gi:38490250,
CC   gi:38684030, gi:38490288, gi:41353667, gi:41353422, gi:41352756,
CC   gi:38490319, gi:41352785, gi:38490370, gi:41353971.
CC   Note:
CC   This annotation is from the TubercuList website, Release 26, Dec
CC   2012 (URL: http://tuberculist.epfl.ch) (email:
CC   tuberculist@epfl.ch).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4411532
FT                   /organism="Mycobacterium tuberculosis H37Rv"
FT                   /strain="H37Rv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:83332"
FT   gene            1..1524
FT                   /gene="dnaA"
FT                   /locus_tag="Rv0001"
FT   CDS_pept        1..1524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Rv0001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /note="Rv0001, (MT0001, MTV029.01, P49993), len: 507 aa.
FT                   dnaA, chromosomal replication initiator protein (see
FT                   citations below), equivalent to other Mycobacterial
FT                   chromosomal replication initiator proteins. Also highly
FT                   similar to others except in N-terminus e.g.
FT                   Q9ZH75|DNAA_STRCH chromosomal replication initiator protein
FT                   from Streptomyces chrysomallus (624 aa). Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and PS01008 DnaA
FT                   protein signature. Belongs to the DnaA family. Note that
FT                   the first base of this gene has been taken as base 1 of the
FT                   Mycobacterium tuberculosis H37Rv genomic sequence."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0001"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42723"
FT                   /db_xref="GOA:P9WNW3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNW3"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS01008"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42723.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   gene            2052..3260
FT                   /gene="dnaN"
FT                   /locus_tag="Rv0002"
FT   CDS_pept        2052..3260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Rv0002"
FT                   /product="DNA polymerase III (beta chain) DnaN (DNA
FT                   nucleotidyltransferase)"
FT                   /note="Rv0002, (MTV029.02, MTCY10H4.0), len: 402 aa.
FT                   DnaN,DNA polymerase III (beta chain) (see citations
FT                   below),equivalent to other Mycobacterial DNA polymerases
FT                   III beta chain. Also highly similar to others e.g.
FT                   P27903|DP3B_STRCO DNA polymerase III beta chain from
FT                   Streptomyces coelicolor (376 aa). Overlaps and extends CDS
FT                   in neighbouring cosmid MTCY10H4.01."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0002"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42724"
FT                   /db_xref="GOA:P9WNU1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:3P16"
FT                   /db_xref="PDB:3RB9"
FT                   /db_xref="PDB:5AGU"
FT                   /db_xref="PDB:5AGV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNU1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42724.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVDVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
FT   gene            3280..4437
FT                   /gene="recF"
FT                   /locus_tag="Rv0003"
FT   CDS_pept        3280..4437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Rv0003"
FT                   /product="DNA replication and repair protein RecF
FT                   (single-strand DNA binding protein)"
FT                   /note="Rv0003, (MTCY10H4.01), len: 385 aa. RecF, DNA
FT                   replication and repair protein (see citations
FT                   below),equivalent to other mycobacterial DNA replication
FT                   and repair proteins. Also highly similar to many others.
FT                   Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop),PS00617 RecF protein signature 1, and PS00618 RecF
FT                   protein signature 2. Belongs to the RecF family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0003"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42725"
FT                   /db_xref="GOA:P9WHI9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHI9"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00617"
FT                   /inference="protein motif:PROSITE:PS00618"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42725.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDIDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
FT   gene            4434..4997
FT                   /locus_tag="Rv0004"
FT   CDS_pept        4434..4997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0004"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0004, (MTCY10H4.02), len: 187 aa. Conserved
FT                   hypothetical protein (see Salazar et al., 1996). Belongs to
FT                   superfamily DUF721; this family contains several
FT                   actinomycete proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0004"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42726"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFL1"
FT                   /protein_id="CCP42726.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
FT   gene            5240..7267
FT                   /gene="gyrB"
FT                   /locus_tag="Rv0005"
FT   CDS_pept        5240..7267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Rv0005"
FT                   /product="DNA gyrase (subunit B) GyrB (DNA topoisomerase
FT                   (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA
FT                   topoisomerase)"
FT                   /note="Rv0005, (MTCY10H4.03), len: 675 aa. GyrB, DNA gyrase
FT                   subunit B (see citations below). Contains PS00177 DNA
FT                   topoisomerase II signature. Belongs to the type II
FT                   topoisomerase family. Start changed since first submission
FT                   (-39 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0005"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42727"
FT                   /db_xref="GOA:P9WG45"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:2ZJT"
FT                   /db_xref="PDB:3IG0"
FT                   /db_xref="PDB:3M4I"
FT                   /db_xref="PDB:3ZKB"
FT                   /db_xref="PDB:3ZKD"
FT                   /db_xref="PDB:3ZM7"
FT                   /db_xref="PDB:5BS8"
FT                   /db_xref="PDB:5BTA"
FT                   /db_xref="PDB:5BTC"
FT                   /db_xref="PDB:5BTD"
FT                   /db_xref="PDB:5BTF"
FT                   /db_xref="PDB:5BTG"
FT                   /db_xref="PDB:5BTI"
FT                   /db_xref="PDB:5BTL"
FT                   /db_xref="PDB:5BTN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG45"
FT                   /inference="protein motif:PROSITE:PS00177"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42727.1"
FT                   /translation="MAAQKKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   IWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVMTQLH
FT                   AGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAP
FT                   TKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEV
FT                   VSDVAEAPKSASERAAESTAPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGK
FT                   GTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEAN
FT                   PTDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRS
FT                   DPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   VTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV"
FT   gene            7302..9818
FT                   /gene="gyrA"
FT                   /locus_tag="Rv0006"
FT   CDS_pept        7302..9818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Rv0006"
FT                   /product="DNA gyrase (subunit A) GyrA (DNA topoisomerase
FT                   (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA
FT                   topoisomerase)"
FT                   /note="Rv0006, (MTCY10H4.04), len: 838 aa. GyrA, DNA gyrase
FT                   subunit A (see citations below). Contains PS00018 EF-hand
FT                   calcium-binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0006"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42728"
FT                   /db_xref="GOA:P9WG47"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="PDB:3IFZ"
FT                   /db_xref="PDB:3ILW"
FT                   /db_xref="PDB:3UC1"
FT                   /db_xref="PDB:4G3N"
FT                   /db_xref="PDB:5BS8"
FT                   /db_xref="PDB:5BTA"
FT                   /db_xref="PDB:5BTC"
FT                   /db_xref="PDB:5BTD"
FT                   /db_xref="PDB:5BTF"
FT                   /db_xref="PDB:5BTG"
FT                   /db_xref="PDB:5BTI"
FT                   /db_xref="PDB:5BTL"
FT                   /db_xref="PDB:5BTN"
FT                   /db_xref="PDB:6GAU"
FT                   /db_xref="PDB:6GAV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG47"
FT                   /inference="protein motif:PROSITE:PS00018"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42728.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIEQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDSLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSAGDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
FT   gene            9914..10828
FT                   /locus_tag="Rv0007"
FT   CDS_pept        9914..10828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0007"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Rv0007, (MTCY10H4.05), len: 304 aa. Possible
FT                   conserved membrane protein. A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0007"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42729"
FT                   /db_xref="GOA:P9WMA7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA7"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42729.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
FT   gene            10887..10960
FT                   /gene="ileT"
FT   tRNA            10887..10960
FT                   /gene="ileT"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:10921..10923,aa:Ile,seq:gat)"
FT                   /note="codon recognized: AUC; ileT, tRNA-Ile, anticodon
FT                   gat, length = 74"
FT   gene            11112..11184
FT                   /gene="alaT"
FT   tRNA            11112..11184
FT                   /gene="alaT"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:11145..11147,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA; alaT, tRNA-Ala, anticodon
FT                   tgc, length = 73"
FT   gene            complement(11874..12311)
FT                   /locus_tag="Rv0008c"
FT   CDS_pept        complement(11874..12311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0008c"
FT                   /product="Possible membrane protein"
FT                   /note="Rv0008c, (MTCY10H4.07c), len: 145 aa. Possible
FT                   membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0008c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42730"
FT                   /db_xref="GOA:P9WJF3"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJF3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42730.1"
FT                   /translation="MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSA
FT                   RSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLW
FT                   IFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRS"
FT   gene            12468..13016
FT                   /gene="ppiA"
FT                   /gene_synonym="cfp22"
FT                   /locus_tag="Rv0009"
FT   CDS_pept        12468..13016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /gene_synonym="cfp22"
FT                   /locus_tag="Rv0009"
FT                   /product="Probable iron-regulated peptidyl-prolyl cis-trans
FT                   isomerase A PpiA (PPIase A) (rotamase A)"
FT                   /note="Rv0009, (MTCY10H4.08), len: 182 aa. Probable ppiA
FT                   (alternate gene name: cfp22), iron-regulated
FT                   peptidyl-prolyl cis-trans isomerase A. Belongs to the
FT                   cyclophilin-type PPIase family. Alternative start codon has
FT                   been suggested."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0009"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42731"
FT                   /db_xref="GOA:P9WHW3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:1W74"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHW3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42731.1"
FT                   /translation="MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGL
FT                   AQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTA
FT                   TDGNDRPTDPVVIESITIS"
FT   gene            complement(13133..13558)
FT                   /locus_tag="Rv0010c"
FT   CDS_pept        complement(13133..13558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0010c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0010c, (MTCY10H4.10c), len: 141 aa. Probable
FT                   conserved membrane protein. Belongs to superfamily
FT                   DUF2581,conserved in the Actinomycetales. A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0010c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42732"
FT                   /db_xref="GOA:P9WMA3"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42732.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR"
FT   gene            complement(13714..13995)
FT                   /locus_tag="Rv0011c"
FT   CDS_pept        complement(13714..13995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0011c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0011c, (MTCY10H4.11c), len: 93 aa. Probable
FT                   conserved transmembrane protein. Belongs to uncharacterized
FT                   protein family UPF0233. A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0011c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42733"
FT                   /db_xref="GOA:P9WP57"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="PDB:2MMU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP57"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42733.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   gene            14089..14877
FT                   /locus_tag="Rv0012"
FT   CDS_pept        14089..14877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0012"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0012, (MTCY10H4.12), len: 262 aa. Probable
FT                   conserved membrane protein. Belongs to superfamily DUF881.
FT                   Contains probable N-terminal signal sequence."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0012"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42734"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:L0T243"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42734.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   KLAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYCEEVHPDLQIVGYADPVRMHFAQPAGPLDY"
FT   gene            14914..15612
FT                   /gene="trpG"
FT                   /gene_synonym="pabA"
FT                   /locus_tag="Rv0013"
FT   CDS_pept        14914..15612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /gene_synonym="pabA"
FT                   /locus_tag="Rv0013"
FT                   /product="Possible anthranilate synthase component II TrpG
FT                   (glutamine amidotransferase)"
FT                   /note="Rv0013, (MTCY10H4.13), len: 232 aa. Possible
FT                   trpG,anthranilate synthase component II (glutamine
FT                   amidotransferase). Contains PS00606 Beta-ketoacyl synthases
FT                   active site; and PS00442 Glutamine amidotransferases
FT                   class-I active site. Similarity to other type-1 glutamine
FT                   amidotransferase domains. Note that previously known as
FT                   pabA."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0013"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42735"
FT                   /db_xref="GOA:P9WN35"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WN35"
FT                   /inference="protein motif:PROSITE:PS00606"
FT                   /inference="protein motif:PROSITE:PS00442"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42735.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAG
FT                   QFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTG
FT                   LPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTAS
FT                   AGEATGRTSA"
FT   gene            complement(15590..17470)
FT                   /gene="pknB"
FT                   /locus_tag="Rv0014c"
FT   CDS_pept        complement(15590..17470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="Rv0014c"
FT                   /product="Transmembrane serine/threonine-protein kinase B
FT                   PknB (protein kinase B) (STPK B)"
FT                   /note="Rv0014c, (MTCY10H4.14c), len: 626 aa.
FT                   PknB,transmembrane serine/threonine-protein kinase (see
FT                   citations below). Contains PS00107 Protein kinases
FT                   ATP-binding region signature, and PS00108 Serine/Threonine
FT                   protein kinases active-site signature. Contains Hank's
FT                   kinase subdomain. Belongs to the Ser/Thr family of protein
FT                   kinases. Experimental studies show evidence of
FT                   auto-phosphorylation on serine/threonine residues. PknB has
FT                   been shown to be a substrate for PstP and its kinase
FT                   activity is affected by PstP-mediated dephosphorylation.
FT                   PknB and PstP (Rv0018c) may act as a functional pair in
FT                   vivo to control mycobacterial cell growth."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0014c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42736"
FT                   /db_xref="GOA:P9WI81"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:1MRU"
FT                   /db_xref="PDB:1O6Y"
FT                   /db_xref="PDB:2FUM"
FT                   /db_xref="PDB:2KUD"
FT                   /db_xref="PDB:2KUE"
FT                   /db_xref="PDB:2KUF"
FT                   /db_xref="PDB:2KUI"
FT                   /db_xref="PDB:3F61"
FT                   /db_xref="PDB:3F69"
FT                   /db_xref="PDB:3ORI"
FT                   /db_xref="PDB:3ORO"
FT                   /db_xref="PDB:5E0Y"
FT                   /db_xref="PDB:5E0Z"
FT                   /db_xref="PDB:5E10"
FT                   /db_xref="PDB:5E12"
FT                   /db_xref="PDB:5U94"
FT                   /db_xref="PDB:6B2P"
FT                   /db_xref="PDB:6I2P"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI81"
FT                   /inference="protein motif:PROSITE:PS00108"
FT                   /inference="protein motif:PROSITE:PS00107"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42736.1"
FT                   /translation="MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPV
FT                   SVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEP
FT                   PEAPKVLTDAERTSLLSSAAGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLA
FT                   VLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHV
FT                   IGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSP
FT                   STPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGF
FT                   TKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEP
FT                   RLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ"
FT   gene            complement(17467..18762)
FT                   /gene="pknA"
FT                   /locus_tag="Rv0015c"
FT   CDS_pept        complement(17467..18762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="Rv0015c"
FT                   /product="Transmembrane serine/threonine-protein kinase A
FT                   PknA (protein kinase A) (STPK A)"
FT                   /note="Rv0015c, (MTCY10H4.15c), len: 431 aa.
FT                   PknA,transmembrane serine/threonine-protein
FT                   kinase,magnesium/manganese dependent (see citations below).
FT                   Contains PS00108 Serine/Threonine protein kinases
FT                   active-site signature. Contains Hank's kinase subdomain.
FT                   Belongs to the Ser/Thr family of protein kinases. It has
FT                   been shown that sodium orthovanadate inhibits the activity
FT                   of the enzyme in vitro."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0015c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42737"
FT                   /db_xref="GOA:P9WI83"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:4OW8"
FT                   /db_xref="PDB:4X3F"
FT                   /db_xref="PDB:6B2Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI83"
FT                   /inference="protein motif:PROSITE:PS00108"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42737.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLK
FT                   SEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGA
FT                   LTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPP
FT                   RPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRAL
FT                   LWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWT
FT                   ERGETRHSGLQSWVVPPTPHSRASLARYEIAQ"
FT   gene            complement(18759..20234)
FT                   /gene="pbpA"
FT                   /locus_tag="Rv0016c"
FT   CDS_pept        complement(18759..20234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="Rv0016c"
FT                   /product="Probable penicillin-binding protein PbpA"
FT                   /note="Rv0016c, (MTCY10H4.16c), len: 491 aa. Probable
FT                   pbpA,penicillin-binding protein, similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0016c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42738"
FT                   /db_xref="GOA:P9WKD1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:3LO7"
FT                   /db_xref="PDB:3UN7"
FT                   /db_xref="PDB:3UPN"
FT                   /db_xref="PDB:3UPO"
FT                   /db_xref="PDB:3UPP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKD1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42738.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAE
FT                   DPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGS
FT                   TFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKS
FT                   CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQK
FT                   DVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKL
FT                   TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
FT   gene            complement(20231..21640)
FT                   /gene="rodA"
FT                   /gene_synonym="ftsW"
FT                   /locus_tag="Rv0017c"
FT   CDS_pept        complement(20231..21640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /gene_synonym="ftsW"
FT                   /locus_tag="Rv0017c"
FT                   /product="Probable cell division protein RodA"
FT                   /note="Rv0017c, (MTCY10H4.17c), len: 469 aa. Probable rodA
FT                   (alternate gene name: ftsW), cell division protein,integral
FT                   membrane protein. Belongs to the FTSW/RODA/SPOVE family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0017c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42739"
FT                   /db_xref="GOA:P9WN99"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WN99"
FT                   /protein_id="CCP42739.1"
FT                   /translation="MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQD
FT                   QGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPLLLPVVALLNGLGLVMIHRLDLVDN
FT                   EIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPALLP
FT                   AALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPR
FT                   PRDLAPLLAAWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGT
FT                   LVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQL
FT                   FIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPI
FT                   TAAGTEVIERV"
FT   gene            complement(21637..23181)
FT                   /gene="pstP"
FT                   /locus_tag="Rv0018c"
FT   CDS_pept        complement(21637..23181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstP"
FT                   /locus_tag="Rv0018c"
FT                   /product="Phosphoserine/threonine phosphatase PstP"
FT                   /note="Rv0018c, (MTCY10H4.18c), len: 514 aa.
FT                   PstP,phosphoserine/threonine phosphatase. Experimental
FT                   studies have shown that PstP specifically dephosporylates
FT                   model phospho-Ser/Thr substrates and it is likely that PknB
FT                   (Rv0014c) and PstP may act as a functional pair in vivo to
FT                   control mycobacterial cell growth (See Boitel et
FT                   al.,2003)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0018c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42740"
FT                   /db_xref="GOA:P9WHW5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:1TXO"
FT                   /db_xref="PDB:2CM1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHW5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42740.1"
FT                   /translation="MARVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAA
FT                   GEVASQLVIAALAHLDDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAI
FT                   LFAGNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIM
FT                   RALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELA
FT                   LRGGGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIV
FT                   KRVPPQADTFSRPRWSGRRLAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMR
FT                   GIQGSLLGMSLHQPYLMGCLSPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAG
FT                   LPAGTLDDAIGQLRELAANSLLPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPASPSP
FT                   TTSAPAPTGTTPAIPTSASPAAPASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA"
FT   repeat_region   complement(23173..23273)
FT                   /note="101 bp Mycobacterial Interspersed Repetitive
FT                   Unit,Class I. See Supply et al. (1997) Molecular
FT                   Microbiology 26, 991-1003"
FT   gene            complement(23270..23737)
FT                   /gene="fhaB"
FT                   /locus_tag="Rv0019c"
FT   CDS_pept        complement(23270..23737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaB"
FT                   /locus_tag="Rv0019c"
FT                   /product="Conserved protein with FHA domain, FhaB"
FT                   /note="Rv0019c, (MTCY10H4.19c), len: 155 aa. FhaB,conserved
FT                   protein with forkhead-associated domain (IPR000253),
FT                   probably involved in signal transduction."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0019c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42741"
FT                   /db_xref="GOA:P9WJB5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJB5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42741.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
FT   gene            complement(23861..25444)
FT                   /gene="fhaA"
FT                   /gene_synonym="TB39.8"
FT                   /locus_tag="Rv0020c"
FT   CDS_pept        complement(23861..25444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaA"
FT                   /gene_synonym="TB39.8"
FT                   /locus_tag="Rv0020c"
FT                   /product="Conserved protein with FHA domain, FhaA"
FT                   /note="Rv0020c, (MTCY10H4.20c), len: 527 aa. FhaA,
FT                   TB39.8,conserved protein with forkhead-associated domain
FT                   (IPR000253) at C-terminus, may be involved in signal
FT                   transduction. Alternative start codon in position 24979 has
FT                   been suggested (see citation below). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0020c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42742"
FT                   /db_xref="GOA:P71590"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="PDB:2LC0"
FT                   /db_xref="PDB:2LC1"
FT                   /db_xref="PDB:3OUN"
FT                   /db_xref="PDB:3PO8"
FT                   /db_xref="PDB:3POA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P71590"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42742.1"
FT                   /translation="MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAA
FT                   DGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDV
FT                   VVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYR
FT                   GGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPD
FT                   QGDYPEQIGYPDQGGYPEQRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPV
FT                   SPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPG
FT                   PPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPA
FT                   GRDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIG
FT                   RGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRL
FT                   GHSEIIVRMH"
FT   gene            25644..25726
FT                   /gene="leuT"
FT   tRNA            25644..25726
FT                   /gene="leuT"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:25677..25679,aa:Leu,seq:cag)"
FT                   /note="codon recognized: CUG; leuT, tRNA-Leu, anticodon
FT                   cag, length = 83"
FT   gene            complement(25913..26881)
FT                   /locus_tag="Rv0021c"
FT   CDS_pept        complement(25913..26881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0021c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0021c, (MTCY10H4.21c), len: 322 aa. Conserved
FT                   hypothetical protein, similar to various proteins."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0021c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42743"
FT                   /db_xref="GOA:P71591"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:P71591"
FT                   /protein_id="CCP42743.1"
FT                   /translation="MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGG
FT                   GYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFAD
FT                   AIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVT
FT                   ARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGD
FT                   DMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDY
FT                   SIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
FT   gene            complement(27023..27442)
FT                   /gene="whiB5"
FT                   /gene_synonym="whmG"
FT                   /locus_tag="Rv0022c"
FT   CDS_pept        complement(27023..27442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB5"
FT                   /gene_synonym="whmG"
FT                   /locus_tag="Rv0022c"
FT                   /product="Probable transcriptional regulatory protein
FT                   WhiB-like WhiB5"
FT                   /note="Rv0022c, (MTCY10H4.22c), len: 139 aa. Probable whiB5
FT                   (alternate gene name: whmG), WhiB-like regulatory protein
FT                   (see citations below), similar to WhiB paralogue of
FT                   Streptomyces coelicolor, wblE gene product (85 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0022c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42744"
FT                   /db_xref="GOA:P71592"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P71592"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42744.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
FT   gene            27595..28365
FT                   /locus_tag="Rv0023"
FT   CDS_pept        27595..28365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0023"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0023, (MTCY10H4.23), len: 256 aa. Possible
FT                   transcriptional regulator. Contains probable helix-turn
FT                   helix motif from aa 19 to 40 (Score 1615, +4.69 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0023"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42745"
FT                   /db_xref="GOA:P9WMI3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMI3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42745.1"
FT                   /translation="MSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKP
FT                   HKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSD
FT                   TDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAG
FT                   ADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMW
FT                   DIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ"
FT   gene            28362..29207
FT                   /locus_tag="Rv0024"
FT   CDS_pept        28362..29207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0024"
FT                   /product="Putative secreted protein P60-related protein"
FT                   /note="Rv0024, (MTCY10H4.24), len: 281 aa. Putative
FT                   secreted protein, p60 homologue, similar to many. Similar
FT                   to Mycobacterium tuberculosis proteins Rv1477,
FT                   Rv1478,Rv1566c, Rv2190c. Could belong to the E. coli NLPC /
FT                   listeria P60 family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0024"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42746"
FT                   /db_xref="GOA:P71594"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:P71594"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42746.1"
FT                   /translation="MNYSEVELLSRAHQLFAGDSRRPGLDAGTTPYGDLLSRAADLNVG
FT                   AGQRRYQLAVDHSRAALLSAARTDAAAGAVITGAQRDRAWARRSTGTVLDEARSDTTVT
FT                   AVMPIAQREAIRRRVARLRAQRAHVLTARRRARRHLAALRALRYRVAHGPGVALAKLRL
FT                   PSPSGRAGIAVHAALSRLGRPYVWGATGPNQFDCSGLVQWAYAQAGVHLDRTTYQQINE
FT                   GIPVPRSQVRPGDLVFPHPGHVQLAIGNNLVVEAPHAGASVRVSSLGNNVQIRRPLSGR
FT                   "
FT   gene            29245..29607
FT                   /locus_tag="Rv0025"
FT   CDS_pept        29245..29607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0025"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0025, (MTCY10H4.25), len: 120 aa. Conserved
FT                   hypothetical protein, showing some similarity to other
FT                   proteins from Mycobacterium tuberculosis e.g. Rv0739 (268
FT                   aa), FASTA score: (37.6% identity in 101 aa overlap), and
FT                   Rv0026 FASTA score: (35.4% identity in 113 aa overlap);
FT                   etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0025"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42747"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42747.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
FT   gene            29722..31068
FT                   /locus_tag="Rv0026"
FT   CDS_pept        29722..31068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0026"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0026, (MTCY10H4.26), len: 448 aa. Conserved
FT                   hypothetical protein, showing some similarity to other
FT                   proteins from Mycobacterium tuberculosis: Rv0025 FASTA
FT                   score: (35.4% identity in 113 aa overlap) and Rv0739 (268
FT                   aa), FASTA score: (32.4% identity in 142 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0026"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42748"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMB1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42748.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHQNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSTPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTATPLPLALAKLFWTARFNTSQPCEGQTF"
FT   gene            31189..31506
FT                   /locus_tag="Rv0027"
FT   CDS_pept        31189..31506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0027"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0027, (MTCY10H4.27), len: 105 aa. Conserved
FT                   hypothetical unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0027"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42749"
FT                   /db_xref="GOA:P9WM99"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM99"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42749.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
FT   gene            31514..31819
FT                   /locus_tag="Rv0028"
FT   CDS_pept        31514..31819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0028"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0028, (MTCY10H4.28), len: 101 aa. Conserved
FT                   hypothetical unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0028"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42750"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM97"
FT                   /protein_id="CCP42750.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
FT   gene            32057..33154
FT                   /locus_tag="Rv0029"
FT   CDS_pept        32057..33154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0029"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0029, (MTCY10H4.29), len: 365 aa. Conserved
FT                   hypothetical protein, showing some similarity to other
FT                   proteins from Mycobacterium tuberculosis e.g. C-terminal
FT                   region of Rv2082; Rv3899c."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0029"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42751"
FT                   /db_xref="GOA:P71599"
FT                   /db_xref="InterPro:IPR040604"
FT                   /db_xref="InterPro:IPR040833"
FT                   /db_xref="UniProtKB/TrEMBL:P71599"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42751.1"
FT                   /translation="MAIFGRWSARQRLRRATRESLTIPTFSSSLDCTTRVIGGLWPAEL
FT                   SSNTAETATLAEHLKADLHRIVGSANDELMVIWRAGMADSTRRAEEDRVIDRARASAMR
FT                   RVESAMRELRQITGRVPVEIPRMRGAGGSDLDTTRLMPAVTVVQPADQACTDWPVAAAE
FT                   DDEARLQRLLAFVARQEPRLNWAVGVHADGTTVLVTDVAHGWIPPGIALPEGVRLLAPA
FT                   RRAGRAPELVGITTCCKTYTPGDSLRRAVDSTAPTSSVQPRALPAIAGLSVELGIATQR
FT                   HDGLPKIVHAMATAAGNGAAAEEVDLLRVHVDTALHHVLAQYPRVDPALLLNCMLLAAT
FT                   ERSVTGDPIAANYHFAWFRELDSRR"
FT   gene            33224..33553
FT                   /locus_tag="Rv0030"
FT   CDS_pept        33224..33553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0030"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0030, (MTCY10H4.30), len: 109 aa. Conserved
FT                   hypothetical unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0030"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42752"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM95"
FT                   /protein_id="CCP42752.1"
FT                   /translation="MVSGSDSRSEPSQLSDRDLVESVLRDLSEAADKWEALVTQAETVT
FT                   YSVDLGDVRAVANSDGRLLELTLHPGVMTGYAHGELADRVNLAITALRDEVEAENRARY
FT                   GGRLQ"
FT   gene            33582..33794
FT                   /locus_tag="Rv0031"
FT   CDS_pept        33582..33794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0031"
FT                   /product="Possible remnant of a transposase"
FT                   /note="Rv0031, (MTCY10H4.31), len: 70 aa. Possible remnant
FT                   of a transposase, showing partial similarity to
FT                   mycobacterial transposases in a short overlap, e.g.
FT                   Rv2791c|MTV002_57 (459 aa), FASTA score: (72.2% identity in
FT                   36 aa overlap); Rv2885c, Rv2978c, Rv3827c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0031"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42753"
FT                   /db_xref="UniProtKB/TrEMBL:P71601"
FT                   /protein_id="CCP42753.1"
FT                   /translation="MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFA
FT                   RIGHTSHPSTRKSRVGPGASEAPLA"
FT   gene            34295..36610
FT                   /gene="bioF2"
FT                   /locus_tag="Rv0032"
FT   CDS_pept        34295..36610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF2"
FT                   /locus_tag="Rv0032"
FT                   /product="Possible 8-amino-7-oxononanoate synthase BioF2
FT                   (AONS) (8-amino-7-ketopelargonate synthase)
FT                   (7-keto-8-amino-pelargonic acid synthetase) (7-KAP
FT                   synthetase) (L-alanine--pimelyl CoA ligase)"
FT                   /note="Rv0032, (MTCY10H4.32), len: 771 aa. Probable
FT                   bioF2,8-amino-7-oxononanoate synthase, with its C-terminal
FT                   similar to others. Contains PS00599 Aminotransferases
FT                   class-II pyridoxal-phosphate attachment site. Belongs to
FT                   class-II of pyridoxal-phosphate-dependent
FT                   aminotransferases."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0032"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42754"
FT                   /db_xref="GOA:P9WQ85"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ85"
FT                   /inference="protein motif:PROSITE:PS00599"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42754.1"
FT                   /translation="MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVC
FT                   FDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLA
FT                   GQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEAL
FT                   GCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNP
FT                   EFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLY
FT                   RAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARM
FT                   MMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFY
FT                   PRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNG
FT                   TLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAA
FT                   RLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGC
FT                   RVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIR
FT                   HNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHG
FT                   TAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRA
FT                   LHVFAGLAEDLTPQGAAL"
FT   gene            36607..36870
FT                   /gene="acpA"
FT                   /gene_synonym="acpP"
FT                   /locus_tag="Rv0033"
FT   CDS_pept        36607..36870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /gene_synonym="acpP"
FT                   /locus_tag="Rv0033"
FT                   /product="Probable acyl carrier protein AcpA (ACP)"
FT                   /note="Rv0033, (MTCY10H4.33), len: 87 aa. Probable acpA
FT                   (alternate gene name: acpP), acyl carrier protein, similar
FT                   to others. Also similar to proteins of Mycobacterium
FT                   tuberculosis Rv1344 and Rv2244 (31.5% identity in 73 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0033"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42755"
FT                   /db_xref="GOA:I6WX95"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:I6WX95"
FT                   /protein_id="CCP42755.1"
FT                   /translation="MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELED
FT                   EFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA"
FT   gene            36867..37262
FT                   /locus_tag="Rv0034"
FT   CDS_pept        36867..37262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0034"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0034, (MTCY10H4.34), len: 131 aa. Conserved
FT                   hypothetical protein, showing weak similarity to
FT                   AE001980|AE001980_7 hypothetical protein from Deinococcus
FT                   radiodurans (120 aa), FASTA scores: opt: 141, E():
FT                   0.0028,(29.3% identity in 123 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0034"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42756"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM93"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42756.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
FT   gene            37259..38947
FT                   /gene="fadD34"
FT                   /locus_tag="Rv0035"
FT   CDS_pept        37259..38947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD34"
FT                   /locus_tag="Rv0035"
FT                   /product="Probable fatty-acid-CoA ligase FadD34
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0035, (MTCY10H4.35), len: 562 aa. Probable
FT                   fadD34,fatty-acid-CoA synthetase, similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0035"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42757"
FT                   /db_xref="GOA:L7N699"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:L7N699"
FT                   /protein_id="CCP42757.1"
FT                   /translation="MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAAC
FT                   IPPLRRLDLKRGEPVLITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLG
FT                   PLLRHHRVLICTPAEHDEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADW
FT                   PLCTLDDDAYVQYTSGSTAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHD
FT                   MGLVGSLFAALFNSVSAVFTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYH
FT                   RRGADIEGIDLHKMRRLIIASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAV
FT                   SMSAPNTGFRTETHAAAEVVTGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGG
FT                   KKLDALDEEGFCDTHDLGFLVDDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHR
FT                   TKVACFGVNERVVVVLESPLDSIIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTT
FT                   SGKLKRRAVAQAYRDGTLPRLATHAWTADPDSAPKTTRSSLEGAH"
FT   gene            complement(39056..39829)
FT                   /locus_tag="Rv0036c"
FT   CDS_pept        complement(39056..39829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0036c"
FT                   /product="Conserved protein"
FT                   /note="Rv0036c, (MTCY10H4.36c), len: 257 aa. Conserved
FT                   protein, highly similar to CAB95889.1|AL359988 conserved
FT                   hypothetical protein from Streptomyces (276 aa). Also some
FT                   similarity to Rv3099c|MTCY164_10 (283 aa), FASTA scores:
FT                   E(): 3.3e-05, (25.9% identity in 205 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0036c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42758"
FT                   /db_xref="GOA:P9WM91"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM91"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42758.1"
FT                   /translation="MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQI
FT                   GHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRG
FT                   RLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSI
FT                   AHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVT
FT                   QRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR"
FT   gene            complement(39877..41202)
FT                   /locus_tag="Rv0037c"
FT   CDS_pept        complement(39877..41202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0037c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0037c, (MTCY10H4.37c), len: 441 aa. Probable
FT                   conserved integral membrane protein, member of major
FT                   facilitator superfamily (MFS) possibly involved in
FT                   transport of macrolide."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0037c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42759"
FT                   /db_xref="GOA:P9WJY1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJY1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42759.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLGANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
FT   gene            41304..41912
FT                   /locus_tag="Rv0038"
FT   CDS_pept        41304..41912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0038"
FT                   /product="Conserved protein"
FT                   /note="Rv0038, (MTCY10H4.38), len: 202 aa. Conserved
FT                   protein, similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0038"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42760"
FT                   /db_xref="GOA:P9WFK5"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFK5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42760.1"
FT                   /translation="MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVE
FT                   HNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADP
FT                   EGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLS
FT                   ALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN"
FT   gene            complement(42004..42351)
FT                   /locus_tag="Rv0039c"
FT   CDS_pept        complement(42004..42351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0039c"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Rv0039c, (MTCY21D4.02c, MTCY10H4.39c), len: 115 aa.
FT                   Possible conserved transmembrane protein. A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0039c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42761"
FT                   /db_xref="GOA:P9WM89"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM89"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42761.1"
FT                   /translation="MFLAGVLCMCAAAASALFGSWSLCHTPTADPTALALRAMAPTQLA
FT                   AAVMLAAGGVVAVAAPGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCV
FT                   GSCAVCTQACH"
FT   gene            complement(42433..43365)
FT                   /gene="mtc28"
FT                   /locus_tag="Rv0040c"
FT   CDS_pept        complement(42433..43365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtc28"
FT                   /locus_tag="Rv0040c"
FT                   /product="Secreted proline rich protein Mtc28 (proline rich
FT                   28 kDa antigen)"
FT                   /note="Rv0040c, (MTCY21D4.03c), len: 310 aa. Mtc28,secreted
FT                   proline rich 28 kDa antigen protein (has hydrophobic
FT                   stretch at N-terminus) (see citation below). A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0040c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42762"
FT                   /db_xref="GOA:P9WIM9"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="PDB:4OL4"
FT                   /db_xref="PDB:4PWS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIM9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42762.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
FT   gene            43562..46471
FT                   /gene="leuS"
FT                   /locus_tag="Rv0041"
FT   CDS_pept        43562..46471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Rv0041"
FT                   /product="Probable leucyl-tRNA synthetase LeuS
FT                   (leucine--tRNA ligase) (LEURS)"
FT                   /note="Rv0041, (MTCY21D4.04), len: 969 aa. Probable
FT                   leucyl-tRNA synthetase, similar to many. Contains PS00178
FT                   Aminoacyl-transfer RNA synthetases class-I signature.
FT                   Belongs to class-I aminoacyl-tRNA synthetase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0041"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42763"
FT                   /db_xref="GOA:P9WFV1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="PDB:5AGR"
FT                   /db_xref="PDB:5AGS"
FT                   /db_xref="PDB:5AGT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFV1"
FT                   /inference="protein motif:PROSITE:PS00178"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42763.1"
FT                   /translation="MTESPTAGPGGVPRADDADSDVPRYRYTAELAARLERTWQENWAR
FT                   LGTFNVPNPVGSLAPPDGAAVPDDKLFVQDMFPYPSGEGLHVGHPLGYIATDVYARYFR
FT                   MVGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEANVVNFRRQLGRLGFGHDSRRSFS
FT                   TTDVDFYRWTQWIFLQIYNAWFDTTANKARPISELVAEFESGARCLDGGRDWAKLTAGE
FT                   RADVIDEYRLVYRADSLVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWMMRIT
FT                   AYADRLLDDLDVLDWPEQVKTMQRNWIGRSTGAVALFSARAASDDGFEVDIEVFTTRPD
FT                   TLFGATYLVLAPEHDLVDELVAASWPAGVNPLWTYGGGTPGEAIAAYRRAIAAKSDLER
FT                   QESREKTGVFLGSYAINPANGEPVPIFIADYVLAGYGTGAIMAVPGHDQRDWDFARAFG
FT                   LPIVEVIAGGNISESAYTGDGILVNSDYLNGMSVPAAKRAIVDRLESAGRGRARIEFKL
FT                   RDWLFARQRYWGEPFPIVYDSDGRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSP
FT                   PLAKATEWVHVDLDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNSERFCAKENEAY
FT                   WMGPRPAEHGPDDPGGVDLYVGGAEHAVLHLLYSRFWHKVLYDLGHVSSREPYRRLVNQ
FT                   GYIQAYAYTDARGSYVPAEQVIERGDRFVYPGPDGEVEVFQEFGKIGKSLKNSVSPDEI
FT                   CDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFLQRVWRLVVDEHTGETRVADGVE
FT                   LDIDTLRALHRTIVGVSEDFAALRNNTATAKLIEYTNHLTKKHRDAVPRAAVEPLVQML
FT                   APLAPHIAEELWLRLGNTTSLAHGPFPKADAAYLVDETVEYPVQVNGKVRGRVVVAADT
FT                   DEETLKAAVLTDEKVQAFLAGATPRKVIVVAGRLVNLVI"
FT   gene            complement(46581..47207)
FT                   /locus_tag="Rv0042c"
FT   CDS_pept        complement(46581..47207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0042c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (probably MarR-family)"
FT                   /note="Rv0042c, (MTCY21D4.05c), len: 208 aa. Possible
FT                   transcriptional regulatory protein, MarR-family. Some
FT                   similarity to Mycobacterium tuberculosis proteins
FT                   Rv2327,Rv0880, and Rv1404."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0042c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42764"
FT                   /db_xref="GOA:P71699"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:P71699"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42764.1"
FT                   /translation="MSVVRSIGKKMQRISGPNALAVKGRPTQVYGHTHVRLDCRFMADS
FT                   EFTAPEVTQLAEGLHRALSKLISMLRRGDPNGAAAGDLTLAQLSILVTLLDQGPIRMTD
FT                   LAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDITPQGRAVHGESLANRRAA
FT                   LAALLSQLPRSDLETLRKALAPLERLASGEPASGPASNSPARKRA"
FT   gene            complement(47366..48100)
FT                   /locus_tag="Rv0043c"
FT   CDS_pept        complement(47366..48100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0043c"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably GntR-family)"
FT                   /note="Rv0043c, (MTCY21D4.06c), len: 244 aa. Probable
FT                   transcriptional regulator, GntR family, similar to others."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0043c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42765"
FT                   /db_xref="GOA:P9WMG9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMG9"
FT                   /protein_id="CCP42765.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
FT   gene            complement(48233..49027)
FT                   /locus_tag="Rv0044c"
FT   CDS_pept        complement(48233..49027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0044c"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0044c, (MTCY21D4.07c), len: 264 aa. Possible
FT                   oxidoreductase, highly similar to AAD32732.1|MmcI|AF127374|
FT                   F420-dependent H4MPT reductase from Streptomyces lavendulae
FT                   (264 aa). Also similar to Mycobacterium tuberculosis
FT                   proteins e.g. Rv1855c, Rv0953c, Rv0791c, Rv0132c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0044c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42766"
FT                   /db_xref="GOA:P71701"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:P71701"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42766.1"
FT                   /translation="MTSLVRPDLPVRIGVQLQPQHAPHYRAVRDAVRRCEDIGVDIAFT
FT                   WDHFFPLYGDPDGPHFECWTVLGAWAEQTSHIEIGALVTCNSYRNPELLADMARTVDHI
FT                   SGGRLILGIGSGWKQKDYDEYGYRFGTAGSRLDDLAAALPRIKARLGKLNPPPTRDIPV
FT                   LIGGGGERKTLRLVAEYADIWHSFTAGDSYLAKSAVLSTHCSTVGRNPATIERSAAVDG
FT                   GGLIASAEALAGLGVTLLTVGCDGPDYDLSAAAALCRWRDGR"
FT   gene            complement(49043..49939)
FT                   /locus_tag="Rv0045c"
FT   CDS_pept        complement(49043..49939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0045c"
FT                   /product="Possible hydrolase"
FT                   /note="Rv0045c, (MTCY21D4.08c), len: 298 aa. Possible
FT                   hydrolase, showing similarity with others. Also similar to
FT                   Mycobacterium tuberculosis proteins Rv3473c,
FT                   Rv1123c,Rv1938, Rv3617, Rv3670, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0045c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42767"
FT                   /db_xref="GOA:I6XU97"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:I6XU97"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42767.1"
FT                   /translation="MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRW
FT                   GGSAPRVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLNSETL
FT                   APVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPSALQRHAELTAEQR
FT                   GTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRGVFHNSRRLDNGNWVWRYDAIRT
FT                   FGDFAGLWDDVDALSAPITLVRGGSSGFVTDQDTAELHRRATHFRGVHIVEKSGHSVQS
FT                   DQPRALIEIVRGVLDTR"
FT   gene            complement(50021..51124)
FT                   /gene="ino1"
FT                   /gene_synonym="tbINO"
FT                   /locus_tag="Rv0046c"
FT   CDS_pept        complement(50021..51124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ino1"
FT                   /gene_synonym="tbINO"
FT                   /locus_tag="Rv0046c"
FT                   /product="myo-inositol-1-phosphate synthase Ino1 (inositol
FT                   1-phosphate synthetase) (D-glucose 6-phosphate
FT                   cycloaldolase) (glucose 6-phosphate cyclase)
FT                   (glucocycloaldolase)"
FT                   /note="Rv0046c, (MTCY21D4.09c), len: 367 aa. Ino1
FT                   (alternate gene name: tbINO), myo-inositol-1-phosphate
FT                   synthase (see citations below)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0046c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42768"
FT                   /db_xref="GOA:P9WKI1"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:1GR0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKI1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42768.1"
FT                   /translation="MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTST
FT                   VPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQ
FT                   RGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPVWAKKFTDARVPIVGDDIKSQVGATITHRVLAKLFEDRGVQL
FT                   DRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLD
FT                   DRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPA
FT                   SAYLMKSPPEQLPDDIARAQLEEFIIG"
FT   gene            complement(51185..51727)
FT                   /locus_tag="Rv0047c"
FT   CDS_pept        complement(51185..51727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0047c"
FT                   /product="Conserved protein"
FT                   /note="Rv0047c, (MTCY21D4.10c), len: 180 aa. Conserved
FT                   protein, similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0047c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42769"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:P71704"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42769.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNPAEQT"
FT   gene            complement(51828..52697)
FT                   /locus_tag="Rv0048c"
FT   CDS_pept        complement(51828..52697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0048c"
FT                   /product="Possible membrane protein"
FT                   /note="Rv0048c, MTCY21D4.11c, len: 289 aa. Possible
FT                   membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0048c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42770"
FT                   /db_xref="GOA:P9WM87"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM87"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42770.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
FT   gene            52831..53244
FT                   /locus_tag="Rv0049"
FT   CDS_pept        52831..53244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0049"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0049, (MTCY21D4.12), len: 137 aa. Conserved
FT                   hypothetical protein. A core mycobacterial gene; conserved
FT                   in mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0049"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42771"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM85"
FT                   /protein_id="CCP42771.1"
FT                   /translation="MDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSRVI
FT                   CPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCRTCSWNHL
FT                   VKSYVLGAARPARPPRGSGGTRTARNGARTASE"
FT   gene            53663..55699
FT                   /gene="ponA1"
FT                   /locus_tag="Rv0050"
FT   CDS_pept        53663..55699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA1"
FT                   /locus_tag="Rv0050"
FT                   /product="Probable bifunctional penicillin-binding protein
FT                   1A/1B PonA1 (murein polymerase) (PBP1):
FT                   penicillin-insensitive transglycosylase (peptidoglycan
FT                   TGASE) + penicillin-sensitive transpeptidase
FT                   (DD-transpeptidase)"
FT                   /note="Rv0050, (MTCY21D4.13), len: 678 aa. Probable
FT                   ponA1,penicillin-binding protein (class A), bienzymatic
FT                   protein with transglycosylase and transpeptidase activities
FT                   (see Graham & Clark-Curtiss 1999), highly similar to many
FT                   (see Billman-Jacobe et al., 1999). Belongs to the
FT                   transglycosylase family in the N-terminal section, and to
FT                   the transpeptidase family in the C-terminal section."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0050"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42772"
FT                   /db_xref="GOA:P71707"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="PDB:5CRF"
FT                   /db_xref="PDB:5CXW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P71707"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42772.1"
FT                   /translation="MVILLPMVTFTMAYLIVDVPKPGDIRTNQVSTILASDGSEIAKIV
FT                   PPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPGFSFTGFARAVKNNLFGGDLQGGST
FT                   ITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMSGEWSKDDVLQAYLNIIYFGRGAYG
FT                   ISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLDPAVDPEGAHARWNWVLDGMVETKA
FT                   LSPNDRAAQVFPETVPPDLARAENQTKGPNGLIERQVTRELLELFNIDEQTLNTQGLVV
FT                   TTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAG
FT                   LQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSL
FT                   NTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTR
FT                   VIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAA
FT                   MEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDE
FT                   PLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPPEVPP
FT                   SETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP"
FT   gene            55696..57378
FT                   /locus_tag="Rv0051"
FT   CDS_pept        55696..57378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0051"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0051, (MTCY21D4.14), len:560 aa. Predicted to be
FT                   in the GT-C superfamily of glycosyltransferases (See Liu
FT                   and Mushegian, 2003). Probable conserved transmembrane
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0051"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42773"
FT                   /db_xref="GOA:P71708"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:P71708"
FT                   /protein_id="CCP42773.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
FT   gene            57410..57973
FT                   /locus_tag="Rv0052"
FT   CDS_pept        57410..57973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0052"
FT                   /product="Conserved protein"
FT                   /note="Rv0052, (MTCY21D4.15), len: 187 aa. Conserved
FT                   protein, similar to others including Rv1930c from
FT                   Mycobacterium tuberculosis (174 aa). May be a membrane
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0052"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42774"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y6S3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42774.1"
FT                   /translation="MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGG
FT                   IGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNS
FT                   LGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPV
FT                   DAGSLAKASPATHRLALEFYQHRL"
FT   gene            58192..58482
FT                   /gene="rpsF"
FT                   /locus_tag="Rv0053"
FT   CDS_pept        58192..58482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="Rv0053"
FT                   /product="30S ribosomal protein S6 RpsF"
FT                   /note="Rv0053, (MTCY21D4.16), len: 96 aa. rpsF, 30S
FT                   ribosomal protein S6, highly similar to many. Contains
FT                   PS01048 Ribosomal protein S6 signature. Belongs to the S6P
FT                   family of ribosomal proteins."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0053"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42775"
FT                   /db_xref="GOA:P9WH31"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH31"
FT                   /inference="protein motif:PROSITE:PS01048"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42775.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
FT   gene            58586..59080
FT                   /gene="ssb"
FT                   /locus_tag="Rv0054"
FT   CDS_pept        58586..59080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="Rv0054"
FT                   /product="Single-strand binding protein Ssb
FT                   (helix-destabilizing protein)"
FT                   /note="Rv0054, (MTCY21D4.17), len: 164 aa.
FT                   ssb,single-strand binding protein (see Mizrahi & Andersen
FT                   1998), highly similar to others. Belongs to the SSB
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0054"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42776"
FT                   /db_xref="GOA:P9WGD5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:1UE1"
FT                   /db_xref="PDB:1UE5"
FT                   /db_xref="PDB:1UE6"
FT                   /db_xref="PDB:1UE7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGD5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42776.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
FT   gene            59122..59376
FT                   /gene="rpsR1"
FT                   /gene_synonym="rpsR"
FT                   /locus_tag="Rv0055"
FT   CDS_pept        59122..59376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR1"
FT                   /gene_synonym="rpsR"
FT                   /locus_tag="Rv0055"
FT                   /product="30S ribosomal protein S18-1 RpsR1"
FT                   /note="Rv0055, (MTCY21D4.18), len: 84 aa. rpsR1, 30S
FT                   ribosomal protein S18-1. Belongs to the S18P family of
FT                   ribosomal proteins. Note that previously known as rpsR."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0055"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42777"
FT                   /db_xref="GOA:P9WH49"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH49"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42777.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
FT   gene            59409..59867
FT                   /gene="rplI"
FT                   /locus_tag="Rv0056"
FT   CDS_pept        59409..59867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="Rv0056"
FT                   /product="50S ribosomal protein L9 RplI"
FT                   /note="Rv0056, (MTCY21D4.19), len: 152 aa. rplI, 50S
FT                   ribosomal protein L9. Contains PS00651 Ribosomal protein L9
FT                   signature. Belongs to the L9P family of ribosomal
FT                   proteins."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0056"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42778"
FT                   /db_xref="GOA:P9WH79"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="PDB:5V7Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH79"
FT                   /inference="protein motif:PROSITE:PS00651"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42778.1"
FT                   /translation="MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAI
FT                   KKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS"
FT   gene            59896..60417
FT                   /locus_tag="Rv0057"
FT   CDS_pept        59896..60417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0057"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0057, (MTCY21D4.20), len: 173 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0057"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42779"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM77"
FT                   /protein_id="CCP42779.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
FT   gene            60396..63020
FT                   /gene="dnaB"
FT                   /locus_tag="Rv0058"
FT   CDS_pept        60396..63020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="Rv0058"
FT                   /product="Probable replicative DNA helicase DnaB"
FT                   /note="Rv0058, (MTV030.01, MTCY21D4.21), len: 874 aa.
FT                   Probable dnaB, replicative DNA helicase. Contains an intein
FT                   (position 61630..62838) similar to, and in the same
FT                   position as, those in Sycnechocystis and Rhodothermus
FT                   marinus (see citation below) and C-terminal extein
FT                   (position 62839..63015) similar to many dnaB proteins. This
FT                   protein undergoes a protein self splicing that involves a
FT                   post-translational excision of the intervening region
FT                   (intein) followed by peptide ligation. Belongs to the
FT                   helicase family, DNAB subfamily. In the intein section;
FT                   belongs to the homing endonuclease family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0058"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42780"
FT                   /db_xref="GOA:P9WMR3"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="PDB:2R5U"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMR3"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42780.1"
FT                   /translation="MAVVDDLAPGMDSSPPSEDYGRQPPQDLAAEQSVLGGMLLSKDAI
FT                   ADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPYLH
FT                   TLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEI
FT                   YDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMV
FT                   IVAARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRS
FT                   GRMSDDDWTRLARRMSEISEAPLFIDDSPNLTMMEIRAKARRLRQKANLKLIVVDYLQL
FT                   MTSGKKYESRQVEVSEFSRHLKLLAKELEVPVVAISQLNRGPEQRTDKKPMLADLRESG
FT                   CLTASTRILRADTGAEVAFGELMRSGERPMVWSLDERLRMVARPMINVFPSGRKEVFRL
FT                   RLASGREVEATGSHPFMKFEGWTPLAQLKVGDRIAAPRRVPEPIDTQRMPESELISLAR
FT                   MIGDGSCLKNQPIRYEPVDEANLAAVTVSAAHSDRAAIRDDYLAARVPSLRPARQRLPR
FT                   GRCTPIAAWLAGLGLFTKRSHEKCVPEAVFRAPNDQVALFLRHLWSAGGSVRWDPTNGQ
FT                   GRVYYGSTSRRLIDDVAQLLLRVGIFSWITHAPKLGGHDSWRLHIHGAKDQVRFLRHVG
FT                   VHGAEAVAAQEMLRQLKGPVRNPNLDSAPKKVWAQVRNRLSAKQMMDIQLHEPTMWKHS
FT                   PSRSRPHRAEARIEDRAIHELARGDAYWDTVVEITSIGDQHVFDGTVSGTHNFVANGIS
FT                   LHNSLEQDADVVILLHRPDAFDRDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFAN
FT                   MAR"
FT   gene            63200..63892
FT                   /locus_tag="Rv0059"
FT   CDS_pept        63200..63892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0059"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0059, (MTV030.02), len: 230 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0059"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42781"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:O53604"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42781.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVPFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
FT   gene            63909..64967
FT                   /locus_tag="Rv0060"
FT   CDS_pept        63909..64967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0060"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0060, (MTV030.03), len: 352 aa. Conserved
FT                   hypothetical protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0060"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42782"
FT                   /db_xref="GOA:O53605"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="PDB:5M3I"
FT                   /db_xref="UniProtKB/TrEMBL:O53605"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42782.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
FT   gene            complement(65012..65350)
FT                   /locus_tag="Rv0061c"
FT   CDS_pept        complement(65012..65350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0061c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0061c, len: 112 aa. Conserved hypothetical protein
FT                   supported by RNA-seq data. Similar to MMAR_3839, 76%
FT                   identity in 112 aa overlap. Replaces questionable ORF
FT                   Rv0061 (MTV030.04)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0061c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42783"
FT                   /db_xref="UniProtKB/TrEMBL:I6X8E6"
FT                   /protein_id="CCP42783.1"
FT                   /translation="MKLKFARLSTAILGCAAALVFPASVASADPPDPHQPDMTKGYCPG
FT                   GRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEPLPGPPPPGGCGGAI
FT                   PSEQPNAP"
FT   gene            65552..66694
FT                   /gene="celA1"
FT                   /gene_synonym="cel6"
FT                   /gene_synonym="celA"
FT                   /locus_tag="Rv0062"
FT   CDS_pept        65552..66694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA1"
FT                   /gene_synonym="cel6"
FT                   /gene_synonym="celA"
FT                   /locus_tag="Rv0062"
FT                   /product="Possible cellulase CelA1 (endoglucanase)
FT                   (endo-1,4-beta-glucanase) (FI-cmcase) (carboxymethyl
FT                   cellulase)"
FT                   /note="Rv0062, (MTV030.05), len: 380 aa. Possible
FT                   celA1,cellulase, similar to many. Seems to belong to
FT                   cellulase family B (family 6 of glycosyl hydrolases). Note
FT                   that previously known as celA."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0062"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42784"
FT                   /db_xref="GOA:Q79G13"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="PDB:1UOZ"
FT                   /db_xref="PDB:1UP0"
FT                   /db_xref="PDB:1UP2"
FT                   /db_xref="PDB:1UP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q79G13"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42784.1"
FT                   /translation="MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMS
FT                   SAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAA
FT                   MVAARNANPPNAELTSVANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYG
FT                   IPHRDCGSYASGGFATGTDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FT                   FDLVRYAVDTLTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTT
FT                   DEEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHA
FT                   DAYLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ"
FT   gene            66923..68362
FT                   /locus_tag="Rv0063"
FT   CDS_pept        66923..68362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0063"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0063, (MTV030.06), len: 479 aa. Possible
FT                   oxidoreductase, similar to many. Similar to Mycobacterium
FT                   tuberculosis proteins e.g. Rv3107c, Rv1257c, etc. Contains
FT                   PS00862 Oxygen oxidoreductases covalent FAD-binding site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0063"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42785"
FT                   /db_xref="GOA:O53608"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:O53608"
FT                   /inference="protein motif:PROSITE:PS00862"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42785.1"
FT                   /translation="MAREISRQTFLRGAAGALAAGAVFGSVRATADPAASGWEALSSAL
FT                   GGKVLQPDDGPQFATAKQVFNTNYNGYTPAVIVTPTSQLDVQKAMAFAAANNLKVAPRG
FT                   GGHSYVGASTANGAMVLDLRQLPGDINYDATTGRVTVTPATGLYAMHQVLAAAGRGIPT
FT                   GTCPTVGVAGHALGGGLGANSRHAGLLCDQLTSASVVLPSGQAVTASATDHPDLFWALR
FT                   GGGGGNFGVTTSLTFATFPSGDLDVVNLNFPPQSFAQVLVGWQNWLRTADRGSWALADA
FT                   TVDPLGTHCRILATCPAGSGGSVAAAIVSAVGTQPTGTENHTFNYLDLVRYLAVGNLNP
FT                   SPLGYVGGSDVFTTITPATAQGIASAVDAFPRGAGRMLAIMHALDGALATVSPGATAFP
FT                   WRRQSALVQWYVETSGSPSEATSWLNTAHQAVRAYSVGGYVNYLEVNQPPARYFGPNLS
FT                   RLSAVRQKYDPSRVMFSGLNF"
FT   gene            68620..71559
FT                   /locus_tag="Rv0064"
FT   CDS_pept        68620..71559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0064"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0064, (MTV030.07), len: 979 aa. Probable conserved
FT                   transmembrane protein, similar to many. Contains probable
FT                   coiled-coil domain from aa 948 to 976."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0064"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42786"
FT                   /db_xref="GOA:P9WFL5"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFL5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42786.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAAALLVLSAILVGGLWPLLMEQFSVRPNAADVERPYIQRNIEATREAYRIGG
FT                   DWVQYRSYPGIGTKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAEILDI
FT                   DRYRIDGELQDYIVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARGA
FT                   ENISDSNSGYPIYAVSDIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAP
FT                   REYDTDTSKYTYTGAGGVSIGNWFNRTVFATKVAQHKFLFSREIGSESKVLIHRDPKER
FT                   VQRVAPWLTTDDNPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEGPVTSPTGIVRQGK
FT                   QVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRY
FT                   PEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNNANATQPPFYVLVGDQQSAQP
FT                   SFRLASAMVGYNREFLSAYISAHSDPANYGKLTVLELPTDTLTQGPQQIQNSMISDTRV
FT                   ASERTLLERSNRIHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVR
FT                   EPRTEGGVRVGYAPTLAESLDQVFGPGTGRVATARGGDAASAPPPGAGGPAPPQAVPPP
FT                   RTTQPPAAPPRGPDVPPATVAELRETLADLRAVLDRLEKAIDAAETPGG"
FT   gene            71589..71828
FT                   /gene="vapB1"
FT                   /locus_tag="Rv0064A"
FT   CDS_pept        71589..71828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB1"
FT                   /locus_tag="Rv0064A"
FT                   /product="Possible antitoxin VapB1"
FT                   /note="Rv0064A, len: 79 aa. Possible vapB1, antitoxin, part
FT                   of toxin-antitoxin (TA) operon with Rv0065 (See Arcus et
FT                   al., 2005; Pandey and Gerdes, 2005). Weakly similar to
FT                   others in Mycobacterium tuberculosis e.g. Rv0300 (73
FT                   aa),Rv1721c (75 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:Rv0064A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42787"
FT                   /db_xref="GOA:P0CW29"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CW29"
FT                   /protein_id="CCP42787.1"
FT                   /translation="MATIQVRDLPEDVAETYRRRATAAGQSLQTYMRTKLIEGVRGRDK
FT                   AEAIEILEQALASTASPGISRETIEASRRELRGG"
FT   gene            71821..72222
FT                   /gene="vapC1"
FT                   /locus_tag="Rv0065"
FT   CDS_pept        71821..72222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC1"
FT                   /locus_tag="Rv0065"
FT                   /product="Possible toxin VapC1"
FT                   /note="Rv0065, (MTV030.08), len: 133 aa. Possible
FT                   vapC1,toxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0064A,contains PIN domain (See Arcus et al., 2005; Pandey
FT                   and Gerdes, 2005). Similar to several others in
FT                   Mycobacterium tuberculosis: Rv0960 (127 aa), Rv1720c (129
FT                   aa), and Rv0549c (137 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0065"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42788"
FT                   /db_xref="GOA:P9WFC1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFC1"
FT                   /protein_id="CCP42788.1"
FT                   /translation="MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVG
FT                   HALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVAL
FT                   ATALDVPLLTGDSRLAAAPGLPCEIKLVR"
FT   gene            complement(72274..74511)
FT                   /gene="icd2"
FT                   /locus_tag="Rv0066c"
FT   CDS_pept        complement(72274..74511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd2"
FT                   /locus_tag="Rv0066c"
FT                   /product="Probable isocitrate dehydrogenase [NADP] Icd2
FT                   (oxalosuccinate decarboxylase) (IDH) (NADP+-specific ICDH)
FT                   (IDP)"
FT                   /note="Rv0066c, (MTV030.09c), len: 745 aa. Probable
FT                   icd2,isocitrate dehydrogenase NADP-dependent. Belongs to
FT                   the monomeric-type family of IDH. Note that in H37Rv,
FT                   Rv0066c is named icd2 and Rv3339c is icd1 while in CDC1551
FT                   and Erdman strains, Rv0066c is icd1 and Rv3339c is icd2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0066c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42789"
FT                   /db_xref="GOA:O53611"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="PDB:5KVU"
FT                   /db_xref="UniProtKB/TrEMBL:O53611"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42789.1"
FT                   /translation="MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDIS
FT                   VAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQD
FT                   KGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHS
FT                   MGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGD
FT                   VIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAF
FT                   AKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGI
FT                   SNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNG
FT                   QFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVATGEVLLTENVEAGDI
FT                   WRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGL
FT                   DIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMA
FT                   GGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKT
FT                   LDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVL
FT                   TKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEAVQG"
FT   gene            complement(74629..75198)
FT                   /locus_tag="Rv0067c"
FT   CDS_pept        complement(74629..75198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0067c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly TetR-family)"
FT                   /note="Rv0067c, (MTV030.10c), len: 189 aa. Possible
FT                   transcriptional regulator, highly similar to many. Contains
FT                   probable helix-turn-helix motif from aa 34 to 55 (Score
FT                   1523, +4.37 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0067c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42790"
FT                   /db_xref="GOA:O53612"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:O53612"
FT                   /protein_id="CCP42790.1"
FT                   /translation="MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGV
FT                   GAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATD
FT                   RGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQ
FT                   AMQSYNAELAAKVTDVALDGLRANRK"
FT   gene            75301..76212
FT                   /locus_tag="Rv0068"
FT   CDS_pept        75301..76212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0068"
FT                   /product="Probable oxidoreductase"
FT                   /note="Rv0068, (MTV030.11), len: 303 aa. Probable
FT                   oxidoreductase, similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0068"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42791"
FT                   /db_xref="GOA:O53613"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O53613"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42791.1"
FT                   /translation="MTKWTAADIPDQTGRTAVITGANTGLGFETAAALAAHGAHVVLAV
FT                   RNLDKGKQAAARITEATPGAEVELQELDLTSLASVRAAAAQLKSDHQRIDLLINNAGVM
FT                   YTPRQTTADGFEMQFGTNHLGHFALTGLLIDRLLPVAGSRVVTISSVGHRIRAAIHFDD
FT                   LQWERRYRRVAAYGQAKLANLLFTYELQRRLAPGGTTIAVASHPGVSNTEVVRNMPRPL
FT                   VAVAAILAPLMQDAELGALPTLRAATDPAVRGGQYFGPDGFGEIRGYPKVVASSAQSHD
FT                   EQLQRRLWAVSEELTGVVYPVG"
FT   gene            complement(76237..77622)
FT                   /gene="sdaA"
FT                   /locus_tag="Rv0069c"
FT   CDS_pept        complement(76237..77622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="Rv0069c"
FT                   /product="Probable L-serine dehydratase SdaA (L-serine
FT                   deaminase) (SDH) (L-SD)"
FT                   /note="Rv0069c, (MTV030.12c), len: 461 aa. Probable
FT                   sdaA,L-serine dehydratase. Belongs to the iron-sulfur
FT                   dependent L-serine dehydratase family. Cofactor:
FT                   iron-sulfur (4FE-4S) (probable)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0069c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42792"
FT                   /db_xref="GOA:P9WGT5"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGT5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42792.1"
FT                   /translation="MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEA
FT                   MRVDLFGSLAATGAGHGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIP
FT                   VPLTERDIDLHPDIVLPTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQ
FT                   HPCSVALPYVSAQELLDICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQ
FT                   RSIAREGLLPGGLRVRRRAKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRV
FT                   VTAPTNGAAGIVPAVLHYAIHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEV
FT                   GCQGEVGSAAAMAAAGLAEILGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERN
FT                   AISAGKAINAARMALRGDGIHRVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNI
FT                   VEC"
FT   gene            complement(77619..78896)
FT                   /gene="glyA2"
FT                   /locus_tag="Rv0070c"
FT   CDS_pept        complement(77619..78896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA2"
FT                   /locus_tag="Rv0070c"
FT                   /product="Serine hydroxymethyltransferase GlyA2 (serine
FT                   methylase 2) (SHMT 2)"
FT                   /note="Rv0070c, (MTV030.13c), len: 425 aa. glyA2, serine
FT                   hydroxymethyltransferase. Contains PS00096 Serine
FT                   hydroxymethyltransferase pyridoxal-phosphate attachment
FT                   site. Belongs to the ShmT family. Cofactor: pyridoxal
FT                   phosphate."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0070c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42793"
FT                   /db_xref="GOA:P9WGI7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGI7"
FT                   /inference="protein motif:PROSITE:PS00096"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42793.1"
FT                   /translation="MNTLNDSLTAFDPDIAALIDGELRRQESGLEMIASENYAPLAVMQ
FT                   AQGSVLTNKYAEGYPGRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAA
FT                   TMHALLNPGDTILGLSLAHGGHLTHGMRINFSGKLYHATAYEVSKEDYLVDMDAVAEAA
FT                   RTHRPKMIIAGWSAYPRQLDFARFRAIADEVDAVLMVDMAHFAGLVAAGVHPSPVPHAH
FT                   VVTSTTHKTLGGPRGGIILCNDPAIAKKINSAVFPGQQGGPLEHVIAAKATAFKMAAQP
FT                   EFAQRQQRCLDGARILAGRLTQPDVAERGIAVLTGGTDVHLVLVDLRDAELDGQQAEDR
FT                   LAAVDITVNRNAVPFDPRPPMITSGLRIGTPALAARGFSHNDFRAVADLIAAALTATND
FT                   DQLGPLRAQVQRLAARYPLYPELHRT"
FT   gene            79486..80193
FT                   /locus_tag="Rv0071"
FT   CDS_pept        79486..80193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0071"
FT                   /product="Possible maturase"
FT                   /note="Rv0071, (MTV030.14), len: 235 aa. Possible
FT                   maturase,similar to many proteins of the group II intron
FT                   maturase family. Contains 5 VDP repeats at N-terminus,
FT                   these are also found in two Streptococcus plasmid
FT                   hypothetical proteins Q52246|X17092 and Q54942|X66468."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0071"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42794"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:O53616"
FT                   /protein_id="CCP42794.1"
FT                   /translation="MSSITVSVDPVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGA
FT                   LEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPI
FT                   FETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRH
FT                   RIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRY
FT                   RGNTIPTPWTQAV"
FT   repeat_region   79507..79551
FT                   /locus_tag="Rv0071"
FT                   /note="5 x 9 bp GTGGACCCG repeats"
FT   repeat_region   80236..80550
FT                   /note="(MTV030.15), len: 315 nt. Probable REP'-1 pseudogene
FT                   fragment, similar to many Mycobacterium tuberculosis
FT                   proteins inside REP13E12 elements e.g.
FT                   Q50655|Z95390|MTCY13E12.20 (317 aa), FASTA scores; opt: 324
FT                   E(): 6.8e-17, 43.4% identity in 99 aa overlap, but no
FT                   possible startsite."
FT   gene            80624..81673
FT                   /locus_tag="Rv0072"
FT   CDS_pept        80624..81673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0072"
FT                   /product="Probable glutamine-transport transmembrane
FT                   protein ABC transporter"
FT                   /note="Rv0072, (MTV030.16), len: 349 aa. Probable
FT                   glutamine-transport transmembrane protein ABC-transporter
FT                   (see citation below). Note that supposed act with near ORF
FT                   Rv0073|MTV030.17 ATP-binding protein ABC-transporter."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0072"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42795"
FT                   /db_xref="GOA:P9WG17"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG17"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42795.1"
FT                   /translation="MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEAR
FT                   HTVDSMGVDVFVVRSGAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTS
FT                   TRNVTVFGAPEHGPGMPRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVP
FT                   NSTALAKIPNVFLTTEGLQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVR
FT                   PLKVAVNSISIVAVLLWIVAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQ
FT                   ALVIALLAAVVGVVLAQVLAPLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTV
FT                   DPAQAFGGP"
FT   gene            81676..82668
FT                   /locus_tag="Rv0073"
FT   CDS_pept        81676..82668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0073"
FT                   /product="Probable glutamine-transport ATP-binding protein
FT                   ABC transporter"
FT                   /note="Rv0073, (MTV030.17), len: 330 aa. Probable
FT                   glutamine-transport ATP-binding protein ABC-transporter
FT                   (see citation below), similar to many ATP-binding proteins.
FT                   Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop),PS00211 ABC transporters family signature, and
FT                   PS00889 Cyclic nucleotide-binding domain signature 2.
FT                   Belongs to the ATP-binding transport protein family (ABC
FT                   transporters). Note that supposed act with near ORF
FT                   Rv0072|MTV030.16 transmembrane ABC-transporter."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0073"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42796"
FT                   /db_xref="GOA:P9WQK5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQK5"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00211"
FT                   /inference="protein motif:PROSITE:PS00889"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42796.1"
FT                   /translation="MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVE
FT                   NVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEI
FT                   GVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND"
FT   gene            82748..83983
FT                   /locus_tag="Rv0074"
FT   CDS_pept        82748..83983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0074"
FT                   /product="Conserved protein"
FT                   /note="Rv0074, (MTV030.18), len: 411 aa. Conserved
FT                   protein,similar to many."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0074"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42797"
FT                   /db_xref="GOA:O53619"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:O53619"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42797.1"
FT                   /translation="MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISA
FT                   VDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHA
FT                   AAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVA
FT                   DSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLP
FT                   VTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYP
FT                   EMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTST
FT                   EVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVP
FT                   LQASAVGYNTPS"
FT   gene            83996..85168
FT                   /locus_tag="Rv0075"
FT   CDS_pept        83996..85168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0075"
FT                   /product="Probable aminotransferase"
FT                   /note="Rv0075, (MTV030.19), len: 390 aa. Probable
FT                   aminotransferase, similar to many class-II
FT                   pyridoxal-phosphate-dependent aminotransferases (MALY/PATB
FT                   subfamily). Also similar to other proteins from
FT                   Mycobacterium tuberculosis e.g. Rv2294, Rv0858c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0075"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42798"
FT                   /db_xref="GOA:O53620"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:O53620"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42798.1"
FT                   /translation="MQDSIFNLLTEEQLRGRNTLKWNYFGPDVVPLWLAEMDFPTAPAV
FT                   LDGVRACVDNEEFGYPPLGEDSLPRATADWCRQRYGWCPRPDWVRVVPDVLKGMEVVVE
FT                   FLTRPESPVALPVPAYMPFFDVLHVTGRQRVEVPMVQQDSGRYLLDLDALQAAFVRGAG
FT                   SVIICNPNNPLGTAFTEAELRAIVDIAARHGARVIADEIWAPVVYGSRHVAAASVSEAA
FT                   AEVVVTLVSASKGWNLPGLMCAQVILSNRRDAHDWDRINMLHRMGASTVGIRANIAAYH
FT                   HGESWLDELLPYLRANRDHLARALPELAPGVEVNAPDGTYLSWVDFRALALPSEPAEYL
FT                   LSKAKVALSPGIPFGAAVGSGFARLNFATTRAILDRAIEAIAAALRDIID"
FT   gene            complement(85183..85572)
FT                   /locus_tag="Rv0076c"
FT   CDS_pept        complement(85183..85572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0076c"
FT                   /product="Probable membrane protein"
FT                   /note="Rv0076c, (MTV030.20c), len: 129 aa. Probable
FT                   membrane protein, with membrane-spanning domain at
FT                   C-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0076c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42799"
FT                   /db_xref="GOA:O53621"
FT                   /db_xref="UniProtKB/TrEMBL:O53621"
FT                   /protein_id="CCP42799.1"
FT                   /translation="MPAVTTPSNHWGDERRKLSHQPPVRGQILGRRQARRLSQHFARVG
FT                   VEAPPKRLQEMLLGAPAADEEWTDVKFALIVTQLNHEKRVAKFHRLQRRATHSLICLGL
FT                   VLVALNFLICLAYIFFSLTQHAAAL"
FT   gene            complement(85636..86466)
FT                   /locus_tag="Rv0077c"
FT   CDS_pept        complement(85636..86466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0077c"
FT                   /product="Probable oxidoreductase"
FT                   /note="Rv0077c, (MTV030.21c), len: 276 aa. Possible
FT                   oxidoreductase, weakly similar to others from Streptomyces.
FT                   Also similar to MTCY05A6_35 and MTCY1A11_10 from
FT                   Mycobacterium tuberculosis. And shows some similarity in
FT                   part with AAL17935.1|AY054120 putative epoxide hydrolase
FT                   from Mycobacterium smegmatis (203 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0077c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42800"
FT                   /db_xref="GOA:O53622"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:O53622"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42800.1"
FT                   /translation="MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLA
FT                   GRGLRCIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTGGVVT
FT                   QLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAAIQVMRAPAARNRA
FT                   YAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSLRTEVTTAVAARLPEFDKPALIA
FT                   WSADDVFFALENGQRLAATIPRARFEVIEGARTFSMVDSPDRLADQLSTVAVRT"
FT   gene            86528..87133
FT                   /locus_tag="Rv0078"
FT   CDS_pept        86528..87133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0078"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /note="Rv0078, (MTV030.22), len: 201 aa. Probable
FT                   transcriptional regulator. Contains probable
FT                   helix-turn-helix motif from aa 35 to 56 (Score 1348, +3.78
FT                   SD)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0078"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42801"
FT                   /db_xref="GOA:O53623"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:5ICJ"
FT                   /db_xref="PDB:5N1C"
FT                   /db_xref="PDB:5N1I"
FT                   /db_xref="PDB:5N7O"
FT                   /db_xref="PDB:5WM9"
FT                   /db_xref="PDB:6C31"
FT                   /db_xref="PDB:6HRW"
FT                   /db_xref="PDB:6HRX"
FT                   /db_xref="PDB:6HRY"
FT                   /db_xref="PDB:6HRZ"
FT                   /db_xref="PDB:6HS0"
FT                   /db_xref="PDB:6HS1"
FT                   /db_xref="PDB:6HS2"
FT                   /db_xref="UniProtKB/TrEMBL:O53623"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42801.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
FT   gene            complement(87208..87801)
FT                   /locus_tag="Rv0078A"
FT   CDS_pept        complement(87208..87801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0078A"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0078A, len: 197 aa. Hypothetical unknown protein.
FT                   This region is a possible MT-complex-specific genomic
FT                   island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0078A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42802"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:L7N686"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42802.1"
FT                   /translation="MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIV
FT                   VAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASC
FT                   GIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQ
FT                   DIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW"
FT   gene            complement(87798..88004)
FT                   /locus_tag="Rv0078B"
FT   CDS_pept        complement(87798..88004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0078B"
FT                   /product="Conserved protein"
FT                   /note="Rv0078B, len: 68 aa. Conserved protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0078B"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42803"
FT                   /db_xref="UniProtKB/TrEMBL:I6X8G2"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42803.1"
FT                   /translation="MAVSVAAQKLRLALDMYEVGEQMQRMRLGRERPNADVVEIEAAID
FT                   AWRMTRPGAEEGDSAGPTSTRFT"
FT   gene            88204..89025
FT                   /locus_tag="Rv0079"
FT   CDS_pept        88204..89025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0079"
FT                   /product="Unknown protein"
FT                   /note="Rv0079, (MTV030.23), len: 273 aa. Unknown protein.
FT                   Predicted possible vaccine candidate (See Zvi et
FT                   al.,2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0079"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42804"
FT                   /db_xref="GOA:P9WMA9"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42804.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
FT   gene            89022..89480
FT                   /locus_tag="Rv0080"
FT   CDS_pept        89022..89480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0080"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0080, (MTV030.24), len: 152 aa. Conserved
FT                   hypothetical protein. Belongs to pyridoxine 5'-phosphate
FT                   (PNP) oxidase-like (PNPOx-like) superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0080"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42805"
FT                   /db_xref="GOA:P9WMA5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMA5"
FT                   /protein_id="CCP42805.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGRVVFTRAALPA
FT                   IRPVNHLVVDGRVIGRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
FT   gene            89575..89919
FT                   /locus_tag="Rv0081"
FT   CDS_pept        89575..89919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0081"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /note="Rv0081, (MTV030.25), len: 114 aa. Probable
FT                   transcriptional regulator, highly similar to others."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0081"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42806"
FT                   /db_xref="GOA:P9WMI7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:6JMI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMI7"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42806.1"
FT                   /translation="MESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVG
FT                   LESSNLSQQLGVLRRAGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVL
FT                   EDLRAGGSAT"
FT   gene            89924..90403
FT                   /locus_tag="Rv0082"
FT   CDS_pept        89924..90403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0082"
FT                   /product="Probable oxidoreductase"
FT                   /note="Rv0082, (MTV030.26), len: 159 aa. Probable
FT                   oxidoreductase, highly similar or similar to other various
FT                   oxidoreductases. Nucleotide position 90144 in the genome
FT                   sequence has been corrected, A:G resulting in Q74R."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0082"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42807"
FT                   /db_xref="GOA:I6XUD2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:I6XUD2"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42807.1"
FT                   /translation="MGWVAKIFRVGRVVEPAAPLPAAIAEPPAGVRGSLQIRHVDAGSC
FT                   NGCEVEISGAFGPVYDAERFGARLVASPRHADALLVTGVVTHNMAGPLRKTLEATPRPR
FT                   VVIACGDCALNRGVFADAYGVVGAVGEVVPVDVEIAGCPPTPAAIMAALRSVTGK"
FT   gene            90400..92322
FT                   /locus_tag="Rv0083"
FT   CDS_pept        90400..92322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0083"
FT                   /product="Probable oxidoreductase"
FT                   /note="Rv0083, (MTV030.27, MTCY251.01), len: 640 aa.
FT                   Probable oxidoreductase, showing some similarity to other
FT                   various oxidoreductases. Nucleotide position 91071 in the
FT                   genome sequence has been corrected, T:C resulting in
FT                   I224I."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0083"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42808"
FT                   /db_xref="GOA:P9WIW3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIW3"
FT                   /protein_id="CCP42808.1"
FT                   /translation="MTAAPTAGGVVTSGVGVAGVGVGLLGMFGPVRVVHVGWLLPLSGV
FT                   HIELDRLGGFFMALTGAVAAPVGCYLIGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSV
FT                   TTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVMTQLGFIAILVGLVVLAAAGGSD
FT                   RFAGLGAVCDGVRAAVFMLTLVGFGSKAGLVPLHAWLPRAHPEAPSPVSALMSAAMVNL
FT                   GIYGIVRFDLQLLGPGPRWWGLALLAVGGTSALYGVLQASVAADLKRLLAYSTTENMGL
FT                   ITLALGAATLFADTGAYGPASIAAAAAMLHMIAHAAFKSLAFMAAGSVLAATGLRDLDL
FT                   LGGLARRMPATTVFFGVAALGACGLPLGAGFVSEWLLVQSLIHAAPGHDPIVALTTPLA
FT                   VGVVALATGLSVAAMTKAFGIGFLARPRSTQAEAAREAPASMRAGMAIAAGACLVLAVA
FT                   PLLVAPMVRRAAATLPAAQAVKFTGLGAVVRLPAMSGSIAPGVIAAAVLAAALAVAVLA
FT                   RWRFRRRPAPARLPLWACGAADLTVRMQYTATSFAEPLQRVFGDVLRPDTDIEVTHTAE
FT                   SRYMAERITYRTAVADAIEQRLYTPVVGAVAAMAELLRRAHTGSVHRYLAYGALGVLIV
FT                   LVVAR"
FT   gene            92328..93278
FT                   /gene="hycD"
FT                   /gene_synonym="hevD"
FT                   /locus_tag="Rv0084"
FT   CDS_pept        92328..93278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycD"
FT                   /gene_synonym="hevD"
FT                   /locus_tag="Rv0084"
FT                   /product="Possible formate hydrogenlyase HycD (FHL)"
FT                   /note="Rv0084, (MTCY251.02), len: 316 aa. Possible hycD
FT                   (alternate gene name: hevD), formate hydrogenlyase,integral
FT                   membrane protein, similar to others. Belongs to the complex
FT                   I subunit 1 family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0084"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42809"
FT                   /db_xref="GOA:Q10881"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q10881"
FT                   /protein_id="CCP42809.1"
FT                   /translation="MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRD
FT                   LLKQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLL
FT                   FLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTILLAVFALSIPAGSANLGALVAS
FT                   TIDHPGHVVSLAGVLAFVALVIVIVAETGRLPVDNPATHLELTMVHEAMVLEYAGPRLA
FT                   LVEWAAGMRLTVLLALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEV
FT                   FLAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA"
FT   gene            93289..93951
FT                   /gene="hycP"
FT                   /locus_tag="Rv0085"
FT   CDS_pept        93289..93951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycP"
FT                   /locus_tag="Rv0085"
FT                   /product="Possible hydrogenase HycP"
FT                   /note="Rv0085, (MTCY251.03), len: 220 aa. Possible
FT                   hycP,hydrogenase, integral membrane protein. Belongs to
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L
FT                   superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0085"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42810"
FT                   /db_xref="GOA:P9WM75"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM75"
FT                   /protein_id="CCP42810.1"
FT                   /translation="MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALA
FT                   AIPLLRGIRDNDRALIAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLL
FT                   ITAGLTLTAFAITQPVVNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLD
FT                   NGIAATAFLLTAGVPLIVELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD"
FT   gene            93951..95417
FT                   /gene="hycQ"
FT                   /locus_tag="Rv0086"
FT   CDS_pept        93951..95417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycQ"
FT                   /locus_tag="Rv0086"
FT                   /product="Possible hydrogenase HycQ"
FT                   /note="Rv0086, (MTCY251.04), len: 488 aa. Possible
FT                   hycQ,hydrogenase, integral membrane protein. Belongs to the
FT                   NADH-Ubiquinone/plastoquinone (complex I) superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0086"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42811"
FT                   /db_xref="GOA:Q10883"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q10883"
FT                   /protein_id="CCP42811.1"
FT                   /translation="MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVA
FT                   MGFWMGSGAQFGLGGLLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSA
FT                   RLYGVLTPAFLCAMVLAVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVI
FT                   CSVGIAVAFLGTVLLYFAARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYG
FT                   AKAGLFPFHTWLADAHSQAPAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGL
FT                   LVVGLATLLVAVLMLTVTGDVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHG
FT                   IGKTVLFLAGGQLQAAHDSTAIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASEL
FT                   AIARSLANERLAWVLGAALLLIAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALM
FT                   VGIVVSAALGITAGPLADLLGIAASNVGLP"
FT   gene            95414..96892
FT                   /gene="hycE"
FT                   /gene_synonym="hevE"
FT                   /locus_tag="Rv0087"
FT   CDS_pept        95414..96892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycE"
FT                   /gene_synonym="hevE"
FT                   /locus_tag="Rv0087"
FT                   /product="Possible formate hydrogenase HycE (FHL)"
FT                   /note="Rv0087, (MTCY251.05), len: 492 aa. Possible hycE
FT                   (alternate gene name: hevE), formate hydrogenlyase, similar
FT                   to others. Belongs to the complex I 49 kDa subunit family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0087"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42812"
FT                   /db_xref="GOA:Q10884"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q10884"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42812.1"
FT                   /translation="MMSASWLRHRVSERGLIATAEQLWADSFRLALVAAHDDGDSLRVV
FT                   YLFLAGYPDRRVELEYVVPADNPEIRSLAYLSFPAGRFEREMADLYGIRPVGHPKPRRL
FT                   VRHAHWPDWHPMRTDAGPAPEFTDTGAFPFLAVEGPGVYEIPVGPVHAGLIEPGHFRFS
FT                   VAGETIVRLKARLWFVHRGIEKLFHGRPATAAVDLAERISGDTSAAHALAHSLAIEDAL
FT                   GIELPHEVHRLRALIVELERLYNHAADLGALANDVGYSLANAHAQRIRENLLRRNAAVT
FT                   GHRLLRGAIRAGGVALRALPDTDELAALAVDLAEVATLTLANSVVYDRFAGTAVLHPDD
FT                   ASALGCLGYVARASGLRSDARVEHPTIVLPITEIGAPDGDVLARYTVRRDEFAASAALA
FT                   QHIVESHTGPIEYAATLHPVGAPSSGIGIVEGWRGTIVHRVEIDVDGRITRAKVVDPSW
FT                   FNWPALPVAMADTIVPDFPLANKSFNQSYAGNDL"
FT   gene            96927..97601
FT                   /locus_tag="Rv0088"
FT   CDS_pept        96927..97601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0088"
FT                   /product="Possible polyketide cyclase/dehydrase"
FT                   /note="Rv0088, (MTCY251.06), len: 224 aa. Possible
FT                   polyketide cyclase/dehydrase. Belongs to the SRPBCC
FT                   ligand-binding domain superfamily. Predicted to be an outer
FT                   membrane protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0088"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42813"
FT                   /db_xref="GOA:P9WM73"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM73"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42813.1"
FT                   /translation="MSVYKHAPSRVRLRQTRSTVVKGRSGSLSWRRVRTGDLGLAVWGG
FT                   REEYRAVKPGTPGIQPKGDMMTVTVVDAGPGRVSRSVEVAAPAAELFAIVADPRRHREL
FT                   DGSGTVRGNIKVPAKLVVGSKFSTKMKLFGLPYRITSRVTALKPNELVEWSHPLGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGAIKNGLKFYEMTGFAKSNAAGIEATLAKLSDQYARG
FT                   RA"
FT   gene            97758..98351
FT                   /locus_tag="Rv0089"
FT   CDS_pept        97758..98351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0089"
FT                   /product="Possible methyltransferase/methylase"
FT                   /note="Rv0089, (MTCY251.07), len: 197 aa. Possible
FT                   methyltransferase, showing some weak similarity to others.
FT                   Also some similarity with many biotin biosynthesis
FT                   proteins. Belongs to the methyltransferase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0089"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42814"
FT                   /db_xref="GOA:P9WK03"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK03"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42814.1"
FT                   /translation="MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIP
FT                   YVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTA
FT                   LSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQ
FT                   TLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV"
FT   gene            98480..99250
FT                   /locus_tag="Rv0090"
FT   CDS_pept        98480..99250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0090"
FT                   /product="Possible membrane protein"
FT                   /note="Rv0090, (MTCY251.08), len: 256 aa. Possible membrane
FT                   protein. Contains IPR014511 Protein of unknown function
FT                   DUF2068, transmembrane, subgroup."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0090"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42815"
FT                   /db_xref="GOA:P9WM71"
FT                   /db_xref="InterPro:IPR014511"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM71"
FT                   /protein_id="CCP42815.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
FT   gene            99684..100451
FT                   /gene="mtn"
FT                   /gene_synonym="pfs"
FT                   /locus_tag="Rv0091"
FT   CDS_pept        99684..100451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /gene_synonym="pfs"
FT                   /locus_tag="Rv0091"
FT                   /product="Probable bifunctional MTA/SAH nucleosidase Mtn:
FT                   5'-methylthioadenosine nucleosidase (methylthioadenosine
FT                   methylthioribohydrolase) + S-adenosylhomocysteine
FT                   nucleosidase (S-adenosyl-L-homocysteine
FT                   homocysteinylribohydrolase)"
FT                   /note="Rv0091, (MTCY251.10), len: 255 aa. Probable mtn
FT                   (alternate gene name:
FT                   pfs),methylthioadenosine/S-Adenosylhomocysteine
FT                   nucleosidase (MTA/SAH nucleosidase), including
FT                   5'-methylthioadenosine nucleosidase and
FT                   S-adenosylhomocysteine nucleosidase,similar to others.
FT                   Belongs to the MTN family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0091"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42816"
FT                   /db_xref="GOA:P9WJM3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJM3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42816.1"
FT                   /translation="MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRV
FT                   VLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGL
FT                   LTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPR
FT                   IYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLA
FT                   GADSGVDFNRFVGEVAASSARVLLRLLPVLTAC"
FT   gene            100583..102868
FT                   /gene="ctpA"
FT                   /locus_tag="Rv0092"
FT   CDS_pept        100583..102868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="Rv0092"
FT                   /product="Cation transporter P-type ATPase a CtpA"
FT                   /note="Rv0092, (MTCY251.11), len: 761 aa.
FT                   CtpA,cation-transporting P-type ATPase a (transmembrane
FT                   protein), highly similar to many. Contains PS01047
FT                   Heavy-metal-associated domain, and PS00154 E1-E2 ATPases
FT                   phosphorylation site. Belongs to the cation transport
FT                   ATPases family (E1-E2 ATPases), subfamily IB."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0092"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42817"
FT                   /db_xref="GOA:P9WPU1"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPU1"
FT                   /inference="protein motif:PROSITE:PS01047"
FT                   /inference="protein motif:PROSITE:PS00154"
FT                   /protein_id="CCP42817.1"
FT                   /translation="MTTAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAA
FT                   VNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLCTDDGRSASDPDADHARQLLIRLAI
FT                   AAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHHAAS
FT                   METLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRY
FT                   FEARAKSQAGSALRALAALSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADG
FT                   LAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGRLIVEAAAVGADTQFAGMVRL
FT                   VEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIAC
FT                   PCALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAV
FT                   TAAPGWEADQVLALAATVEAASEHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRA
FT                   VRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCGVIAVADAVKDSARDAV
FT                   AALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMV
FT                   GDGINDGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLN
FT                   MVWAFGYNIAAIPVAAAGLLNPLVAGAAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGP
FT                   QMTAPSSA"
FT   gene            complement(102815..103663)
FT                   /locus_tag="Rv0093c"
FT   CDS_pept        complement(102815..103663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0093c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0093c, (MTCY251.12c), len: 282 aa. Probable
FT                   conserved membrane protein, equivalent only to
FT                   CAC30943.1|AL583924 probable integral membrane protein from
FT                   Mycobacterium leprae (237 aa). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0093c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42818"
FT                   /db_xref="GOA:P9WM69"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM69"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42818.1"
FT                   /translation="MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATID
FT                   GMDCEVAREALSARLDGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRP
FT                   VVPPVGRLGIRRAPRRQHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAG
FT                   THLLNESTSWSIALGVIMVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTR
FT                   ILTHLPVVIGAVLAIMVWRSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSA
FT                   A"
FT   gene            complement(103710..104663)
FT                   /locus_tag="Rv0094c"
FT   CDS_pept        complement(103710..104663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0094c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0094c, (MTCY251.13c), len: 317 aa. Member of 13E12
FT                   repeat family, showing some similarity to U15187|MLU15187_7
FT                   from Mycobacterium leprae (94 aa), FASTA score: (49.4%
FT                   identity in 79 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0094c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42819"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:Q50655"
FT                   /protein_id="CCP42819.1"
FT                   /translation="MSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTER
FT                   ARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTPDA
FT                   AAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDLQTGAGKGFT
FT                   GGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFAN
FT                   DRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACGPDNRLAEKGWTTHNNTHGH
FT                   TEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
FT   repeat_region   complement(103713..105215)
FT                   /note="REP-2, len: 1503 nt. REP251, member of REP13E12
FT                   family."
FT   gene            complement(104805..105215)
FT                   /locus_tag="Rv0095c"
FT   CDS_pept        complement(104805..105215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0095c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0095c, (MTCY251.14c), len: 136 aa. Member of 13E12
FT                   repeat, also partially similar to AF0418|AF041819_8 from
FT                   Mycobacterium bovis BCG (222 aa), FASTA score: (89.6%
FT                   identity in 96 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0095c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42820"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q10891"
FT                   /protein_id="CCP42820.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDADLDRLDEVSFEVLSTPERLRSLERLECLARRLPAAQHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPEAGRRSAEAKP"
FT   gene            105324..106715
FT                   /gene="PPE1"
FT                   /locus_tag="Rv0096"
FT   CDS_pept        105324..106715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE1"
FT                   /locus_tag="Rv0096"
FT                   /product="PPE family protein PPE1"
FT                   /note="Rv0096, (MTCY251.15), len: 463 aa. PPE1, Member of
FT                   the Mycobacterium tuberculosis PPE family, similar to many.
FT                   A core mycobacterial gene; conserved in mycobacterial
FT                   strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0096"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42821"
FT                   /db_xref="GOA:P9WI49"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI49"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42821.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
FT   gene            106734..107603
FT                   /locus_tag="Rv0097"
FT   CDS_pept        106734..107603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0097"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0097, (MTCY251.16), len: 289 aa. Possible
FT                   oxidoreductase, equivalent to NP_302343.1|NC_002677
FT                   putative oxidoreductase from Mycobacterium leprae (289 aa).
FT                   Also highly similar to BAB69377.1|AB070955 putative
FT                   oxidoreductase from Streptomyces avermitilis (296 aa).
FT                   Contains PS00077 Cytochrome c oxidase subunit I, copper B
FT                   binding region signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0097"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42822"
FT                   /db_xref="GOA:P9WG83"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG83"
FT                   /inference="protein motif:PROSITE:PS00077"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42822.1"
FT                   /translation="MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDV
FT                   HPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMP
FT                   EPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSD
FT                   VYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYICATGTTKIEDKDGNPVDPEVLQ
FT                   ELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDG
FT                   LKTPGYAA"
FT   gene            107600..108151
FT                   /gene="fcoT"
FT                   /locus_tag="Rv0098"
FT   CDS_pept        107600..108151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcoT"
FT                   /locus_tag="Rv0098"
FT                   /product="Probable fatty acyl CoA thioesterase type III
FT                   FcoT"
FT                   /note="Rv0098, (MTCY251.17), len: 183 aa. FcoT, long-chain
FT                   fatty acyl CoA thioesterase type III (See Wang et
FT                   al.,2007), equivalent to CAC30948.1|AL583924 from
FT                   Mycobacterium leprae (183 aa). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et al.,
FT                   2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0098"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42823"
FT                   /db_xref="GOA:P9WM67"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="PDB:2PFC"
FT                   /db_xref="PDB:3B18"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM67"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42823.1"
FT                   /translation="MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQ
FT                   YSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRG
FT                   WSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEF
FT                   WDENGGAASGEIELAALNIP"
FT   gene            108156..109778
FT                   /gene="fadD10"
FT                   /locus_tag="Rv0099"
FT   CDS_pept        108156..109778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD10"
FT                   /locus_tag="Rv0099"
FT                   /product="Possible fatty-acid-CoA ligase FadD10
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0099, (MTCY251.18), len: 540 aa. Possible
FT                   fadD10,fatty-acid-CoA synthetase, similar to many. Contains
FT                   PS00455 putative AMP-binding domain signature. Contains
FT                   IPR000873 AMP-dependent synthetase/ligase domain. Belongs
FT                   to the ATP-dependent AMP-binding enzyme family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0099"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42824"
FT                   /db_xref="GOA:P9WQ55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ55"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42824.1"
FT                   /translation="MGGKKFQAMPQLPSTVLDRVFEQARQQPEAIALRRCDGTSALRYR
FT                   ELVAEVGGLAADLRAQSVSRGSRVLVISDNGPETYLSVLACAKLGAIAVMADGNLPIAA
FT                   IERFCQITDPAAALVAPGSKMASSAVPEALHSIPVIAVDIAAVTRESEHSLDAASLAGN
FT                   ADQGSEDPLAMIFTSGTTGEPKAVLLANRTFFAVPDILQKEGLNWVTWVVGETTYSPLP
FT                   ATHIGGLWWILTCLMHGGLCVTGGENTTSLLEILTTNAVATTCLVPTLLSKLVSELKSA
FT                   NATVPSLRLVGYGGSRAIAADVRFIEATGVRTAQVYGLSETGCTALCLPTDDGSIVKIE
FT                   AGAVGRPYPGVDVYLAATDGIGPTAPGAGPSASFGTLWIKSPANMLGYWNNPERTAEVL
FT                   IDGWVNTGDLLERREDGFFYIKGRSSEMIICGGVNIAPDEVDRIAEGVSGVREAACYEI
FT                   PDEEFGALVGLAVVASAELDESAARALKHTIAARFRRESEPMARPSTIVIVTDIPRTQS
FT                   GKVMRASLAAAATADKARVVVRG"
FT   gene            109783..110019
FT                   /locus_tag="Rv0100"
FT   CDS_pept        109783..110019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0100"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0100, (MTCY251.19), len: 78 aa. Conserved
FT                   hypothetical protein, equivalent only to
FT                   CAC30950.1|AL583924 conserved hypothetical protein from
FT                   Mycobacterium leprae (78 aa). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0100"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42825"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM65"
FT                   /protein_id="CCP42825.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
FT   gene            110001..117539
FT                   /gene="nrp"
FT                   /locus_tag="Rv0101"
FT   CDS_pept        110001..117539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrp"
FT                   /locus_tag="Rv0101"
FT                   /product="Probable peptide synthetase Nrp (peptide
FT                   synthase)"
FT                   /note="Rv0101, (MTCY251.20), len: 2512 aa. Probable
FT                   nrp,peptide synthetase, similar to others e.g.
FT                   AAD44234.1|AF143772_40|PstB peptide synthetase from
FT                   Mycobacterium avium (2552 aa); 7476034|S77657 cyclic
FT                   peptide synthetase from Mycobacterium leprae (1401
FT                   aa),FASTA scores: opt: 4268, E(): 0, (65.7% identity in
FT                   1091 aa overlap); part of CAB55600.1|AJ238027 peptide
FT                   synthetase from Mycobacterium smegmatis (5990). Also
FT                   similar to e.g. AAD56240.1|AF184977_1|AF184977 DhbF protein
FT                   from Bacillus subtilis (2378 aa); SRF1_BACSU|P27206
FT                   surfactin synthetase subunit 1 (3587 aa), FASTA scores:
FT                   opt: 1708, E(): 0,(30.6% identity in 1633 aa overlap): etc.
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop), 2 x
FT                   PS00455 Putative AMP-binding domain signature, and PS00012
FT                   Phosphopantetheine attachment site. Belongs to the
FT                   ATP-dependent AMP-binding enzyme family. Thought to be not
FT                   involved in mycobactin biosynthesis (see citation below)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0101"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42826"
FT                   /db_xref="GOA:Q10896"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PDB:4DQV"
FT                   /db_xref="PDB:4U5Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q10896"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /inference="protein motif:PROSITE:PS00012"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42826.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVR
FT                   HTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLRE
FT                   AHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNA
FT                   FDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVN
FT                   SVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNF
FT                   IREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPK
FT                   VAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGV
FT                   HQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTAD
FT                   EISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDERVTQVTHDALLATKTAY
FT                   IMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGA
FT                   ACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQ
FT                   IVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFLPIVCDQTTMDGALLRL
FT                   GRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADGSRRRAFATGDRVTVDA
FT                   EGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVELHSGSLGVWFKSQRTRE
FT                   GEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDNLPRLPQWSAAGLNTAE
FT                   TGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPETRRYLGWRLSLLDLIGA
FT                   DTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRLWFLDQLQRPAPVYNMA
FT                   VALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLVIEARRADLGCDIVDAT
FT                   AWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVAVAHHIAADGWSVAPLT
FT                   ADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSDSPIAAQLAYWENALAG
FT                   MPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQHNATSFMVVAAGLAVLL
FT                   SKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGDPSFAELLGQVRARSLA
FT                   AYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDNPVGQLNLGDLQATPMPIDTRTA
FT                   RMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIERLRKVLVAVAAAPERTV
FT                   SSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVARIPEAEAVCCGDASMTY
FT                   RELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVLKTGAAYLPIDPANPPP
FT                   RVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPGTPPPMPAAVNLAYILY
FT                   TSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGFDASAWEIWGALLGGGR
FT                   LVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLESVALVVAGEACPAALV
FT                   DRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGAALFVLDSWLRPVPAG
FT                   VAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDLVCWRADGQLEFLGR
FT                   TDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVGYATEIAPGAVDPA
FT                   GLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTNGYRAPAGPVEKT
FT                   VAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVRALLHASSTRGL
FT                   SQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNLPGPSPELRTV
FT                   LLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLRHFK
FT                   ELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHELFGPNVAGT
FT                   AELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWAGGYGTSK
FT                   WAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATGIAPRSF
FT                   YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEY
FT                   VDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPLKPTR
FT                   GCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL"
FT   gene            117714..119699
FT                   /locus_tag="Rv0102"
FT   CDS_pept        117714..119699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0102"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0102, (MTCY251.21), len: 661 aa. Probable
FT                   conserved integral membrane protein, highly similar to
FT                   P53525|Y102_MYCLE|ML1998|NP_302349.1|NC_002677 possible
FT                   membrane protein from Mycobacterium leprae (659 aa), FASTA
FT                   scores: opt: 3107, E(): 0, (70.2% identity in 662 aa
FT                   overlap). Also similar to others e.g. CAC01497.1|AL391017
FT                   putative integral membrane protein from Streptomyces
FT                   coelicolor (316 aa); etc. Contains PS00343 Gram-positive
FT                   cocci surface proteins 'anchoring' hexapeptide."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0102"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42827"
FT                   /db_xref="GOA:P9WM63"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM63"
FT                   /inference="protein motif:PROSITE:PS00343"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42827.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
FT   gene            complement(119915..122173)
FT                   /gene="ctpB"
FT                   /locus_tag="Rv0103c"
FT   CDS_pept        complement(119915..122173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="Rv0103c"
FT                   /product="Probable cation-transporter P-type ATPase B CtpB"
FT                   /note="Rv0103c, (MTCY251.22c), len: 752 aa. Probable
FT                   ctpB,cation-transporting P-type ATPase B (transmembrane
FT                   protein), equivalent to CTPB_MYCLE|P46840
FT                   cation-transporting P-type ATPase B from Mycobacterium
FT                   leprae (750 aa), FASTA scores: opt: 3615, E(): 0, (76.5%
FT                   identity in 752 aa overlap). Also highly similar to others
FT                   e.g. CAB96031.1|AL360055 putative metal transporter ATPase
FT                   from Streptomyces coelicolor (753 aa);
FT                   NP_241423.1|NC_002570 copper-transporting ATPase from
FT                   Bacillus halodurans (806 aa); etc. Also highly similar to
FT                   Z46257|MLACEA_7 aceA gene for isocitrate L from
FT                   Mycobacterium leprae (750 aa), FASTA scores: opt:
FT                   3615,E():0, (76.5% identity in 752 aa overlap). And similar
FT                   to MTCY251.11 from Mycobacterium tuberculosis, FASTA score:
FT                   (68.3% identity in 742 aa overlap). Contains PS01047
FT                   Heavy-metal-associated domain, PS00154 E1-E2 ATPases
FT                   phosphorylation site. Belongs to the cation transport
FT                   ATPases family (E1-E2 ATPases), subfamily IB."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0103c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42828"
FT                   /db_xref="GOA:P9WPT9"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPT9"
FT                   /inference="protein motif:PROSITE:PS00154"
FT                   /inference="protein motif:PROSITE:PS01047"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42828.1"
FT                   /translation="MAAPVVGDADLQSVRRIRLDVLGMSCAACASRVETKLNKIPGVRA
FT                   SVNFATRVATIDAVGMAADELCGVVEKAGYHAAPHTETTVLDKRTKDPDGAHARRLLRR
FT                   LLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNARHR
FT                   TTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLA
FT                   GRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIA
FT                   ADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQFAAM
FT                   VRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLV
FT                   IACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAV
FT                   STVTMAGSGTSERDREEVLGLAAAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVS
FT                   GEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVFVSVDGVVRAALTIADT
FT                   LKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLR
FT                   EEGHTVAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLAR
FT                   ATMRTIRMNMIWAFGYNVAAIPIAAAGLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ"
FT   gene            122317..123831
FT                   /locus_tag="Rv0104"
FT   CDS_pept        122317..123831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0104"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0104, (MTCY251.23), len: 504 aa. Conserved
FT                   hypothetical protein, showing weak similarity with other
FT                   cAMP-dependent protein kinases e.g. AAC37564.1|M65066
FT                   cAMP-dependent protein kinase RI-beta regulatory subunit
FT                   from Homo sapiens (380 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0104"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42829"
FT                   /db_xref="GOA:P9WM61"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WM61"
FT                   /protein_id="CCP42829.1"
FT                   /translation="MTPVTTFPLVDAILAGRDRNLDGVILIAAQHLLQTTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHPGVVDAMRADGIYVDDCSDAYAPHESFDTQYTRHVERFFAE
FT                   SWARLTAGRTARVVLLDDGGSLLAVAGAMLDASADVIGIEQTSAGYAKIVGCALGFPVI
FT                   NIARSSAKLLYESPIIAARVTQTAFERTAGIDSSAAILITGAGAIGTALADVLRPLHDR
FT                   VDVYDTRSGCMTPIDLPNAIGGYDVIIGATGATSVPASMHELLRPGVLLMSASSSDREF
FT                   DAVALRRRTTPNPDCHADLRVADGSVDATLLNSGFPVNFDGSPMCGDASMALTMALLAA
FT                   AVLYASVAVADEMSSDHPHLGLIDQGDIVASFLNIDVPLQALSRLPLLSIDGYRRLQVR
FT                   SGYTLFRQGERADHFFVIESGELEALVDGKVILRLGAGDHFGEACLLGGMRRIATVRAC
FT                   EPSVLWELDGKAFGDALHGDAAMREIAYGVARTRLMHAGASESLMV"
FT   gene            complement(123980..124264)
FT                   /gene="rpmB1"
FT                   /locus_tag="Rv0105c"
FT   CDS_pept        complement(123980..124264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB1"
FT                   /locus_tag="Rv0105c"
FT                   /product="50S ribosomal protein L28-1 RpmB1"
FT                   /note="Rv0105c, (MTCY251.24c), len: 94 aa. rpmB1, 50S
FT                   ribosomal protein L28-1, highly similar to others e.g.
FT                   Q9X8K8|R28B_STRCO 50S ribosomal protein L28-2 from
FT                   Streptomyces coelicolor (78 aa); RL28_ECOLI|P02428 50s
FT                   ribosomal protein l28 from Escherichia coli (77 aa), FASTA
FT                   scores: opt: 167, E(): 6.2e-06, (40.7% identity in 59 aa
FT                   overlap); etc. Also similar to MTCY63A_2 from Mycobacterium
FT                   tuberculosis. Belongs to the L28P family of ribosomal
FT                   proteins."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0105c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42830"
FT                   /db_xref="GOA:P9WHB1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHB1"
FT                   /protein_id="CCP42830.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
FT   gene            124374..125570
FT                   /locus_tag="Rv0106"
FT   CDS_pept        124374..125570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0106"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0106, (MTCY251.25), len: 398 aa. Conserved
FT                   hypothetical protein, similar to others e.g.
FT                   AL049841|SCE9_33 from Streptomyces coelicolor (370
FT                   aa),FASTA scores: opt: 282, E(): 2.5e-11, (32.0% identity
FT                   in 381 aa overlap); etc. Some similarity to P94400
FT                   homologue to nitrile hydratase region from Bacillus
FT                   subtilis (397 aa), FASTA scores: opt: 226, E(): 5.4e-08,
FT                   (26.4% identity in 405 aa overlap). Also similar to
FT                   COBW_PSEDE|P29937 FASTA score: (25.3% identity in 186 aa
FT                   overlap); and P47K_PSECL|P31521 47 kDa protein (p47k) (419
FT                   aa), FASTA score: (25.9% identity in 401 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0106"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42831"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPI5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42831.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
FT   gene            complement(125643..130541)
FT                   /gene="ctpI"
FT                   /locus_tag="Rv0107c"
FT   CDS_pept        complement(125643..130541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpI"
FT                   /locus_tag="Rv0107c"
FT                   /product="Probable cation-transporter ATPase I CtpI"
FT                   /note="Rv0107c, (MTCY251.26c, MTV031.01c), len: 1632 aa.
FT                   Probable ctpI, cation-transporting ATPase I P-type, highly
FT                   similar to NP_302704.1|NC_002677 probable cation transport
FT                   ATPase from Mycobacterium leprae (1609 aa); and similar to
FT                   others e.g. CAB69720.1|AL137166 putative transport ATPase
FT                   from Streptomyces coelicolor (1472 aa); ATA1_SYNY|P37367
FT                   cation-transporting ATPase pma1 from Synechocystis sp. (915
FT                   aa), FASTA scores: opt: 603, E(): 6.6e-29, (32.4% identity
FT                   in 710 aa overlap); etc. Also similar to MTCY39.21c and
FT                   MTCY22G10.22c from Mycobacterium tuberculosis, FASTA score:
FT                   (34.4% identity in 796 aa overlap). Contains PS00154 E1-E2
FT                   ATPases phosphorylation site. Belongs to the cation
FT                   transport ATPases family (E1-E2 ATPases)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0107c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42832"
FT                   /db_xref="GOA:P9WPS5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPS5"
FT                   /inference="protein motif:PROSITE:PS00154"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42832.1"
FT                   /translation="MKIPGVATVLGGVTNGVAQTVRAGARLPGSAAAAVQTLASPVLEL
FT                   TGPVVQSVVQTTGRAIGVRGSHNESPDGMTPPVRWRSGRRVHFDLDPLLPFPRWHEHAA
FT                   MVEEPVRRIPGVAEAHVEGSLGRLVVELEPDADSDIAVDEVRDVVSAVAADIFLAGSVS
FT                   SPNSAPFADPGNPLAILVPLTAAAMDLVAMGATVTGWVARLPAAPQTTRALAALINHQP
FT                   RMVSLMESRLGRVGTDIALAATTAAANGLTQSLGTPLLDLVQRSLQISEAAAHRRVWRD
FT                   REPALASPRRPQAPVVPIISSAGAKSQEPRHSWAAAAAGEASHVVVGGSIDAAIDTAKG
FT                   SRAGPVEQYVNQAANGSLIAAASALVAGGGTEDAAGAILAGVPRAAHMGRQAFAAVLGR
FT                   GLANTGQLVLDPGALRRLDRVRVVVIDGAALRGDNRAVLHAQGDEPGWDDDRVYEVADA
FT                   LLHGEQAPEPDPDELPATGARLRWAPAQGPSATPAQGLEHADLVVDGQCVGSVDVGWEV
FT                   DPYAIPLLQTAHRTGARVVLRHVAGTEDLSASVGSTHPPGTPLLKLVRELRADRGPVLL
FT                   ITAVHRDFASTDTLAALAIADVGVALDDPRGATPWTADLITGTDLAAAVRILSALPVAR
FT                   AASESAVHLAQGGTTLAGLLLVTGEQDKTTNPASFRRWLNPVNAAAATALVSGMWSAAK
FT                   VLRMPDPTPQPLTAWHALDPEIVYSRLAGGSRPLAVEPGIPAWRRILDDLSYEPVMAPL
FT                   RGPARTLAQLAVATRHELADPLTPILAVGAAASAIVGSNIDALLVAGVMTVNAITGGVQ
FT                   RLRAEAAAAELFAEQDQLVRRVVVPAVATTRRRLEAARHATRTATVSAKSLRVGDVIDL
FT                   AAPEVVPADARLLVAEDLEVDESFLTGESLPVDKQVDPVAVNDPDRASMLFEGSTIVAG
FT                   HARAIVVATGVGTAAHRAISAVADVETAAGVQARLRELTSKVLPMTLAGGAAVTALALL
FT                   RRASLRQAVADGVAIAVAAVPEGLPLVATLSQLAAAQRLTARGALVRSPRTIEALGRVD
FT                   TICFDKTGTLTENRLRVVCALPSSTAAERDPLPQTTDAPSAEVLRAAARASTQPHNGEG
FT                   HAHATDEAILAAASALAGSLSSQGDSEWVVLAEVPFESSRGYAAAIGRVGTDGIPMLML
FT                   KGAPETILPRCRLADPGVDHEHAESVVRHLAEQGLRVLAVAQRTWDNGTTHDDETDADA
FT                   VDAVAHDLELIGYVGLADTARSSSRPLIEALLDAERNVVLITGDHPITARAIARQLGLP
FT                   ADARVVTGAELAVLDEEAHAKLAADMQVFARVSPEQKVQIVAALQRCGRVTAMVGDGAN
FT                   DAAAIRMADVGIGVSGRGSSAARGAADIVLTDDDLGVLLDALVEGRSMWAGVRDAVTIL
FT                   VGGNVGEVLFTVIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQFAEPDDAEYP
FT                   TDDAAERAQREHRRAVLIGPTPSLDAPLLRQIVNRGVVTAAGATAAWAIGRWTPGTERR
FT                   TATMGLTALVMTQLAQTLLTRRHSPLVIATALGSAGVLVGIIQTPVISHFSGVPRWDRS
FT                   PGRASSAPRQEPPQSQRWHRSGWQAQSVSCNLMNALTTRKTLTRVDRTYRRPR"
FT   gene            complement(130895..131104)
FT                   /locus_tag="Rv0108c"
FT   CDS_pept        complement(130895..131104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0108c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0108c, (MTV031.02c), len: 69 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0108c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42833"
FT                   /db_xref="GOA:O53630"
FT                   /db_xref="UniProtKB/TrEMBL:O53630"
FT                   /protein_id="CCP42833.1"
FT                   /translation="MVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVVLELESRVN
FT                   HQLQVIEKSFPAGYHVGRAHHRIL"
FT   gene            131382..132872
FT                   /gene="PE_PGRS1"
FT                   /locus_tag="Rv0109"
FT   CDS_pept        131382..132872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE_PGRS1"
FT                   /locus_tag="Rv0109"
FT                   /product="PE-PGRS family protein PE_PGRS1"
FT                   /note="Rv0109, (MTV031.03c), len: 496 aa. PE_PGRS1, Member
FT                   of the M. tuberculosis PE family, PGRS subfamily of
FT                   gly-rich proteins (see Brennan and Delogu, 2002), highly
FT                   similar to many e.g. Q50615|Y0DP_MYCTU hypothetical
FT                   glycine-rich 40.8 kDa protein from Mycobacterium
FT                   tuberculosis (498 aa), FASTA scores: opt: 1772, E():
FT                   0,(57.3% identity in 513 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0109"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42834"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:L0T2H7"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42834.1"
FT                   /translation="MSLLITSPATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGAD
FT                   EVSVLIAALFEAYAQEYQALSAQALAFHDQFVQALNMGAVCYAAAETANATPLQALQTV
FT                   QQNVLTVVNAPTQALLGRPIIGNGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGN
FT                   GGAAGLIGNGGSGGVGGPGIAGSAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGG
FT                   NAIGLFGSGGTGGMGGVGGMGGVGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGG
FT                   GGNGRFMGNGGVGGAGGYGASGDGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGG
FT                   NAGFVRNGGAGGNGQLGSGAVSSAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNA
FT                   VGLFGQGGAGGAGGSGFGAGIPGGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGN
FT                   ARLIGNGGDGGPGMFGGPGGAGGSGGTIFGFAGTPGPS"
FT   gene            133020..133769
FT                   /locus_tag="Rv0110"
FT   CDS_pept        133020..133769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0110"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0110, (MTV031.04), len: 249 aa. Probable conserved
FT                   integral membrane protein, similar to many e.g.
FT                   AL079308|SCH69_25 from Streptomyces coelicolor (297
FT                   aa),FASTA scores: opt: 552, E(): 6.1e-29, (45.4% identity
FT                   in 251 aa overlap); P54493|YQGP_BACSU hypothetical 56.4 KD
FT                   protein from Bacillus subtilis (507 aa), FASTA scores: opt:
FT                   320, E(): 4e-15, (32.4% identity in 210 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0110"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42835"
FT                   /db_xref="GOA:O53632"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:O53632"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42835.1"
FT                   /translation="MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLIS
FT                   LNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGP
FT                   PLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHL
FT                   DVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTIT
FT                   VLVAFVVLIGWRTVDLLALFGGRLNLS"
FT   gene            133950..136007
FT                   /locus_tag="Rv0111"
FT   CDS_pept        133950..136007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0111"
FT                   /product="Possible transmembrane acyltransferase"
FT                   /note="Rv0111, (MTV031.05), len: 685 aa. Possible
FT                   transmembrane acyltransferase, equivalent to
FT                   AA22904.1|AL035300 putative acyltransferase from
FT                   Mycobacterium leprae (696 aa). Also similar to others e.g.
FT                   C69975 acyltransferase homolog yrhL from Bacillus subtilis
FT                   (634 aa), FASTA scores: opt: 520, E(): 4e-22, (36.4%
FT                   identity in 382 aa overlap). Very similar to Mycobacterium
FT                   tuberculosis proteins Rv0228, Rv1254, Rv1565c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0111"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42836"
FT                   /db_xref="GOA:O53633"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:O53633"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42836.1"
FT                   /translation="MPARSVPRPRWVAPVRRVGRLAVWDRPERRSGIPALDGLRAIAVA
FT                   LVLASHGGIPGMGGGFIGVDAFFVLSGFLITSLLLDELGRTGRIDLSGFWIRRARRLLP
FT                   ALVLMVLTVSAARALFPDQALTGLRSDAIAAFLWTANWRFVAQNTDYFTQGAPPSPLQH
FT                   TWSLGVEEQYYVVWPLLLIGATLLLAARARRRCRRATVGGVRFAAFLIASLGTMASATA
FT                   AVAFTSAATRDRIYFGTDTRAQALLIGSAAAALLVRDWPSLNRGWCLIRTRWGRRIARL
FT                   LPFVGLAGLAVTTHVATGSVGEFRHGLLIVVAGAAVIVVASVAMEQRGAVARILAWRPL
FT                   VWLGTISYGVYLWHWPIFLALNGQRTGWSGPALFAARCAATVVLAGASWWLIEQPIRRW
FT                   RPARVPLLPLAAATVASAAAVTMLVVPVGAGPGLREIGLPPGVSAVAAVSPSPPEASQP
FT                   APGPRDPNRPFTVSVFGDSIGWTLMHYLPPTPGFRFIDHTVIGCSLVRGTPYRYIGQTL
FT                   EQRAECDGWPARWSAQVNRDQPDVALLIVGRWETVDRVNEGRWTHIGDPTFDAYLNAEL
FT                   QRALSIVGSTGVRVMVTTVPYSRGGEKPDGRLYPEDQPERVNKWNAMLHNAISQHSNVG
FT                   MIDLNKKLCPDGVYTAKVDGIKVRSDGVHLTQEGVKWLIPWLEDSVRVAS"
FT   gene            136289..137245
FT                   /gene="gca"
FT                   /locus_tag="Rv0112"
FT   CDS_pept        136289..137245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gca"
FT                   /locus_tag="Rv0112"
FT                   /product="Possible GDP-mannose 4,6-dehydratase Gca
FT                   (GDP-D-mannose dehydratase)"
FT                   /note="Rv0112, (MTV031.06), len: 318 aa. Possible
FT                   gca,GDP-mannose 4,6-dehydratase, similar to others e g.
FT                   U18320|PAU18320_1 GDP-D-mann from Pseudomonas aeruginosa
FT                   (323 aa), FASTA scores: opt: 415, E(): 4.4e-21, (27.0%
FT                   identity in 318 aa overlap). Similar to Rv3634c, Rv3784,etc
FT                   from Mycobacterium tuberculosis. Contains PS00061
FT                   Short-chain dehydrogenases/reductases family signature.
FT                   Seems to belong to the GDP-mannose 4,6-dehydratase family.
FT                   Cofactor: NAD(+). This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0112"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42837"
FT                   /db_xref="GOA:O53634"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O53634"
FT                   /inference="protein motif:PROSITE:PS00061"
FT                   /protein_id="CCP42837.1"
FT                   /translation="MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNG
FT                   AEVDITDWCSVYDSIATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRR
FT                   VRPHAKIIVAGSSAEYGFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMH
FT                   TVVARIFNCTGPRKVGDALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRAL
FT                   MLMLDKGEAGADYNVGGSIAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGD
FT                   CSKLAAITGWQQEICLTQTIADMFDYWRSKSESALMV"
FT   gene            137319..137909
FT                   /gene="gmhA"
FT                   /gene_synonym="lpcA"
FT                   /locus_tag="Rv0113"
FT   CDS_pept        137319..137909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /gene_synonym="lpcA"
FT                   /locus_tag="Rv0113"
FT                   /product="Probable sedoheptulose-7-phosphate isomerase GmhA
FT                   (phosphoheptose isomerase)"
FT                   /note="Rv0113, (MTV031.07), len: 196 aa. Probable gmhA
FT                   (alternate gene name: lpcA), sedoheptulose-7-phosphate
FT                   isomerase (see citation below), similar to many e.g.
FT                   AE0005|HPAE000596_11 from Helicobacter pylori (192
FT                   aa),FASTA scores: opt: 451, E(): 1.9e-24, (45.1% identity
FT                   in 162 aa overlap). Belongs to the sis family, LPCA
FT                   subfamily. This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0113"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42838"
FT                   /db_xref="GOA:P9WGG1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGG1"
FT                   /protein_id="CCP42838.1"
FT                   /translation="MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAG
FT                   ARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGAEALHANSSHLTAVANDYDYDTVFA
FT                   RALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADFLIN
FT                   VPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ"
FT   gene            137941..138513
FT                   /gene="gmhB"
FT                   /locus_tag="Rv0114"
FT   CDS_pept        137941..138513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="Rv0114"
FT                   /product="Possible D-alpha,beta-D-heptose-1,7-biphosphate
FT                   phosphatase GmhB (D-glycero-D-manno-heptose 7-phosphate
FT                   kinase)"
FT                   /note="Rv0114, (MTV031.08), len: 190 aa. Possible
FT                   gmhB,D-alpha,beta-D-heptose-1,7-biphosphate phosphatase
FT                   (see citation below), similar to several hypothetical
FT                   proteins and phosphatases e.g. HIS7_ECOLI|P06987
FT                   imidazoleglycerol-phosphate dehydratase (355 aa), FASTA
FT                   scores: opt: 250, E(): 3.6e-11, (34.0 % identity in 141 aa
FT                   overlap). This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0114"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42839"
FT                   /db_xref="GOA:P9WMV3"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMV3"
FT                   /protein_id="CCP42839.1"
FT                   /translation="MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARAL
FT                   KKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQ
FT                   RCGCRKPRPGLVLDWLGRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGAS
FT                   SGGVADASFDSLWEFAVAVGHARGERG"
FT   gene            138513..139673
FT                   /gene="hddA"
FT                   /locus_tag="Rv0115"
FT   CDS_pept        138513..139673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hddA"
FT                   /locus_tag="Rv0115"
FT                   /product="Possible D-alpha-D-heptose-7-phosphate kinase
FT                   HddA"
FT                   /note="Rv0115, (MTV031.09), len: 386 aa. Possible
FT                   hddA,D-alpha-D-heptose-7-phosphate kinase (see citation
FT                   below),similar to several hypothetical proteins and sugar
FT                   kinases e.g. AAK27850.1|AF324836_3
FT                   D-glycero-D-manno-heptose 7-phosphate kinase from
FT                   Aneurinibacillus thermoaerophilus (341 aa);
FT                   AAK80995.1|AE007802_11 Sugar kinase from Clostridium
FT                   acetobutylicum (364 aa). This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,
FT                   2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0115"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42840"
FT                   /db_xref="GOA:O53637"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:O53637"
FT                   /inference="protein motif:PROSITE:PS00435"
FT                   /protein_id="CCP42840.1"
FT                   /translation="MAILRGRAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDKYAYAFA
FT                   ERGTGDEIAFRSPDRDRAGQASIDDLASLEEDFPLHVAVYRRVIAEFNGGTPFPLQLAT
FT                   QVDAPPGSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLGMAGGWQDHY
FT                   AAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNV
FT                   VERDADALAATHSICAEALEMKDLLVVGDIPGFADSLLRGWQAKKRTSTRISNPAIEHA
FT                   YQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRRIEVARSLERECGGSVAPCLFTKGGAVT
FT                   WHIPESTAPVRRGVADAVASALGNAGILLCAGCVLATSHSTWRVPV"
FT   gene            complement(140267..141022)
FT                   /gene="ldtA"
FT                   /locus_tag="Rv0116c"
FT   CDS_pept        complement(140267..141022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldtA"
FT                   /locus_tag="Rv0116c"
FT                   /product="Probable L,D-transpeptidase LdtA"
FT                   /note="Rv0116c, (MTV031.10c), len: 251 aa. Probable
FT                   ldtA,L,D-transpeptidase, showing similarity to several
FT                   hypothetical mycobacterial proteins e.g. Rv1433 from
FT                   Mycobacterium tuberculosis (271 aa); and
FT                   Q49706|B1496_F2_81|U00013 from Mycobacterium leprae (271
FT                   aa); to the C-terminal regions of others like Rv0192 from
FT                   Mycobacterium tuberculosis (366 aa), FASTA scores: opt:
FT                   451, E(): 1.7e-21, (46.7% identity in 270 aa overlap); and
FT                   Rv0192|Z97050|MTCI28_32 from Mycobacterium tuberculosis
FT                   cosmid (366 aa), FASTA scores: opt: 699, E(): 0, (45.7%
FT                   identity in 221 aa overlap). Predicted to be an outer
FT                   membrane protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0116c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42841"
FT                   /db_xref="GOA:O53638"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="PDB:4JMN"
FT                   /db_xref="PDB:4JMX"
FT                   /db_xref="PDB:5E51"
FT                   /db_xref="PDB:5E5L"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53638"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42841.1"
FT                   /translation="MRRVVRYLSVVVAITLMLTAESVSIATAAVPPLQPIPGVASVSPA
FT                   NGAVVGVAHPVVVTFTTPVTDRRAVERSIRISTPHNTTGHFEWVASNVVRWVPHRYWPP
FT                   HTRVSVGVQELTEGFETGDALIGVASISAHTFTVSRNGEVLRTMPASLGKPSRPTPIGS
FT                   FHAMSKERTVVMDSRTIGIPLNSSDGYLLTAHYAVRVTWSGVYVHSAPWSVNSQGYANV
FT                   SHGCINLSPDNAAWYFDAVTVGDPIEVVG"
FT   gene            141200..142144
FT                   /gene="oxyS"
FT                   /locus_tag="Rv0117"
FT   CDS_pept        141200..142144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyS"
FT                   /locus_tag="Rv0117"
FT                   /product="Oxidative stress response regulatory protein
FT                   OxyS"
FT                   /note="Rv0117, (MTV031.11), len: 314 aa. OxyS, oxidative
FT                   stress response protein regulatory protein, LysR family
FT                   (see citation below). Similar to many transcription
FT                   regulators and OxyR, the oxidative stress response protein
FT                   of many bacteria. Contains LysR family signature at
FT                   N-terminus. Also contains helix-turn-helix motif at aa
FT                   16-37 (Score 1543, +4.44 SD). Belongs to the LysR family of
FT                   transcriptional regulators. OXYR is required for the
FT                   induction of a regulon of hydrogen peroxide inducible genes
FT                   such as catalase, glutathione-reductase, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0117"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42842"
FT                   /db_xref="GOA:L7N677"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:L7N677"
FT                   /inference="protein motif:PROSITE:PS00044"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42842.1"
FT                   /translation="MLFRQLEYFVAVAQERHFARAAEKCYVSQPALSSAIAKLERELNV
FT                   TLINRGHSFEGLTREGERLVVWAKRILAEHAAFKAEVDAVRSGITGTLRLGTVPTASTT
FT                   ASLVLSAFCSAHPLAKVQVCSRLAATELYRRLREFELDAVIVHPETQDSDDVDLVPLYE
FT                   EQYVLLSPADMLPPGTSTLVWRDAAQLPLALLTADMRDRQVIDAAFADHAVSAIPQVET
FT                   DSVASLFAQVATGNWASIVPHTWLWAMPMSGPTGGEIRAVELVDPVLKAQIALATNALG
FT                   PGSPVARALITCAQALALNEFFDTQLRGITRRR"
FT   gene            complement(142128..143876)
FT                   /gene="oxcA"
FT                   /locus_tag="Rv0118c"
FT   CDS_pept        complement(142128..143876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxcA"
FT                   /locus_tag="Rv0118c"
FT                   /product="Probable oxalyl-CoA decarboxylase OxcA"
FT                   /note="Rv0118c, (MTV031.12c), Len: 582 aa. Probable
FT                   oxcA,oxalyl-CoA decarboxylase, highly similar to many e.g.
FT                   P78093|OXC_ECOLI|7449483|B65011|YFDU|B2373|Z3637|ECS325
FT                   probable oxalyl-CoA decarboxylase from Escherichia coli
FT                   (564 aa); M77128|OXAOXA_1 oxalyl-CoA decarboxylase from
FT                   Oxalobacter formigenes (568 aa), FASTA scores: opt:
FT                   2124,E():0, (55.6% identity in 568 aa overlap). Also
FT                   similar to mycobacterial IlvB proteins e.g. MLCB1788.46c
FT                   unknown TPP-requiring enzyme from Mycobacterium leprae (548
FT                   aa); and AL0086|MLCB1788_19 from Mycobacterium leprae (548
FT                   aa),FASTA scores: opt: 831, E(): 0, (33.9% identity in 567
FT                   aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0118c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42843"
FT                   /db_xref="GOA:O53639"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:O53639"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42843.1"
FT                   /translation="MTTRSASPCTVLTDGCHLVVDALKANDVDTIYGVVGIPITDLARA
FT                   AQASGIRYIGFRHEASAGNAAAAAGFLTARPGVCLTTSGPGFLNGLPALANATTNCFPM
FT                   IQISGSSSRPMVDLQRGDYQDLDQLNAARPFVKAAYRIGQVQDIGRGVARAIRTATSGR
FT                   PGGVYLDIPGDVLGQAVEASAASGAIWRPVDPAPRLLPAPEAIDRALDVLAQAQRPLLV
FT                   LSKGAAYAQADNVIREFVEHTGIPFLPMSMAKGLLPDSHPQSAAAARSLAMARADVVLL
FT                   VGARLNWLLGNGESPQWSADAKFIQVDIEASEFDSNRPIVAPLTGDIGSVMSALLEAAA
FT                   DRSSVASAAWTGELADRKARNSAKMRRRLADDHHPMRFYNALGAIRSVLQRNPDVYVVN
FT                   EGANALDLARNIIDMHLPRHRLDSGTWGVMGIGMGYAIAAAVETGRPVVAIEGDSAFGF
FT                   SGMEFETICRYRLPVTVVILNNGGVYRGDEATIFRSAAPVWRHDPAPTVLNAHARHELI
FT                   AEAFGGKGYHVSTPTELESALTDALASNGPSLIDCELDPADGVESGHLAKLNTTSAATP
FT                   AISGDG"
FT   gene            144049..145626
FT                   /gene="fadD7"
FT                   /locus_tag="Rv0119"
FT   CDS_pept        144049..145626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD7"
FT                   /locus_tag="Rv0119"
FT                   /product="Probable fatty-acid-CoA ligase FadD7
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0119, (MTV031.13-MTCI418B.01), len: 525 aa.
FT                   Probable fadD7, fatty-acid-CoA synthetase, similar to
FT                   4-coumarate:CoA ligase of many organisms e.g.
FT                   U39405|PTU39405_1 4-coumarate:CoA ligase from Pinus
FT                   taedaxylem (537 aa), FASTA scores: opt: 483, E():
FT                   8.3e-22,(28.2% identity in 440 aa overlap). Contains
FT                   PS00455 Putative AMP-binding domain signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0119"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42844"
FT                   /db_xref="GOA:O07169"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:O07169"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42844.1"
FT                   /translation="MASDFGPRIADLVEVAATRLPEAPALVVTADRIAISHRDLARLVD
FT                   ELAGQLTRSGLLPGDRVALRMGSNAEFVVALLAASRADLVVVPLDPALPITEQRVRSQA
FT                   AGARVVLIDADGPHDRAEPTTRWWPLTVNVGGDSGPSGGTLSVHLDAATEPNPATSTPE
FT                   GLRPDDAMIMFTGGTTGLPKMVPWTHANIASSVRAIITGYRLSPRDATVAVMPLYHGHG
FT                   LIASLLATLASGGAVSLPARGRFSAHTFWDDIKAVGATWYTAVPTIHQILLERSATEPS
FT                   GRKPAALRFIRSCSAPLTAQAALALQTEFAAPVVCAFGMTEATHQVTTTQIEGIDQTET
FT                   PVVSTGLVGRSTGAQIRIVGSDGLPLPAGAVGEIWLRGTTVVRGYLGDPTITAANFTDG
FT                   WLRTGDLGSLSAAGDLSIRGRIKELINRGGEKISPERVEGVLASHPNVMEAAVFGVPHQ
FT                   LYGEAVAAVIVPRESAPPTREELVQFCRERLAAFEIPASFQEASGLPHTAKGSLDRRAV
FT                   AERFGHSV"
FT   gene            complement(145627..147771)
FT                   /gene="fusA2"
FT                   /gene_synonym="fus2"
FT                   /locus_tag="Rv0120c"
FT   CDS_pept        complement(145627..147771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /gene_synonym="fus2"
FT                   /locus_tag="Rv0120c"
FT                   /product="Probable elongation factor G FusA2 (EF-G)"
FT                   /note="Rv0120c, (MTCI418B.02c), len: 714 aa. Probable fusA2
FT                   (alternate gene name: fus2), elongation factor G, highly
FT                   similar to others e.g. EFG_ECOLI|P02996 elongation factor G
FT                   (ef-g) from Escherichia coli (703 aa), FASTA scores: opt:
FT                   1049, E(): 0, (32.5% identity in 717 aa overlap). Also
FT                   similar to fusA1|MTCY210.01 from Mycobacterium tuberculosis
FT                   FASTA score: (39.1% identity in 299 aa overlap); and
FT                   P30767|EFG_MYCLE elongation factor G (EF-G) from
FT                   Mycobacterium leprae (701 aa), FASTA score: (31.7% identity
FT                   in 710 aa overlap). Contains PS00017 ATP/GTP-binding site
FT                   motif A (P-loop). Belongs to the GTP-binding elongation
FT                   factor family, EF-G/EF-2 subfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0120c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42845"
FT                   /db_xref="GOA:P9WNM9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNM9"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42845.1"
FT                   /translation="MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLV
FT                   AAKVLSRPGSVTEGTTVCDFDEAEIRQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGE
FT                   LRAGLRAADCALFVIAANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYREALTA
FT                   AQDAFGDKVLPLYLPSGDGLIGLLSQALYEYADGKRTTRTPAESDTERIEEARGALIEG
FT                   IIEESEDESLMERYLGGETIDESVLIQDLEKAVARGSFFPVIPVCSSTGVGTLELLEVA
FT                   TRGFPSPMEHPLPEVFTPQGVPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSGT
FT                   IRPDTTVHVSGHFSSFFGGGTSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICAI
FT                   GKLSRAETGDTLSDKAEPLVLKPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPT
FT                   LRIEQNQETHQVVLWCMGEAHAGVVLDTLANRYGVSVDTIELRVPLRETFAGNAKGHGR
FT                   HIKQSGGHGQYGVCDIEVEPLPEGSGFEFLDKVVGGAVPRQFIPNVEKGVRAQMDKGVH
FT                   AGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGALALREAAAATKVILLEPIDEISVLVPD
FT                   DFVGAVLGDLSSRRGRVLGTETAGHDRTVIKAEVPQVELTRYAIDLRSLAHGAASFTRS
FT                   FARYEPMPESAAARVKAGAG"
FT   gene            complement(147908..148342)
FT                   /locus_tag="Rv0121c"
FT   CDS_pept        complement(147908..148342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0121c"
FT                   /product="Conserved protein"
FT                   /note="Rv0121c, (MTCI418B.03c), len: 144 aa. Conserved
FT                   protein, showing some similarity with others proteins from
FT                   Mycobacterium tuberculosis e.g. Rv1155, Rv1875,
FT                   Rv2074,etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0121c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42846"
FT                   /db_xref="GOA:O07171"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:O07171"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42846.1"
FT                   /translation="MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEAT
FT                   GADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRD
FT                   GEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA"
FT   gene            148491..148859
FT                   /locus_tag="Rv0122"
FT   CDS_pept        148491..148859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0122"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0122, (MTCI418B.04), len: 122 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0122"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42847"
FT                   /db_xref="GOA:O07172"
FT                   /db_xref="UniProtKB/TrEMBL:O07172"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42847.1"
FT                   /translation="MAGSVSAAAGIGWVGLNVTETNRDQCYRVERTTVDALTHPEYRVH
FT                   TRGVQRVRVTRNARKHRVSKHRIVAAMRHCGVPVIQEDGSLYYQGRDTSGRLTEVVAVE
FT                   ADDGDLIITHAMPKEWKR"
FT   gene            148856..149224
FT                   /locus_tag="Rv0123"
FT   CDS_pept        148856..149224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0123"
FT                   /product="Unknown protein"
FT                   /note="Rv0123, (MTCI418B.05), len: 122 aa. Unknown
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0123"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42848"
FT                   /db_xref="GOA:O07173"
FT                   /db_xref="UniProtKB/TrEMBL:O07173"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42848.1"
FT                   /translation="MTKKPRNPADYVIGDDVEVSDVDLKQEEVYVDGERLTDERVEQMA
FT                   SESLRLAREREANLIPGGKSLSGGSAHSPAVQVVVSKATHAKLKELARSRKMSVSKLLR
FT                   PVLDEFVQRETGRILPRR"
FT   gene            149533..150996
FT                   /gene="PE_PGRS2"
FT                   /locus_tag="Rv0124"
FT   CDS_pept        149533..150996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE_PGRS2"
FT                   /locus_tag="Rv0124"
FT                   /product="PE-PGRS family protein PE_PGRS2"
FT                   /note="Rv0124, (MTCI418B.06), len: 487 aa. PE_PGRS2, Member
FT                   of the Mycobacterium tuberculosis PE family, PGRS subfamily
FT                   of gly-rich proteins (see Brennan and Delogu, 2002), highly
FT                   similar to many e.g. Y0DP_MYCTU|Q50615 from Mycobacterium
FT                   tuberculosis (498 aa), FASTA scores: opt: 1730, E():
FT                   0,(60.7% identity in 504 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0124"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42849"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:Q79G08"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42849.1"
FT                   /translation="MSFVSVAPEIVVAAATDLAGIGSAISAANAAAAAPTTAVLAAGAD
FT                   EVSAAIAALFSGHAQAYQALSAQAAAFHQQFVQTLAGGAGAYAAAEAQVEQQLLAAINA
FT                   PTQALLGRPLIGNGADGAPGTGQAGGAGGILYGNGGNGGSGAAGQAGGAGGPAGLIGHG
FT                   GSGGAGGSGAAGGAGGHGGWLWGNGGVGGSGGAGVGAGVAGGHGGAGGAAGLWGAGGGG
FT                   GNGGNGADANIVSGGDGGLGGAGGGGGWLYGDGGAGGHGGQGAIGLGGGAGGDGGQGGA
FT                   GRGLWGTGGAGGHGGQGGGTGGPPLPGQAGMGAAGGAGGLIGNGGAGGDGGVGASGGVA
FT                   GVGGAGGNAMLIGHGGAGGAGGDSSFANGAAGGAGGAGGHLFGNGGSGGHGGAVTAGNT
FT                   GIGGAGGVGGDARLIGHGGAGGAGGDRAGALVGRDGGPGGNGGAGGQLYGNGGDGAPGT
FT                   GGTLQAAVSGLVTALFGAPGQPGDTGQPG"
FT   gene            151148..152215
FT                   /gene="pepA"
FT                   /gene_synonym="mtb32a"
FT                   /locus_tag="Rv0125"
FT   CDS_pept        151148..152215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /gene_synonym="mtb32a"
FT                   /locus_tag="Rv0125"
FT                   /product="Probable serine protease PepA (serine proteinase)
FT                   (MTB32A)"
FT                   /note="Rv0125, (MTCI418B.07, MTB32A), len: 355 aa. Probable
FT                   pepA (alternate gene name: mtb32a), serine protease (see
FT                   Skeiky et al., 1999), highly similar to other proteases
FT                   e.g. HHOB_ECOLI|P31137 protease hhob precursor (355
FT                   aa),FASTA scores: opt: 400, E(): 3.8e-14, (32.4% identity
FT                   in 346 aa overlap). Also similar to Q50320 34 kDa protein
FT                   precursor from Mycobacterium tuberculosis (361 aa), FASTA
FT                   scores: opt: 1689, E(): 0, (70.7% identity in 362 aa
FT                   overlap). Contains PS00135 Serine proteases, trypsin
FT                   family, serine active site. Has a putative signal sequence
FT                   at the N-terminus. Belongs to the serine protease family.
FT                   Conserved in M. tuberculosis, M. leprae, M. bovis and M.
FT                   avium paratuberculosis; predicted to be essential for in
FT                   vivo survival and pathogenicity (See Ribeiro-Guimaraes and
FT                   Pessolani, 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0125"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42850"
FT                   /db_xref="GOA:O07175"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:O07175"
FT                   /inference="protein motif:PROSITE:PS00135"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42850.1"
FT                   /translation="MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADF
FT                   PALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDIN
FT                   AFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQG
FT                   GTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGM
FT                   NTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNG
FT                   ARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSG
FT                   GTRTGNVTLAEGPPA"
FT   gene            152324..154129
FT                   /gene="treS"
FT                   /locus_tag="Rv0126"
FT   CDS_pept        152324..154129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="Rv0126"
FT                   /product="Trehalose synthase TreS"
FT                   /note="Rv0126, (MTCI418B.08), len: 601 aa. TreS, trehalose
FT                   synthase (see citation below), highly similar to others
FT                   e.g. CAA04601.2|AJ001205 putative trehalose synthase from
FT                   Streptomyces coelicolor (566 aa);
FT                   S71450|1536814|BAA11303.1|D78198 trehalose synthase
FT                   maltose-specific from Pimelobacter sp. strain R48 (573 aa).
FT                   Also similar to MAL1_DROME|P07191 possible maltase
FT                   precursor (508 aa), FASTA scores: opt: 807, E(): 0, (33.7%
FT                   identity in 504 aa overlap); and similar to proteins
FT                   associated with amino-acid transport e.g. Q64319 rat
FT                   protein which stimulates transport of cystine and dibasic
FT                   and neutral amino acids (683 aa), FASTA scores: opt:
FT                   839,E(): 0, (32.0% identity in 531 aa overlap). Also
FT                   similar to several other Mycobacterium tuberculosis
FT                   proteins e.g. Rv2471 FASTA score: (31.7% identity in 164 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0126"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42851"
FT                   /db_xref="GOA:P9WQ19"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ19"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42851.1"
FT                   /translation="MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFK
FT                   HAVFYEVLVRAFFDASADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIR
FT                   DFYKVLPEFGTVDDFVALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDY
FT                   YVWSDTSERYTDARIIFVDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMID
FT                   VIRFWLGLGIDGFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEA
FT                   NQWPGDVVEYFGDPNTGGDECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMA
FT                   QWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELF
FT                   TALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPP
FT                   SQDPVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYV
FT                   RQVAGDDGDTVLCVNNLSRFPQPIELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPG
FT                   HGFYWFQLTTHEVGAPPTCGGERRL"
FT   repeat_region   154073..154125
FT                   /gene="treS"
FT                   /locus_tag="Rv0126"
FT                   /note="53 bp Mycobacterial Interspersed Repetitive
FT                   Unit,Class III (see Supply et al., 1997)"
FT   repeat_region   154126..154178
FT                   /note="53 bp Mycobacterial Interspersed Repetitive
FT                   Unit,Class II"
FT   repeat_region   154179..154231
FT                   /note="53 bp Mycobacterial Interspersed Repetitive
FT                   Unit,Class II"
FT   gene            154232..155599
FT                   /gene="mak"
FT                   /locus_tag="Rv0127"
FT   CDS_pept        154232..155599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="Rv0127"
FT                   /product="Maltokinase Mak"
FT                   /note="Rv0127, (MTCI418B.09, MTCI5.01), len: 455 aa.
FT                   Mak,maltokinase; highly similar to various proteins e.g.
FT                   AJ0012|SCJ001205_4 hypothetical protein from Streptomyces
FT                   coelicolor A3(2) (464 aa), FASTA scores: opt: 412, E():
FT                   1.1e-19, (40.6% identity in 485 aa overlap);
FT                   AJ0012|SCJ001206_5 hypothetical protein from Streptomyces
FT                   coelicolor A3(2) (453 aa), FASTA scores: opt: 403, E(): 4.3
FT                   e-19, (36.5% identity in 455 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0127"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42852"
FT                   /db_xref="GOA:O07177"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="PDB:4O7O"
FT                   /db_xref="PDB:4O7P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07177"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42852.1"
FT                   /translation="MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNL
FT                   DLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLL
FT                   SLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVS
FT                   SGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRM
FT                   LARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDF
FT                   EGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAA
FT                   FCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS"
FT   gene            155667..156446
FT                   /locus_tag="Rv0128"
FT   CDS_pept        155667..156446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0128"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0128, (MTCI5.02), len: 259 aa. Probable conserved
FT                   transmembrane protein, with some similarity to Rv3064c and
FT                   other bacterial proteins e.g.
FT                   AAK85977.1|AE007957|AGR_C_254p from Agrobacterium
FT                   tumefaciens (206 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0128"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42853"
FT                   /db_xref="GOA:P96805"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:P96805"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42853.1"
FT                   /translation="MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQR
FT                   AVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGV
FT                   DIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHL
FT                   AGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRR
FT                   GLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS"
FT   gene            complement(156578..157600)
FT                   /gene="fbpC"
FT                   /gene_synonym="85C"
FT                   /gene_synonym="fbpC2"
FT                   /gene_synonym="mpt45"
FT                   /locus_tag="Rv0129c"
FT   CDS_pept        complement(156578..157600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /gene_synonym="85C"
FT                   /gene_synonym="fbpC2"
FT                   /gene_synonym="mpt45"
FT                   /locus_tag="Rv0129c"
FT                   /product="Secreted antigen 85-C FbpC (85C) (antigen 85
FT                   complex C) (AG58C) (mycolyl transferase 85C)
FT                   (fibronectin-binding protein C)"
FT                   /note="Rv0129c, (MT0137, MTCI5.03c), len: 340 aa. FbpC
FT                   (alternate gene names: mpt45, 85C, fbpC2), secreted antigen
FT                   85c (fibronectin-binding protein C) (mycolyl transferase
FT                   85C) (see citations below), also highly similar to other
FT                   Mycobacterial antigen precursors e.g. A85C_MYCLE|Q05862
FT                   antigen 85-c precursor (85c) from Mycobacterium leprae (333
FT                   aa), FASTA scores: opt: 1937, E(): 0, (81.4% identity in
FT                   333 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0129c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42854"
FT                   /db_xref="GOA:P9WQN9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1DQY"
FT                   /db_xref="PDB:1DQZ"
FT                   /db_xref="PDB:1VA5"
FT                   /db_xref="PDB:3HRH"
FT                   /db_xref="PDB:4MQL"
FT                   /db_xref="PDB:4MQM"
FT                   /db_xref="PDB:4QDO"
FT                   /db_xref="PDB:4QDT"
FT                   /db_xref="PDB:4QDU"
FT                   /db_xref="PDB:4QDX"
FT                   /db_xref="PDB:4QDZ"
FT                   /db_xref="PDB:4QE3"
FT                   /db_xref="PDB:4QEK"
FT                   /db_xref="PDB:5KWI"
FT                   /db_xref="PDB:5KWJ"
FT                   /db_xref="PDB:5OCJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQN9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42854.1"
FT                   /translation="MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAG
FT                   AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEE
FT                   YYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTG
FT                   NAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANS
FT                   MWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTN
FT                   QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
FT                   "
FT   gene            157847..158302
FT                   /gene="htdZ"
FT                   /locus_tag="Rv0130"
FT   CDS_pept        157847..158302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htdZ"
FT                   /locus_tag="Rv0130"
FT                   /product="Probable 3-hydroxyl-thioester dehydratase"
FT                   /note="Rv0130, (MTCI5.04), len: 151 aa. Probable
FT                   htdZ,3-hydroxyl-thioester dehydratase. Forms single hot-dog
FT                   fold, features R-specific hydratase motif, substrate
FT                   unknown, forms homodimer. Shows structural similarity to
FT                   six others in Mycobacterium tuberculosis (see Castell et al
FT                   (2005) below). Similar to others e.g. AL096811|SCI30A_19
FT                   from Streptomyces coelicolor (153 aa), FASTA scores: opt:
FT                   639, E(): 0, (60.8% identity in 148 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0130"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42855"
FT                   /db_xref="GOA:P9WNP3"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="PDB:2C2I"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNP3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42855.1"
FT                   /translation="MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIH
FT                   VDPERAAAGPFGTTIAHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGS
FT                   RVRATSSLVGVEDLGNGTVQATVSTTVEVEGSAKPACVAESIVRYVA"
FT   gene            complement(158315..159658)
FT                   /gene="fadE1"
FT                   /locus_tag="Rv0131c"
FT   CDS_pept        complement(158315..159658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="Rv0131c"
FT                   /product="Probable acyl-CoA dehydrogenase FadE1"
FT                   /note="Rv0131c, (MTCI5.05c), len: 447 aa. Probable
FT                   fadE1,acyl-CoA dehydrogenase, similar to many e.g.
FT                   ACDS_HUMAN|P16219 acyl-CoA dehydrogenase short-chain
FT                   specific precursor (412 aa), FASTA scores: opt: 522, E():
FT                   1.4e-23, (30.1% identity in 425 aa overlap). Also highly
FT                   similar to MTCI5_28 from Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0131c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42856"
FT                   /db_xref="GOA:P96808"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P96808"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42856.1"
FT                   /translation="MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVA
FT                   LDPYDKKNADTMAILRPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWA
FT                   PSAFGCQAPDSGNAEILALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTA
FT                   ATRDAAGNGDWIINGEKWFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEI
FT                   VRNVGVGAESTRHASHGYIRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIA
FT                   LARRAFDMMCERALSRQTRHGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHD
FT                   YQKVRRDIAAVKVAMPQVLHDVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATE
FT                   LHKMTVARRTLREYQPVTTLFPSQHIPTRRAHAEAWLAQRLEHAIAEF"
FT   gene            complement(159700..160782)
FT                   /gene="fgd2"
FT                   /locus_tag="Rv0132c"
FT   CDS_pept        complement(159700..160782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgd2"
FT                   /locus_tag="Rv0132c"
FT                   /product="Putative F420-dependent glucose-6-phosphate
FT                   dehydrogenase Fgd2"
FT                   /note="Rv0132c, (MTCI5.06c), len: 360 aa. Putative
FT                   fgd2,F420-dependent glucose-6-phosphate dehydrogenase,
FT                   highly similar to many from Mycobacteria e.g.
FT                   AAD38167|g5031431 from Mycobacterium chelonae. Also similar
FT                   to MJ1534|Q58929 N5,N10-methylene tetrahydromethanopterin
FT                   reductase from methanococcus jannaschii (342 aa), FASTA
FT                   scores: opt: 285,E(): 7.9e-11, (28.4% identity in 292 aa
FT                   overlap). And also similar to Rv0953c, Rv0791c, etc from
FT                   Mycobacterium tuberculosis. Contains PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0132c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42857"
FT                   /db_xref="GOA:P96809"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR031017"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96809"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42857.1"
FT                   /translation="MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVG
FT                   VVLSHEQFRTDRLVAHAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTS
FT                   SILFGTGVTCPIYRYHPATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRE
FT                   RHDRLIEAIVLIRQLWSGERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAG
FT                   RYGDGWIAQARDINDAKLLAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLW
FT                   RFTAGAVDQPNPVEIQRAAESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFP
FT                   QDDPITAIDFYRTNVLPELR"
FT   gene            160869..161474
FT                   /locus_tag="Rv0133"
FT   CDS_pept        160869..161474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0133"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="Rv0133, (MTCI5.07), len: 201 aa. Probable
FT                   acetyltransferase. Contains GNAT (Gcn5-related
FT                   N-acetyltransferase) domain in C-terminal part. See Vetting
FT                   et al. 2005. Highly similar to others e.g.
FT                   PUAC_STRLP|P13249 puromycyn N-acetyltransferase (199
FT                   aa),FASTA scores: opt: 341, E(): 1.8e-16, (33.3% identity
FT                   in 201 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0133"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42858"
FT                   /db_xref="GOA:P96810"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:P96810"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42858.1"
FT                   /translation="MTPQARPARRADVRELSRTMARAFYDDPVMSWLLSNDNARTARLT
FT                   RLFATIVRHQHLAGGGVEVARGAAGIGGAALWDPPDRWRESRRQQLAMTPGFLRVFGFR
FT                   TAKARAALDVMMRVHPEEPHWYLAAIGSDPTVRGQGFGQVLMRSRLDRCDAEHCPAYLE
FT                   STKPENVPYYQRFGFRVTREIALPDAGPPLWAMWREPR"
FT   gene            161771..162673
FT                   /gene="ephF"
FT                   /locus_tag="Rv0134"
FT   CDS_pept        161771..162673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ephF"
FT                   /locus_tag="Rv0134"
FT                   /product="Possible epoxide hydrolase EphF (epoxide
FT                   hydratase) (arene-oxide hydratase)"
FT                   /note="Rv0134, (MTCI5.08), len: 300 aa. Possible
FT                   ephE,epoxide hydrolase (see citation below), similar to
FT                   others e.g. Q39856 epoxide hydrolase (341 aa), FASTA
FT                   scores: opt: 369, E(): 4.6e-17, (27.2% identity in 335 aa
FT                   overlap); etc. Also similar to MTCY09F9.26c from
FT                   Mycobacterium tuberculosis (29.5% identity in 346 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0134"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42859"
FT                   /db_xref="GOA:P96811"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:P96811"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42859.1"
FT                   /translation="MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQN
FT                   WWEWRDLIGPLAADGNRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKL
FT                   VAHDWGGPVAFIMMLRHPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIG
FT                   PRVISDPKGRYFRLLTGWVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREML
FT                   RWLRGEYNDARVDVPVRWLHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRP
FT                   ELVLDRVRAFLAAGTEQRD"
FT   gene            complement(162644..163249)
FT                   /locus_tag="Rv0135c"
FT   CDS_pept        complement(162644..163249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0135c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0135c, (MTCI5.09c), len: 201 aa. Possible
FT                   transcriptional regulator, weakly similar to others e.g.
FT                   P32398|YHGD_BACSU hypothetical transcriptional regulator
FT                   from Bacillus subtilis (191 aa), FASTA scores: opt:
FT                   145,E(): 0.0012, (21.0% identity in 162 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0135c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42860"
FT                   /db_xref="GOA:P96812"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:P96812"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42860.1"
FT                   /translation="MTAVAAGALVVETDSFRLRLLDGLVASIGERGYRATTVSDIVRHA
FT                   RTSKRTFYDRFTSKEQCFLELLLADNETLGNSIRAAVDPNADWHDQIRQAVEAYVTHIE
FT                   SRPAVTLSWIREFPSLGAAAYPVQRRGMEQLTSLLIELSASPGFRRANLPPLNVPLAVI
FT                   LLGGLRELTALTVEDGQPIRNIVEPAVDASIALLGPRS"
FT   gene            163366..164691
FT                   /gene="cyp138"
FT                   /locus_tag="Rv0136"
FT   CDS_pept        163366..164691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp138"
FT                   /locus_tag="Rv0136"
FT                   /product="Probable cytochrome P450 138 Cyp138"
FT                   /note="Rv0136, (MT0144, MTCI5.10), len: 441 aa. Probable
FT                   cyp138, cytochrome P450 138, similar to others e.g.
FT                   SLR0574|Q59990 from synechocystis SP. (444 aa), FASTA
FT                   scores: opt: 315, E(): 1e-13, (25.7% identity in 416 aa
FT                   overlap); etc. Also similar to MTV039_6 from Mycobacterium
FT                   tuberculosis (472 aa), FASTA score: (38.2% identity in 442
FT                   aa overlap). Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop); and PS00086 Cytochrome P450 cysteine heme-iron
FT                   ligand signature. Belongs to the cytochrome P450 family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0136"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42861"
FT                   /db_xref="GOA:P9WPM3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPM3"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00086"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42861.1"
FT                   /translation="MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVRR
FT                   YGKAFTANILMYGRVVVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGDDH
FT                   RRRRRLLAPPFHGKSMKNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILRAIF
FT                   GAGGSELDELRRLIPPWVTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVIDKLIE
FT                   AERADPNFADRTDVLALMLRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLGWAFER
FT                   LSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTVIDFAARRVNPPVYQLGEWVIPRG
FT                   YSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMD
FT                   VVLRTVLRHFTLETTTAAGERSHGRGVAFTPKDGGRVVMRRR"
FT   gene            complement(164712..165260)
FT                   /gene="msrA"
FT                   /locus_tag="Rv0137c"
FT   CDS_pept        complement(164712..165260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Rv0137c"
FT                   /product="Probable peptide methionine sulfoxide reductase
FT                   MsrA (protein-methionine-S-oxide reductase) (peptide met(O)
FT                   reductase)"
FT                   /note="Rv0137c, (MTCI5.11c), len: 182 aa. Probable
FT                   msrA,peptide methionine sulfoxide reductase (See St. John
FT                   et al., 2001), equivalent to CAC32179.1|AL583926 putative
FT                   peptide methionine sulfoxide from Mycobacterium leprae (177
FT                   aa). Highly similar to others e.g. CAC18703.1|AL451182
FT                   putative peptide methionine sulfoxide reductase from
FT                   Streptomyces coelicolor (172 aa); PMSR_SCHPO|Q09859
FT                   putative peptide methionine sulfoxide reductase from
FT                   Streptomyces (187 aa), FASTA scores: opt: 468, E():
FT                   9.9e-26, (45.6% identity in 158 aa overlap); etc. Belongs
FT                   to the MsrA family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0137c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42862"
FT                   /db_xref="GOA:P9WJM5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="PDB:1NWA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJM5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42862.1"
FT                   /translation="MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYR
FT                   NHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQK
FT                   RIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRL
FT                   PRRTAESALRASLSPELGT"
FT   gene            165323..165826
FT                   /locus_tag="Rv0138"
FT   CDS_pept        165323..165826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0138"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0138, (MTCI5.12), len: 167 aa. Conserved
FT                   hypothetical protein, showing weak similarity to
FT                   Q10827|YT10_MYCTU hypothetical 17.0 KDA protein from
FT                   Mycobacterium tuberculosis (147 aa), FASTA scores: opt:
FT                   131, E(): 0.047, (31.15% identity in 106 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0138"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42863"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:P96815"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42863.1"
FT                   /translation="MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYI
FT                   EHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGD
FT                   GSVISATNISIITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRR
FT                   HGGP"
FT   gene            165827..166849
FT                   /locus_tag="Rv0139"
FT   CDS_pept        165827..166849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0139"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0139, (MTCI5.13), len: 340 aa. Possible
FT                   oxidoreductase, similar to others e.g. O34285|HPNA HPNA
FT                   protein from Zymomonas mobilis (337 aa), FASTA scores: opt:
FT                   507, E (): 5.8e-27, (31.1% identity in 328 aa overlap);
FT                   TRE_STRGR|P29782 dtdp-glucose 4,6-dehydratase (328
FT                   aa),FASTA scores: opt: 254, E(): 2.6e-10, (29.0% identity
FT                   in 307 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0139"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42864"
FT                   /db_xref="GOA:P96816"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:P96816"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42864.1"
FT                   /translation="MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRS
FT                   IDDLPLTRFHGDVFDTATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLD
FT                   VATDASLRRFVFTSSYATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDA
FT                   GLPAVAMCVSTTYGGGDWGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILA
FT                   AERGRNGERYLISERMMPLQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTG
FT                   KDTELSLASVRMMRSEADVDHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
FT                   "
FT   gene            166910..167290
FT                   /locus_tag="Rv0140"
FT   CDS_pept        166910..167290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0140"
FT                   /product="Conserved protein"
FT                   /note="Rv0140, (MTCI5.14), len: 126 aa. Conserved
FT                   protein,similar to others e.g. P74567|D90916_48
FT                   hypothetical 20.8 KDP protein from Synechocystis sp. (180
FT                   aa), FASTA scores: opt: 229, E(): 4.7e-10, (36.1% identity
FT                   in 108 aa overlap). Also similar to Rv1056 and Rv1670 from
FT                   Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0140"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42865"
FT                   /db_xref="GOA:P96817"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:P96817"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42865.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
FT   gene            complement(167271..167681)
FT                   /locus_tag="Rv0141c"
FT   CDS_pept        complement(167271..167681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0141c"
FT                   /product="Unknown protein"
FT                   /note="Rv0141c, (MTCI5.15c), len: 136 aa. Unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0141c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42866"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:P96818"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42866.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
FT   gene            167711..168637
FT                   /locus_tag="Rv0142"
FT   CDS_pept        167711..168637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0142"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0142, (MTCI5.16), len: 308 aa. Conserved
FT                   hypothetical protein, similar, except in N-terminus, to
FT                   AB88922.1|AL353862 hypothetical protein SCE34.20 from
FT                   Streptomyces coelicolor (326 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0142"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42867"
FT                   /db_xref="GOA:P96819"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:P96819"
FT                   /protein_id="CCP42867.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
FT   gene            complement(168704..170182)
FT                   /locus_tag="Rv0143c"
FT   CDS_pept        complement(168704..170182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0143c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0143c, (MTCI5.17c), len: 492 aa. Probable
FT                   conserved transmembrane protein, CIC family possibly
FT                   involved in transport of chloride, similar to others and
FT                   hypothetical proteins e.g. O28857 putative chloride channel
FT                   from Archaeoglobus fulgidus (589 aa), FASTA scores: opt:
FT                   966, E(): 0, (37.7% identity in 453 aa overlap);
FT                   YADQ_ECOLI|P37019 hypothetical 46.0 kDa protein (436
FT                   aa),FASTA scores: opt: 452, E(): 2.4e-20, (28.0% identity
FT                   in 460 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0143c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42868"
FT                   /db_xref="GOA:P96820"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:P96820"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42868.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
FT   gene            170284..171126
FT                   /locus_tag="Rv0144"
FT   CDS_pept        170284..171126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0144"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly TetR-family)"
FT                   /note="Rv0144, (MTCI5.18), len: 280 aa. Probable
FT                   transcriptional regulator, possibly TetR family. Has region
FT                   similar to others e.g.
FT                   Q59431|UIDR_ECOLI|GUSR|B1618|Z2623|ECS2326 UID operon
FT                   repressor (GUS operon) from Escherichia coli strains K12
FT                   and O157:H7 (196 aa), FASTA scores: opt: 214, E():
FT                   1.1e-06,(26.0% identity in 196 aa overlap). Contains
FT                   probable helix-turn helix motif from aa 109-130 (Score
FT                   1463, +4.17 SD). Could belong to the TetR/AcrR family of
FT                   transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0144"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42869"
FT                   /db_xref="GOA:P96821"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:P96821"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42869.1"
FT                   /translation="MPHSWTPTSVMTPPLVVAAFRPVGHYRLATDRAGGPCSPPATGAK
FT                   LTSSVASRPTVGTKPQWWHTLVMSMSLTAGRGPGRPPAAKADETRKRILHAARQVFSER
FT                   GYDGATFQEIAVRADLTRPAINHYFANKRVLYQEVVEQTHELVIVAGIERARREPTLMG
FT                   RLAVVVDFAMEADAQYPASTAFLATTVLESQRHPELSRTENDAVRATREFLVWAVNDAI
FT                   ERGELAADVDVSSLAETLLVVLCGVGFYIGFVGSYQRMATITDSFQQLLAGTLWRPPT"
FT   gene            171215..172168
FT                   /locus_tag="Rv0145"
FT   CDS_pept        171215..172168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0145"
FT                   /product="Possible S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Rv0145, (MTCI5.19), len: 317 aa. Possible
FT                   S-adenosylmethionine-dependent methyltransferase (see Grana
FT                   et al., 2007), highly similar to many e.g.
FT                   CAC32172.1|AL583926 conserved hypothetical protein from
FT                   Mycobacterium leprae (310 aa); and several Mycobacterium
FT                   tuberculosis proteins e.g. Rv0726c, Rv0731c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0145"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42870"
FT                   /db_xref="GOA:P9WFJ1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFJ1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42870.1"
FT                   /translation="MTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAAT
FT                   NPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYF
FT                   GAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTAR
FT                   RHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQ
FT                   VAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSN
FT                   REEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA"
FT   gene            172211..173143
FT                   /locus_tag="Rv0146"
FT   CDS_pept        172211..173143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0146"
FT                   /product="Possible S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Rv0146, (MTCI5.20), len: 310 aa. Possible
FT                   S-adenosylmethionine-dependent methyltransferase (see Grana
FT                   et al., 2007), highly similar to others e.g.
FT                   AC30975.1|AL583924 conserved hypothetical protein from
FT                   Mycobacterium leprae (304 aa); and several Mycobacterium
FT                   tuberculosis proteins e.g. Rv0726c, Rv0731c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0146"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42871"
FT                   /db_xref="GOA:P9WFJ3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFJ3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42871.1"
FT                   /translation="MRTHDDTWDIKTSVGATAVMVAAARAVETDRPDPLIRDPYARLLV
FT                   TNAGAGAIWEAMLDPTLVAKAAAIDAETAAIVAYLRSYQAVRTNFFDTYFASAVAAGIR
FT                   QVVILASGLDSRAYRLDWPAGTIVYEIDQPKVLSYKSTTLAENGVTPSAGRREVPADLR
FT                   QDWPAALRDAGFDPTARTAWLAEGLLMYLPAEAQDRLFTQVGAVSVAGSRIAAETAPVH
FT                   GEERRAEMRARFKKVADVLGIEQTIDVQELVYHDQDRASVADWLTDHGWRARSQRAPDE
FT                   MRRVGRWVEGVPMADDPTAFAEFVTAERL"
FT   gene            173238..174758
FT                   /locus_tag="Rv0147"
FT   CDS_pept        173238..174758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0147"
FT                   /product="Probable aldehyde dehydrogenase (NAD+) dependent"
FT                   /note="Rv0147, (MTCI5.21), len: 506 aa. Probable aldehyde
FT                   dehydrogenase (NAD+) dependent, similar to others e.g.
FT                   DHAP_RAT|P11883 aldehyde dehydrogenase (dimeric
FT                   NADP-preferring) (452 aa), FASTA scores: opt: 1291, E():
FT                   0,(43.9% identity in 453 aa overlap). Also similar to
FT                   several Mycobacterium tuberculosis aldehyde dehydrogenases
FT                   e.g. Rv0768, Rv2858c, etc. Contains PS00687 aldehyde
FT                   dehydrogenases glutamic acid active site, and PS00070
FT                   aldehyde dehydrogenases cysteine active site. Belongs to
FT                   the aldehyde dehydrogenases family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0147"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42872"
FT                   /db_xref="GOA:P96824"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:P96824"
FT                   /inference="protein motif:PROSITE:PS00687"
FT                   /inference="protein motif:PROSITE:PS00070"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42872.1"
FT                   /translation="MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQ
FT                   TDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY
FT                   LADIATTSAEAKYAAKRVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFY
FT                   LTLGPAVGAIAAGNAVVLKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIA
FT                   QGFDRVMFTGGTEIGRKVYEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKL
FT                   LNAGQTCVAPDYVLADATVRDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAA
FT                   AKTDAAADGGGVVVGGDCDASNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDD
FT                   AIRFVNSRPKPLSAYLFTKSRAVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASG
FT                   MGAYHGRWGFEEFSHRKSVLTKPTRPDLSSFIYPPYTERAIKVARRLF"
FT   gene            174833..175693
FT                   /locus_tag="Rv0148"
FT   CDS_pept        174833..175693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0148"
FT                   /product="Probable short-chain type
FT                   dehydrogenase/reductase"
FT                   /note="Rv0148, (MTCI5.22), len: 286 aa. Probable
FT                   short-chain dehydrogenase, similar to others, in particular
FT                   Estradiol 17 beta-dehydrogenases, e.g. DHB4_MOUSE|P51660
FT                   estradiol 17 beta-dehydrogenase 4 (735 aa), FASTA scores:
FT                   opt: 952, E(): 0, (52.5% identity in 276 aa overlap).
FT                   Contains PS00061 Short-chain alcohol dehydrogenase family
FT                   signature. Belongs to the short-chain
FT                   dehydrogenases/reductases (SDR) family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0148"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42873"
FT                   /db_xref="GOA:P96825"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96825"
FT                   /inference="protein motif:PROSITE:PS00061"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42873.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGT
FT                   GAGSAMADEVVAEIRDKGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILR
FT                   DGTFHKMSFENWDAVLKVHLYGGYHVLRAAWPHFREQSYGRVVVATSTSGLFGNFGQTN
FT                   YGAAKLGLVGLINTLALEGAKYNIHANALAPIAATRMTQDILPPEVLEKLTPEFVAPVV
FT                   AYLCTEECADNASVYVVGGGKVQRVALFGNDGANFDKPPSVQDVAARWAEITDLSGAKI
FT                   AGFKL"
FT   gene            175700..176668
FT                   /locus_tag="Rv0149"
FT   CDS_pept        175700..176668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0149"
FT                   /product="Possible quinone oxidoreductase (NADPH:quinone
FT                   oxidoreductase) (zeta-crystallin)"
FT                   /note="Rv0149, (MTCI5.23), len: 322 aa. Possible quinone
FT                   oxidoreductase, similar to others oxidoreductases e.g.
FT                   Q08257 quinone oxidoreductase (329 aa), FASTA scores: opt:
FT                   397, E(): 3.2e-18, (28.4% identity in 328 aa overlap);
FT                   SCHCOADH_4 from Streptomyces coelicolor. Also similar to
FT                   many proteins from Mycobacterium tuberculosis. Contains
FT                   PS01162 Quinone oxidoreductase / zeta-crystallin signature.
FT                   Belongs to the zinc-containing alcohol dehydrogenase
FT                   family, quinone oxidoreductase subfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0149"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42874"
FT                   /db_xref="GOA:P96826"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:P96826"
FT                   /inference="protein motif:PROSITE:PS01162"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42874.1"
FT                   /translation="MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLL
FT                   LTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANV
FT                   VRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQ
FT                   AGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDD
FT                   ALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGL
FT                   NQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP"
FT   gene            complement(176665..176952)
FT                   /locus_tag="Rv0150c"
FT   CDS_pept        complement(176665..176952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0150c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0150c, (MTCI5.24c), len: 95 aa. Conserved
FT                   hypothetical protein, showing some similarity with
FT                   C-terminus of O53949|Rv1800|MTV049.22 PPE-family protein
FT                   from Mycobacterium tuberculosis (655 aa), FASTA score:
FT                   (36.5% identity in 104 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0150c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42875"
FT                   /db_xref="UniProtKB/TrEMBL:P96827"
FT                   /protein_id="CCP42875.1"
FT                   /translation="MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTA
FT                   DIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA"
FT   gene            complement(177543..179309)
FT                   /gene="PE1"
FT                   /locus_tag="Rv0151c"
FT   CDS_pept        complement(177543..179309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE1"
FT                   /locus_tag="Rv0151c"
FT                   /product="PE family protein PE1"
FT                   /note="Rv0151c, (MTCI5.25c), len: 588 aa. PE1, Member of
FT                   the Mycobacterium tuberculosis PE family (see citation
FT                   below), with N-terminal region similar to others e.g.
FT                   MTV032_2 PE_PGRS family from Mycobacterium tuberculosis
FT                   (468 aa), FASTA scores: opt: 1125, E(): 0, (46.3% identity
FT                   in 456 aa overlap); MTCY493_24 from Mycobacterium
FT                   tuberculosis FASTA score: (42.5% identity in 558 aa
FT                   overlap). Also similar to upstream ORF MTCI5.26c FASTA
FT                   score: (54.7% identity in 464 aa overlap). Also shows
FT                   similarity to C-terminal part of some PPE family proteins
FT                   e.g. MTV049_21 from Mycobacterium tuberculosis FASTA score:
FT                   (41.5% identity in 591 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0151c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42876"
FT                   /db_xref="GOA:Q79G06"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q79G06"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42876.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDGWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAANAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
FT   gene            complement(179319..180896)
FT                   /gene="PE2"
FT                   /locus_tag="Rv0152c"
FT   CDS_pept        complement(179319..180896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE2"
FT                   /locus_tag="Rv0152c"
FT                   /product="PE family protein PE2"
FT                   /note="Rv0152c, (MTCI5.26c), len: 525 aa. PE2, Member of
FT                   the Mycobacterium tuberculosis PE family (see citation
FT                   below), similar to ORF downstream Z92770|MTCI5_25 (588
FT                   aa),FASTA scores: opt: 1492, E(): 0, (54.7% identity in 464
FT                   aa overlap); and to many other PE family type members.
FT                   Predicted to be an outer membrane protein (See Song et
FT                   al.,2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0152c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42877"
FT                   /db_xref="GOA:Q79G05"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:Q79G05"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42877.1"
FT                   /translation="MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYAD
FT                   AEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRC
FT                   RSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWS
FT                   QSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYG
FT                   ATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGAT
FT                   KLPTSPGYTGVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNY
FT                   GYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLP
FT                   QPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQL
FT                   AAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPP
FT                   TTVYRPRQ"
FT   gene            complement(181155..181985)
FT                   /gene="ptbB"
FT                   /gene_synonym="MPtpB"
FT                   /locus_tag="Rv0153c"
FT   CDS_pept        complement(181155..181985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptbB"
FT                   /gene_synonym="MPtpB"
FT                   /locus_tag="Rv0153c"
FT                   /product="Phosphotyrosine protein phosphatase PTPB
FT                   (protein-tyrosine-phosphatase) (PTPase)"
FT                   /note="Rv0153c, (MTCI5.27c), len: 276 aa. PtbB (alternate
FT                   gene name: MPtpB), protein-tyrosine-phosphatase (see
FT                   citation below), showing some similarity to several
FT                   protein-tyrosine phosphatases, polyketide synthase and
FT                   aminotransferase e.g. Q05918|IPHP_NOSCO|IPH
FT                   protein-tyrosine-phosphatase precursor from Nostoc commune
FT                   (294 aa), FASTA scores: opt: 150, E(): 0.0096, (26.8%
FT                   identity in 269 aa overlap); etc. Supposedly a secreted
FT                   protein. Potent and selective inhibitor is an isoxazole
FT                   compound (See Seollner et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0153c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42878"
FT                   /db_xref="GOA:I6WXK4"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:I6WXK4"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42878.1"
FT                   /translation="MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLR
FT                   RLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTN
FT                   DGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAG
FT                   KDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTF
FT                   TKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG"
FT   gene            complement(181987..183198)
FT                   /gene="fadE2"
FT                   /locus_tag="Rv0154c"
FT   CDS_pept        complement(181987..183198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE2"
FT                   /locus_tag="Rv0154c"
FT                   /product="Probable acyl-CoA dehydrogenase FadE2"
FT                   /note="Rv0154c, (MTCI5.28c), len: 403 aa. Probable
FT                   fadE2,acyl-CoA dehydrogenase, similar to many e.g.
FT                   C-terminal region of O01590 acyl-CoA dehydrogenase (974
FT                   aa), FASTA scores: opt: 1150, E(): 0, (50.0% identity in
FT                   402 aa overlap); ACDS_MEGEL|Q06319 acyl-CoA dehydrogenase
FT                   (short-chain) (383 aa), FASTA score: (35.0% identity in 306
FT                   aa overlap). Could belong to the acyl-CoA dehydrogenases
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0154c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42879"
FT                   /db_xref="GOA:P96831"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P96831"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42879.1"
FT                   /translation="MSAKAIDYRTRLSDFMTEHVFGAEADYDDYRRAAGPADHTAPPII
FT                   EELKTKAKDRGLWNLFLSAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEIL
FT                   HMFGTEQQRAQWLRPLLDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWW
FT                   TSGAADPRCKILIVMGRTNPDAAAHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCE
FT                   IDYHNVRVPATNLLGEEGSGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVA
FT                   FGRPLAEQGVVQQAIAQSRNEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVA
FT                   CDVIDRAIQVHGAAGVSDDTPLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFA
FT                   AAVT"
FT   gene            183622..184722
FT                   /gene="pntAa"
FT                   /locus_tag="Rv0155"
FT   CDS_pept        183622..184722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAa"
FT                   /locus_tag="Rv0155"
FT                   /product="Probable NAD(P) transhydrogenase (subunit alpha)
FT                   PntAa [first part; catalytic part] (pyridine nucleotide
FT                   transhydrogenase subunit alpha) (nicotinamide nucleotide
FT                   transhydrogenase subunit alpha)"
FT                   /note="Rv0155, (MTCI5.29), len: 366 aa. Probable
FT                   pntAa,first part of NAD(P) transhydrogenase subunit
FT                   alpha,similar to N-terminus of others e.g.
FT                   PNTA_ECOLI|P07001|P76888|B1603 NAD (P) transhydrogenase
FT                   subunit alpha from Escherichia coli strain K12 (510
FT                   aa),FASTA scores: opt: 921, E(): 0, (42.1% identity in 361
FT                   aa overlap); proton-translocating nicotinamide nucleotide
FT                   transhydrogenase subunit PNTAA."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0155"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42880"
FT                   /db_xref="GOA:P96832"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:P96832"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42880.1"
FT                   /translation="MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEA
FT                   GAGERALLPDELYTAVGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNAD
FT                   NSIGALTQAGVQAFALEAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTT
FT                   AAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGIS
FT                   ASGEGGYARELTDDERAQQQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPG
FT                   SVVVDLAGETGGNCELTEPGRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLL
FT                   IKDGRLAPDFDDEVIAQSCVTRGKDS"
FT   gene            184723..185055
FT                   /gene="pntAb"
FT                   /locus_tag="Rv0156"
FT   CDS_pept        184723..185055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAb"
FT                   /locus_tag="Rv0156"
FT                   /product="Probable NAD(P) transhydrogenase (subunit alpha)
FT                   PntAb [second part; integral membrane protein] (pyridine
FT                   nucleotide transhydrogenase subunit alpha) (nicotinamide
FT                   nucleotide transhydrogenase subunit alpha)"
FT                   /note="Rv0156, (MTCI5.30), len: 110 aa. Probable
FT                   pntAb,second part of NAD(P) transhydrogenase subunit
FT                   alpha,integral membrane protein, similar to C-terminus of
FT                   others e.g. Q59764 nicotinamide nucleotide transhydrogenase
FT                   subunit PNTAB (139 aa), FASTA scores: opt: 247, E():
FT                   1.9e-11, (45.5% identity in 88 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0156"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42881"
FT                   /db_xref="GOA:P96833"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:P96833"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42881.1"
FT                   /translation="MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
FT   gene            185052..186479
FT                   /gene="pntB"
FT                   /locus_tag="Rv0157"
FT   CDS_pept        185052..186479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="Rv0157"
FT                   /product="Probable NAD(P) transhydrogenase (subunit beta)
FT                   PntB [integral membrane protein] (pyridine nucleotide
FT                   transhydrogenase subunit beta) (nicotinamide nucleotide
FT                   transhydrogenase subunit beta)"
FT                   /note="Rv0157, (MTCI5.31), len: 475 aa. Probable
FT                   pntB,pyridine nucleotide transhydrogenase (nicotinamide
FT                   nucleotide transhydrogenase) subunit beta, integral
FT                   membrane protein, similar to others e.g. Q59763
FT                   proton-translocating nicotinamide nucleotide
FT                   transhydrogenase subunit beta from hodospirillum rubrum
FT                   (464 aa), FASTA scores: opt: 1344, E(): 0, (46.4% identity
FT                   in 472 aa overlap);
FT                   P07002|PNTB_ECOLI|P76890|PNTB|B1602|Z2597|ECS2308 NAD(P)
FT                   transhydrogenase subunit beta from Escherichia coli strains
FT                   K12 and O157:H7 (462 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0157"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42882"
FT                   /db_xref="GOA:P96834"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:P96834"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42882.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
FT   gene            complement(186495..186623)
FT                   /locus_tag="Rv0157A"
FT   CDS_pept        complement(186495..186623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0157A"
FT                   /product="Conserved protein"
FT                   /note="Rv0157A, len: 42 aa. Conserved protein, showing
FT                   similarity to C-terminal part (aa 186-220) of
FT                   O53976|Rv1975|MTV051.13 conserved hypothetical protein from
FT                   Mycobacterium tuberculosis (221 aa), FASTA scores: opt:
FT                   173, E(): 3e-06, (62.5% identity in 40 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0157A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42883"
FT                   /db_xref="UniProtKB/TrEMBL:I6WXK8"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42883.1"
FT                   /translation="MMDPSPDYDVSDEIEFFFRYLTWGLRGVETGDGYPPPAYPPV"
FT   gene            186785..187429
FT                   /locus_tag="Rv0158"
FT   CDS_pept        186785..187429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0158"
FT                   /product="Probable transcriptional regulatory protein
FT                   (possibly TetR-family)"
FT                   /note="Rv0158, (MTV032.01), len: 214 aa. Probable
FT                   transcriptional regulator, possibly TetR family, showing
FT                   weak similarity to various transcriptional activators and
FT                   repressors e.g. P32398|YIXD_BACSU|YHGD hypothetical
FT                   transcriptional regulatory protein from Bacillus subtilis
FT                   (191 aa), FASTA scores: opt:172, E(): 2.4e-05, (23.0%
FT                   identity in 191 aa overlap). Contains helix-turn-helix
FT                   motif at aa 32-53 (Score 1296, +3.60 SD). Could belong to
FT                   the TetR/AcrR family of transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0158"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42884"
FT                   /db_xref="GOA:O53641"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:O53641"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42884.1"
FT                   /translation="MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNK
FT                   ATVYHYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERA
FT                   AVYFQEQPYITEWFTSEQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYI
FT                   GMTLGSYRWLRPSGRRTAKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET"
FT   gene            complement(187433..188839)
FT                   /gene="PE3"
FT                   /locus_tag="Rv0159c"
FT   CDS_pept        complement(187433..188839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE3"
FT                   /locus_tag="Rv0159c"
FT                   /product="PE family protein PE3"
FT                   /note="Rv0159c, (MTV032.02c), len: 468 aa. PE3, Member of
FT                   the Mycobacterium tuberculosis PE family (see citation
FT                   below), similar to many other PE proteins e.g. O06828 from
FT                   Mycobacterium tuberculosis (528 aa), FASTA scores: opt:
FT                   1163, E(): 0, (45.8% identity in 467 aa overlap). Also
FT                   highly similar to upstream MTV032_3, and to
FT                   MTCI5_25,MTCI5_26, MTV049_ 21, MTCY1A10_26, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0159c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42885"
FT                   /db_xref="GOA:Q79G04"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q79G04"
FT                   /protein_id="CCP42885.1"
FT                   /translation="MSYVIAAPEMLATTAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLPFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
FT   gene            complement(188931..190439)
FT                   /gene="PE4"
FT                   /locus_tag="Rv0160c"
FT   CDS_pept        complement(188931..190439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE4"
FT                   /locus_tag="Rv0160c"
FT                   /product="PE family protein PE4"
FT                   /note="Rv0160c, (MTV032.03c), len: 502 aa. PE4, Member of
FT                   the Mycobacterium tuberculosis PE family (see citation
FT                   below), similar to many other PE proteins e.g.
FT                   Z92770|MTCI5_26c from Mycobacterium tuberculosis (525
FT                   aa),FASTA scores: opt: 816, E(): 0, (41.4% identity in 367
FT                   aa overlap); C-terminal region of O06801|RV1768|MTCY28.34
FT                   from Mycobacterium tuberculosis (618 aa), FASTA scores:
FT                   opt: 417, E(): 6.7e-18, (53.5% identity in 142 aa overlap).
FT                   Also highly similar to downstream ORF MTV032_2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0160c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42886"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:L7N661"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42886.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRAPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
FT   gene            190607..191956
FT                   /locus_tag="Rv0161"
FT   CDS_pept        190607..191956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0161"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0161, (MTCI28.01, MTV032.04), len: 449 aa.
FT                   Possible oxidoreductase, similar to hypothetical proteins
FT                   and various oxidoreductases e.g. AIP2_YEAST|P46681 actin
FT                   interacting protein 2 (530 aa), FASTA scores: opt: 356, E
FT                   (): 0, (33.3% identity in 357 aa overlap);
FT                   DLD1_YEAST|P32891 d-lactate dehydrogenase (cytochrome) (587
FT                   aa), FASTA scores: opt: 311, E(): 2.5e-20, (27.9% identity
FT                   in 366 aa overlap). Also similar to other Mycobacteria
FT                   proteins e.g. MTCY339.30c from Mycobacterium tuberculosis
FT                   FASTA score: (29.4% identity in 357 aa overlap);
FT                   MLCL622.30c from Mycobacterium tuberculosis (449 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0161"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42887"
FT                   /db_xref="GOA:O07406"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:O07406"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42887.1"
FT                   /translation="MLTSLVSAVGSHHVTTDPDVLAGRSVDHTGRYRGRASALVRPGSA
FT                   EEVAEVLRVCRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLCVVSDVDTVERRIEI
FT                   GAGVTLAAVQHAASTAGLVFGVDLSARDTATVGGMASTNAGGLRTVRYGNMGEQVVGLD
FT                   VALPDGTVLRRHSRVRRDNTGYDLPALFVGAEGTLGVITALDLRLHPTPSHRVTAVCGF
FT                   AELAALVDAGRMFRDVEGIAALELIDGRAAALTREHLGVRPPVEADWLLLVELAADHDQ
FT                   TDRLADLLGGARMCGEPAVGVDAAAQQRLWRTRESLAEVLGVYGPPLKFDVSLPLSAIS
FT                   GFARDAVALVHRHVPDSPEALPLLFGHIGEGNLHLNVLRCPPDREPALYAKMMGLIAEC
FT                   GGNVSSEHGVGSRKRAYLGMSRQANDVAAMRRVKAALDPTGYLNAAVLFD"
FT   gene            complement(191984..193135)
FT                   /gene="adhE1"
FT                   /locus_tag="Rv0162c"
FT   CDS_pept        complement(191984..193135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhE1"
FT                   /locus_tag="Rv0162c"
FT                   /product="Probable zinc-type alcohol dehydrogenase (E
FT                   subunit) AdhE1"
FT                   /note="Rv0162c, (MTCI28.02c), len: 383 aa. Probable
FT                   adhE1,zinc-type alcohol dehydrogenase, similar to others
FT                   e.g. ADH_MACMU|P28469 alcohol dehydrogenase alpha chain
FT                   (374 aa), FASTA scores: opt: 619, E(): 0, (34.7% identity
FT                   in 363 aa overlap). Also similar to other alcohol
FT                   dehydrogenases from Mycobacterium tuberculosis e.g.
FT                   MTCY369.06c FASTA score: (34.0% identity in 365 aa
FT                   overlap), MTV022_9 FASTA score: (35.0% identity in 371 aa
FT                   overlap). Contains PS00059 Zinc-containing alcohol
FT                   dehydrogenases signature. Belongs to the zinc-containing
FT                   alcohol dehydrogenase family,class-I subfamily. Cofactor:
FT                   zinc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0162c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42888"
FT                   /db_xref="GOA:L7N6B3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:L7N6B3"
FT                   /inference="protein motif:PROSITE:PS00059"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42888.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
FT   gene            193117..193572
FT                   /locus_tag="Rv0163"
FT   CDS_pept        193117..193572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0163"
FT                   /product="Conserved protein"
FT                   /note="Rv0163, (MTCI28.03), len: 151 aa. Conserved
FT                   protein,similar to others e.g. Q44017 hypothetical 16.6 KDA
FT                   protein in GBD 5'region (ORF6)from Alcaligenes eutrophus
FT                   (145 aa),FASTA scores: opt: 155, E(): 0.0002, (26.6%
FT                   identity in 139 aa overlap). Also weak similarity with
FT                   MTV008.31c|Rv2475c|B70867 from Mycobacterium tuberculosis
FT                   (138 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0163"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42889"
FT                   /db_xref="GOA:O07408"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:O07408"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42889.1"
FT                   /translation="MAALPAPEKLLRSDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDT
FT                   AINAWINTSTGVDPLAMPVLGIVAESGCRYFSELRFPESLMVGLAVTRLGRSSVTYRLG
FT                   VFKEPDDAGVITALGHWVHVYVDRTSRRPVPIPEAIRSLLSTACVSG"
FT   gene            193626..194111
FT                   /gene="TB18.5"
FT                   /locus_tag="Rv0164"
FT   CDS_pept        193626..194111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TB18.5"
FT                   /locus_tag="Rv0164"
FT                   /product="Conserved protein TB18.5"
FT                   /note="Rv0164, (MTCI28.04), len: 161 aa. TB18.5, conserved
FT                   protein, equivalent to CAB08818.1|Z95398 hypothetical
FT                   protein from Mycobacterium leprae (156 aa) FASTA scores:
FT                   opt: 762, E(): 0, (76.3% identity in 152 aa overlap). Some
FT                   similarity to Rv2185c, Rv0854, Rv0857 from Mycobacterium
FT                   tuberculosis. Alternative start codon has been suggested.
FT                   3' part corrected since first submission (-24 aa). A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004). Predicted to be an outer membrane
FT                   protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0164"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42890"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:L7N657"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42890.1"
FT                   /translation="MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEW
FT                   NEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQ
FT                   EQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS"
FT   gene            complement(194144..194815)
FT                   /gene="mce1R"
FT                   /locus_tag="Rv0165c"
FT   CDS_pept        complement(194144..194815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1R"
FT                   /locus_tag="Rv0165c"
FT                   /product="Probable transcriptional regulatory protein Mce1R
FT                   (probably GntR-family)"
FT                   /note="Rv0165c, (MTCI28.05c), len: 223 aa. Probable
FT                   mce1R,transcriptional regulator, GntR family (See Casali et
FT                   al.,2006), showing some similarity to several e.g.
FT                   NTRA_CHELE|P54988 nta operon transcriptional regulator (231
FT                   aa), FASTA scores: opt: 154, E(): 0.00058, (32.0% identity
FT                   in 125 aa overlap); P46833|GNTR_BACLI gluconate operon
FT                   transcriptional repressor from Bacillus licheniformis (243
FT                   aa); GNTR_BACSU gluconate operon repressor from Bacillus
FT                   subtilis (243 aa). Also similar to Rv0043c from
FT                   Mycobacterium tuberculosis. Seems to belong to the GntR
FT                   family of transcriptional regulators. Start changed since
FT                   first submission (-41 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0165c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42891"
FT                   /db_xref="GOA:Q79G00"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q79G00"
FT                   /protein_id="CCP42891.1"
FT                   /translation="MNAPLSAKPRSQLPLRRAQLSDEVAGHLRAAIMSGALRSGTFIRL
FT                   DETAAELGVSVTPVREALLKLRGEGMVGLEPHRGHVVLPLTRQDIDDIFWLQATIAQEL
FT                   ATSATAHITDVEIDELDRINNALAGAIGSGDAKTIASIEFAFHRVFNKASRRIKLAWFL
FT                   LNAARYMGAGVRGRPAMGRGRGEQSSAADRRAAPPRHSRRNRAHRLAVHRWGTQADGGP
FT                   G"
FT   gene            194993..196657
FT                   /gene="fadD5"
FT                   /locus_tag="Rv0166"
FT   CDS_pept        194993..196657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD5"
FT                   /locus_tag="Rv0166"
FT                   /product="Probable fatty-acid-CoA ligase FadD5
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0166, (MTCI28.06), len: 554 aa. Probable
FT                   fadD5,fatty-acid-CoA synthetase, similar to many eg
FT                   LCFA_ECOLI|P29212 long-chain-fatty-acid--CoA ligase (561
FT                   aa), FASTA scores: opt: 612, E(): 0, (29.4% identity in 534
FT                   aa overlap). Also similar to many other fatty-acid-CoA
FT                   ligases from Mycobacterium tuberculosis e.g. MTCY07A7.11c
FT                   FASTA score: (35.3% identity in 487 aa overlap),
FT                   MTV013_10,MTY25D10_30, etc. Contains PS00455 putative
FT                   AMP-binding domain signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0166"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42892"
FT                   /db_xref="GOA:O07411"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:O07411"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /protein_id="CCP42892.1"
FT                   /translation="MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPAL
FT                   RFVGNTMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIGAIAV
FT                   PLNFRLTPTEIAVLVEDCVAHVMLTEAALAPVAIGVRNIQPLLSVIVVAGGSSQDSVFG
FT                   YEDLLNEAGDVHEPVDIPNDSPALIMYTSGTTGRPKGAVLTHANLTGQAMTALYTSGAN
FT                   INSDVGFVGVPLFHIAGIGNMLTGLLLGLPTVIYPLGAFDPGQLLDVLEAEKVTGIFLV
FT                   PAQWQAVCTEQQARPRDLRLRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPV
FT                   TCMLLGEDAIAKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPE
FT                   ATAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVLASHPDIAE
FT                   VAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARYKHPKALEIVDALPRNPA
FT                   GKVLKTELRLRYGACVNVERRSASAGFTERRENRQKL"
FT   gene            196861..197658
FT                   /gene="yrbE1A"
FT                   /locus_tag="Rv0167"
FT   CDS_pept        196861..197658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="Rv0167"
FT                   /product="Conserved integral membrane protein YrbE1A"
FT                   /note="Rv0167, (MTCI28.07), len: 265 aa. YrbE1A, unknown
FT                   integral membrane protein, part of mce1 operon and member
FT                   of YrbE family (see citations below), highly similar to
FT                   Mycobacterium tuberculosis proteins
FT                   O07791|Rv0587|MTCY19H5.35|yrbE2A (265 aa);
FT                   O53965|Rv1964|MTV051.02|yrbE3A (265 aa); etc. Also highly
FT                   similar or similar to conserved hypothetical integral
FT                   membrane proteins of yrbEA type, e.g. NP_302654.1|NC_002677
FT                   conserved membrane protein from Mycobacterium leprae (267
FT                   aa); P45030|YRBE_HAEIN|HI1086 hypothetical protein from
FT                   Haemophilus influenzae (261 aa), FASTA scores: opt:
FT                   328,E(): 1.8e-15, (26.6% identity in 244 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0167"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42893"
FT                   /db_xref="GOA:O07412"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:O07412"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42893.1"
FT                   /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FT                   FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
FT                   TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
FT                   VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
FT                   LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
FT   gene            197660..198529
FT                   /gene="yrbE1B"
FT                   /locus_tag="Rv0168"
FT   CDS_pept        197660..198529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="Rv0168"
FT                   /product="Conserved integral membrane protein YrbE1B"
FT                   /note="Rv0168, (MTCI28.08), len: 289 aa. YrbE1B, unknown
FT                   integral membrane protein, part of mce1 operon and member
FT                   of YrbE family (see citations below), highly similar to
FT                   Mycobacterium tuberculosis proteins
FT                   O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa);
FT                   O53966|Rv1965|MTV051.03|yrbE3B (271 aa); etc. Also highly
FT                   similar to conserved hypothetical integral membrane
FT                   proteins of the yrbEB type, e.g. NP_302655.1|NC_002677
FT                   conserved membrane protein from Mycobacterium leprae (289
FT                   aa); P45030|YRBE_HAEIN|HI1086 hypothetical protein from
FT                   Haemophilus influenzae (261 aa), FASTA scores: opt:
FT                   223,E(): 7.6e-07, (23.7% identity in 257 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0168"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42894"
FT                   /db_xref="GOA:L0T2Q9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:L0T2Q9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42894.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
FT   gene            198534..199898
FT                   /gene="mce1A"
FT                   /gene_synonym="mce1"
FT                   /locus_tag="Rv0169"
FT   CDS_pept        198534..199898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /gene_synonym="mce1"
FT                   /locus_tag="Rv0169"
FT                   /product="Mce-family protein Mce1A"
FT                   /note="Rv0169, (MTCI28.09), len: 454 aa. Mce1A; belongs to
FT                   24-membered Mycobacterium tuberculosis Mce protein family
FT                   (see citations below), highly similar to Mycobacterium
FT                   tuberculosis proteins O07789|MCE2|Rv0589|MTCY19H5.33c|mce2A
FT                   (404 aa); O53967|MCE3|Rv1966|MTV051.04|mce3A (425 aa); etc.
FT                   Also highly similar to others e.g.
FT                   AAD52105.1|AF113402_1|AF113402 mycobacterial cell entry
FT                   protein from Mycobacterium bovis BCG (454 aa);
FT                   NP_302656.1|NC_002677 putative cell invasion protein from
FT                   Mycobacterium leprae (441 aa); AAA92845.1|U26018 mce gene
FT                   product from Mycobacterium avium (88 aa) (similarity on
FT                   C-terminus); CAC12798.1|AL445327 putative secreted protein
FT                   from Streptomyces coelicolor (418 aa); etc. Note that
FT                   equivalent, but longer 22 aa, to P72013|CAA50257.1|X70901
FT                   Mcep protein from Mycobacterium tuberculosis (432 aa).
FT                   Contains a very hydrophobic region around residues 20-35.
FT                   Note that previously known as mce1. A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004). Predicted to be an outer membrane protein (See
FT                   Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0169"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42895"
FT                   /db_xref="GOA:Q79FZ9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:Q79FZ9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42895.1"
FT                   /translation="MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKT
FT                   QLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPA
FT                   NVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKV
FT                   DPVKLNLTLSAAAEALTGLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYA
FT                   DAAPDLFDFLDSSVTTARTINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADL
FT                   VPTATLLDTYSPELFCTIRNFYDADPLAKAASGGGNGYSLRTNSEILSGIGISLLSPLA
FT                   LATNGAAIGIGLVAGLIAPPLAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGG
FT                   APGCWQPITRDLWPAPYLVMDTGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP"
FT   gene            199895..200935
FT                   /gene="mce1B"
FT                   /gene_synonym="mceD"
FT                   /locus_tag="Rv0170"
FT   CDS_pept        199895..200935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /gene_synonym="mceD"
FT                   /locus_tag="Rv0170"
FT                   /product="Mce-family protein Mce1B"
FT                   /note="Rv0170, (MTCI28.10), len: 346 aa. Mce1B (alternate
FT                   gene name: mceD); belongs to 24-membered Mycobacterium
FT                   tuberculosis Mce protein family (see citations
FT                   below),highly similar to Mycobacterium tuberculosis
FT                   proteins O07788|Rv0590|MTCY19H5.32c|mce2B (275 aa);
FT                   O53968|Rv1967|MTV051.05|mce3B (342 aa); etc. Also highly
FT                   similar to others e.g. NP_302657.1|NC_002677 putative
FT                   secreted protein from Mycobacterium leprae (346 aa);
FT                   CAC12797.1|AL445327 putative secreted protein from
FT                   Streptomyces coelicolor (354 aa); etc. Contains hydrophobic
FT                   region in N-terminal 30 residues. In Escherichia
FT                   coli,N-terminal part is functional and directs export of a
FT                   leaderless beta-lactamase into the periplasm (see Chubb et
FT                   al., 1998). Predicted to be an outer membrane protein (See
FT                   Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0170"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42896"
FT                   /db_xref="GOA:O07414"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:O07414"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42896.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDILDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
FT   gene            200932..202479
FT                   /gene="mce1C"
FT                   /locus_tag="Rv0171"
FT   CDS_pept        200932..202479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="Rv0171"
FT                   /product="Mce-family protein Mce1C"
FT                   /note="Rv0171, (MTCI28.11), len: 515 aa. Mce1C; belongs to
FT                   24-membered Mycobacterium tuberculosis Mce protein family
FT                   (see citations below), highly similar to Mycobacterium
FT                   tuberculosis proteins O07787|Rv0591|MTCY19H5.31|mce2C (481
FT                   aa); O53969|Rv1968|MTV051.06|mce3C (410 aa); etc. Also
FT                   highly similar to others e.g. NP_302658.1|NC_002677
FT                   putative secreted protein from Mycobacterium leprae (519
FT                   aa); CAC12796.1|AL445327 putative secreted protein from
FT                   Streptomyces coelicolor (351 aa); etc. Weakly similar to
FT                   downstream ORF Rv0172|MTCI28.12|mce1D (530 aa), FASTA
FT                   score: (24.6% identity in 552 aa overlap). Contains
FT                   possible signal sequence and highly proline-rich
FT                   C-terminus. Predicted to be an outer membrane protein (See
FT                   Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0171"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42897"
FT                   /db_xref="GOA:O07415"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:O07415"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42897.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
FT   gene            202476..204068
FT                   /gene="mce1D"
FT                   /locus_tag="Rv0172"
FT   CDS_pept        202476..204068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="Rv0172"
FT                   /product="Mce-family protein Mce1D"
FT                   /note="Rv0172, (MTCI28.12), len: 530 aa. Mce1D; belongs to
FT                   24-membered Mycobacterium tuberculosis Mce protein family
FT                   (see citations below), highly similar to Mycobacterium
FT                   tuberculosis proteins O07786|Rv0592|MTCY19H5.30c|mce2D (508
FT                   aa); O53970|Rv1969|MTV051.07|mce3D (423 aa); etc. Also
FT                   highly similar to others e.g. NP_302659.1|NC_002677
FT                   putative secreted protein from Mycobacterium leprae (531
FT                   aa); CAC12795.1|AL445327 putative secreted protein from
FT                   Streptomyces coelicolor (337 aa); etc. Hydrophobic region
FT                   at N-terminus. Predicted to be an outer membrane protein
FT                   (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0172"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42898"
FT                   /db_xref="GOA:O07416"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:O07416"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42898.1"
FT                   /translation="MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLT
FT                   NNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTP
FT                   EQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVARPFFAKNREVLTHDVN
FT                   NLATVTTTLLQPDPLDGLETVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMG
FT                   GPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAP
FT                   VGAPLPAEAGGGQ"
FT   gene            204065..205237
FT                   /gene="lprK"
FT                   /gene_synonym="mce1E"
FT                   /locus_tag="Rv0173"
FT   CDS_pept        204065..205237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprK"
FT                   /gene_synonym="mce1E"
FT                   /locus_tag="Rv0173"
FT                   /product="Possible Mce-family lipoprotein LprK (Mce-family
FT                   lipoprotein Mce1E)"
FT                   /note="Rv0173, (MTCI28.13), len: 390 aa. Possible lprK
FT                   (alternate gene name: mce1E), lipoprotein which belongs to
FT                   24-membered Mycobacterium tuberculosis Mce protein family
FT                   (see citations below), highly similar to Mycobacterium
FT                   tuberculosis proteins O07785|LPRL|Rv0593|MTCY19H5.29|mce2E
FT                   (402 aa); O53971|LPRM|Rv1970|MTV051.08|mce3E (377 aa); etc.
FT                   Also highly similar to others e.g. NP_302660.1|NC_002677
FT                   putative lipoprotein from Mycobacterium leprae (392 aa);
FT                   CAC12794.1|AL445327 putative secreted protein from
FT                   Streptomyces coelicolor (413 aa); etc. Contains PS00013
FT                   prokaryotic membrane lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0173"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42899"
FT                   /db_xref="GOA:O07417"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:O07417"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42899.1"
FT                   /translation="MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGP
FT                   GTGPGSYTIYVQMPDTLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPK
FT                   NATAKIGQTSLLGSQHVELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLR
FT                   GGGLVNLEGIQQEINAIVTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAY
FT                   VGGRSEVLNRVLTDLPPLIKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQ
FT                   ALQCPLKELRRAAPYLVGALKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAF
FT                   LTGTGFSGALRALEQSFGRDPETMIPDIRYTPNPNDAPGGPLVERGNRQC"
FT   gene            205231..206778
FT                   /gene="mce1F"
FT                   /locus_tag="Rv0174"
FT   CDS_pept        205231..206778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="Rv0174"
FT                   /product="Mce-family protein Mce1F"
FT                   /note="Rv0174, (MTCI28.14), len: 515 aa. Mce1F; belongs to
FT                   24-membered Mycobacterium tuberculosis Mce protein family
FT                   (see citations below), similar to Mycobacterium
FT                   tuberculosis proteins O07784|Rv0594|MTCY19H5.28c|mce2F (516
FT                   aa); O53972|Rv1971|MTV051.09|mce3F (437 aa); etc. Also
FT                   highly similar to others e.g. NP_302661.1|NC_002677
FT                   putative secreted protein from Mycobacterium leprae (516
FT                   aa); AAF74993.1|AF143400_1|AF143400|996A027a protein from
FT                   Mycobacterium avium (80 aa) (similarity on C-terminus);
FT                   CAC12793.1|AL445327 putative secreted protein from
FT                   Streptomyces coelicolor (433 aa); etc. Has hydrophobic
FT                   stretch, possibly a signal peptide at the N-terminus.
FT                   Predicted to be an outer membrane protein (See Song et
FT                   al.,2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0174"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42900"
FT                   /db_xref="GOA:L0T2W6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:L0T2W6"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42900.1"
FT                   /translation="MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKAD
FT                   LPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAV
FT                   GEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETA
FT                   QAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKL
FT                   NNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAG
FT                   VEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPR
FT                   PLPSGTYCKIPQDAQLQVRGARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPN
FT                   QILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQ
FT                   CNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS"
FT   repeat_region   206812..206850
FT                   /note="39 bp direct repeat
FT                   1,AGGTGAAGGCGGCGGATTCGGCGGAATCTGACGCCGGAG"
FT   gene            206814..207455
FT                   /locus_tag="Rv0175"
FT   CDS_pept        206814..207455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0175"
FT                   /product="Probable conserved Mce associated membrane
FT                   protein"
FT                   /note="Rv0175, (MTCI28.15), len: 213 aa. Probable conserved
FT                   Mce-associated membrane protein, equivalent, but longer in
FT                   N-terminus, to CAC32127.1|AL583926 possible membrane
FT                   protein from Mycobacterium leprae (182 aa). Also similar to
FT                   mce-associated proteins from Mycobacterium tuberculosis
FT                   e.g. Rv1363c, Rv0177, Rv1973, etc. Contains two 12 residue
FT                   direct repeats at N-terminus. A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0175"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42901"
FT                   /db_xref="GOA:O07419"
FT                   /db_xref="UniProtKB/TrEMBL:O07419"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42901.1"
FT                   /translation="MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVE
FT                   RRPSRLRRGWLVGIAATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAA
FT                   TQAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNN
FT                   NDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK"
FT   repeat_region   206869..206907
FT                   /locus_tag="Rv0175"
FT                   /note="39 bp direct repeat
FT                   2,AGGTGAAGGCGGCGGATTCGGCGGAATCTGACGCCGGAG"
FT   gene            207452..208420
FT                   /locus_tag="Rv0176"
FT   CDS_pept        207452..208420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0176"
FT                   /product="Probable conserved Mce associated transmembrane
FT                   protein"
FT                   /note="Rv0176, (MTCI28.16), len: 322 aa. Probable conserved
FT                   Mce-associated transmembrane protein. Contains short region
FT                   of similarity to PRA_MYCLE|P41484 proline-rich antigen (36
FT                   kDa antigen) from Mycobacterium leprae (249 aa) (outside
FT                   the proline-rich region), FASTA scores: opt: 165, E():
FT                   2.9e-05, (40.0% identity in 65 aa overlap). Also similar to
FT                   mce-associated proteins from Mycobacterium tuberculosis
FT                   e.g. Rv1363c, Rv0177, Rv3493c, etc. A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0176"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42902"
FT                   /db_xref="GOA:O07420"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:O07420"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42902.1"
FT                   /translation="MTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMA
FT                   LTALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAI
FT                   GPWRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRL
FT                   TAAVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRD
FT                   FERARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERG
FT                   TPPNQRYIQSTVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
FT   gene            208417..208971
FT                   /locus_tag="Rv0177"
FT   CDS_pept        208417..208971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0177"
FT                   /product="Probable conserved Mce associated protein"
FT                   /note="Rv0177, (MTCI28.17), len: 184 aa. Probable conserved
FT                   Mce-associated protein, equivalent to CAC32129.1|AL583926
FT                   conserved membrane protein from Mycobacterium leprae (184
FT                   aa). Also similar to mce-associated proteins from
FT                   Mycobacterium tuberculosis e.g. Rv1363c, Rv1973,
FT                   Rv3493c,etc. A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0177"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42903"
FT                   /db_xref="GOA:O07421"
FT                   /db_xref="UniProtKB/TrEMBL:O07421"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42903.1"
FT                   /translation="MSPRRKFEPGEGALLAPQSIEPSRRWGLPLALTASAVVMAAAISA
FT                   CALMRISHESHQRAAHKDIVMLSDVRSFMTMFTSPDPFHANEYAERVLSHATGDFAKQY
FT                   HERANDILIRISGVEPTTGTVLDAGVQRWNEDGSANVLVVTQITSKSADGKRVVSNANR
FT                   WLVTAKQEGNEWKISSLLPVI"
FT   gene            208938..209672
FT                   /locus_tag="Rv0178"
FT   CDS_pept        208938..209672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0178"
FT                   /product="Probable conserved Mce associated membrane
FT                   protein"
FT                   /note="Rv0178, (MTCI28.18), len: 244 aa. Probable conserved
FT                   Mce-associated membrane protein, highly similar in
FT                   C-terminus to CAC32130.1|AL583926 putative secreted protein
FT                   from Mycobacterium leprae (184 aa). Also similar to
FT                   mce-associated proteins from Mycobacterium tuberculosis
FT                   e.g. Rv1363c, Rv0177, Rv1973, etc. Note that there is a 10
FT                   aa overlap with the upstream ORF. A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0178"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42904"
FT                   /db_xref="GOA:O07422"
FT                   /db_xref="UniProtKB/TrEMBL:O07422"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42904.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
FT   gene            complement(209703..210812)
FT                   /gene="lprO"
FT                   /locus_tag="Rv0179c"
FT   CDS_pept        complement(209703..210812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprO"
FT                   /locus_tag="Rv0179c"
FT                   /product="Possible lipoprotein LprO"
FT                   /note="Rv0179c, (MTCI28.19c), len: 369 aa. Possible
FT                   lprO,lipoprotein (visibly not conserved). Contains possible
FT                   N-terminal signal sequence and PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0179c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42905"
FT                   /db_xref="GOA:O07423"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:O07423"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /protein_id="CCP42905.1"
FT                   /translation="MWIRAERVAVLTPTASLRRLTACYAALAVCAALACTTGQPAARAA
FT                   DGREMLAQAIATTRGSYLVYNFGGGHPMPLLNAGGHWYEMNNGGHLMIIKNASQRLSPH
FT                   LLVDTHTGDQARCEHNPGARTGEGLWQASEIYPPLKAWQRMGRPTIAVNANFFDVRGQK
FT                   GGSWRSTGCSSPLGAYVDNTRGQGRANQAVTGTVAYAGKQGLSGGNELWSSLTTMILPV
FT                   GGAPYVLRPKSRQDYDLATPVIEDLLNKNARFVAVAGIGLLSPGNTGQLHDGGPSAART
FT                   ALAYAKQKDEMYIFQGGNYTPDNIQDLFRGLGSDTAILLDGGGSSAIVLRRDTGGMWAG
FT                   AGSPKGSCDTRQVLCDSHERALPSWLAFN"
FT   gene            complement(210892..212250)
FT                   /locus_tag="Rv0180c"
FT   CDS_pept        complement(210892..212250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0180c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0180c, (MTCI28.20c), len: 452 aa. Probable
FT                   conserved transmembrane protein, equivalent to
FT                   CAC32132.1|AL583926 probable conserved membrane protein
FT                   from Mycobacterium leprae (465 aa). Shows some similarity
FT                   with others membrane proteins e.g. AL096849|SCI11_29 from
FT                   Streptomyces coelicolor (354 aa), FASTA scores: opt:
FT                   190,E(): 0.00067, (25.9% identity in 409 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0180c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42906"
FT                   /db_xref="GOA:O07424"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:O07424"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42906.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
FT   gene            complement(212277..213011)
FT                   /locus_tag="Rv0181c"
FT   CDS_pept        complement(212277..213011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0181c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0181c, (MTCI28.21c), len: 244 aa. Conserved
FT                   hypothetical protein, highly similar to other hypothetical
FT                   proteins e.g. YHHW_ECOLI|P46852 hypothetical 26.3 kd
FT                   protein from Escherichia coli (231 aa), FASTA scores: opt:
FT                   479, E(): 1.2e-29, (37.3% identity in 233 aa overlap);
FT                   P73623|SLL1773 hypothetical 25.7 kDa protein from
FT                   Synechocystis sp. strain PCC 6803 (232 aa), FASTA score:
FT                   (39.1% identity in 233 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0181c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42907"
FT                   /db_xref="GOA:P9WI85"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI85"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42907.1"
FT                   /translation="MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLV
FT                   NNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILH
FT                   SEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTL
FT                   HNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADARGL
FT                   TANEPSEVLIWEMHAKLGDSAT"
FT   gene            complement(213028..214140)
FT                   /gene="sigG"
FT                   /locus_tag="Rv0182c"
FT   CDS_pept        complement(213028..214140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigG"
FT                   /locus_tag="Rv0182c"
FT                   /product="Probable alternative RNA polymerase sigma factor
FT                   SigG (RNA polymerase ECF type sigma factor)"
FT                   /note="Rv0182c, (MTCI28.22c), len: 370 aa (start site
FT                   uncertain; first of several possibles was chosen, but note
FT                   that this overlaps the upstream ORF). Probable
FT                   sigG,alternative RNA polymerase sigma subunit (see
FT                   citations below), similar to many e.g. Q45585|SIGW_BACSU
FT                   RNA polymerase sigma factor from Bacillus subtilis (187
FT                   aa). Also similar to nine other ECF sigma factors from
FT                   Mycobacterium tuberculosis e.g. Rv1221, Rv0735, etc.
FT                   Contains PS01063 Sigma-70 factors ECF subfamily signature
FT                   and probable helix-turn helix motif from aa 205-226 (Score
FT                   1181, +3.21 SD). Belongs to the sigma-70 factor family, ECF
FT                   subfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0182c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42908"
FT                   /db_xref="GOA:P9WGG5"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGG5"
FT                   /inference="protein motif:PROSITE:PS01063"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42908.1"
FT                   /translation="MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAEN
FT                   SGREPADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGK
FT                   SSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERREVSWLEPLPDVTD
FT                   DPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVN
FT                   SLLQRARSQLQTVRPSAADRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWE
FT                   MPPYTGWYQGAQAIVTLIHQQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLH
FT                   VLDMAADRVSHVVAFLDTTLFPKFGLPDSL"
FT   gene            214088..214927
FT                   /locus_tag="Rv0183"
FT   CDS_pept        214088..214927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0183"
FT                   /product="Possible lysophospholipase"
FT                   /note="Rv0183, (MTCI28.23), len: 279 aa. Possible
FT                   lysophospholipase, similar to several (especially
FT                   eukaryotic enzymes, weaker with Escherichia coli), e.g.
FT                   U67963|HSU67963_1 Human lysophospholipase homolog from Homo
FT                   sapiens (313 aa), FASTA scores: opt: 569, E():
FT                   2.6e-29,(37.1% identity in 259 aa overlap);
FT                   P07000|PLDB_ECOLI lysophospholipase L2 from Escherichia
FT                   coli (165 aa), FASTA scores: opt: 219, E(): 0.00012. Start
FT                   changed based on similarity to AE001997_8 from Deinococcus
FT                   radiodurans (282 aa), FASTA scores: opt: 510, E(): 1.4e-25,
FT                   (34.8% identity in 282 aa overlap). Also shows some
FT                   similarity to epoxide hydrolases from Mycobacterium
FT                   tuberculosis e.g. Rv1938 FASTA score: (30.7% identity in
FT                   114 aa overlap); and
FT                   O07214|YR15_MYCTU|Rv2715|MT2788|MTCY05A6.36 (341 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0183"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42909"
FT                   /db_xref="GOA:O07427"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:6EIC"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07427"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42909.1"
FT                   /translation="MTTTRTERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARR
FT                   YDHVAQRLGAAGLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKR
FT                   IVLGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGVVVPGLPV
FT                   QELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGETMPRRAPALTAPLLVLH
FT                   GTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYHEVFNEPERNQVLDDVVAWLTERL"
FT   gene            214969..215718
FT                   /locus_tag="Rv0184"
FT   CDS_pept        214969..215718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0184"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0184, (MTCI28.24), len: 249 aa. Conserved
FT                   hypothetical protein, equivalent to CAC32136.1|AL583926
FT                   conserved hypothetical protein from Mycobacterium leprae
FT                   (249 aa); and C-terminus highly similar to
FT                   CAB08793.1|Z95398 conserved hypothetical protein from
FT                   Mycobacterium leprae (145 aa), FASTA scores: E(): 0, (75.2
FT                   identity in 145 aa overlap). Also similar to
FT                   049841|SCE9_39|T36358 hypothetical protein from
FT                   Streptomyces coelicolor (418 aa), FASTA scores: opt:
FT                   231,E(): 8.1e-08, (30.4% identity in 270 aa overlap). A
FT                   core mycobacterial gene; conserved in mycobacterial strains
FT                   (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0184"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42910"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:O07428"
FT                   /protein_id="CCP42910.1"
FT                   /translation="MTNDKMLARIAALLRQAEGTDNPHEADAFMSTAQRLATAASIDLA
FT                   VARSHAGNRSPAQAPTQRTITIGAAGTRGLRTYVQLFVLIAAANDVRCDVASNSTFVYA
FT                   YGFAEDIDTSHALYASLVVQMVRASDAYLASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   DAREQTRQEATKDRDRPPGTAIALRDKDIELHEYYRRSSKARGAWRASRATAGYSSAAR
FT                   RAGDRAGRQARLGNNPELPGARAALGR"
FT   gene            215715..216224
FT                   /locus_tag="Rv0185"
FT   CDS_pept        215715..216224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0185"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0185, (MTCI28.25a), len: 169 aa. Conserved
FT                   hypothetical protein, equivalent to
FT                   CAB08794.1|Z95398|MLCL622_2 from Mycobacterium leprae (168
FT                   aa), FASTA scores: opt: 861, E(): 0, (76.4% identity in 165
FT                   aa overlap). Contains PS00142 Neutral zinc
FT                   metallopeptidases, zinc-binding region signature. A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0185"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42911"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:O07429"
FT                   /inference="protein motif:PROSITE:PS00142"
FT                   /protein_id="CCP42911.1"
FT                   /translation="MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLT
FT                   LPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIA
FT                   VPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVY
FT                   AQEGVR"
FT   gene            216269..218344
FT                   /gene="bglS"
FT                   /locus_tag="Rv0186"
FT   CDS_pept        216269..218344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglS"
FT                   /locus_tag="Rv0186"
FT                   /product="Probable beta-glucosidase BglS (gentiobiase)
FT                   (cellobiase) (beta-D-glucoside glucohydrolase)"
FT                   /note="Rv0186, (MTCI28.25b), len: 691 aa. Probable
FT                   bglS,beta-glucosidase, highly similar to many e.g.
FT                   BGLS_AGRTU|P27034 beta-glucosidase from Agrobacterium
FT                   tumefaciens (818 aa), FASTA scores: opt: 643, E(): 0,(32.5%
FT                   identity in 842 aa overlap). Seems to belong to family 3 of
FT                   glycosyl hydrolases."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0186"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42912"
FT                   /db_xref="GOA:O07430"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:O07430"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42912.1"
FT                   /translation="MTDDERFSLLVGLTGASDLWPVRDERIPQGVPMCAGYVPGIPRLG
FT                   VPALLMSDAGLGVTNPGYRPGDTATALPAGLALAASFNPVLARSSGKAIGREARSRGFN
FT                   VQLAGAINLARDPRNGRNFEYLSEDPLLSATMAAESIIGIQQQGVIATTKHFSLNCNET
FT                   NRHWLDAVIDPDAHRESDLLAFEIVIERSQPGAVMAAYNKVNGDYAAGNDHLLNDVLKG
FT                   AWGYRGWVMSDWGGTPSWECALAGLDQECGAQIDAVLWQSEAFTDRLRAAYADGNLPKG
FT                   RLSDMVRRILRSMFAVGIDRWKPAPAPDMNAHNEIAAQMARQGIVLLQNRGLLPLAPES
FT                   AGRIAVIGGYAHLGVPAGYGSSAVTPPGGYAGVIPIGGSGLAAGLRNLYLLPSSPLSEL
FT                   RKRLPNAQFEFDPGINPAEAVLAARRADIAIVFAIRAEGEGFDSADLSLPWGQDALIAA
FT                   VASANANTVVVLETGNPVTMPWRDSVNAIMQAWYPGQAGGQAVAEIVTGQVNPSGRLPI
FT                   TFPVDLGQTPRSQPPELGAPWGTSTTIHYTEGADVGYRWFASTNQTPMFAFGHGLSYTS
FT                   FEYRDLVVTGGHTVHASFSVTNTGDRSGADVPQLYMIAAPGESRLRLLGFERVELEPGQ
FT                   TRRVRIEADPRLLARYDGEARSWRIEPGGYTVAVGASAVALKLAAKVKLAGRGFGR"
FT   gene            complement(218390..218551)
FT                   /gene="mymT"
FT                   /locus_tag="Rv0186A"
FT   CDS_pept        complement(218390..218551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mymT"
FT                   /locus_tag="Rv0186A"
FT                   /product="Metallothionein, MymT"
FT                   /note="Rv0186A, len: 53 aa. MymT,
FT                   metallothionein,equivalent to MAV_4993|A0QMH5 hypothetical
FT                   protein from Mycobacterium avium (strain 104) (51 aa), and
FT                   MAP_3626c|Q73TU2 hypothetical protein from Mycobacterium
FT                   avium subsp. paratuberculosis (51 aa), FASTA scores: opt:
FT                   312, E(): 4.6e-17, (81.2% identity in 48 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0186A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42913"
FT                   /db_xref="GOA:P9WK09"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WK09"
FT                   /protein_id="CCP42913.1"
FT                   /translation="MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTC
FT                   GDELAPVK"
FT   gene            218705..219367
FT                   /locus_tag="Rv0187"
FT   CDS_pept        218705..219367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0187"
FT                   /product="Probable O-methyltransferase"
FT                   /note="Rv0187, (MTCI28.26), len: 220 aa. Probable
FT                   O-methyltransferase, similar to many e.g.
FT                   AB93458.1|AL357591 putative O-methyltransferase from
FT                   Streptomyces coelicolor (223 aa); MDMC_STRMY|Q00719
FT                   O-methyltransferase from Streptomyces mycarofaciens (221
FT                   aa), FASTA scores: opt: 327, E(): 2.4e-17, (35.9% identity
FT                   in 192 aa overlap). Also similar to Rv1703c, Rv1220c from
FT                   Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0187"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42914"
FT                   /db_xref="GOA:O07431"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O07431"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42914.1"
FT                   /translation="MGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVS
FT                   AQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVN
FT                   LQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIV
FT                   VDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR"
FT   gene            219486..219917
FT                   /locus_tag="Rv0188"
FT   CDS_pept        219486..219917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0188"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0188, (MTCI28.27), len: 143 aa. Probable conserved
FT                   transmembrane protein, similar to
FT                   T35347|4835334|CAB42956.1|AL049863|SC5H1_31 probable
FT                   membrane protein from Streptomyces coelicolor (147
FT                   aa),FASTA scores: opt: 326, E(): 6.5e-15, (36.2% identity
FT                   in 141 aa overlap); N-terminus of P80185|MTRC_METTH
FT                   tetrahydromethanopterin S-methyltransferase subunit C from
FT                   Methanobacterium thermoautotrophicum strain Marburg/DSM
FT                   2133 (266 aa), FASTA scores: opt: 125, E(): 0.033, (31.6%
FT                   identity in 98 aa overlap). Also similar to Rv3635 from
FT                   Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0188"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42915"
FT                   /db_xref="GOA:O07432"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:O07432"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42915.1"
FT                   /translation="MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVA
FT                   ASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWV
FT                   LPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG"
FT   gene            complement(219996..221723)
FT                   /gene="ilvD"
FT                   /locus_tag="Rv0189c"
FT   CDS_pept        complement(219996..221723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="Rv0189c"
FT                   /product="Probable dihydroxy-acid dehydratase IlvD (dad)"
FT                   /note="Rv0189c, (MTCI28.28c), len: 575 aa. Probable
FT                   ilvD,dihydroxy-acid dehydratase, similar to many e.g.
FT                   ILVD_LACLA|Q02139 dihydroxy-acid dehydratase (dad) from
FT                   Lactococcus lactis (subsp. lactis) (Streptococcus lactis)
FT                   (570 aa), FASTA scores: opt: 1605, E(): 0, (46.0% identity
FT                   in 561 aa overlap). Also similar to
FT                   ML2608|MLCL622.06c|O06069|ILVD_MYCLE dihydroxy-acid
FT                   dehydratase from Mycobacterium leprae (564 aa). Contains
FT                   PS00886 Dihydroxy-acid and 6-phosphogluconate dehydratases
FT                   signature 1. Belongs to the ILVD / EDD family. Cofactor:
FT                   binds 1 4FE-4S cluster (potential)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0189c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42916"
FT                   /db_xref="GOA:P9WKJ5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKJ5"
FT                   /inference="protein motif:PROSITE:PS00886"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42916.1"
FT                   /translation="MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE
FT                   DFAKPQIGVASSWNEITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEG
FT                   MHFSLVSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSI
FT                   LPGRAKLSDGSERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANT
FT                   MASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAI
FT                   AVVMAFGGSTNAVLHLLAIAHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHI
FT                   GGVPVVMKALLDAGLLHGDCLTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGIT
FT                   ILHGSLAPEGAVVKTAGFDSDVFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPK
FT                   GGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRN
FT                   GDRIRLDVAGRVLDVLADPAEFASRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG"
FT   gene            221871..222161
FT                   /locus_tag="Rv0190"
FT   CDS_pept        221871..222161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0190"
FT                   /product="Conserved protein"
FT                   /note="Rv0190, (MTCI28.29), len: 96 aa. Conserved
FT                   protein,highly similar to several hypothetical proteins
FT                   e.g. SYCSLRA_35|Q55554|SLL0176 hypothetical 18.9 kDa
FT                   protein from Synechocystis (167 aa), FASTA scores: opt:
FT                   237, E(): 5.8e-16, (39.4% identity in 94 aa overlap). Also
FT                   highly similar to Z95398|MLCL622_7|O06070 from
FT                   Mycobacterium leprae (135 aa), FASTA score: (82.6% identity
FT                   in 92 aa overlap). Also similar to hypothetical proteins
FT                   from Mycobacterium tuberculosis e.g. Rv0967, Rv0030, Rv1766
FT                   (42.5% identity in 80 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0190"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42917"
FT                   /db_xref="GOA:O07434"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07434"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42917.1"
FT                   /translation="MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQI
FT                   SAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS"
FT   gene            222289..223530
FT                   /locus_tag="Rv0191"
FT   CDS_pept        222289..223530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0191"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0191, (MTCI28.30), len: 413 aa. Probable conserved
FT                   integral membrane protein, member of major facilitator
FT                   superfamily (MFS) possibly involved in transport of
FT                   drug,similar to several hypothetical proteins e.g.
FT                   YDEA_ECOLI|P31122 hypothetical 42.5 kd protein from
FT                   Escherichia coli (396 aa), FASTA scores: opt: 475, E():
FT                   4.2e-33, (29.7% identity in 381 aa overlap); and to several
FT                   chloramphenicol resistance proteins e.g. CMLR_STRLI|P31141
FT                   chloramphenicol resistance protein from Streptomyces
FT                   lividans (392 aa), FASTA scores: opt: 394, E():
FT                   6.7e-12,(28.2% identity in 383 aa overlap). Also similar to
FT                   SVU09991_1 from Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0191"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42918"
FT                   /db_xref="GOA:P9WJX7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJX7"
FT                   /protein_id="CCP42918.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
FT   gene            223564..224664
FT                   /locus_tag="Rv0192"
FT   CDS_pept        223564..224664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0192"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0192, (MTCI28.31), len: 366 aa. Conserved
FT                   hypothetical protein. Has Gly- Arg-rich region followed by
FT                   highly Pro-rich repetitive region near N-terminus. Similar
FT                   in C-terminus to other hypothetical proteins e.g.
FT                   Q49706|B1496_F2_81|U00013 from Mycobacterium leprae (271
FT                   aa), FASTA scores: opt: 375, E(): 3.2e-24, (36.1% identity
FT                   in 255 aa overlap); YV09_MYCTU|Q11149|cY20G9.09
FT                   hypothetical 47.9 kDa protein from Mycobacterium
FT                   tuberculosis (451 aa), FASTA scores: opt: 330, E():
FT                   3.2e-13, (35.1% identity in 271 aa overlap). Also similar
FT                   to Rv0116c, Rv1433, Rv2518c, Rv0483 from Mycobacterium
FT                   tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0192"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42919"
FT                   /db_xref="GOA:O07436"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07436"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42919.1"
FT                   /translation="MPHWAEERHRRESNYVALEAGLDEGESIRRSEHSRSGCGADAGCW
FT                   RCRGGPGRGSRRSRRSRGPGGTAGPVDPPAVDLLAPPPDPLALPPALDPLAPPPPDPLA
FT                   PPPPDPLAVPVAAGPVAGQDPTSFVGPPPFRPPTFNPVDGAMVGVAKPIVINFAVPIAD
FT                   RAMAESAIHISSIPPVPGKFYWMSPTQVRWRPFEFWPANTAVNIDAAGTKSSFRTGDSL
FT                   VATADDATHQMTITRNGVVQKTFPMSMGMVSGGHQTPNGTYYVLEKFATVVMDSSTYGV
FT                   PVNSAQGYKLTVSDAVRIDNSGNFVHSAPWSVADQGKRNVTHGCINLSPANAKWFYDNF
FT                   GSGDPVVVKNSVGTYNKNDGAQDWQI"
FT   gene            223607..223909
FT                   /locus_tag="Rv0192A"
FT   CDS_pept        223607..223909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0192A"
FT                   /product="Conserved secreted protein"
FT                   /note="Rv0192A, len: 100 aa. Probable N-terminal part of
FT                   Rv0192, which is member of family P5.17 with
FT                   Rv0116c,Rv1433, Rv2518c, Rv0483. These are all predicted to
FT                   be exported/membrane proteins. Rv0192A has typical
FT                   N-terminal signal peptide which is functional and was
FT                   identified by PhoA fusion screens: O52054 PGB14T-O1
FT                   precursor (fragment 45 AA) (see Chubb et al., 1998). Since
FT                   Rv0192 misses a signal peptide this suggests that there is
FT                   a frameshift in the region of the overlap with Rv0192 but
FT                   none found on reinspection of sequence."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0192A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42920"
FT                   /db_xref="UniProtKB/TrEMBL:Q79FZ8"
FT                   /protein_id="CCP42920.1"
FT                   /translation="MSRWKQGWTRGSLFAALNIAAVVAVLMLGAGVAVADPDAAPGDPG
FT                   GPGAPGAQRDPSTRRQLTCWRRHPTRWRCRRHLTRWRRRHLTRSRRPRLTRWQCR"
FT   gene            complement(224724..226571)
FT                   /locus_tag="Rv0193c"
FT   CDS_pept        complement(224724..226571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0193c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0193c, (MTV033.01c-MTCI28.32), len: 615 aa.
FT                   Hypothetical unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0193c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42921"
FT                   /db_xref="UniProtKB/TrEMBL:O07437"
FT                   /protein_id="CCP42921.1"
FT                   /translation="MIQISRDMSSLGQTATTQALPDNSDGIQLTKFAADDILPLEYAPP
FT                   IGPELVSQDQLPAAWAYKRFRDLDDKESYRRKLLQELTDALAAQGSEAAEIATAALRDL
FT                   IDQMAEQGAVVLADIVESDDFLELVKRYDELMAREGSRSFIHRFLDLRRSPGMLTDPAV
FT                   NGALVHPLMIALISYAVGGPIRMIDARGKDAEPLSVLAQDNMLHIDNTPFNDEYKILIT
FT                   WRRGTAQGPAGQNFTFLPGTHKLARTCFVNEDGVPWSSENASIFTTPDSIRKVFDAQRQ
FT                   LGGQDHPTVIEVTDSERPLSGVFAAGSLVHHRFRTASGSARSCIILVFHRVADNPGRMV
FT                   SDVEDSSDVSLSELLTRGVPDESYQQRFIATLCAAADEIAELLLKWKKTPQRPVSLPLQ
FT                   TKQIDGARFEEWISAATKAPEVREIRNRELTIPYGEVLSAEEFFDLIWRLMRFDKHGPL
FT                   DLILYHDNREEPRKWARNLIREMSADRLYERLLGWLADIQQPRPADCLRPLQIHALISE
FT                   VLKTLPLDEDQDPPADWHFDLLGMSHAEAARSVKHLLEDVAEALLRCEDMAAYLSTSLF
FT                   AFWAVDAAYSLDGRRNLVVKDCARRLLRHYTMLSLTCFQ"
FT   gene            226878..230462
FT                   /locus_tag="Rv0194"
FT   CDS_pept        226878..230462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0194"
FT                   /product="Probable transmembrane multidrug efflux pump"
FT                   /note="Rv0194, (MTV033.02), len: 1194 aa. Probable
FT                   multidrug efflux pump (See Danilchanka et al., 2008),highly
FT                   similar to many e.g. U62129|STU62129_2|T30293 ABC transport
FT                   protein homolog from Salmonella typhi (1218 aa),FASTA
FT                   scores: opt: 1116, E(): 0, (36.3% identity in 1209 aa
FT                   overlap); CAB66302.1|AL136519 ABC transporter protein
FT                   ATP-binding component from Streptomyces coelicolor (1243
FT                   aa); I84547 mdl protein from Escherichia coli (1143 aa);
FT                   etc. Also similar to MTCY50_9 and MTCY50_10 from
FT                   Mycobacterium tuberculosis, FASTA score: (33.8% identity in
FT                   574 aa overlap). Contains two PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and one PS00211 ABC transporters family
FT                   signature. Belongs to the ATP-binding transport protein
FT                   family (ABC transporters). Alternative start possible at
FT                   1823 but no RBS."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0194"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42922"
FT                   /db_xref="GOA:O53645"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53645"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00211"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42922.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLMYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   TASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSPEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
FT   gene            230899..231534
FT                   /locus_tag="Rv0195"
FT   CDS_pept        230899..231534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0195"
FT                   /product="Possible two component transcriptional regulatory
FT                   protein (probably LuxR-family)"
FT                   /note="Rv0195, (MTV033.03), len: 211 aa. Possible
FT                   two-component response regulator, luxR family, similar to
FT                   many e.g. U00008|ECOHU49_15 regulatory protein narP from
FT                   Escherichia coli strain K12 (225 aa), FASTA scores: opt:
FT                   232, E(): 7.3e-09, (29.2% identity in 219 aa overlap).
FT                   Start chosen by similarity. Contains probable
FT                   helix-turn-helix motif at aa 166-187 (Score 1164, +3.15
FT                   SD)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0195"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42923"
FT                   /db_xref="GOA:O53646"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:O53646"
FT                   /protein_id="CCP42923.1"
FT                   /translation="MAPVNVISVAVVASDPLTRDGALARLSSHRELDVRAWQAGCETSV
FT                   LLVLATTITAPLLCQIEDVQKDGPSHAPKLVVVADEFSAEQVFRMIKLGLTGLLYRSQS
FT                   TFDCIVETIRLSAEGRLRLPERVQRYLVGRIKSTPTAEPDTPCAAALAEREVAVLRLLA
FT                   DGLSTHQVAVQLNYCERTIKNIVHDIVTRLKLRNRTHAVAHALRAGLI"
FT   gene            231647..232231
FT                   /locus_tag="Rv0196"
FT   CDS_pept        231647..232231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0196"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0196, (MTV033.04), len: 194 aa. Possible
FT                   transcriptional regulatory protein, similar to two Bacillus
FT                   subtilis regulators: P42105|YXAF_BACSU hypothetical 21.0
FT                   kDa protein (191 aa), FASTA scores: opt: 323, E():
FT                   2.1e-15,(30.9% identity in 181 aa overlap); and
FT                   Z99105|BSUB0002_9 negative regulator of the lincomycin
FT                   operon (188 aa), FASTA scores: opt: 255, E(): 1e-10, (25.9
FT                   identity in 185 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0196"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42924"
FT                   /db_xref="GOA:P9WME1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WME1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42924.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
FT   gene            232231..234519
FT                   /locus_tag="Rv0197"
FT   CDS_pept        232231..234519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0197"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0197, (MTV033.05), len: 762 aa. Possible
FT                   oxidoreductase, similar to others e.g.
FT                   9948789|AAG06102.1|AE004699_7|B83307 probable molybdopterin
FT                   oxidoreductase from Pseudomonas aeruginosa strain PAO1 (769
FT                   aa); 5441785|CAB46809.1|AL096811|T36812 probable
FT                   dehydrogenase from Streptomyces coelicolor (747 aa), FASTA
FT                   scores: opt: 617, E(): 9.8e-30, (29.9% identity in 762 aa
FT                   overlap); BAB04334.1|AP001509 assimilatory nitrate
FT                   reductase (catalytic subunit) from Bacillus halodurans (743
FT                   aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0197"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42925"
FT                   /db_xref="GOA:L0T2Z1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:L0T2Z1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42925.1"
FT                   /translation="MTSSDWLPTACILCECNCGIVVQVDDRRLARIRGDKAHPGSAGYT
FT                   CNKALRLDHYQNNRARLSSPMRRRADGTYEEIDWDTAIVEIAEGFKQIRDTHGGDKIFY
FT                   YGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGEAWVDFQLYGGHTRGEFENAEV
FT                   SVFVGKNPWMSQSFPRARVVLNEIAKDPGRSMIVIDPVVTDTAKMADFHLRVQPGCDAW
FT                   CLAALAAVLVQENLCNEAFLAAHVHGVDTVRAALQEVPVADYAQRCGVDEELLRAAARR
FT                   IGTAASVSVFEDLGIQQAPNSTVCSYLNKLLWILTGNFAKKGGQHLHSSFAPLFSQVSG
FT                   RTPVTGAPIIAGLIPGNVVPEEILTEHPDRFRAMIVERGNPAHSLADSAACRAAFQALE
FT                   LMVVVDVAMTETARLAHYVLPAASQFEKPEATFFNFEFPRNGFQLRRPLFPPLPGTLPE
FT                   PEIWARLVRALGVVDEADLRPLREAAAQGRQAYTEAFLAAAATNPTVAKLTAYVLYETL
FT                   GPTLPDGLAGAAALWGLAQKTAMAYPDAVRRAGHADGNALFDAILERPSGVTFTVHNYE
FT                   DDFALISHPDHKIALEIPEMLAEIRSLTQTPSRLTTPQLPIVLSVGERRAYTANDIFRD
FT                   PSWRKRDANGALRVSVEDAQALGLADGCLARITTAAGSAEATVEVTETMLAGHAALPNG
FT                   FGLDYTGDDGRTVVAGVAPNALTSTRWRDPYAGTPWHKHVPAAIRRADAESPIWYPKWA
FT                   ILPARGVLA"
FT   gene            complement(234516..236507)
FT                   /gene="zmp1"
FT                   /locus_tag="Rv0198c"
FT   CDS_pept        complement(234516..236507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmp1"
FT                   /locus_tag="Rv0198c"
FT                   /product="Probable zinc metalloprotease Zmp1"
FT                   /note="Rv0198c, (MTV033.06c), len: 663 aa. Probable
FT                   zmp1,zinc metalloprotease, equivalent to Z95398|MLCL622.12c
FT                   from Mycobacterium leprae (667 aa), FASTA scores: opt:
FT                   3710,E(): 0, (80.8 % identity in 667 aa overlap). Also
FT                   similar to many other metalloproteases e.g. members of the
FT                   eukaryotic neprilysin family: P08473|NEP_HUMAN neprilysin
FT                   (749 aa), FASTA scores: opt: 872, E(): 0, (31.1% identity
FT                   in 692 aa overlap); Q07744|PEPO_LACLA neutral endopeptidase
FT                   from Lactococcus lactis (626 aa), FASTA scores: opt:
FT                   862,E(): 0, (30.0% identity in 654 aa overlap). Contains
FT                   PS00142 Neutral zinc metallopeptidases, zinc-binding region
FT                   signature. Belongs to peptidase family M13 (zinc
FT                   metalloprotease); also known as the neprilysin subfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0198c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42926"
FT                   /db_xref="GOA:I6X8R2"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:I6X8R2"
FT                   /inference="protein motif:PROSITE:PS00142"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42926.1"
FT                   /translation="MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATD
FT                   GAFRSLFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQPLHDE
FT                   LATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVHFTQSGIGLPDESY
FT                   YRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTADRIVALETKLADAHWDVVKRRDA
FT                   DLGYNLRTFAQLQTEGAGFDWVSWVTALGSAPDAMTELVVRQPDYLVTFASLWASVNVE
FT                   DWKCWARWRLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAV
FT                   GKLYVQRHFPPDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGY
FT                   PIKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQTVNAYYNPG
FT                   MNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWT
FT                   DDDRTEFAARTKALIEQYHAYTPRDLVDHPGPPHVQGAFTIGENIGDLGGLSIALLAYQ
FT                   LSLNGNPAPVIDGLTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRN
FT                   VDAFYQAFDVTEDDALFLDPQRRVRIWN"
FT   gene            236550..237209
FT                   /locus_tag="Rv0199"
FT   CDS_pept        236550..237209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0199"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0199, (MTV033.07), len: 219 aa. Probable conserved
FT                   membrane protein, equivalent to Z95398|MLCL622.13 from
FT                   Mycobacterium leprae (224 aa), FASTA scores: opt: 920, E():
FT                   0, (67.7% identity in 220 aa overlap). Also some similarity
FT                   to Mce-associated membrane proteins from Mycobacterium
FT                   tuberculosis e.g. Rv0178, Rv0175, etc. A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0199"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42927"
FT                   /db_xref="GOA:O53650"
FT                   /db_xref="UniProtKB/TrEMBL:O53650"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42927.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
FT   gene            237206..237895
FT                   /locus_tag="Rv0200"
FT   CDS_pept        237206..237895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0200"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Rv0200, (MTV033.08), len: 229 aa. Possible conserved
FT                   transmembrane protein, equivalent to Z95398|MLCL622.14 from
FT                   Mycobacterium leprae (229 aa), FASTA scores: opt: 1147,E():
FT                   0, (74.7% identity in 229 aa overlap). Also some similarity
FT                   to Rv1973 from Mycobacterium tuberculosis (160 aa); and
FT                   Rv1362c|Z75555|MTCY02B10_26 (220 aa), FASTA scores: opt:
FT                   134, E(): 0.063, (25.8% identity in 159 aa overlap). A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0200"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42928"
FT                   /db_xref="GOA:O53651"
FT                   /db_xref="UniProtKB/TrEMBL:O53651"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42928.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
FT   gene            complement(237892..238395)
FT                   /locus_tag="Rv0201c"
FT   CDS_pept        complement(237892..238395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0201c"
FT                   /product="Conserved protein"
FT                   /note="Rv0201c, (MTV033.09c), len: 167 aa. Conserved
FT                   protein, equivalent to Z95398|MLCL622.15c from
FT                   Mycobacterium leprae (170 aa), FASTA scores: opt: 646, E():
FT                   0, (63.9% identity in 158 aa overlap). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0201c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42929"
FT                   /db_xref="GOA:O53652"
FT                   /db_xref="UniProtKB/TrEMBL:O53652"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42929.1"
FT                   /translation="MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDI
FT                   ATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVAR
FT                   QVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVR
FT                   AADS"
FT   gene            complement(238392..241292)
FT                   /gene="mmpL11"
FT                   /locus_tag="Rv0202c"
FT   CDS_pept        complement(238392..241292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL11"
FT                   /locus_tag="Rv0202c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein MmpL11"
FT                   /note="Rv0202c, (MTV033.10c), len: 966 aa. Probable
FT                   mmpL11,conserved transmembrane transport protein (see
FT                   citation below), equivalent to Z95398|MLCL622.16c from
FT                   Mycobacterium leprae (1014 aa), FASTA scores: opt: 4076,
FT                   E(): 0, (72.8% identity in 1017 aa overlap). Member of RND
FT                   superfamily,similar to several putative transport proteins
FT                   e.g. P96687 from Bacillus subtilis (724 aa), FASTA scores:
FT                   opt: 594,E(): 9.1e-29, (26.9% identity in 717 aa overlap);
FT                   etc. Belongs to the MmpL family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0202c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42930"
FT                   /db_xref="GOA:P9WJT9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="PDB:4Y0L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJT9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42930.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
FT   gene            241514..241924
FT                   /locus_tag="Rv0203"
FT   CDS_pept        241514..241924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0203"
FT                   /product="Possible exported protein"
FT                   /note="Rv0203, (MTV033.11), len: 136 aa. Possible exported
FT                   protein (has hydrophobic stretch near N-terminus). Some
FT                   similarity to part of U02459|LDU02459_1 hypothetical
FT                   protein from Leishmania donovani (741 aa), FASTA score:
FT                   opt: 111, E(): 9.1, (30.0% identity in 90 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0203"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42931"
FT                   /db_xref="GOA:I6X8R5"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="PDB:3MAY"
FT                   /db_xref="UniProtKB/Swiss-Prot:I6X8R5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42931.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
FT   gene            complement(241976..243214)
FT                   /locus_tag="Rv0204c"
FT   CDS_pept        complement(241976..243214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0204c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0204c, (MTV033.12c), len: 412 aa. Probable
FT                   conserved transmembrane protein (see citation
FT                   below),equivalent, but has C-terminal extension, to
FT                   Z95398|MLCL622.17c from Mycobacterium leprae (367 aa),FASTA
FT                   scores: opt: 2002, E(): 0, (82.4% identity in 374 aa
FT                   overlap). Some similarity to Rv0585c from Mycobacterium
FT                   tuberculosis. Nucleotide position 242299 in the genome
FT                   sequence has been corrected, C:G resulting in V306L."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0204c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42932"
FT                   /db_xref="GOA:I6Y748"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y748"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42932.1"
FT                   /translation="MSHDAPARNLRQRVGALPRTRVGAPPAEGVPPRGKYWWLRWAVLA
FT                   IVAIVLAIEVALGWDQLAKAWVSLYRAKWWWLLAAVAAAGASMHSFAQIQRTLLKSAGV
FT                   HVKQWRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVLQAV
FT                   GLALLGLGGAFFLGAKNNPFSLLFTLGGFVTLLLLAQAVASRPELIEGIGRRVLSWANS
FT                   VRGRPADAGLPKWRETLMQLESVSLGRRDLGVAFGWSLFNWIADVACLGFAAYAAGDHA
FT                   SVGGLAVAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMPLPSAISAMLIYRLISWL
FT                   LIAAIGWVVFFFMFRTESTADSDNDRDPPTDPNLRLVIQPQGTPCDDPVETTPQGPAPT
FT                   PDLRPEGGETPPR"
FT   gene            243384..244487
FT                   /locus_tag="Rv0205"
FT   CDS_pept        243384..244487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0205"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0205, (MTV033.13), len: 367 aa. Possible conserved
FT                   transmembrane protein, similar to hypothetical proteins
FT                   from many bacteria e.g. AL0209|SC4H8_6 from Streptomyces
FT                   coelicolor (402 aa), FASTA scores: opt: 436, E():
FT                   1.7e-21,(27.2% identity in 349 aa overlap);
FT                   Z99117|BSUB0014_221 from Bacillus subtilis (353 aa), FASTA
FT                   scores: opt: 394,E(): 8.6e-19, (28.7% identity in 324 aa
FT                   overla)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0205"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42933"
FT                   /db_xref="GOA:P9WFM5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFM5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42933.1"
FT                   /translation="MSASLDDASVAPLVRKTAAWAWRFLVILAAMVALLWVLNKFEVIV
FT                   VPVLLALMLSALLVPPVDWLDSRGLPHAVAVTLVLLSGFAVLGGILTFVVSQFIAGLPH
FT                   LVTEVERSIDSARRWLIEGPAHLRGEQIDNAGNAAIEALRNNQAKLTSGALSTAATITE
FT                   LVTAAVLVLFTLIFFLYGGRSIWQYVTKAFPASVRDRVRAAGRAGYASLIGYARATFLV
FT                   ALTDAAGVGAGLAVMGVPLALPLASLVFFGAFIPLIGAVVAGFLAVVVALLAKGIGYAL
FT                   ITVGLLIAVNQLEAHLLQPLVMGRAVSIHPLAVVLAIAAGGVLAGVVGALLAVPTVAFF
FT                   NNAVQVLLGGNPFADVADVSSDHLTEV"
FT   gene            complement(244484..247318)
FT                   /gene="mmpL3"
FT                   /locus_tag="Rv0206c"
FT   CDS_pept        complement(244484..247318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL3"
FT                   /locus_tag="Rv0206c"
FT                   /product="Possible conserved transmembrane transport
FT                   protein MmpL3"
FT                   /note="Rv0206c, (MTV033.14c, MTCY08D5.01c), len: 944 aa.
FT                   Possible mmpL3, conserved transmembrane transport protein
FT                   (see Tekaia et al., 1999), equivalent to Z95398|MLCL622.18c
FT                   from Mycobacterium leprae (955 aa), FASTA scores: opt:
FT                   806,E(): 1.8e-21, (57.2% identity in 243 aa overlap).
FT                   Member of RND superfamily, similar to others. Belongs to
FT                   the MmpL family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0206c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42934"
FT                   /db_xref="GOA:P9WJV5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42934.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGFWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTDAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSPASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSAPSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
FT   gene            complement(247384..248112)
FT                   /locus_tag="Rv0207c"
FT   CDS_pept        complement(247384..248112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0207c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0207c, (MTCY08D5.02c), len: 242 aa. Conserved
FT                   hypothetical protein, equivalent to Z95398|MLCL622_19 from
FT                   Mycobacterium leprae (261 aa), FASTA scores: E(): 0, (60.8
FT                   identity in 199 aa overlap). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0207c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42935"
FT                   /db_xref="GOA:P96389"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:P96389"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42935.1"
FT                   /translation="MSLTEDVTSQTSESLARHSVLAEDLSQDGLTSLGAPGARVLLVWD
FT                   APNLDMGLGSILGRRPTALERPRFDALGRWLLARTAEIVAGRPGISTEPEATVFTNIAP
FT                   GSAEVVRPWVDALRNVGFAVFAKPKVDEDSDVDRDMLAHIDERYREGLAALVVASADGQ
FT                   AFRQPLEAVARSGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLDSLP
FT                   EQGAWLQPFRPLSSLLTSRV"
FT   gene            complement(248115..248906)
FT                   /locus_tag="Rv0208c"
FT   CDS_pept        complement(248115..248906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0208c"
FT                   /product="Hypothetical methlytransferase (methylase)"
FT                   /note="Rv0208c, (MTCY08D5.03c), len: 263 aa. Hypothetical
FT                   methyltransferase, equivalent to Z95398|MLCL622_20 from
FT                   Mycobacterium leprae (279 aa), FASTA score: (64.2% identity
FT                   in 246 aa overlaps). Also similar to others e.g.
FT                   10178368|CAC08407.1|AL392177|Q9F305|MT04_STRCO|SCD17A.03c
FT                   hypothetical methlytransferase from Streptomyces coelicolor
FT                   (271 aa). Could start at aa 7."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0208c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42936"
FT                   /db_xref="GOA:P9WFY9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFY9"
FT                   /protein_id="CCP42936.1"
FT                   /translation="MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRET
FT                   WERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVI
FT                   AVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPK
FT                   ARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTEL
FT                   LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR"
FT   gene            249038..250123
FT                   /locus_tag="Rv0209"
FT   CDS_pept        249038..250123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0209"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0209, (MTCY08D5.04), len: 361 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0209"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42937"
FT                   /db_xref="GOA:P96391"
FT                   /db_xref="UniProtKB/TrEMBL:P96391"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42937.1"
FT                   /translation="MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPG
FT                   VGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVV
FT                   AVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAVL
FT                   RALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRT
FT                   PAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLR
FT                   DDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIAR
FT                   GSLRLWSLAGGMPLHRYRKSS"
FT   gene            250120..251598
FT                   /locus_tag="Rv0210"
FT   CDS_pept        250120..251598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0210"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0210, (MTCY08D5.05), len: 492 aa. Hypothetical
FT                   unknown protein. Possibly membrane protein; has hydrophobic
FT                   stretches around aa 333 - 381."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0210"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42938"
FT                   /db_xref="GOA:P96392"
FT                   /db_xref="UniProtKB/TrEMBL:P96392"
FT                   /protein_id="CCP42938.1"
FT                   /translation="MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLA
FT                   GVSGVRAALAERLPQRRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTD
FT                   AVVAVVSKIDVHRGWRDVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAI
FT                   QKQLADPAVARRNMLRAWESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQS
FT                   KSEHTIALRAQIQHARVKLSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQE
FT                   VVAEVGEGAVAHLADVAQLLGVPVQPPVLENLPAVLPTVVAPPLTSRRLEIRLTTLLGA
FT                   GFGLGIALTLSRLVAGLTPGLAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGE
FT                   VTASLRSVVEQLVATRVVAVETLLSTAISERDDAENARVADQVSIIDGELREHAVAAAR
FT                   AAALRDREMPAVRAALEAVRAELGEPGAPTTGLF"
FT   gene            251782..253602
FT                   /gene="pckA"
FT                   /gene_synonym="pck1"
FT                   /gene_synonym="pckG"
FT                   /locus_tag="Rv0211"
FT   CDS_pept        251782..253602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /gene_synonym="pck1"
FT                   /gene_synonym="pckG"
FT                   /locus_tag="Rv0211"
FT                   /product="Probable iron-regulated phosphoenolpyruvate
FT                   carboxykinase [GTP] PckA (phosphoenolpyruvate carboxylase)
FT                   (PEPCK)(pep carboxykinase)"
FT                   /note="Rv0211, (MTCY08D5.06), len: 606 aa. Probable pckA
FT                   (alternate gene names: pckG and pck1), iron-regulated
FT                   phosphoenolpyruvate carboxykinase [GTP], equivalent to
FT                   Z95398|MLCL622_21 probable phosphoenolpyruvate
FT                   carboxykinase from Mycobacterium leprae (609 aa), FASTA
FT                   score: (86.1% identity in 605 aa overlap). Also highly
FT                   similar to others e.g. PPCK_NEOFR|P22130
FT                   phosphoenolpyruvate carboxykinase [GTP] (608 aa), FASTA
FT                   scores: opt: 2287, E(): 0, (55.9% identity in 598 aa
FT                   overlap). Contains PS00505 Phosphoenolpyruvate
FT                   carboxykinase (GTP) signature. Belongs to the
FT                   phosphoenolpyruvate carboxykinase [GTP] family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0211"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42939"
FT                   /db_xref="GOA:P9WIH3"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="PDB:4R43"
FT                   /db_xref="PDB:4RCG"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIH3"
FT                   /inference="protein motif:PROSITE:PS00505"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42939.1"
FT                   /translation="MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEF
FT                   QRLCDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMD
FT                   PGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   KAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSETKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAML
FT                   QPTIPGWRAETLGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGN
FT                   TVFTNVALTDDGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPI
FT                   LAPEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGN
FT                   VRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQEL
FT                   PLIEEWLQFVGEKLPTGVKDEFDALKERLG"
FT   gene            complement(253669..254640)
FT                   /gene="nadR"
FT                   /gene_synonym="nadI"
FT                   /locus_tag="Rv0212c"
FT   CDS_pept        complement(253669..254640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /gene_synonym="nadI"
FT                   /locus_tag="Rv0212c"
FT                   /product="Possible transcriptional regulatory protein NadR
FT                   (probably AsnC-family)"
FT                   /note="Rv0212c, (MTCY08D5.07c), len: 323 aa. Possible nadR
FT                   (alternate gene name: nadI), transcriptional
FT                   regulator,similar to others e.g. NADR_ECOLI|P27278
FT                   transcriptional regulator from Escherichia coli (410 aa),
FT                   FASTA scores: opt: 377, E (): 1e-17, (31.1% identity in 347
FT                   aa overlap). Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0212c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42940"
FT                   /db_xref="GOA:P96394"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:P96394"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /protein_id="CCP42940.1"
FT                   /translation="MTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPG
FT                   AQRVAWMRELFPFDRVVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYN
FT                   ADFAQVLGARFVAVDHGRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPEST
FT                   GKTTLAQAVAEKLRTKWVPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRV
FT                   LICDTDPLATTVWAEFLAGGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGT
FT                   FFARCEQALRAAGRSFVVITGGWEERLSVSLRAVEELVRARR"
FT   gene            complement(254637..255950)
FT                   /locus_tag="Rv0213c"
FT   CDS_pept        complement(254637..255950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0213c"
FT                   /product="Possible methyltransferase (methylase)"
FT                   /note="Rv0213c, (MTCY08D5.08c), len: 437 aa. Possible
FT                   methyltransferase, weakly similar to others
FT                   methyltransferases e.g. AF127374_30|LINA from Streptomyces
FT                   lavendulae (611 aa), FASTA scores: opt: 400, E():
FT                   8.1e-19,(27.3% identity in 388 aa overlap); Q50258
FT                   fortimicin kl1 methyltransferase (553 aa), FASTA scores:
FT                   opt: 267, E(): 1.2e-13, (29.3% identity in 351 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0213c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42941"
FT                   /db_xref="GOA:P96395"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:P96395"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42941.1"
FT                   /translation="MSIKAYAKTQGIAVTSVNGLVAGHGSVQETWLAMQSAAALSGTPR
FT                   LVGFSCIDTFPEVLWLAQRARQAWDGVRIVIGNAMATLNYERILRQHDCFDYVVVGDGE
FT                   VAFTKLALALANDAAVDDVPGLARRSEQGQILRTPSSLVDLDELPRPARDELPTVLADG
FT                   FAASVFSTRGCPYRCTFCGTGAMSAMLGKDSYRAKSVDAVVDEIDYLVSDYDVNFLSIT
FT                   DDLFISKHPGSQQRAADFANAVLRRGISVNFMVDIRLDSVVDLDLFKHLHRAGLRRVFI
FT                   GVETGSYEQLRAYRKQILTRGQDAADTINALQQLGIDVIPGTIMFHPTVQPDELRETVR
FT                   LLRATKYTVGFKFMSRIVPYPGTPLYQAYSDAGYLTAKWPLGQWEFVDPEASRVYADVV
FT                   AKVAPDVGISFDEAEAYFLSRLDEWENVIAGRIAEATS"
FT   gene            256064..257677
FT                   /gene="fadD4"
FT                   /locus_tag="Rv0214"
FT   CDS_pept        256064..257677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD4"
FT                   /locus_tag="Rv0214"
FT                   /product="Probable fatty-acid-CoA ligase FadD4
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0214, (MTCY08D5.09), len: 537 aa. Probable
FT                   fadD4,fatty-acid-CoA synthetase, similar to many e.g.
FT                   4CL_PINTA|P41636 4-coumarate--CoA ligase (537 aa), FASTA
FT                   scores: opt: 622, E(): 1e-31, (30.0% identity in 514 aa
FT                   overlap). Also similar to others from Mycobacterium
FT                   tuberculosis e.g. MTCY6A4.14 FASTA score: (30.7% identity
FT                   in 501 aa overlap); MTCY493_27, MTCY07A7_11, MTCI28_6.
FT                   Contains PS00455 putative AMP-binding domain signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0214"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42942"
FT                   /db_xref="GOA:P96396"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:P96396"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42942.1"
FT                   /translation="MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIGADKPA
FT                   VILYPSGTVISFDELEARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGL
FT                   YYVPINTHLTASEAAYIVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLV
FT                   GWMTYPECVADQPDTPIEDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALL
FT                   DFWMDADSVYLSPAPMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQ
FT                   FVPAMFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSE
FT                   ASGSTLITAEDWLTHPGSVGKPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDP
FT                   AKTAASRNKHGWVTVGDVGYLDDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKV
FT                   LDAAVFGVPDDEMGQRVMAAVQTVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQ
FT                   LPRTDTGKLYKSGLVEKYSV"
FT   gene            complement(257783..258856)
FT                   /gene="fadE3"
FT                   /locus_tag="Rv0215c"
FT   CDS_pept        complement(257783..258856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE3"
FT                   /locus_tag="Rv0215c"
FT                   /product="Probable acyl-CoA dehydrogenase FadE3"
FT                   /note="Rv0215c, (MTCY08D5.10c), len: 357 aa. Probable
FT                   fadE3, acyl- dehydrogenase, similar to many e.g.
FT                   ACDB_BACSU|P45857 acyl-CoA dehydrogenase from B. subtilis
FT                   (379 aa), FASTA scores: opt: 812, E(): 0, (39.5% identity
FT                   in 354 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0215c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42943"
FT                   /db_xref="GOA:P96397"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P96397"
FT                   /protein_id="CCP42943.1"
FT                   /translation="MRNELNDDEAMLVATVRAFIDRDVKPTVREVEHANSYPEAWIEQM
FT                   KHIGIYGLAIDEQYGGSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEE
FT                   QRRTYLPPMASGELRATMALTEPGGGSDLQNMSTTALADGPEGSAGLLINGCKTWISNA
FT                   RRSGLFAVLCKTDPNATPRHQGMSIVLVEPGPGLTVSRDLPKLGYKGVESCELSFDNLR
FT                   VPVSAILGGAMGQGFSQMMKGLETGRIQVAARALGVATAALEDSLAYAQQRESFGRPIW
FT                   QHQAVGNYLADMATKLTAARQLTRYAAERYDSGQRCDMEAGMAKLFASEVAMEIALNAV
FT                   RIHGGYGYSTEYDVERR"
FT   gene            258913..259926
FT                   /locus_tag="Rv0216"
FT   CDS_pept        258913..259926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0216"
FT                   /product="Double hotdog hydratase"
FT                   /note="Rv0216, (MTCY08D5.11), len: 337 aa. Double hotdog
FT                   R-specific hydratase of unknown function, shows no activity
FT                   for crotonyl-CoA, equivalent to Z95398|MLCL622_22 from
FT                   Mycobacterium leprae (339 aa), FASTA scores: E(): 0, (73.7
FT                   identity in 338 aa overlap). Shows structural similarity to
FT                   six others in Mycobacterium tuberculosis (see Castell et al
FT                   (2005) below). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0216"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42944"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y340"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42944.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
FT   gene            complement(259923..260831)
FT                   /gene="lipW"
FT                   /locus_tag="Rv0217c"
FT   CDS_pept        complement(259923..260831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipW"
FT                   /locus_tag="Rv0217c"
FT                   /product="Possible esterase LipW"
FT                   /note="Rv0217c, (MTCY08D5.12c), len: 302 aa. Possible
FT                   esterase, showing similarity with others e.g.
FT                   EST_ACICA|P18773 esterase (303 aa), FASTA scores: opt:
FT                   320,E(): 3.2e-13, (29.2% identity in 274 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0217c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42945"
FT                   /db_xref="GOA:P96399"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:P96399"
FT                   /protein_id="CCP42945.1"
FT                   /translation="MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTP
FT                   PDIEVLTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGIT
FT                   VASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLAR
FT                   DRGGITPAFQLLVYPMLDDRPSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRR
FT                   DDLGGLAPAWIGVGTHDLLHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVS
FT                   QRFFTSQCNSLRAALALSNRT"
FT   gene            260924..262252
FT                   /locus_tag="Rv0218"
FT   CDS_pept        260924..262252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0218"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0218, (MTCY08D5.13), len: 442 aa. Probable
FT                   conserved transmembrane protein, some similarity with
FT                   sulfite oxidases e.g. SUOX_HUMAN|P51687 sulfite oxidase
FT                   precursor (488 aa), FASTA scores: opt: 153, E():
FT                   0.0087,(28.6% identity in 161 aa overlap); and with some
FT                   nitrate reductases e.g. NIA_FUSOX|P39863 nitrate reductase
FT                   (NADPH) (905 aa), FASTA scores: opt: 143, E(): 0.06, (29.3%
FT                   identity in 92 aa overlap). Also similar to BSUB0017_86
FT                   from Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0218"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42946"
FT                   /db_xref="GOA:P96400"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:P96400"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42946.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLCGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLDHGYPARIIVPALPGVHNTKWVAGIEFHKR"
FT   gene            262254..262802
FT                   /locus_tag="Rv0219"
FT   CDS_pept        262254..262802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0219"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0219, (MTCY08D5.14), len: 182 aa. Probable
FT                   conserved transmembrane protein, showing similarity with
FT                   CAB76992.1|AL159178 putative lipoprotein from Streptomyces
FT                   coelicolor (163 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0219"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42947"
FT                   /db_xref="GOA:P96401"
FT                   /db_xref="UniProtKB/TrEMBL:P96401"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42947.1"
FT                   /translation="MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQA
FT                   TWWQSIAVWFVAAVVAHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIP
FT                   ALAAGLTLLVFLPGIIRQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVV
FT                   AHVRRRRAGCSRVDAIDEE"
FT   gene            262812..264023
FT                   /gene="lipC"
FT                   /locus_tag="Rv0220"
FT   CDS_pept        262812..264023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="Rv0220"
FT                   /product="Probable esterase LipC"
FT                   /note="Rv0220, (MTCY08D5.15), len: 403 aa. Probable
FT                   esterase, similar to others proteins and esterases from
FT                   various organisms and Mycobacterium tuberculosis e.g.
FT                   Q50681 (431 aa), FASTA scores: opt: 841, E(): 0, (38.2%
FT                   identity in 408 aa overlap); Rv1426c, Rv1399c, etc.
FT                   Contains PS00122 Carboxylesterases type-B serine active
FT                   site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0220"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42948"
FT                   /db_xref="GOA:P96402"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:P96402"
FT                   /inference="protein motif:PROSITE:PS00122"
FT                   /protein_id="CCP42948.1"
FT                   /translation="MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLK
FT                   PLGGVTAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIVSPDD
FT                   LAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKDMPTKPAPVLIFVP
FT                   GGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPHHRWPRHILDVKTAIAWARANVD
FT                   KFGGDRNFIAVAGCSAGGHLSALAGLTANDPQYQAELPEGSDTSVDAVVGIYGRYDWED
FT                   RSTPERARFVDFLERVVVQRTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVE
FT                   QARSFVERLRAVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFA
FT                   KEVI"
FT   gene            264067..265476
FT                   /locus_tag="Rv0221"
FT   CDS_pept        264067..265476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0221"
FT                   /product="Possible triacylglycerol synthase (diacylglycerol
FT                   acyltransferase)"
FT                   /note="Rv0221, (MTCY08D5.16), len: 469 aa. Possible
FT                   triacylglycerol synthase (See Daniel et al., 2004), similar
FT                   to other proteins from Mycobacterium tuberculosis e.g.
FT                   Q50680|Rv2285|MT2343|MTCY339.25c 47.7 kDa protein (445
FT                   aa),FASTA scores: opt: 455, E(): 8.1e-23, (26.7% identity
FT                   in 461 aa overlap); Rv3740c, Rv3734c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0221"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42949"
FT                   /db_xref="GOA:P9WKB7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKB7"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42949.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFRE
FT                   VIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVG
FT                   EIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEV
FT                   GRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFT
FT                   PPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGK
FT                   AEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLL
FT                   GPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIY
FT                   SVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVE
FT                   LTVVESAMAQA"
FT   gene            265507..266295
FT                   /gene="echA1"
FT                   /locus_tag="Rv0222"
FT   CDS_pept        265507..266295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA1"
FT                   /locus_tag="Rv0222"
FT                   /product="Probable enoyl-CoA hydratase EchA1 (enoyl
FT                   hydrase) (unsaturated acyl-CoA hydratase) (crotonase)"
FT                   /note="Rv0222, (MTCY08D5.17), len: 262 aa. Probable
FT                   echA1,enoyl-CoA hydratase, similar to others e.g.
FT                   AAC77915.1|AF063588 enoyl CoA hydratase from Rhodococcus
FT                   fascians (275 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0222"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42950"
FT                   /db_xref="GOA:P96404"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:5KJP"
FT                   /db_xref="UniProtKB/TrEMBL:P96404"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42950.1"
FT                   /translation="MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLA
FT                   DAMDQLDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIA
FT                   AVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMEL
FT                   ALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGW
FT                   SPDTMFAEQMKILVPVFTSNDAKEGAIAFAERRRPRWTGT"
FT   gene            complement(266301..267764)
FT                   /locus_tag="Rv0223c"
FT   CDS_pept        complement(266301..267764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0223c"
FT                   /product="Probable aldehyde dehydrogenase"
FT                   /note="Rv0223c, (MTCY08D5.18), len: 487 aa. Probable
FT                   aldehyde dehydrogenase, similar to others e.g.
FT                   A75608|6460525|AAF12231.1|AE001862_57 aldehyde
FT                   dehydrogenase from Deinococcus radiodurans strain R1 (495
FT                   aa); Q47943 L-sorbosone dehydrogenase NAD(P) dependent from
FT                   Gluconobacter oxydans (498 aa), FASTA scores: opt: 1157, E
FT                   (): 0, (42.1% identity in 482 aa overlap); etc. Also
FT                   similar to Rv0768, Rv2858c, etc from Mycobacterium
FT                   tuberculosis. Contains PS00687 Aldehyde dehydrogenases
FT                   glutamic acid active site; and PS00070 Aldehyde
FT                   dehydrogenases cysteine active site. Belongs to the
FT                   aldehyde dehydrogenases family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0223c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42951"
FT                   /db_xref="GOA:I6X8S7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:I6X8S7"
FT                   /inference="protein motif:PROSITE:PS00070"
FT                   /inference="protein motif:PROSITE:PS00687"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42951.1"
FT                   /translation="MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAA
FT                   ADVDAAVAAARAAFDNGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTI
FT                   IETMHWMGSMGAMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLA
FT                   VNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSN
FT                   PDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGV
FT                   MNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVE
FT                   GYIAKGIEEGARLVCGGGRPEGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYD
FT                   TEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYAFDPGSPFGGYKNS
FT                   GIGRENGPEGVEHFTQQKSVLLPMGYTVA"
FT   gene            complement(267863..268627)
FT                   /locus_tag="Rv0224c"
FT   CDS_pept        complement(267863..268627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0224c"
FT                   /product="Possible methyltransferase (methylase)"
FT                   /note="Rv0224c, (MTCY08D5.19c), len: 254 aa. Possible
FT                   methyltransferase, showing weak similarity with other
FT                   methyltransferases e.g. P74388 sterol-C-methyltransferase
FT                   (318 aa), FASTA scores: opt: 190, E(): 3.6e-05, (33.3%
FT                   identity in 114 aa overlap). Equivalent to
FT                   AL022486|MLCB1883_1 from Mycobacterium leprae (269
FT                   aa),FASTA scores: opt: 1456, E(): 0, (82.9% identity in 252
FT                   aa overlap). Also some similarity with MTCY21B4.22c from
FT                   Mycobacterium tuberculosis FASTA score: (30.1% identity in
FT                   136 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0224c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42952"
FT                   /db_xref="GOA:P9WJZ9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJZ9"
FT                   /protein_id="CCP42952.1"
FT                   /translation="MAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMI
FT                   GDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRP
FT                   GMFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLG
FT                   PFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAV
FT                   FPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP"
FT   gene            268663..269817
FT                   /locus_tag="Rv0225"
FT   CDS_pept        268663..269817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0225"
FT                   /product="Possible conserved protein"
FT                   /note="Rv0225, (MTCY08D5.20), len: 384 aa. Possible
FT                   conserved protein involved in LPS biosynthesis, similar to
FT                   O26275 LPS biosynthesis RFBU related protein (382 aa),FASTA
FT                   scores: opt: 426, E(): 1.2e-20, (28.2% identity in 394 aa
FT                   overlap). Some similarity with Rv3032 from Mycobacterium
FT                   tuberculosis FASTA score: (31.6% identity in 228 aa
FT                   overlap). Predicted to be an outer membrane protein (See
FT                   Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0225"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42953"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:P96407"
FT                   /protein_id="CCP42953.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
FT   gene            complement(269834..271564)
FT                   /locus_tag="Rv0226c"
FT   CDS_pept        complement(269834..271564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0226c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0226c, (MTCY08D5.21c), len: 576 aa. Probable
FT                   conserved transmembrane protein, equivalent, except in
FT                   N-terminal part, to AC32114.1|AL583926 conserved membrane
FT                   protein from Mycobacterium leprae (600 aa), FASTA scores:
FT                   opt: 2086, E(): 0, (70.3% identity in 579 aa overlap). Also
FT                   similar to AL021411|SC7H1_20 from Streptomyces coelicolor
FT                   (483 aa), FASTA scores: opt: 180, E(): 0.00028, (26.5
FT                   identity in 388 aa overlap). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0226c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42954"
FT                   /db_xref="GOA:P96408"
FT                   /db_xref="UniProtKB/TrEMBL:P96408"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42954.1"
FT                   /translation="MRWFRPGYALVLVLLLAAPLLRPGYLLLRDAVSTPRSYVSANALG
FT                   LTSAPRATPQDFAVALASHLVDGGVVVKALLLLGLWLAGWGAARLVATALPAAGAAGQF
FT                   VAITLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLTMRTTVGAGWFGLFGLAFWVA
FT                   LAGLTPSGLLLAATVAVVCVAMPGAGRPRWQCGVAALGSALVGALPWLTASALGSSLTS
FT                   HTAANQLGVTAFAPRAEPGLGTLGSLASLGGIWNGEAVPSSRTTLFAVASAVVLLAMVA
FT                   IGLPTVARRPVAVPLLTLAAVSVMVPAVLATGPGLHALRVVVDAAPGLGVLRDGQKWVA
FT                   LAVPGYTLSGAGTVLTLRRWLRPATAAVVCCLALVLTLPDLAWGVWGKVAPVHYPSGWA
FT                   AVAAAINADPRTVAVLPAGTMRRFSWSGSAPVLDPLPRWVRADVLTTGDLVISGVTVPG
FT                   EDAHARAVQELLLTGPHPSTLAAAGVGWLVVESDSAGDMGAAARTLGRLAAAHRDDELA
FT                   LYRVGGQTSGASSARLKATMLAHWAWLSMLLVGGAGAAGYWVRRHLHHCEDTPASRAQD
FT                   "
FT   gene            complement(271574..272839)
FT                   /locus_tag="Rv0227c"
FT   CDS_pept        complement(271574..272839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0227c"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0227c, (MTCY08D5.22c), len: 421 aa. Possible
FT                   conserved membrane protein, equivalent to
FT                   AL022486|MLCB1883_4 from Mycobacterium leprae (448
FT                   aa),FASTA scores: opt: 2148, E(): 0, (76.6% identity in 423
FT                   aa overlap). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0227c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42955"
FT                   /db_xref="GOA:P96409"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:P96409"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42955.1"
FT                   /translation="MLRFAACGAIGLGAALLIAALLLSTYTTSRIAEIPLDIDATLISD
FT                   GTGTALDSASLATEHIVVNQDVPLVSQQQVTVESPANADVVTLQVGSSLRRTDKQKDSG
FT                   LLLAIVDTVTLNRKTAMAVSDDTHTGGAVQKPRGLNDENPPTAIPLRHDGLSYRFPFHT
FT                   EKKTYPYFDPIAQKAFDANYEGEEDVNGLTTYRFTQNVGYTPEGKLVAPLKYPSLYAGD
FT                   EDGKVTTSAAMWGLPGDPNEQITMTRYYAAQRTFWVDPVSGTIVKETERANHYFARDPL
FT                   KPEVTFADYQVTSTEETVESQVNAARDERDRLALWSRVLPITFTAAGLVALVGGGLFAS
FT                   FSLRTEGALMAASGDRDDHDYRRGGFEEPVPGAEAETEKLPTQRPDFPREPSGSDPPRL
FT                   GSAQPPPPPDAGHPDPGPPERR"
FT   repeat_region   complement(272855..272955)
FT                   /note="101 bp Mycobacterial Interspersed Repetitive
FT                   Unit,class III"
FT   gene            273055..274278
FT                   /locus_tag="Rv0228"
FT   CDS_pept        273055..274278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0228"
FT                   /product="Probable integral membrane acyltransferase"
FT                   /note="Rv0228, (MTCY08D5.23), len: 407 aa. Probable
FT                   integral membrane acyltransferase, equivalent to
FT                   3063875|CAA18555.1|AL022486|T44870 acyltransferase from
FT                   Mycobacterium leprae (384 aa), FASTA scores: opt: 2004,E():
FT                   0, (79.3% identity in 381 aa overlap). Also similar to
FT                   others e.g. Q11064 probable acyltransferase CY50.28C (383
FT                   aa), FASTA scores: opt: 372, E(): 2.6e-16, (35.9% identity
FT                   in 359 aa overlap); Q00718|MDMB_STRMY acyltransferase. Very
FT                   similar to Rv0111, Rv1254, etc from Mycobacterium
FT                   tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0228"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42956"
FT                   /db_xref="GOA:P96410"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:P96410"
FT                   /protein_id="CCP42956.1"
FT                   /translation="MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRAC
FT                   AAVGVVVTHVAFQTGHSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPR
FT                   TGPYLRSRVARIMPAYVVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQ
FT                   MWSLSVEVAFYAALPVLALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTW
FT                   PPAFFSWFAAGMLLAEWAYSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPG
FT                   TAAQFAVKTAMGSLVAFALVAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALA
FT                   MVFPVIGAFPFTGRMPTVLVLTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGE
FT                   LQADAIAP"
FT   gene            complement(274306..274986)
FT                   /locus_tag="Rv0229c"
FT   CDS_pept        complement(274306..274986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0229c"
FT                   /product="Possible conserved membrane protein with PIN
FT                   domain"
FT                   /note="Rv0229c, (MTCY08D5.24c), len: 226 aa. Possible
FT                   conserved membrane protein with PIN domain in C-terminal
FT                   half, similar to several others from Mycobacterium
FT                   tuberculosis. Has some similarity with Rv2757c|D70880 from
FT                   Mycobacterium tuberculosis (138 aa). (See Arcus et
FT                   al.,2005). FASTA scores: E(): 1e-15, (45.3% identity in 137
FT                   aa overlap), and Rv0301, Rv2546, etc. Also some similarity
FT                   with Q48177 virulence associated protein C (132 aa), FASTA
FT                   scores: opt: 101, E(): 0.6, (24.3% identity in 136 aa
FT                   overlap). Contains PS00626 Regulator of chromosome
FT                   condensation (RCC1) signature 2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0229c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42957"
FT                   /db_xref="GOA:L0T5V6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:L0T5V6"
FT                   /inference="protein motif:PROSITE:PS00626"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42957.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
FT   gene            complement(274983..275963)
FT                   /gene="php"
FT                   /locus_tag="Rv0230c"
FT   CDS_pept        complement(274983..275963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="php"
FT                   /locus_tag="Rv0230c"
FT                   /product="Probable phosphotriesterase Php (parathion
FT                   hydrolase) (PTE) (aryldialkylphosphatase) (paraoxonase)
FT                   (a-esterase) (aryltriphosphatase) (paraoxon hydrolase)"
FT                   /note="Rv0230c, (MTCY08D5.26c), len: 326 aa. Probable
FT                   php,phosphotriesterase, similar to others e.g.
FT                   AAK42653.1|AE006849 putative aryldialkylphosphatase
FT                   (phosphotriesterase) (paraoxonase) from Sulfolobus
FT                   solfataricus (314 aa); PHP_ECOLI|P45548 phosphotriesterase
FT                   homology protein from Escherichia coli (292 aa), FASTA
FT                   scores: opt: 408, E(): 7.1e-20, (31.1% identity in 305 aa
FT                   overlap); OPD_FLASP|P16648 parathion hydrolase precursor
FT                   (365 aa), FASTA scores: opt: 319, E(): 5.1e-14, (34.5%
FT                   identity in 333 aa overlap); etc. Belongs to the
FT                   phosphotriesterase family. Cofactor: contains 2 moles of
FT                   zinc per subunit."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0230c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42958"
FT                   /db_xref="GOA:P9WHN9"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:4IF2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHN9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42958.1"
FT                   /translation="MPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDK
FT                   RVAGAIARLGELKARGVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVP
FT                   FYFHYLGPGAQLDGPEIMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRA
FT                   VAQAHKRTGAPISTHTHAGLRRGLDQQRIFAEEGVDLSRVVIGHCGDSTDVGYLEELIA
FT                   AGSYLGMDRFGVDVISPFQDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAM
FT                   PNWHYLHIHNDVIPALKQHGVTDEQLHTMLVDNPRRIFERQGGYQ"
FT   gene            276058..277764
FT                   /gene="fadE4"
FT                   /locus_tag="Rv0231"
FT   CDS_pept        276058..277764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE4"
FT                   /locus_tag="Rv0231"
FT                   /product="Probable acyl-CoA dehydrogenase FadE4"
FT                   /note="Rv0231, (MTCY08D5.27), len: 568 aa. Probable
FT                   fadE4,acyl-CoA dehydrogenase, similar to many e.g. O29752
FT                   acyl-CoA dehydrogenase (ACD-3) from Archaeoglobus fulgidus
FT                   (576 aa), FASTA scores: opt: 1788, E(): 0, (51.0% identity
FT                   in 577 aa overlap); ACDB_BACSU|P45857 acyl-CoA
FT                   dehydrogenase from Bacillus subtilis (379 aa), FASTA
FT                   scores: opt: 232, E(): 2.2e- 08, (21.6% identity in 291 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0231"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42959"
FT                   /db_xref="GOA:P96414"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P96414"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42959.1"
FT                   /translation="MLLNPNHLTRKYPDRRSGEIMAATVDFFESRGKARLKHDDHERIW
FT                   YSDFLDFVGRERIFASLLTPASYGADDCRWDTYRISEFAEIMGFYGLSYWYPFQVTALG
FT                   LGPIWMSANEDAKRKAAAGLEAGEVFAFGLSEQTHGADVYQTDMILTPSDGGWTANGEK
FT                   YYIGNANVARMVSTFGKIAGTPESQEYVFFVADSQHERYDLIKNVVNSQNYVANYALRD
FT                   YPVTEADILHRGAEAFHAALNTVNVCKYNLGWGAIGMCTHALYESVTHAANRHLYGTVV
FT                   TDFSHVRRLLTDAYVRLIAMKLVASRASDYMRSASAADRRYLLYSPLTKAKVTSEGERV
FT                   ITALWDVIAAKGVEKDTFFETVAREIGLLPRLEGTVHINIGLLGKFMPNYLFAPDSTLP
FT                   VIPRRDDAADDAFLFAQGPTGGLGKVRFHDWRASFDTCAHLPNVALLREQVDVFAELLA
FT                   SATPDAAQQKDIDFAFGVGQLFANVPYAQLILEEARLSGVDEALIDEIFGVLVRDFNTH
FT                   AVELHGRSATTAEQARFAMRMVRRPVHDPARYDQIWKDHVLALNGAYQMAP"
FT   gene            277899..278588
FT                   /locus_tag="Rv0232"
FT   CDS_pept        277899..278588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0232"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably TetR/AcrR-family)"
FT                   /note="Rv0232, (MTCY08D5.28), len: 229 aa. Probable
FT                   transcriptional regulatory protein, TetR/AcrR
FT                   family,similar to others e.g. YIXD_BACSU|P32398
FT                   hypothetical transcriptional regulator (191 aa), FASTA
FT                   scores: opt: 149,E(): 0.0014, (21.5% identity in 158 aa
FT                   overlap). Also similar to MTV030_11 from Mycobacterium
FT                   tuberculosis. Contains PS01081 Bacterial regulatory
FT                   proteins, TetR family signature, and probable helix-turn
FT                   helix motif from aa 33-54 (Score 1142, +3.08 SD). Belongs
FT                   to the TetR/AcrR family of transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0232"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42960"
FT                   /db_xref="GOA:P96415"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:P96415"
FT                   /inference="protein motif:PROSITE:PS01081"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42960.1"
FT                   /translation="MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVA
FT                   KGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFA
FT                   EHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALM
FT                   SLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQ
FT                   TRSEEIT"
FT   gene            278585..279529
FT                   /gene="nrdB"
FT                   /gene_synonym="rnrS"
FT                   /locus_tag="Rv0233"
FT   CDS_pept        278585..279529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /gene_synonym="rnrS"
FT                   /locus_tag="Rv0233"
FT                   /product="Ribonucleoside-diphosphate reductase (beta chain)
FT                   NrdB (ribonucleotide reductase small chain)"
FT                   /note="Rv0233, (MTCY08D5.29), len: 314 aa. nrdB (alternate
FT                   gene name: rnrS) ribonucleoside-diphosphate reductase, beta
FT                   chain, similar to others e.g. RIR2_SCHPO|P36603
FT                   ribonucleoside-diphosphate reductase (391 aa), FASTA
FT                   scores: opt: 168, E(): 0.00018, (26.1% identity in 199 aa
FT                   overlap); etc. Belongs to the ribonucleoside diphosphate
FT                   reductase small chain family. Cofactor: iron, manganese"
FT                   /db_xref="EnsemblGenomes-Gn:Rv0233"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42961"
FT                   /db_xref="GOA:P9WH69"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="PDB:3EE4"
FT                   /db_xref="PDB:4AC8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH69"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42961.1"
FT                   /translation="MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWHPADIDFTRDRAD
FT                   WEKLSDDERDYATRLCTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKH
FT                   TQVFRMWLDAVGISEDLHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYN
FT                   HIVEGMLALTGYYAWHKICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDA
FT                   NWTVFETRMNELIPLALRLIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNAR
FT                   GRPVAEIDVDYSPAQLEDTFADEDRRTLAAASA"
FT   gene            complement(279605..281140)
FT                   /gene="gabD1"
FT                   /gene_synonym="gabD2"
FT                   /locus_tag="Rv0234c"
FT   CDS_pept        complement(279605..281140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /gene_synonym="gabD2"
FT                   /locus_tag="Rv0234c"
FT                   /product="Succinate-semialdehyde dehydrogenase [NADP+]
FT                   dependent (SSDH) GabD1"
FT                   /note="Rv0234c, (MTCY08D5.30c), len: 511 aa.
FT                   gabD1,succinate-semialdehyde dehydrogenase [NADP+]
FT                   dependent,equivalent to AL022486|MLCB1883_6 probable
FT                   aldehyde dehydrogenase from Mycobacterium leprae (457 aa),
FT                   FASTA scores: opt: 2617, E(): 0, (85.7% identity in 455 aa
FT                   overlap). Also highly similar to Q55585|GABD|SLR0370
FT                   probable succinate-semialdehyde dehydrogenase from
FT                   Synechocystis sp. strain PCC 6803 (454 aa), FASTA scores:
FT                   opt: 1676, E(): 0, (55.8% identity in 455 aa overlap); and
FT                   similar to others e.g. GABD_ECOLI|P25526
FT                   succinate-semialdehyde dehydrogenase from Escherichia coli
FT                   (482 aa), FASTA scores: opt: 929, E(): 0, (36.5% identity
FT                   in 452 aa overlap); etc. Note that similar to other
FT                   cytosolic aldehyde dehydrogenases with EC number: 1.2.1.3.
FT                   Also similar to Rv0768|aldA semialdehyde dehydrogenase from
FT                   Mycobacterium tuberculosis (489 aa); and
FT                   gabD2|Rv1731|MTCY04C12.16 possible succinate-semialdehyde
FT                   dehydrogenase [NADP+] dependent from Mycobacterium
FT                   tuberculosis (518 aa). Contains PS00070 aldehyde
FT                   dehydrogenases cysteine active site. Belongs to the
FT                   aldehyde dehydrogenases family. Could start at different
FT                   site by homology. Note that previously known as gabD2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0234c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42962"
FT                   /db_xref="GOA:P9WNX9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNX9"
FT                   /inference="protein motif:PROSITE:PS00070"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42962.1"
FT                   /translation="MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFV
FT                   QTHPAKDVSVPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARW
FT                   ANATADLLEAEADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADA
FT                   AKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALY
FT                   LADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKP
FT                   TVLELGGSDPFIVMPSADLDAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFV
FT                   ARMAALRVGDPTDPDTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYP
FT                   PTVITDISKDMALYTEEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRR
FT                   FIDDIVAGQVFINGMTVSYPELPFGGVKRSGYGRELSAHGIREFCNIKTVWIA"
FT   gene            complement(281166..282614)
FT                   /locus_tag="Rv0235c"
FT   CDS_pept        complement(281166..282614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0235c"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0235c, (MTCY08D5.31c), len: 482 aa. Probable
FT                   conserved transmembrane protein, highly similar to
FT                   AL133278|CAB61913.1|SCM11_2 putative integral membrane
FT                   protein from Streptomyces coelicolor (470 aa), FASTA
FT                   scores: opt: 2116, E(): 0, (61.8% identity in 474 aa
FT                   overlap); and similar to hypothetical proteins from other
FT                   organisms e.g. Q13392|384D8_7 hypothetical protein (579
FT                   aa), FASTA scores: opt: 355, E(): 6.9e-17, (28.5% identity
FT                   in 569 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0235c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42963"
FT                   /db_xref="GOA:P96418"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:P96418"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42963.1"
FT                   /translation="MGWFSAPEYWLGRLALERGTAIIYLIAFVAAAQQFRPLIGEHGML
FT                   PVPRYLAGQSFWRTPSIFHFRYSDRVFAGVCWLGAVLSAAVVAGAASFVPLWATMLIWL
FT                   TLWVLYLSIVNVGQAWYSFGWESLLLETGFLMIFLGNERTAPPILTLLLARWLLFRVEF
FT                   GAGLIKMRGDSCWRSLTCLYYHHETQPMPGPLSWFFHHLPKPLHRIEVAGNHFAQLVVP
FT                   FGLFTPQPAASIAAAIIVVTQLWLVASGNFSWLNWLTILLACSAIDTSSAAALLPMPAQ
FT                   PALSAPPQWFAGLVVVFTAAVLLLSYWPARNLLSSHQRMNMSFNPFHLVNTYGAFGSIC
FT                   RTRREVVIEGTDESPITEQTVWKAYEFKGKPGDPRRLPRQWAPYHLRLDWLMWFAAISP
FT                   GYALPWMTPFLNRLLRNDPATLKLLRHNPFPQSPPRYVRAQLYQYRFTTVAELRRDRAW
FT                   WHRTLIGRYVPPMSLRKVASPPAD"
FT   gene            complement(282649..286851)
FT                   /gene="aftD"
FT                   /locus_tag="Rv0236c"
FT   CDS_pept        complement(282649..286851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aftD"
FT                   /locus_tag="Rv0236c"
FT                   /product="Possible arabinofuranosyltransferase AftD"
FT                   /note="Rv0236c, (MTV034.01c, MTV034.02c, MTCY08D5.32c),len:
FT                   1400 aa. Possible aftD, arabinofuranosyltransferase (See
FT                   Skovierova et al., 2009). Predicted to be in the GT-C
FT                   superfamily of glycosyltransferases (See Liu and
FT                   Mushegian,2003). Probable conserved transmembrane protein,
FT                   equivalent to AL022486|CAC32102.1|MLCB1883_7 possible
FT                   integral membrane protein from Mycobacterium leprae (1440
FT                   aa), FASTA scores: opt: 7491, E(): 0, (78.8% identity in
FT                   1397 aa overlap). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0236c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42964"
FT                   /db_xref="GOA:P96419"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96419"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42964.1"
FT                   /translation="MAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLA
FT                   RATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVGFWGL
FT                   LRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGT
FT                   SGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIWWACHRPNRLWWRYTAWWLLAMA
FT                   LATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAP
FT                   LVTGSAAILGTCLVAAAGLAGLTSPAMPARGRLVTMLLVGVVLLAVGHRGGLASPVAHP
FT                   VQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDK
FT                   RVAVAVVALTALMVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLV
FT                   VPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIRALDSVQRLFAAGRPSAG
FT                   LADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAG
FT                   FVNDSGLRPRYPAIEIYRVSAPANPGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQP
FT                   PLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPD
FT                   YPVPGAEPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAA
FT                   VGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRFDEAGKPLTAALP
FT                   YGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAI
FT                   AGWDLGSELLGRPGCAPGPDGVRCAASMALAPEEPANLSRTLTVPRPVSVTPMVWVRPR
FT                   QGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTL
FT                   TLPRPTVVTGLRLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVS
FT                   VSLLDWDDVIDRNALGFDQLKPPGLAEVVVLSAGGAPIAPADAARNRARALTVDCDHGP
FT                   VVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQ
FT                   LSTPGAGLSSATVTSAETGAWGPTHREVRVPESATSRVLVVPESINSGWVARTSTGARL
FT                   TPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQL
FT                   ADRPTPPWRPGAWAAAGVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLA
FT                   AGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ"
FT   gene            complement(286898..287071)
FT                   /locus_tag="Rv0236A"
FT   CDS_pept        complement(286898..287071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0236A"
FT                   /product="Small secreted protein"
FT                   /note="Rv0236A, len: 57 aa. Small secreted protein. A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0236A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42965"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WLB1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42965.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
FT   gene            287186..288352
FT                   /gene="lpqI"
FT                   /locus_tag="Rv0237"
FT   CDS_pept        287186..288352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqI"
FT                   /locus_tag="Rv0237"
FT                   /product="Probable conserved lipoprotein LpqI"
FT                   /note="Rv0237, (MTV034.03), len: 388 aa. Probable
FT                   lpQI,conserved lipoprotein, equivalent to
FT                   AL022486|MLCB1883_8|T44873 probable secreted hydrolase from
FT                   Mycobacterium leprae (387 aa), FASTA scores: opt: 1831,E():
FT                   0, (73.3% identity in 390 aa overlap). Also similar to
FT                   other lipoproteins and various hydrolases e.g.
FT                   P40406|2126897|YBBD_BACSU|I39839 hypothetical 70.6 KDA
FT                   lipoprotein from Bacillus subtilis (642 aa);
FT                   P48823|HEXA_ALTSO beta-hexosaminidase a precursor from
FT                   alteromonas SP. (598 aa), FASTA scores: opt: 415, E():
FT                   5.8e-17, (31.2% identity in 343 aa overlap); PCC6803|P74340
FT                   beta-glucosidase from Synechocystis sp. (538 aa), FASTA
FT                   scores: opt: 414, E(): 6.1e-17, (30.6 identity in 320 aa
FT                   overlap). Contains signal sequence and appropriately
FT                   positioned PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0237"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42966"
FT                   /db_xref="GOA:L7N6B0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:6GFV"
FT                   /db_xref="UniProtKB/Swiss-Prot:L7N6B0"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42966.1"
FT                   /translation="MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPV
FT                   PRSCAEPAGIPALLSPRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDG
FT                   ALAEIVAGGGPLPLAVSVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRG
FT                   RQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVL
FT                   KHFPGHGRGSGDSHNGGVTTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSE
FT                   PASLSKAAVNLLRTGTGYGAPPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIA
FT                   LWVTTKEVPAVLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR"
FT   gene            288428..289042
FT                   /locus_tag="Rv0238"
FT   CDS_pept        288428..289042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0238"
FT                   /product="Possible transcriptional regulatory protein
FT                   (probably TetR-family)"
FT                   /note="Rv0238, (MTV034.04), len: 204 aa. Possible
FT                   transcriptional regulatory protein, TetR family, equivalent
FT                   to AL022486|MLCB1883_9|T44874 probable transcription
FT                   regulator from Mycobacterium leprae (208 aa), FASTA scores:
FT                   opt: 1029, E(): 0, (80.9% identity in 199 aa overlap). Also
FT                   similar to others e.g. CAB77290.1|AL160312 putative
FT                   TetR-family regulatory protein from Streptomyces coelicolor
FT                   (240 aa). Also similar to Mycobacterium tuberculosis
FT                   proteins Z95120|Rv3208 (228 aa), FASTA scores: opt:
FT                   266,E(): 8.3e-12, (28.1% identity in 196 aa overlap); and
FT                   Rv1019 (197 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0238"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42967"
FT                   /db_xref="GOA:O53661"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:O53661"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42967.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANR
FT                   ASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAG
FT                   EAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH"
FT   gene            289104..289337
FT                   /gene="vapB24"
FT                   /locus_tag="Rv0239"
FT   CDS_pept        289104..289337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB24"
FT                   /locus_tag="Rv0239"
FT                   /product="Possible antitoxin VapB24"
FT                   /note="Rv0239, (MTV034.05), len: 77 aa. Possible
FT                   vapB24,antitoxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0240. Weakly similar to others e.g.
FT                   Rv1839c|Z83859|MTCY359_34 from Mycobacterium tuberculosis
FT                   (87 aa). See Arcus et al. 2005. FASTA scores: opt: 88, E():
FT                   5, (40.0% identity in 45 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0239"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ41"
FT                   /protein_id="CCP42968.1"
FT                   /translation="MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRR
FT                   DAASDTWQPPTPRRLGPFRASEETWRELANEA"
FT   gene            289345..289782
FT                   /gene="vapC24"
FT                   /locus_tag="Rv0240"
FT   CDS_pept        289345..289782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC24"
FT                   /locus_tag="Rv0240"
FT                   /product="Possible toxin VapC24. Contains PIN domain."
FT                   /note="Rv0240, (MTV034.06), len: 145 aa. Possible
FT                   vapC24,toxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0239,contains PIN domain, weak similarity with Rv3697c
FT                   from Mycobacterium tuberculosis (145 aa). See Arcus et al.
FT                   2005. FASTA scores: opt: 145, E(): 7.6e-05, (28.0% identity
FT                   in 143 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0240"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42969"
FT                   /db_xref="GOA:P9WF87"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF87"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42969.1"
FT                   /translation="MLSIDTNILLYAQNRDCPEHDAAAAFLVECAGRADVAVCELVLME
FT                   LYQLLRNPTVVTRPLEGPEAAEVCQTFRRNRRWALLENAPVMNEVWVLAATPRIARRRL
FT                   FDARLALTLRHHGVDEFATRNINGFTDFGFSRVWDPITSDG"
FT   gene            complement(289812..290654)
FT                   /gene="htdX"
FT                   /locus_tag="Rv0241c"
FT   CDS_pept        complement(289812..290654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htdX"
FT                   /locus_tag="Rv0241c"
FT                   /product="Probable 3-hydroxyacyl-thioester dehydratase
FT                   HtdX"
FT                   /note="Rv0241c, (MTV034.07c), len: 280 aa. Probable
FT                   htdX,3-hydroxyacyl-thioester dehydratase (See Gurvitz et
FT                   al.,2009), highly similar to
FT                   MLCB1883.17c|T44876063881|CAA18566.1|AL022486 hypothetical
FT                   protein from Mycobacterium leprae (280 aa), FASTA scores:
FT                   opt: 1564, E(): 0, (81.8% identity in 280 aa overlap); and
FT                   CAC32097.1|AL583926 conserved hypothetical protein from
FT                   Mycobacterium leprae (300 aa). Shows structural similarity
FT                   to six others in Mycobacterium tuberculosis (see Castell et
FT                   al (2005) below). Also similar to proteins from other
FT                   organisms e.g. CAB77291.1|AL160312 putative dehydratase
FT                   from Streptomyces coelicolor (291 aa); part of
FT                   BAA92930.1|AB032743 fatty acid synthetase beta subunit from
FT                   Pichia angusta (2060 aa). Predicted to be an outer membrane
FT                   protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0241c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42970"
FT                   /db_xref="GOA:O53664"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:3WEW"
FT                   /db_xref="PDB:4OOB"
FT                   /db_xref="UniProtKB/TrEMBL:O53664"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42970.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
FT   gene            complement(290665..292029)
FT                   /gene="fabG4"
FT                   /locus_tag="Rv0242c"
FT   CDS_pept        complement(290665..292029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG4"
FT                   /locus_tag="Rv0242c"
FT                   /product="Probable 3-oxoacyl-[acyl-carrier protein]
FT                   reductase FabG4 (3-ketoacyl-acyl carrier protein
FT                   reductase)"
FT                   /note="Rv0242c, (MTV034.08c), len: 454 aa. Probable
FT                   fabG4,3-oxoacyl-[acyl-carrier protein] reductase,
FT                   equivalent to
FT                   3063883|CAA18568.1|AL022486|MLCB1883_13|T44878
FT                   3-oxoacyl-[acyl-carrier protein] reductase homolog from
FT                   Mycobacterium leprae (454 aa), FASTA scores: opt: 2486,E():
FT                   0, (84.8% identity in 454 aa overlap). C-terminal part
FT                   highly similar to many FabG proteins e.g. U39441|VHU3944
FT                   1_2 from Vibrio harveyi (244 aa), FASTA scores: opt:
FT                   562,E(): 3.4e-28, (40.2% identity in 241 aa overlap);
FT                   U91631|PAU91631_3 from Pseudomonas aeruginosa (247
FT                   aa),FASTA scores: opt: 584, E(): 1.5e-29, (44.4% identity
FT                   in 241 aa overlap). Has N-terminal extension of ~200 aa and
FT                   C-terminal part contains PS00061 Short-chain
FT                   dehydrogenases/reductases family signature. Belongs to the
FT                   short-chain dehydrogenases/reductases (SDR) family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0242c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42971"
FT                   /db_xref="GOA:I6Y778"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y778"
FT                   /inference="protein motif:PROSITE:PS00061"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42971.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
FT   gene            292171..293493
FT                   /gene="fadA2"
FT                   /locus_tag="Rv0243"
FT   CDS_pept        292171..293493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="Rv0243"
FT                   /product="Probable acetyl-CoA acyltransferase FadA2
FT                   (3-ketoacyl-CoA thiolase) (beta-ketothiolase)"
FT                   /note="Rv0243, (MTV034.09), len: 440 aa. Probable
FT                   fadA2,acetyl-CoA acyltransferase (3-acyl-CoA
FT                   thiolase),equivalent, but shorter 17 aa, to
FT                   AL022486|MLCB1883_14T44879 acetyltransferase from
FT                   Mycobacterium leprae (457 aa), FASTA scores: opt: 250
FT                   7,E(): 0, (87.6% identity in 435 aa overlap). Also highly
FT                   similar to many e.g. G83046|PA478 probable acyl-CoA
FT                   thiolase from Pseudomonas aeruginosa (425 aa);
FT                   AB77293.1|AL160312 putative ketoacyl CoA thiolase from
FT                   Streptomyces coelicolor (428 aa);
FT                   P76503|7449731|YFCY_ECOLI|D65007|B2342 probable
FT                   3-ketoacyl-CoA thiolase (acetyl-CoA acyltransferase)
FT                   (beta-ketothiolase) from Escherichia coli strain K-12 (436
FT                   aa), FASTA scores: opt: 914, E(): 0, (38.2% identity in 434
FT                   aa overlap); P55084|ECHB_HUMAN mitochondrial trifunctonal
FT                   enzyme (474 aa), FASTA scores: opt: 881, E(): 0, (37.7
FT                   identity in 451 aa overlap). Contains PS00099 Thiolases
FT                   active site. Belongs to the thiolase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0243"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42972"
FT                   /db_xref="GOA:O86361"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:O86361"
FT                   /inference="protein motif:PROSITE:PS00099"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42972.1"
FT                   /translation="MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAAL
FT                   SGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQ
FT                   AAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTL
FT                   PASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFD
FT                   DLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLAS
FT                   EQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEI
FT                   HEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRI
FT                   LAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA"
FT   gene            293604..293705
FT                   /gene="F6"
FT                   /gene_synonym="mcr14"
FT                   /gene_synonym="mpr13"
FT   ncRNA           293604..293705
FT                   /gene="F6"
FT                   /gene_synonym="mcr14"
FT                   /gene_synonym="mpr13"
FT                   /product="Putative small regulatory RNA"
FT                   /note="F6, putative small regulatory RNA (See Arnvig and
FT                   Young, 2009; DiChiara et al., 2010). Alternate 3'-ends at
FT                   positions 293641 and 293661."
FT                   /ncRNA_class="other"
FT   gene            complement(293798..295633)
FT                   /gene="fadE5"
FT                   /locus_tag="Rv0244c"
FT   CDS_pept        complement(293798..295633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE5"
FT                   /locus_tag="Rv0244c"
FT                   /product="Probable acyl-CoA dehydrogenase FadE5"
FT                   /note="Rv0244c, (MTV034.10c), len: 611 aa. Probable
FT                   fadE5,acyl-CoA dehydrogenase, equivalent to
FT                   AL022486|MLCB1883_15 from Mycobacterium leprae (611 aa),
FT                   FASTA scores: opt: 3598, E(): 0, (89.4% identity in 611 aa
FT                   overlap). Also highly similar to AL0211|MTV007.14 from
FT                   Mycobacterium tuberculosis (609 aa), FASTA scores: opt:
FT                   2576, E(): 0,(64.6% identity in 611 aa overlap); and to
FT                   various other bacterial proteins described as putative
FT                   acyl-CoA dehydrogenases e.g. AE0010|AE001025_6 from
FT                   Archaeoglobus fulgidus (387 aa), FASTA scores: opt: 229,
FT                   E(): 6.8e-08,(29.8% identity in 409 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0244c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42973"
FT                   /db_xref="GOA:O53666"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:O53666"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42973.1"
FT                   /translation="MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEV
FT                   SRLAEGPVAESFVEGDRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEALGGM
FT                   PMPKAVVWALHEHILGANPAVWMYAGGAGFAQILYHLGTEEQKKWAVLAAERGWGSTMV
FT                   LTEPDAGSDVGAARTKAVQQADGSWHIDGVKRFITSGDSGDLFENIFHLVLARPEGAGP
FT                   GTKGLSLYFVPKFLFDVETGEPGERNGVFVTNVEHKMGLKVSATCELAFGQHGVPAKGW
FT                   LVGEVHNGIAQMFEVIEQARMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDAAVAEVVHGVDAKLAVKVNDLM
FT                   LPVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVSGQIQEFVDSGAGNGRLKTERALLAKALTDVQGMAAALTGYLMA
FT                   AQQDVTSLYKVGLGSVRFLMSVGDLIIGWLLQRQAAVAVAALDAGATGDERSFYEGKVA
FT                   VASFFAKNFLPLLTSTREVIETLDNDIMELDEAAF"
FT   gene            296005..296493
FT                   /locus_tag="Rv0245"
FT   CDS_pept        296005..296493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0245"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0245, (MTV034.11), len: 162 aa. Possible
FT                   oxidoreductase, equivalent to AL022486|MLCB1883_17|T44882
FT                   probable oxidoreductase from Mycobacterium leprae (162
FT                   aa),FASTA scores: opt: 860, E(): 0, (83.4% identity in 157
FT                   aa overlap). Also similar to several hypothetical proteins
FT                   and various oxidoreductases e.g. AAK24246.1|AE005898
FT                   NADH:riboflavin 5'-phosphate oxidoreductase from
FT                   Caulobacter crescentus (174 aa);
FT                   Q02058|DIM6_STRCO|CAA45048.1 actinorhodin polyketide
FT                   dimerase from streptomyces coelicolor (177 aa), FASTA
FT                   scores: opt: 308, E(): 3. 2e-15, (37.8% identity in 143 aa
FT                   overlap). Also similar to Z84498|Rv1939|MTCY09F9.25c from
FT                   Mycobacterium tuberculosis (171 aa), FASTA scores: opt:
FT                   517, E(): 3.5e-30, (49.4% identity in 158 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0245"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42974"
FT                   /db_xref="GOA:O53667"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:O53667"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42974.1"
FT                   /translation="MNSTNNLTPSSLREAFGHFPTGVVAIAAEVDGVRQGLAASTFVPV
FT                   SLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEAHDAAVRTLAAKTGDRFAGLETVSN
FT                   DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPNVAPIVFHRSVLRRLGV"
FT   gene            296809..298119
FT                   /locus_tag="Rv0246"
FT   CDS_pept        296809..298119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0246"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0246, (MTV034.12), len: 436 aa (start uncertain).
FT                   Probable conserved integral membrane protein, similar to
FT                   Rv2209|1237062|CAA94252.1|Z70283|Q10398|YM09_MYCTU from
FT                   Mycobacterium tuberculosis (512 aa), FASTA scores: opt:
FT                   712, E(): 0, (33.2% identity in 422 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0246"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42975"
FT                   /db_xref="GOA:O53668"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:O53668"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42975.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
FT   gene            complement(298116..298862)
FT                   /locus_tag="Rv0247c"
FT   CDS_pept        complement(298116..298862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0247c"
FT                   /product="Probable succinate dehydrogenase [iron-sulfur
FT                   subunit] (succinic dehydrogenase)"
FT                   /note="Rv0247c, (MTV034.13c), len: 248 aa. Probable
FT                   succinate dehydrogenase, iron-sulfur subunit, highly
FT                   similar to CAC44313.1|AL596043 putative succinate
FT                   dehydrogenase iron-sulfur subunit from Streptomyces
FT                   coelicolor (259 aa); and similar to iron-sulphur protein
FT                   subunits of fumarate reductase or succinate dehydrogenases
FT                   from many bacteria e.g. NP_147618.1|7521083|B72691 fumarate
FT                   reductase iron-sulfur protein from Aeropyrum pernix (305
FT                   aa); NP_069516.1|2649932|AAB90556.1|AE001057 succinate
FT                   dehydrogenase iron-sulfur subunit B (sdhB) from
FT                   Archaeoglobus fulgidus (236 aa); etc. Also similar to
FT                   Q10761|FRDB_MYCTU|7431693|F70762 fumarate reductase
FT                   iron-sulfur protein from Mycobacterium tuberculosis (247
FT                   aa), FASTA scores: opt: 358, E():1e-16, (31.3% identity in
FT                   214 aa overlap). Contains PS00197 2Fe-2S
FT                   ferredoxins,iron-sulfur binding region signature. Note that
FT                   succinate dehydrogenase forms generally part of an enzyme
FT                   complex containing four subunits: a flavoprotein (Rv0248c
FT                   ?), an iron-sulfur (Rv0247c ?), and two hydrophobic anchor
FT                   proteins (Rv0249c ?)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0247c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42976"
FT                   /db_xref="GOA:O53669"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:O53669"
FT                   /inference="protein motif:PROSITE:PS00197"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42976.1"
FT                   /translation="MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDV
FT                   SFNYQKAREIPSFAPPKELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEEN
FT                   KDAFAGPRFLMRIAELEMHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVADRKYDPVVWLGSKLFRR"
FT   gene            complement(298863..300803)
FT                   /locus_tag="Rv0248c"
FT   CDS_pept        complement(298863..300803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0248c"
FT                   /product="Probable succinate dehydrogenase [iron-sulfur
FT                   subunit] (succinic dehydrogenase)"
FT                   /note="Rv0248c, (MTV034.14c), len: 646 aa. Probable
FT                   succinate dehydrogenase, flavoprotein subunit, highly
FT                   similar to flavoprotein subunit of various succinate
FT                   dehydrogenases e.g. M88696|RIRSDHA_1 flavoprotein from
FT                   Rickettsia prowazekii (596 aa), FASTA scores: opt: 651,E():
FT                   0, (34.6 % identity in 598 aa overlap). Also similar to
FT                   truncated U00022_17 flavoprotein from Mycobacterium leprae
FT                   (401 aa), FASTA scores: opt: 677, E(): 0, (39.0% identity
FT                   in 423 aa overlap). Note that succinate dehydrogenase forms
FT                   generally part of an enzyme complex containing four
FT                   subunits: a flavoprotein (Rv0248c ?), an iron-sulfur
FT                   (Rv0247c ?), and two hydrophobic anchor proteins (Rv0249c
FT                   ?)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0248c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42977"
FT                   /db_xref="GOA:O53670"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:O53670"
FT                   /inference="protein motif:PROSITE:PS00141"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42977.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
FT   gene            complement(300834..301655)
FT                   /locus_tag="Rv0249c"
FT   CDS_pept        complement(300834..301655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0249c"
FT                   /product="Probable succinate dehydrogenase [membrane anchor
FT                   subunit] (succinic dehydrogenase)"
FT                   /note="Rv0249c, (MTV034.15c), len: 273 aa. Probable
FT                   succinate dehydrogenase, membrane-anchor subunit for
FT                   succinate dehydrogenase encoded by Rv0247c and Rv0248c.
FT                   Highly similar to AC44315.1|AL596043 putative integral
FT                   membrane protein from Streptomyces coelicolor (278 aa).
FT                   Note that succinate dehydrogenase forms generally part of
FT                   an enzyme complex containing four subunits: a flavoprotein
FT                   (Rv0248c ?), an iron-sulfur (Rv0247c ?), and two
FT                   hydrophobic anchor proteins (Rv0249c ?)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0249c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42978"
FT                   /db_xref="GOA:O53671"
FT                   /db_xref="UniProtKB/TrEMBL:O53671"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42978.1"
FT                   /translation="MSAPTANRPAIGVFTPTRAQIPERTLRTDLWWLPPLLTNLGLLAF
FT                   ICYATTRAFWGSQYWVEKYHYLTPFYSPCVSASCQPGASHLGVWFGHFPGWIPLGAMVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTSCAVPEPRAHYTGETRLPLIVQNTHRYFFYIAV
FT                   VVSLINTYDAIAAFHSPSGFGFGLGNVILTINVVLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMQFAWITLGTLALTDFYIMLVASGSITDLRFIG"
FT   gene            complement(301735..302028)
FT                   /locus_tag="Rv0250c"
FT   CDS_pept        complement(301735..302028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0250c"
FT                   /product="Conserved protein"
FT                   /note="Rv0250c, (MTV034.16c), len: 97 aa. Conserved
FT                   protein, equivalent to
FT                   MLCB1883.27c|T44883|3063888|CAA18576.1|AL022486
FT                   hypothetical protein from Mycobacterium leprae (98
FT                   aa),FASTA scores: opt: 478, E(): 4.4e-28, (72.6% identity
FT                   in 95 aa overlap). Also similar to C-terminus of
FT                   AC44316.1|AL596043|SCBAC31E11.05c hypothetical protein from
FT                   Streptomyces coelicolor (146 aa). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0250c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42979"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53672"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42979.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
FT   gene            complement(302173..302652)
FT                   /gene="hsp"
FT                   /gene_synonym="acr2"
FT                   /gene_synonym="hrpA"
FT                   /gene_synonym="hsp20"
FT                   /locus_tag="Rv0251c"
FT   CDS_pept        complement(302173..302652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /gene_synonym="acr2"
FT                   /gene_synonym="hrpA"
FT                   /gene_synonym="hsp20"
FT                   /locus_tag="Rv0251c"
FT                   /product="Heat shock protein Hsp (heat-stress-induced
FT                   ribosome-binding protein A)"
FT                   /note="Rv0251c, (MTV034.17c), len: 159 aa. Hsp (alternate
FT                   gene name: hsp20, hrpA, acr2), heat-stress-induced
FT                   ribosome-binding protein A (see citations below). Highly
FT                   similar to AAD39038.1|AF072875_1|AF072875 putative HSP20
FT                   from Mycobacterium smegmatis (145 aa), FASTA scores: opt:
FT                   479, E(): 2.3e-24, (59.9% identity in 157 aa overlap); and
FT                   similar to many bacterial and eukaryotic hsp proteins e.g.
FT                   P12811|HS2C_CHLRE chloroplast heat shock 22KD protein from
FT                   chlamydomonas reinhardtii (157 aa), FASTA scores: opt:
FT                   184,E(): 1.2e-05, (32.4% identity in 142 aa overlap). Also
FT                   similar to PCC6803 Spore protein sp21 from Synechocystis
FT                   sp. (146 aa), FASTA scores: opt: 213, E(): 1.2e-07, (30.3
FT                   identity in 145 aa overlap). Also similar to
FT                   P30223|14KD_MYCTU 14 KDA antigen (16 KDA antigen) 19K major
FT                   membrane protein (HSP 16.3) from Mycobacterium tuberculosis
FT                   (144 aa). Belongs to the small heat shock protein (HSP20)
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0251c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42980"
FT                   /db_xref="GOA:O53673"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:O53673"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42980.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
FT   gene            302866..305427
FT                   /gene="nirB"
FT                   /gene_synonym="nasB"
FT                   /locus_tag="Rv0252"
FT   CDS_pept        302866..305427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /gene_synonym="nasB"
FT                   /locus_tag="Rv0252"
FT                   /product="Probable nitrite reductase [NAD(P)H] large
FT                   subunit [FAD flavoprotein] NirB"
FT                   /note="Rv0252, (MTV034.18), len: 853 aa. Probable nirB
FT                   (alternate gene name: nasB), nitrite reductase [NAD(P)H]
FT                   large subunit, flavoprotein containing siroheme and a
FT                   2FE-2S iron-sulfur centre. Highly similar to many others
FT                   bacterial enzymes e.g. P08201|NIRB_ECOLI nitrite reductase
FT                   (NAD(P)H) large subunit from Escherichia coli strain K12
FT                   (847 aa), FASTA scores: opt: 2775, E(): 0, (49.8% identity
FT                   in 840 aa overlap); Q06458|NIRB_KLEPN nitrite reductase
FT                   (NAD(P)H) large subunit (957 aa), FASTA scores: opt:
FT                   2902,E(): 0, (54.2% identity in 827 aa overlap). Contains
FT                   PS00365 Nitrite and sulfite reductases
FT                   iron-sulfur/siroheme-binding site. Homodimer which
FT                   associates with NIRD|Rv0253. Cofactors: FAD; Iron;
FT                   Siroheme."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0252"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42981"
FT                   /db_xref="GOA:O53674"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:O53674"
FT                   /inference="protein motif:PROSITE:PS00365"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42981.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
FT   gene            305453..305809
FT                   /gene="nirD"
FT                   /locus_tag="Rv0253"
FT   CDS_pept        305453..305809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="Rv0253"
FT                   /product="Probable nitrite reductase [NAD(P)H] small
FT                   subunit NirD"
FT                   /note="Rv0253, (MTV034.19), len: 118 aa. Probable
FT                   nirD,nitrite reductase [NAD(P)H] small subunit, similar to
FT                   others e.g. P23675|NIRD_ECOLI|B3366|Z4727|ECS4217 from
FT                   Escherichia coli strains K12 and O157:H7 (108 aa), FASTA
FT                   scores: opt: 271, E():1.7e-12, (41.9% identity in 105 aa
FT                   overlap). Associates with NIRB|Rv0252."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0253"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42982"
FT                   /db_xref="GOA:O53675"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="PDB:4AIV"
FT                   /db_xref="UniProtKB/TrEMBL:O53675"
FT                   /protein_id="CCP42982.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
FT   gene            complement(305825..306349)
FT                   /gene="cobU"
FT                   /locus_tag="Rv0254c"
FT   CDS_pept        complement(305825..306349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="Rv0254c"
FT                   /product="Probable bifunctional cobalamin biosynthesis
FT                   protein CobU: cobinamide kinase + cobinamide phosphate
FT                   guanylyltransferase"
FT                   /note="Rv0254c, (MTV034.20), len: 174 aa. Probable
FT                   cobU,cobalamin biosynthesis protein including a cobinamide
FT                   kinase and cobinamide phosphate guanylyltransferase. Highly
FT                   similar to many e.g. Q05599|COBU_SALTY cobinamide kinase /
FT                   cobinamide phosphate guanylyltransferase from Salmonella
FT                   typhimurium (181 aa), FASTA scores: opt: 308, E():
FT                   1.1e-14,(38.7% identity in 181 aa overlap);
FT                   P46886|COBU_ECOLI|B1993|Z3153|ECS2788 Bifunctional
FT                   cobalamin biosynthesis protein cobU from Escherichia coli
FT                   strains K12 and O157:H7 (181 aa); part of AL096872|SC5F7_10
FT                   from Streptomyces coelicolor (397 aa), FASTA scores: opt:
FT                   445, E(): 3.6e-23, (46.0% identity in 176 aa overlap); etc.
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0254c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42983"
FT                   /db_xref="GOA:O53676"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O53676"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42983.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
FT   gene            complement(306374..307858)
FT                   /gene="cobQ1"
FT                   /gene_synonym="cobQ"
FT                   /locus_tag="Rv0255c"
FT   CDS_pept        complement(306374..307858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ1"
FT                   /gene_synonym="cobQ"
FT                   /locus_tag="Rv0255c"
FT                   /product="Probable cobyric acid synthase CobQ1"
FT                   /note="Rv0255c, (MTV034.21c), len: 494 aa. Probable
FT                   cobQ1,cobyric acid synthase, similar to many e.g.
FT                   Z46611|RCBLUGNS_8 cobyric acid synthase from R.capsulatus
FT                   (483 aa), FASTA scores: opt: 1239, E(): 0, (47.1% identity
FT                   in 493 aa overlap); P29932|COBQ_PSEDE cobyric acid synthase
FT                   from Pseudomonas denitrificans (484 aa), FASTA scores: opt:
FT                   1168, E():0, (44.9% identity in 490 aa overlap); etc.
FT                   Belongs to the COBB/COBQ family, COBQ subfamily. Note that
FT                   previously known as cobQ."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0255c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42984"
FT                   /db_xref="GOA:P9WP95"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP95"
FT                   /protein_id="CCP42984.1"
FT                   /translation="MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNS
FT                   MVCRGPDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
FT                   SSWCAGRRALAEAACRAFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPT
FT                   IVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRR
FT                   VYGTLPWHPDLWLDSEDALDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDV
FT                   VFASDPRALDDADLIVLPGTRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQML
FT                   GRVIRDPYGIEGPGGQVTEVEGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGR
FT                   ITRGDTAEEFLGGARDGPVFGTMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRL
FT                   DLLGDLVERHLDVDALLNLARHGCPPTLPFLAPGAP"
FT   gene            complement(307877..309547)
FT                   /gene="PPE2"
FT                   /locus_tag="Rv0256c"
FT   CDS_pept        complement(307877..309547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE2"
FT                   /locus_tag="Rv0256c"
FT                   /product="PPE family protein PPE2"
FT                   /note="Rv0256c, (MTV034.22c), len: 556 aa. PPE2, Member of
FT                   the M. tuberculosis PPE family, similar to many e.g.
FT                   Rv0280, Rv0286, etc. Equivalent to Z98756|MLCB2492.30 from
FT                   Mycobacterium leprae (572 aa), FASTA scores: opt: 1837,E():
FT                   0, (62.9% identity in 461 aa overlap). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0256c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42985"
FT                   /db_xref="GOA:P9WI47"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI47"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42985.1"
FT                   /translation="MTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETA
FT                   DELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAYGTAL
FT                   AAMPTLAELGANHALHGVLMATNFFGINTIPIALNESDYARMWIQAATTMASYQAVSTA
FT                   AVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQWLQKIGYTDFYNNVIQPFINWLTN
FT                   LPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGYPMDIGSYVAFLSQTFAFIGADLA
FT                   AAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPL
FT                   TLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPAPAPTAVTA
FT                   PTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKTPEPDSAEA
FT                   PAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPTGSPQGAGTLGFAGTTHK
FT                   ASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSATRVE"
FT   gene            309699..310073
FT                   /locus_tag="Rv0257"
FT   CDS_pept        309699..310073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0257"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0257, len: 124 aa. Hypothetical protein,orthologue
FT                   of ML1828A conserved hypothetical protein from
FT                   Mycobacterium leprae. Replaced Rv0257c (older annotation).
FT                   A core mycobacterial gene; conserved in mycobacterial
FT                   strains (See Marmiesse et al., 2004). Predicted to be an
FT                   outer membrane protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0257"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42986"
FT                   /db_xref="UniProtKB/TrEMBL:L7N694"
FT                   /protein_id="CCP42986.1"
FT                   /translation="MTRVSWLPDRCLPRLPACGRGLRGSLPGDSGGTAPDSHRLPASSS
FT                   PDGKNIGMQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAWPAVLFPS
FT                   WSWLCGIGGGVDLQKPSCRA"
FT   gene            complement(310294..310749)
FT                   /locus_tag="Rv0258c"
FT   CDS_pept        complement(310294..310749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0258c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0258c, (MTCY06A4.02c), len: 151 aa (alternative
FT                   start possible). Conserved hypothetical protein, showing
FT                   some similarity to Rv1685c|MTCI125_6 from Mycobacterium
FT                   tuberculosis (207 aa), FASTA scores: E(): 9.3e-07, (32.1%
FT                   identity in 140 aa overlap). Also some similarity with
FT                   AL049819|SCE7_13|T36295 probable transcription regulator
FT                   from Streptomyces coelicolor (204 aa), FASTA scores: opt:
FT                   158, E(): 0.00052, (27.0% identity in 111 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0258c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42987"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:P95215"
FT                   /protein_id="CCP42987.1"
FT                   /translation="MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTL
FT                   YVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASL
FT                   CAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG"
FT   gene            complement(310774..311517)
FT                   /locus_tag="Rv0259c"
FT   CDS_pept        complement(310774..311517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0259c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0259c, (MTCY06A4.03c), len: 247 aa. Conserved
FT                   hypothetical protein, showing some similarity to
FT                   Rv2393|Z81368|MTCY253_28 from Mycobacterium tuberculosis
FT                   (281 aa), FASTA scores: E(): 9.5e-16, (33.6 % identity in
FT                   235 aa overlap). Also some similarity with
FT                   CAC33938.1|AL589708 putative secreted protein from
FT                   Streptomyces coelicolor (248 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0259c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42988"
FT                   /db_xref="GOA:P95216"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:P95216"
FT                   /protein_id="CCP42988.1"
FT                   /translation="MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPS
FT                   PSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVT
FT                   QQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRT
FT                   AVQRARDRAEANRGARRVAVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANR
FT                   FRSAVARQQRLHRWHGTPTPVTLDL"
FT   gene            complement(311514..312659)
FT                   /locus_tag="Rv0260c"
FT   CDS_pept        complement(311514..312659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0260c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0260c, (MTCY0A4.04c), len: 381 aa. Possible
FT                   two-component response regulator, highly similar to
FT                   CAB72204.1|AL138851 putative transcriptional regulator from
FT                   Streptomyces coelicolor (395 aa); and similar to
FT                   O34394|D69851|YJJA conserved hypothetical protein from
FT                   Bacillus subtilis (270 aa), FASTA scores: opt: 312, E():
FT                   7.4e-14, (25.8% identity in 267 aa overlap). Also some
FT                   similarity to regulatory proteins at C-terminal region e.g.
FT                   CUTR_STRLI|Q03756 transcriptional regulatory protein (217
FT                   aa), FASTA scores: opt: 138, E(): 0.02, (30.6% identity in
FT                   111 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0260c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42989"
FT                   /db_xref="GOA:P95217"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:P95217"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42989.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
FT   gene            complement(312759..314168)
FT                   /gene="narK3"
FT                   /locus_tag="Rv0261c"
FT   CDS_pept        complement(312759..314168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK3"
FT                   /locus_tag="Rv0261c"
FT                   /product="Probable integral membrane nitrite extrusion
FT                   protein NarK3 (nitrite facilitator)"
FT                   /note="Rv0261c, (MTCY06A4.05c), len: 469 aa. Probable
FT                   nirK3, nitrite extrusion protein, integral membrane protein
FT                   possibly member of major facilitator superfamily
FT                   (MFS),equivalent to AAB41700.1|U72744 nitrite extrusion
FT                   protein from Mycobacterium fortuitum (471 aa); and
FT                   2342627|CAB11406.1|Z98741|T44908 nitrite extrusion protein
FT                   homolog from Mycobacterium leprae (517 aa; longer in
FT                   N-terminus). Also similar to other nitrite extrusion
FT                   proteins e.g. NARK_ECOLI|P10903|B1223 nitrite extrusion
FT                   protein 1 from Escherichia coli strain K12 (463 aa), FASTA
FT                   scores: opt: 755, E(): 0, (35.0% identity in 466 aa
FT                   overlap). Belongs to the nark/NASA family of transporters."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0261c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42990"
FT                   /db_xref="GOA:P95218"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:P95218"
FT                   /protein_id="CCP42990.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
FT   gene            complement(314309..314854)
FT                   /gene="aac"
FT                   /locus_tag="Rv0262c"
FT   CDS_pept        complement(314309..314854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aac"
FT                   /locus_tag="Rv0262c"
FT                   /product="Aminoglycoside 2'-N-acetyltransferase Aac
FT                   (Aac(2')-IC)"
FT                   /note="Rv0262c, (MTCY06A4.06c), len: 181 aa.
FT                   Aac,aminoglycoside 2'-N-acetyltransferase (aac(2')-IC) (see
FT                   citation below), highly similar to NP_302635.1|NC_002677
FT                   aminoglycoside 2'-N-acetyltransferase from Mycobacterium
FT                   leprae (182 aa); Q49157|AAC2_MYCFO|AAC aminoglycoside
FT                   2'-N-acetyltransferase from Mycobacterium fortuitum (195
FT                   aa), Contains GNAT (Gcn5-related N-acetyltransferase)
FT                   domain. See Vetting et al. 2005. FASTA scores: opt:
FT                   884,E(): 0, (69.1% identity in 181 aa overlap); and
FT                   P94968|AAC2_MYCSM|AAC aminoglycoside 2'-N-acetyltransferase
FT                   from Mycobacterium smegmatis (210 aa) (see also citation
FT                   below). Also similar to Q52424|AAC2_PROST aminoglycoside
FT                   2'-N-acetyltransferase from Providencia stuartii (178 aa).
FT                   Belongs to the AAC(2')-I family of acetyltransferases. Note
FT                   that previously known as aac(2')-IC."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0262c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42991"
FT                   /db_xref="GOA:P9WQG9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1M44"
FT                   /db_xref="PDB:1M4D"
FT                   /db_xref="PDB:1M4G"
FT                   /db_xref="PDB:1M4I"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQG9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42991.1"
FT                   /translation="MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTL
FT                   GGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVE
FT                   QVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDI
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(314864..315766)
FT                   /locus_tag="Rv0263c"
FT   CDS_pept        complement(314864..315766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0263c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0263c, (MTCY06A4.07c), len: 300 aa. Conserved
FT                   hypothetical protein, equivalent to NP_302634.1|NC_002677
FT                   conserved hypothetical protein from Mycobacterium leprae
FT                   (305 aa). Also similar to others e.g. AL121596|SC51A_21
FT                   hypothetical protein from Streptomyces coelicolor (285
FT                   aa),FASTA scores: opt: 714, E(): 0, (45.3% identity in 289
FT                   aa overlap); NP_233164.1|NC_002506 conserved hypothetical
FT                   protein from Vibrio cholerae (309 aa);
FT                   NP_406216.1|NC_003143 conserved hypothetical protein from
FT                   Yersinia pestis (316 aa); YH30_HAEIN|P44298|hi1730
FT                   hypothetical protein from Haemophilus influenzae (309
FT                   aa),FASTA scores: opt: 430, E(): 3e-20, (29.6% identity in
FT                   284 aa overlap); etc. Also similar to carboxylases eg
FT                   NP_415240.1|NC_000913|P75745|YBGK_ECOLI putative
FT                   carboxylase from Escherichia coli strain K12 (310 aa),FASTA
FT                   score: (34.6% identity in 286 aa overlap);
FT                   NP_459698.1|NC_003197 putative carboxylase from Salmonella
FT                   typhimurium (310 aa); and to middle part of
FT                   NP_420636.1|NC_002696 urea amidolyase-related protein from
FT                   Caulobacter crescentus (1207 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0263c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42992"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:P95220"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42992.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
FT   gene            complement(315783..316415)
FT                   /locus_tag="Rv0264c"
FT   CDS_pept        complement(315783..316415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0264c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0264c, (MTCY06A4.08c), len: 210 aa. Conserved
FT                   hypothetical protein, equivalent to CAC32080.1|AL583926
FT                   conserved hypothetical protein from Mycobacterium leprae
FT                   (222 aa). Also similar to others hypothetical proteins e.g.
FT                   AL121596|SC51A_20 from Streptomyces coelicolor (252
FT                   aa),FASTA scores: opt: 420, E(): 2.7e-20, (41.7% identity
FT                   in 204 aa overlap); P75744|YBGJ_ECOLI hypothetical 23.9 KD
FT                   protein from Escherichia coli (218 aa), FASTA scores: E():
FT                   2.1e-14, (35.7% identity in 182 aa overlap);
FT                   YH31_HAEIN|P44299|hi173 hypothetical protein from
FT                   Haemophilus influenzae (213 aa), FASTA scores: opt:
FT                   252,E(): 8.3e-10, (31.1% identity in 183 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0264c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42993"
FT                   /db_xref="GOA:P95221"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:P95221"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42993.1"
FT                   /translation="MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDI
FT                   VAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLAEVAR
FT                   CTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMPPGSVALA
FT                   DGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA"
FT   gene            complement(316511..317503)
FT                   /gene_synonym="fecB2"
FT                   /locus_tag="Rv0265c"
FT   CDS_pept        complement(316511..317503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene_synonym="fecB2"
FT                   /locus_tag="Rv0265c"
FT                   /product="Probable periplasmic iron-transport lipoprotein"
FT                   /note="Rv0265c, (MTCY06A4.09c), len: 330 aa. Probable
FT                   iron-transport lipoprotein, most similar to
FT                   T36412|5763945|CAB53324.1|AL109974 probable
FT                   iron-siderophore binding lipoprotein from Streptomyces
FT                   coelicolor (350 aa); and (N-terminus may be incorrect) to
FT                   T14166|3560508|AAC82551.1|AF027770 fxuD protein from
FT                   Mycobacterium smegmatis (420 aa), FASTA scores: opt:
FT                   385,E(): 1.5e-16, (32.3% identity in 232 aa overlap). Also
FT                   similar to AAB97475.1|U02617 DtxR/iron regulated
FT                   lipoprotein precursor from Corynebacterium diphtheriae (355
FT                   aa); FECB_ECOLI|P15028 iron(III) dicitrate-binding
FT                   periplasmic protein (300 aa), FASTA scores: opt: 191, E():
FT                   2.3e-05, (26.5% identity in 196 aa overlap). Contains
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Note that previously known as fecB2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0265c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42994"
FT                   /db_xref="GOA:L7N6B2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="PDB:4PM4"
FT                   /db_xref="UniProtKB/TrEMBL:L7N6B2"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42994.1"
FT                   /translation="MRQGCSRRGFLQVAEAAAATGLFAGCSSPKPPPGTPGGAAVTITH
FT                   LFGQTVIKEPPKRVVSAGYTEQDDLLAVDVVPIAVTDWFGDQPFAVWPWAAPKLGGARP
FT                   AVLNLDNGIQIDRIAALKPDLIVAINAGVDADTYQQLSAIAPTVAQSGGDAFFEPWKDQ
FT                   ARSIGQAVFAADRMRSLIEAVDQKFAAVAQRHPRWRGKKALLLQGRLWQGNVVATLAGW
FT                   RTDFLNDMGLVIADSIKPFAVDQRGVIPRDHIKAVLDAADVLIWMTESPEDEKALLADP
FT                   EIAASQATAQRRHIFTSKEQAGAIAFSSVLSYPVVAEQLPPQISQILGA"
FT   gene            complement(317525..321154)
FT                   /gene="oplA"
FT                   /locus_tag="Rv0266c"
FT   CDS_pept        complement(317525..321154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oplA"
FT                   /locus_tag="Rv0266c"
FT                   /product="Probable 5-oxoprolinase OplA (5-oxo-L-prolinase)
FT                   (pyroglutamase) (5-OPASE)"
FT                   /note="Rv0266c, (MTCY06A4.10c), len: 1209 aa. Probable
FT                   oplA, 5-oxoprolinase, highly similar to others or to
FT                   hypothetical proteins e.g. AAK24340.1|AE005906
FT                   hydantoinase/oxoprolinase from Caulobacter crescentus (1196
FT                   aa); NP_103129.1|14022305|BAB48915.1|AP002997
FT                   5-oxoprolinase from Mesorhizobium loti (1210 aa);
FT                   CAC48426.1|AL603642 conserved hypothetical protein from
FT                   Sinorhizobium meliloti (1205 aa);
FT                   S77037|slr0697|1006579|BAA10729.1|D6400 hypothetical
FT                   protein from Synechocystis sp. strain PCC 6803 (1252
FT                   aa),FASTA scores: opt: 2016, E(): 0, (51.4% identity in
FT                   1247 aa overlap); P97608|OPLA_RAT|T42756|11278797
FT                   5-oxoprolinase (5-oxo-L-prolinase) (pyroglutamase)
FT                   (5-OPASE) from Rattus norvegicus (1288 aa); etc. Belongs to
FT                   the oxoprolinase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0266c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42995"
FT                   /db_xref="GOA:P95223"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:P95223"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42995.1"
FT                   /translation="MVGAGWHFWVDRGGTFTDVVARRPDGRLLTHKLLSDNPARYRDAA
FT                   VAGIRALLANGEAGTRVDAVRMGTTVATNALLERTGERTLLVITRGFGDALRIAYQNRP
FT                   RIFDRRIVLPEMLYERVVEVDERVTADGRVLRAPDLEALGEKMRQAHADGIRAVAVVCL
FT                   HSYLYPGHEREIGTLAQRIGFAQISLSSEVSPLMKLVPRGDTTVVDAYLSPVLRRYINQ
FT                   VADQMRGVRLMFMQSNGGLAQAGHFRGKDAILSGPAGGIVGMVRMSALAGFDHVIGFDM
FT                   GGTSTDVSHYAGEYERVFTTQVAGVRLRAPMLDIHTVAAGGGSILHFDGSRYRVGPDSA
FT                   GADPGPACYRGGGPLCVTDANVMLGRIQPTHFPSVFGPSGDQPLDAGTVRRGFTDLAAD
FT                   IAARTGDDRSPEQVAEGYLRIAVANMANAVKKISVQKGHDVTRYALTTFGGAGGQHACA
FT                   VADALGIRTVLIPPMAGVLSALGIGLADTTAMREQSVEIPLGPAAPQRLASVAESLERA
FT                   ARAELLDEGVPGERIRVVRRVHLRYEGTDTAIPVQLAEIETMATAFESSHRALYTFLLD
FT                   RPLIAEAISVEATGLTDQPDLSQLGDQANDTTGSSETVRIYSNGLWRDAPLRRREAMRP
FT                   GDVLTGPAIIAEANATTVVDDGWQATMTETGHLLAQRVVTPPRPDAATRAGFEAGFEAD
FT                   PVLLEIFNNLFMSIAEQMGFRLEATAQSVNIRERLDFSCALFDPDGNLVANAPHIPVHL
FT                   GSMGTTVKEVIRRRLSGMKPGDVYAVNDPYHGGTHLPDITVITPVFNTGGEDVLFFVAS
FT                   RGHHAEIGGITPGSMPADSREIHEEGVLFDNWLLAENGRFREAETRRLLTEAPFGSRNP
FT                   DTNLADLRAQIAANQKGVDEVGKMIDHFGRDVVAAYMRHVQDNAEEAVRRVIDRLDNGA
FT                   YRYRMDSGATIAVRITVDRAARSATIDFTGTSAQLDTNFNAPTSVVNAAVLYVFRTLVA
FT                   DDIPLNDGCLRPLRIVVPEGSMLAPTHPAAVVAGNVETSQAITGALFAALGVQAEGSGT
FT                   MNNVTFGNERHQYYETVGSGSGAGDGYHGASVVQTHMTNSRLTDPEVLEWRYPVLLREF
FT                   AVRQGSGGAGRWRGGDGAVRRLEFTEPMTVSTLSGHRRVRPYGMAGGSPGELGRNRVER
FT                   ADGSTVELAGCGSTHVEPGDTLVIETPGGGGYGPASTSARRRR"
FT   gene            321331..322722
FT                   /gene="narU"
FT                   /locus_tag="Rv0267"
FT   CDS_pept        321331..322722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narU"
FT                   /locus_tag="Rv0267"
FT                   /product="Probable integral membrane nitrite extrusion
FT                   protein NarU (nitrite facilitator)"
FT                   /note="Rv0267, (MTCY06A4.11), len: 463 aa. Probable
FT                   narU,nitrite extrusion protein, integral membrane protein
FT                   possibly member of major facilitator superfamily
FT                   (MFS),similar to other nitrite extrusion proteins e.g.
FT                   NARU_ECOLI|P37758 nitrite extrusion protein 2 from
FT                   Escherichia coli (462 aa), FASTA scores: opt: 630, E():
FT                   4.4e-33, (38.9% identity in 463 aa overlap); and
FT                   NARK_ECOLI|P10903|B1223 nitrite extrusion protein 1 from
FT                   Escherichia coli strain K12 (463 aa), FASTA scores: opt:
FT                   607, E(): 1.3e-31, (42.0% identity in 457 aa overlap). Also
FT                   similar to Rv0261c, Rv2329c, Rv1737c, and to MLCB22_25 from
FT                   Mycobacterium leprae (517 aa), FASTA score: (35.1 identity
FT                   in 459 aa overlap). Belongs to the nark/NASA family of
FT                   transporters."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0267"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42996"
FT                   /db_xref="GOA:P95224"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:P95224"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42996.1"
FT                   /translation="MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARR
FT                   NLIFSIFAEHVGFSVWMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAF
FT                   LRLPYTFAIPIFGGRNWTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGN
FT                   FASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFV
FT                   PLAVAAAVCAFLFMNNLTEAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPT
FT                   LLKTVFGRGDIALGWAFLGAGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALW
FT                   SVQSVNLPVFFVSFMFLFVATGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAG
FT                   ALGIISSIGAFGGFVVPLAYAWSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPM
FT                   GQVGV"
FT   gene            complement(322764..323273)
FT                   /locus_tag="Rv0268c"
FT   CDS_pept        complement(322764..323273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0268c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0268c, (MTCY06A4.12c), len: 169 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0268c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42997"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95225"
FT                   /protein_id="CCP42997.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
FT   gene            complement(323338..324531)
FT                   /locus_tag="Rv0269c"
FT   CDS_pept        complement(323338..324531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0269c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0269c, (MTCY06A4.13c), len: 397 aa. Conserved
FT                   hypothetical protein, highly similar to AL079355|SC4C6_19
FT                   hypothetical protein from Streptomyces coelicolor (341
FT                   aa),FASTA scores: opt: 1019, E(): 0, (46.5% identity in 344
FT                   aa overlap), and similar to other proteins e.g.
FT                   CAC49016.1|AL603644 putative ATP-dependent DNA ligase
FT                   protein from Sinorhizobium meliloti (636 aa); O34398 YKOU
FT                   protein from Bacillus subtilis (611 aa), FASTA score:
FT                   (27.2% identity in 283 aa overlap). Also similar to
FT                   proteins from Mycobacterium tuberculosis e.g. Rv3062,Rv3731
FT                   (both DNA ligases), and Rv0938, Rv3730c."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0269c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42998"
FT                   /db_xref="UniProtKB/TrEMBL:P95226"
FT                   /protein_id="CCP42998.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
FT   gene            324567..326249
FT                   /gene="fadD2"
FT                   /locus_tag="Rv0270"
FT   CDS_pept        324567..326249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD2"
FT                   /locus_tag="Rv0270"
FT                   /product="Probable fatty-acid-CoA ligase FadD2
FT                   (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)"
FT                   /note="Rv0270, (MTCY06A4.14), len: 560 aa. Probable
FT                   fadD2,fatty-acid-CoA synthetase, similar to many e.g.
FT                   LCFA_ECOLI|P29212 long-chain-fatty-acid--CoA ligase from
FT                   Escherichia coli (561 aa), FASTA scores: opt: 544, E():
FT                   2.9e-26, (27.7% identity in 535 aa overlap). Also similar
FT                   to others from Mycobacterium tuberculosis e.g.
FT                   MTCY493_2,MTCY8D5_9, MTCY6G11_8, etc. Contains PS00455
FT                   Putative AMP-binding domain signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0270"
FT                   /db_xref="EnsemblGenomes-Tr:CCP42999"
FT                   /db_xref="GOA:P95227"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:P95227"
FT                   /inference="protein motif:PROSITE:PS00455"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP42999.1"
FT                   /translation="MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLE
FT                   PPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLL
FT                   AKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVII
FT                   YDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRAS
FT                   IIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALA
FT                   MFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIV
FT                   FVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTV
FT                   KILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVS
FT                   GRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLD
FT                   EDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL"
FT   gene            complement(326266..328461)
FT                   /gene="fadE6"
FT                   /locus_tag="Rv0271c"
FT   CDS_pept        complement(326266..328461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE6"
FT                   /locus_tag="Rv0271c"
FT                   /product="Probable acyl-CoA dehydrogenase FadE6"
FT                   /note="Rv0271c, (MTCY06A4.15c), len: 731 aa. Probable
FT                   fadE6, acyl-CoA dehydrogenase, with C-terminal half similar
FT                   to many e.g. ACDS_HUMAN|P16219 acyl-CoA dehydrogenase
FT                   (short-chain) from Homo sapiens (412 aa), FASTA scores:
FT                   opt: 339, E(): 1.3e-13, (28.1% identity in 288 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0271c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43000"
FT                   /db_xref="GOA:P95228"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P95228"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43000.1"
FT                   /translation="MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQ
FT                   AAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQA
FT                   KVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDE
FT                   WVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEA
FT                   VGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDA
FT                   GESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFG
FT                   RGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGG
FT                   WVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLL
FT                   PPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLA
FT                   RTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNR
FT                   GWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGH
FT                   ATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPG
FT                   KWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(328575..329708)
FT                   /locus_tag="Rv0272c"
FT   CDS_pept        complement(328575..329708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0272c"
FT                   /product="Unknown protein"
FT                   /note="Rv0272c, (MTCY06A4.16c), len: 377 aa. Unknown
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0272c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43001"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:P95229"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43001.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
FT   gene            complement(329705..330325)
FT                   /locus_tag="Rv0273c"
FT   CDS_pept        complement(329705..330325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0273c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0273c, (MTV035.01c), len: 206 aa (start
FT                   uncertain). Possible transcriptional regulator, showing
FT                   some similarity to hypothetical regulators from
FT                   Mycobacterium tuberculosis e.g. P96222|Rv3855|MTCY01A6.13c
FT                   (216 aa); O08377|Rv1534|MTCY07A7A.03 (225 aa), FASTA
FT                   scores: opt: 123, E(): 3.2e-06, (28.5% identity in 172 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0273c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43002"
FT                   /db_xref="GOA:O86342"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:O86342"
FT                   /protein_id="CCP43002.1"
FT                   /translation="MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLA
FT                   EAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMF
FT                   NQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN"
FT   gene            330422..331003
FT                   /locus_tag="Rv0274"
FT   CDS_pept        330422..331003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0274"
FT                   /product="Conserved protein"
FT                   /note="Rv0274, (MTV035.02), len: 193 aa. Conserved
FT                   protein,highly similar to AAK25058.1|AE005973 conserved
FT                   hypothetical protein from Caulobacter crescentus (174 aa).
FT                   Shows also some similarity to others hypothetical proteins
FT                   e.g. AJ002571|BSAJ2571_7 from Bacillus subtilis (316
FT                   aa),FASTA scores: opt: 138, E(): 0.033, (27.1% identity in
FT                   133 aa overlap). Previous hits with Q56415|M85195
FT                   fosfomycin-resistance protein from serratia marcescens (141
FT                   aa), FASTA scores: opt: 82, E(): 1.1e -08, (29.1% identity
FT                   in 151 aa overlap). Contains PS00082 Extradiol
FT                   ring-cleavage dioxygenases signature near C-terminus. May
FT                   belong to the vicinal-oxygen-chelate (VOC) superfamily of
FT                   metalloenzymes (See Rawat et al., 2003)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0274"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43003"
FT                   /db_xref="GOA:O53680"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:O53680"
FT                   /inference="protein motif:PROSITE:PS00082"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43003.1"
FT                   /translation="MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKAL
FT                   DLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAF
FT                   HVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEF
FT                   ACWTKEFTTSDAQAVPKTAADRRPPVAADR"
FT   gene            complement(330933..331658)
FT                   /locus_tag="Rv0275c"
FT   CDS_pept        complement(330933..331658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0275c"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly TetR-family)"
FT                   /note="Rv0275c, (MTV035.03c), len: 241 aa. Possible
FT                   transcriptional regulator, TetR family, similar to others
FT                   e.g. Q9RJE7|SCF81.04c putative TetR-family transcriptional
FT                   regulator from Streptomyces coelicolor (219 aa);
FT                   Q9FBI8|SCP8.33c putative TetR-family transcriptional
FT                   regulator from Streptomyces coelicolor (213 aa);
FT                   Q9I2Q9|PA1836 probable transcriptional regulator from
FT                   Pseudomonas aeruginosa (193 aa); etc. Also shows some
FT                   similarity with Rv0825c from Mycobacterium tuberculosis
FT                   (213 aa), FASTA scores: opt: 230, E(): 2.7e-07, (32.6%
FT                   identity in 190 aa overlap). Seems to belong to the
FT                   TetR/AcrR family of transcriptional regulators (M.
FT                   tuberculosis regulatory protein family with many TetR
FT                   orthologues)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0275c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43004"
FT                   /db_xref="GOA:L7N6A2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:L7N6A2"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43004.1"
FT                   /translation="MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIR
FT                   TICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANI
FT                   VRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVA
FT                   HFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDP
FT                   QPPEVAGQPPSSARPARRS"
FT   gene            331748..332668
FT                   /locus_tag="Rv0276"
FT   CDS_pept        331748..332668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0276"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0276, (MTV035.04), len: 306 aa. Conserved
FT                   hypothetical protein, similar to Rv2237|Z70692|MTCY427.18
FT                   from Mycobacterium tuberculosis (296 aa), FASTA scores:
FT                   opt: 874, E(): 0, (49.6% identity in 282 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0276"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43005"
FT                   /db_xref="GOA:O53682"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:O53682"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43005.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
FT   gene            complement(332708..333136)
FT                   /gene="vapC25"
FT                   /locus_tag="Rv0277c"
FT   CDS_pept        complement(332708..333136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC25"
FT                   /locus_tag="Rv0277c"
FT                   /product="Possible toxin VapC25. Contains PIN domain."
FT                   /note="Rv0277c, (MTV035.05c), len: 142 aa. Possible
FT                   vapC25,toxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0277A,contains PIN domain, see Arcus et al. 2005. Highly
FT                   similar to others e.g.
FT                   Rv0749|H70824|2911023|CAA17516.1|AL021958 conserved
FT                   hypothetical protein from Mycobacterium tuberculosis (142
FT                   aa); and Rv2530c, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0277c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43006"
FT                   /db_xref="GOA:P9WF85"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WF85"
FT                   /protein_id="CCP43006.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
FT   gene            complement(333160..333417)
FT                   /pseudo
FT                   /gene="vapB25"
FT                   /locus_tag="Rv0277A"
FT   CDS_pept        complement(333160..333417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB25"
FT                   /locus_tag="Rv0277A"
FT                   /product="Possible antitoxin VapB25"
FT                   /note="Rv0277A, len: 85 aa. Possible vapB25, antitoxin,part
FT                   of toxin-antitoxin (TA) operon with Rv0277c, see Arcus et
FT                   al. 2005. Has in-frame stop codon so may not be expressed.
FT                   Very similar to others in Mycobacterium tuberculosis e.g.
FT                   Rv0748 (85 aa). Fasta score E(): 4e-24; 88.2% identity in
FT                   85 aa overlap"
FT                   /pseudogene="unknown"
FT   gene            complement(333437..336310)
FT                   /gene="PE_PGRS3"
FT                   /locus_tag="Rv0278c"
FT   CDS_pept        complement(333437..336310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE_PGRS3"
FT                   /locus_tag="Rv0278c"
FT                   /product="PE-PGRS family protein PE_PGRS3"
FT                   /note="Rv0278c, (MTV035.06c), len: 957 aa. PE_PGRS3, Member
FT                   of the Mycobacterium tuberculosis PE family (see citation
FT                   below), PGRS subfamily of gly-rich proteins, similar to
FT                   many e.g. Z95890|MTCY28_25|Rv1759c from Mycobacterium
FT                   tuberculosis (914 aa), FASTA scores: opt: 3849, E():
FT                   0,(67.8% identity in 903 aa overlap). Contains PS00583 pfkB
FT                   family of carbohydrate kinases signature 1."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0278c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43008"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIG3"
FT                   /inference="protein motif:PROSITE:PS00583"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43008.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTALMAAGAD
FT                   EVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSPLLDPINE
FT                   FFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGNG
FT                   GAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAGG
FT                   AGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGA
FT                   GGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGG
FT                   NAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGG
FT                   QGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGN
FT                   GGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLN
FT                   VVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGANGTPGTGAAGGAGGWLFGN
FT                   GGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGGIGGAGGAGGVSLLIG
FT                   SGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGGVPAGVGGAGGNGGLF
FT                   ANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGNGGLFGAGGTGGAAGS
FT                   GGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGTGGNGALLFGFRGAGGA
FT                   GGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALGAGTGGTGGDGGHAGV
FT                   FGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGHARCRRHRRAAARRER
FT                   TQRLAIAGRPATTRGVEGISCSPQMMP"
FT   gene            complement(336560..339073)
FT                   /gene="PE_PGRS4"
FT                   /locus_tag="Rv0279c"
FT   CDS_pept        complement(336560..339073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE_PGRS4"
FT                   /locus_tag="Rv0279c"
FT                   /product="PE-PGRS family protein PE_PGRS4"
FT                   /note="Rv0279c, (MTV035.07c), len: 837 aa. PE_PGRS4, Member
FT                   of the Mycobacterium tuberculosis PE family, PGRS subfamily
FT                   of gly-rich proteins (see Brennan and Delogu, 2002),similar
FT                   to many e.g. Z95890|MTCY28_25|Rv0278c from Mycobacterium
FT                   tuberculosis (914 aa), FASTA scores: opt: 2677, E(): 0,
FT                   (64.5% identity in 926 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0279c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43009"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:L0T4W6"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43009.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAATSPLLAPINE
FT                   FFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLI
FT                   GNGGAGGAGGRASTGTGGAGGAGGAAGMLFGAAGVGGPGGFAAAFGATGGAGGAGGNGG
FT                   LFADGGVGGAGGATDAGTGGAGGSGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLF
FT                   GAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSNPDGGGGAGGIGGDGG
FT                   TLFGSGGAGGVCGLGFDAGGAGGAGGKAGLLIGAGGAGGAGGGSFAGAGGTGGAGGAPG
FT                   LVGNAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLL
FT                   GRDGFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFG
FT                   NGGNGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSG
FT                   GTGGSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFAN
FT                   GGAGGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSG
FT                   GTFGGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGT
FT                   GGSSGIGSSGGTGGDGGTAGVFGNGGDGGAGGFGADTGGNSSSVPNAVLIGNGGNGGNG
FT                   GKAGGTPGAGGTSGLIIGENGLNGL"
FT   gene            339364..340974
FT                   /gene="PPE3"
FT                   /locus_tag="Rv0280"
FT   CDS_pept        339364..340974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE3"
FT                   /locus_tag="Rv0280"
FT                   /product="PPE family protein PPE3"
FT                   /note="Rv0280, (MTV035.08), len: 536 aa. PPE3, Member of
FT                   the Mycobacterium tuberculosis PPE family, similar to
FT                   others e.g. Z80108|MTCY21B4_4|Rv0453 from Mycobacterium
FT                   tuberculosis (539 aa), FASTA scores: opt: 1131, E():
FT                   0,(51.7% identity in 540 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0280"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43010"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI45"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43010.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPSTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
FT   gene            340998..341906
FT                   /locus_tag="Rv0281"
FT   CDS_pept        340998..341906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0281"
FT                   /product="Possible S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Rv0281, (MTV035.09), len: 302 aa. Possible
FT                   S-adenosylmethionine-dependent methyltransferase (see Grana
FT                   et al., 2007), member of Mycobacterium tuberculosis protein
FT                   family that includes Rv0726c, Rv0731c, Rv3399, Rv1729c,etc.
FT                   MTCY31_23 (325 aa), FASTA scores: opt: 1386, E(): 0,(69. 1%
FT                   identity in 301 aa overlap). Contains possible N-terminal
FT                   signal sequence."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0281"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43011"
FT                   /db_xref="GOA:P9WFI9"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFI9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43011.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
FT   gene            342130..344025
FT                   /gene="eccA3"
FT                   /locus_tag="Rv0282"
FT   CDS_pept        342130..344025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccA3"
FT                   /locus_tag="Rv0282"
FT                   /product="ESX conserved component EccA3. ESX-3 type VII
FT                   secretion system protein."
FT                   /note="Rv0282, (MTV035.10), len: 631 aa. eccA3, esx
FT                   conserved component, ESX-3 type VII secretion system
FT                   protein, similar to Y14967|MLCB628.18c hypothetical protein
FT                   from Mycobacterium leprae (573 aa), FASTA scores: opt:
FT                   916,E(): 0, (38.7% identity in 568 aa overlap). Also
FT                   similar to Mycobacterium tuberculosis proteins e.g.
FT                   Z94121|MTY15F10.26 (619 aa), FASTA scores: opt: 743, E():
FT                   0, (29.9% identity in 612 aa overlap). Member of CFXQ, CBXP
FT                   family - 9 members in Mycobacterium tuberculosis. Contains
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0282"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43012"
FT                   /db_xref="GOA:P9WPI3"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPI3"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43012.1"
FT                   /translation="MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCC
FT                   RALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTAT
FT                   TAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHV
FT                   VSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTA
FT                   LARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPEN
FT                   EQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQ
FT                   LAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVA
FT                   KIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGA
FT                   KNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTS
FT                   HELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVR
FT                   NIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA"
FT   gene            344022..345638
FT                   /gene="eccB3"
FT                   /locus_tag="Rv0283"
FT   CDS_pept        344022..345638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccB3"
FT                   /locus_tag="Rv0283"
FT                   /product="ESX conserved component EccB3. ESX-3 type VII
FT                   secretion system protein. Possible membrane protein."
FT                   /note="Rv0283, (MTV035.11), len: 538 aa. eccB3, esx
FT                   conserved component, ESX-3 type VII secretion system
FT                   protein, possible membrane protein, similar to several
FT                   hypothetical mycobacterial proteins e.g.
FT                   Z94121|MTY15F10_16|Rv3895c from Mycobacterium tuberculosis
FT                   (495 aa), FASTA scores: opt: 698, E(): 0, (37.6% identity
FT                   in 492 aa overlap); Rv1782; Rv3450c; Rv3869; and
FT                   Y14967|MLCB628_16|MLCB628.17c from Mycobacterium leprae
FT                   (481 aa), FASTA scores: opt: 672, E(): 1.5e-31, (37.2%
FT                   identity in 506 aa overlap). Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0283"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43013"
FT                   /db_xref="GOA:P9WNR3"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNR3"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43013.1"
FT                   /translation="MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGW
FT                   RFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSN
FT                   AVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPG
FT                   APERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLV
FT                   DSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPII
FT                   PDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNN
FT                   NSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATS
FT                   SLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLF
FT                   WVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLA
FT                   HDTLVPDSRPARPVSAEGGYR"
FT   gene            345635..349627
FT                   /gene="eccC3"
FT                   /locus_tag="Rv0284"
FT   CDS_pept        345635..349627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccC3"
FT                   /locus_tag="Rv0284"
FT                   /product="ESX conserved component EccC3. ESX-3 type VII
FT                   secretion system protein. Possible membrane protein."
FT                   /note="Rv0284, (MTV035.12), len: 1330 aa. eccC3, esx
FT                   conserved component, ESX-3 type VII secretion system
FT                   protein, possible membrane protein, similar to products of
FT                   two adjacent Mycobacterium leprae genes, MLCB628.16c (744
FT                   aa) and MLCB628.15c (597 aa); and throughout its length to
FT                   several large Mycobacterium tuberculosis proteins:
FT                   Rv3447c,Rv3870, Rv1784, etc. Y14967|MLCB628_ 15 (744 aa),
FT                   FASTA scores: opt: 942, E(): 0, (33.8% identity in 730 aa
FT                   overlap); Y14967|MLCB628_14 (597 aa), FASTA scores: opt:
FT                   613, E(): 3.1e-30, (31.7% identity in 615 aa overlap);
FT                   Z94121|MTY15F10_17 (1396 aa), FASTA scores: opt: 652, E():
FT                   2.2e-32, (35.4% identity in 1321 aa overlap);
FT                   Z95389|MTCY77_19 (1236 aa), FASTA scores: opt 652, E():
FT                   2.2e-32, (35.4% identity in 1321 aa overlap). Contains
FT                   three PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0284"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43014"
FT                   /db_xref="GOA:P9WNA9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNA9"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43014.1"
FT                   /translation="MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPY
FT                   LIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRH
FT                   TVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSPITVLGERA
FT                   QVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARN
FT                   LSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVV
FT                   HCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSR
FT                   WDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEP
FT                   LMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAG
FT                   ADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLE
FT                   YENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTL
FT                   DVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPI
FT                   RFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKL
FT                   IATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRD
FT                   PLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQ
FT                   DLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVID
FT                   NLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRL
FT                   ELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAIN
FT                   ARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFG
FT                   DARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAM
FT                   LGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTP
FT                   LIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRG
FT                   ERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS"
FT   gene            349624..349932
FT                   /gene="PE5"
FT                   /locus_tag="Rv0285"
FT   CDS_pept        349624..349932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE5"
FT                   /locus_tag="Rv0285"
FT                   /product="PE family protein PE5"
FT                   /note="Rv0285, (MTV035.13), len: 102 aa. PE5, Member of the
FT                   Mycobacterium tuberculosis PE family (see Brennan & Delogu
FT                   2002), similar to others e.g. AL0212|MTV012_37 from
FT                   Mycobacterium tuberculosis (105 aa), FASTA scores: opt:
FT                   497, E(): 2.6e-24, (80.4% identity in 102 aa overlap);
FT                   Z80108|MTCY21B4.03 from Mycobacterium tuberculosis (102
FT                   aa), FASTA scores: opt: 413, E(): 3.7e-19, (66.7% identity
FT                   in 102 aa overlap); etc. A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0285"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43015"
FT                   /db_xref="GOA:L7N695"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/Swiss-Prot:L7N695"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43015.1"
FT                   /translation="MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADP
FT                   VSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG"
FT   gene            349935..351476
FT                   /gene="PPE4"
FT                   /locus_tag="Rv0286"
FT   CDS_pept        349935..351476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE4"
FT                   /locus_tag="Rv0286"
FT                   /product="PPE family protein PPE4"
FT                   /note="Rv0286, (MTV035.14), len: 513 aa. PPE4, Member of
FT                   the Mycobacterium tuberculosis PPE family, similar to
FT                   others e.g. AL0212|MTV012_32 from Mycobacterium
FT                   tuberculosis (434 aa), FASTA scores: opt: 958, E():
FT                   0,(43.5% identity in 522 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0286"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43016"
FT                   /db_xref="GOA:P9WI43"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI43"
FT                   /protein_id="CCP43016.1"
FT                   /translation="MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTA
FT                   AELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTAL
FT                   AAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGA
FT                   ALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQF
FT                   LQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPA
FT                   GLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAA
FT                   GAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAA
FT                   TRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKE
FT                   RRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
FT   gene            351525..351818
FT                   /gene="esxG"
FT                   /gene_synonym="TB9.8"
FT                   /locus_tag="Rv0287"
FT   CDS_pept        351525..351818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxG"
FT                   /gene_synonym="TB9.8"
FT                   /locus_tag="Rv0287"
FT                   /product="ESAT-6 like protein EsxG (conserved protein
FT                   TB9.8)"
FT                   /note="Rv0287, (MTV035.15), len: 97 aa. EsxG, ESAT-6 like
FT                   protein. PE-family related protein; distant member of the
FT                   Mycobacterium tuberculosis PE family, similar to
FT                   Rv3020c|AL0212|MTV012.34 (97 aa), FASTA scores: opt:
FT                   564,E(): 0, (91.8% identity in 97 aa overlap). Contains
FT                   probable helix-turn-helix motif at aa 14-35 (Score
FT                   144,+4.11 SD). Seems to belong to the ESAT6 family (see Gey
FT                   Van Pittius et al., 2001). Note that previously known as
FT                   TB9.8."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0287"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43017"
FT                   /db_xref="GOA:O53692"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:2KG7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53692"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43017.1"
FT                   /translation="MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQG
FT                   ESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF"
FT   gene            351848..352138
FT                   /gene="esxH"
FT                   /gene_synonym="cfp7"
FT                   /gene_synonym="TB10.4"
FT                   /locus_tag="Rv0288"
FT   CDS_pept        351848..352138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxH"
FT                   /gene_synonym="cfp7"
FT                   /gene_synonym="TB10.4"
FT                   /locus_tag="Rv0288"
FT                   /product="Low molecular weight protein antigen 7 EsxH (10
FT                   kDa antigen) (CFP-7) (protein TB10.4)"
FT                   /note="Rv0288, (MT0301, MTV035.16), len: 96 aa. EsxH, low
FT                   molecular weight protein antigen 7 (10 kDa antigen) (CFP-7)
FT                   (Protein TB10.4) (see citations below), ala-rich protein;
FT                   member of mycobacterial protein family containing
FT                   ESAT-6,very similar to MTV012_33 from Mycobacterium
FT                   tuberculosis (96 aa), FASTA scores: opt: 566, E(): 0,
FT                   (84.4% identity in 96 aa overlap). Alternative start codon
FT                   possible position 351878 (see Rosenkrands et al., 2000).
FT                   Belongs to the ESAT6 family (see Skjot et al., 2000; 2002;
FT                   Gey Van Pittius et al., 2001). Note that previously known
FT                   as cfp7 (alternate gene name: TB10.4). A core mycobacterial
FT                   gene; conserved in mycobacterial strains (See Marmiesse et
FT                   al., 2004). Predicted possible vaccine candidate (See Zvi
FT                   et al.,2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0288"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43018"
FT                   /db_xref="GOA:P9WNK3"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:2KG7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNK3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43018.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
FT   gene            352149..353036
FT                   /gene="espG3"
FT                   /locus_tag="Rv0289"
FT   CDS_pept        352149..353036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espG3"
FT                   /locus_tag="Rv0289"
FT                   /product="ESX-3 secretion-associated protein EspG3"
FT                   /note="Rv0289, (MTV035.17), len: 295 aa. EspG3, ESX-3
FT                   secretion-associated protein, equivalent to
FT                   CAC32061.1|AL583926 possible DNA-binding protein from
FT                   Mycobacterium leprae (289 aa); and showing some similarity
FT                   to Rv3866|G70656|CAB06238.1|Z94121|MTCY15F10.23 from
FT                   Mycobacterium tuberculosis (276 aa), FASTA scores: opt:
FT                   149, E(): 0.0035, (27.7% identity in 289 aa overlap). A
FT                   core mycobacterial gene; conserved in mycobacterial strains
FT                   (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0289"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43019"
FT                   /db_xref="GOA:P9WJC7"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="PDB:4W4I"
FT                   /db_xref="PDB:5XKL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJC7"
FT                   /protein_id="CCP43019.1"
FT                   /translation="MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGA
FT                   FVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGI
FT                   VALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEF
FT                   SLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGR
FT                   HTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWF
FT                   PGQRVSRDFSTQSS"
FT   gene            353083..354501
FT                   /gene="eccD3"
FT                   /locus_tag="Rv0290"
FT   CDS_pept        353083..354501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccD3"
FT                   /locus_tag="Rv0290"
FT                   /product="ESX conserved component EccD3. ESX-3 type VII
FT                   secretion system protein. Probable transmembrane protein."
FT                   /note="Rv0290, (MTV035.18), len: 472 aa. EccD3, esx
FT                   conserved component, ESX-3 type VII secretion system
FT                   protein, probable transmembrane protein, similar to several
FT                   others in mycobacteria e.g. Z95389|MTCY77_20|Rv3887c from
FT                   Mycobacterium tuberculosis (467 aa), FASTA scores: opt:
FT                   429, E(): 5.1e-19, (28. 6% identity in 479 aa overlap);
FT                   Rv3877; Rv1795; Rv3448; and Y14967|MLCB628_9|MLCB628.10c
FT                   from Mycobacterium leprae (480 aa), FASTA scores: opt:
FT                   269,E(): 3.1e-09, (26.0% identity in 503 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0290"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43020"
FT                   /db_xref="GOA:P9WNQ3"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNQ3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43020.1"
FT                   /translation="MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSA
FT                   QNGDGGQADSGAAVQLSLAPVGGQPFSLDASLDTVGVVDGDLLVLQPVPAGPAAPGIVE
FT                   DIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAG
FT                   IAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWS
FT                   LIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQ
FT                   AAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYT
FT                   ATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPV
FT                   MAYLVGLFAWVLNR"
FT   gene            354498..355883
FT                   /gene="mycP3"
FT                   /locus_tag="Rv0291"
FT   CDS_pept        354498..355883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mycP3"
FT                   /locus_tag="Rv0291"
FT                   /product="Probable membrane-anchored mycosin MycP3 (serine
FT                   protease) (subtilisin-like protease) (subtilase-like)
FT                   (mycosin-3)"
FT                   /note="Rv0291, (MTV035.19), len: 461 aa. Probable
FT                   mycP3,membrane-anchored serine protease (mycosin) (see
FT                   Brown et al., 2000), similar to several others in
FT                   mycobacteria e.g. Z94121|MTY15F10_28|Rv1796 from
FT                   Mycobacterium tuberculosis (446 aa), FASTA scores: opt:
FT                   1168, E(): 0, (44.6% identity in 453 aa overlap); Rv3886c;
FT                   Rv3883c; Rv3449; and Y14967|MLCB628_4|MLCB628.04 from
FT                   Mycobacterium leprae (446 aa), FASTA scores: opt: 1159,
FT                   E(): 0, (43.5 identity in 446 aa overlap). Has signal
FT                   sequence and hydrophobic stretch at C-terminus, followed by
FT                   short positively charged segment,that seems to act as a
FT                   membrane anchor. Contains PS00137 Serine proteases,
FT                   subtilase family, histidine active site signature. Belongs
FT                   to peptidase family S8 (also known as the subtilase
FT                   family), pyrolysin subfamily. Conserved in M. tuberculosis,
FT                   M. leprae, M. bovis and M. avium paratuberculosis;
FT                   predicted to be essential for in vivo survival and
FT                   pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0291"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43021"
FT                   /db_xref="GOA:O53695"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53695"
FT                   /inference="protein motif:PROSITE:PS00137"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43021.1"
FT                   /translation="MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPV
FT                   APMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRL
FT                   PNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFS
FT                   PRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIR
FT                   YAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPY
FT                   VLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSG
FT                   TSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTW
FT                   QLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRRE
FT                   PTE"
FT   gene            355880..356875
FT                   /gene="eccE3"
FT                   /locus_tag="Rv0292"
FT   CDS_pept        355880..356875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccE3"
FT                   /locus_tag="Rv0292"
FT                   /product="ESX conserved component EccE3. ESX-3 type VII
FT                   secretion system protein. Probable transmembrane protein."
FT                   /note="Rv0292, (MTV035.20), len: 331 aa. EccE3, esx
FT                   conserved component, ESX-3 type VII secretion system
FT                   protein, probable transmembrane protein (has two
FT                   hydrophobic segments at N-terminal end), equivalent to
FT                   CAC32058.1|AL583926 conserved membrane protein from
FT                   Mycobacterium leprae (339 aa). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0292"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43022"
FT                   /db_xref="GOA:P9WJE5"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJE5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43022.1"
FT                   /translation="MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVV
FT                   IGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLI
FT                   ARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVA
FT                   ARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSANAELPD
FT                   TLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNH
FT                   VPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT"
FT   gene            complement(356862..358064)
FT                   /locus_tag="Rv0293c"
FT   CDS_pept        complement(356862..358064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0293c"
FT                   /product="Conserved protein"
FT                   /note="Rv0293c, (MTV035.21c), len: 400 aa. Conserved
FT                   protein, similar in C-terminal part to
FT                   Rv2627c|B70573|MTCY01A10.05|CAB08637.1|Z95387 conserved
FT                   hypothetical protein from Mycobacterium tuberculosis (413
FT                   aa), FASTA scores: opt: 394, E(): 2.1e-17, (31.1% identity
FT                   in 299 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0293c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43023"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:O53697"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43023.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
FT   gene            358171..358956
FT                   /gene="tam"
FT                   /locus_tag="Rv0294"
FT   CDS_pept        358171..358956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tam"
FT                   /locus_tag="Rv0294"
FT                   /product="Probable trans-aconitate methyltransferase Tam"
FT                   /note="Rv0294, (MTV035.22), len: 261 aa. Probable
FT                   tam,trans-aconitate methyltransferase, similar to others
FT                   e.g. P76145|TAM_ECOLI|7465793|B64906|B1519 trans-aconitate
FT                   methyltransferase from Escherichia coli strain K12 (252
FT                   aa), FASTA scores: opt: 649, E(): 0, (39.3 identity in 252
FT                   aa overlap). Belongs to the methyltransferase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0294"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43024"
FT                   /db_xref="GOA:P9WGA3"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGA3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43024.1"
FT                   /translation="MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTR
FT                   YLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPE
FT                   HSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQ
FT                   SPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQ
FT                   ELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG"
FT   gene            complement(358945..359748)
FT                   /locus_tag="Rv0295c"
FT   CDS_pept        complement(358945..359748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0295c"
FT                   /product="Conserved protein"
FT                   /note="Rv0295c, (MTV035.23c), len: 267 aa. Conserved
FT                   protein, showing weak similarity with CAC46877.1|AL591790
FT                   conserved hypothetical protein from Sinorhizobium meliloti
FT                   (213 aa); and NP_104818.1|14023999|BAB50604.1|AP00300
FT                   Protein with weak similarity to NodH from Mesorhizobium
FT                   loti (257 aa). Predicted to be an outer membrane protein
FT                   (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0295c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43025"
FT                   /db_xref="GOA:O53699"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O53699"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43025.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
FT   gene            complement(359758..361155)
FT                   /gene_synonym="atsG"
FT                   /locus_tag="Rv0296c"
FT   CDS_pept        complement(359758..361155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene_synonym="atsG"
FT                   /locus_tag="Rv0296c"
FT                   /product="Probable sulfatase"
FT                   /note="Rv0296c, (MTCY63.01c, MTV035.24c), len: 465 aa.
FT                   Probable sulfatase, possibly an aryl-/steryl-sulfatase or a
FT                   sulfamidase (sulfohydrolase) (sulphamidase). Similar to
FT                   various hydrolases e.g. AAG41945.1|AF304053_1|AF304053
FT                   heparan N-sulfatase from Mus musculus (502 aa);
FT                   NP_061292.1|6851181|AAF29460.1|AF153827_1|AF153827
FT                   N-sulfoglucosamine sulfohydrolase (sulfamidase)
FT                   (sulphamidase) from Mus musculus (502 aa);
FT                   AAG17206.1|AF217203_1|AF217203 heparan sulfate sulfamidase
FT                   from Canis familiaris (507 aa); P08842|STS_HUMAN|1360652
FT                   steryl-sulfatase precursor (steroid sulfatase)
FT                   (steryl-sulfate sulfohydrolase) (arylsulfatase C) (ASC)
FT                   from Homo sapiens (583 aa); ARSB_FELCA|P33727 arylsulfatase
FT                   B precursor (535 aa), FASTA scores: opt: 231, E():
FT                   1.7e-08,(30.3% identity in 261 aa overlap). Also similarity
FT                   with 4 others sulfatases in Mycobacterium tuberculosis.
FT                   Contains sulfatases signature 1 (PS00523). Note that
FT                   previously known as atsG."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0296c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43026"
FT                   /db_xref="GOA:Q6MX51"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MX51"
FT                   /inference="protein motif:PROSITE:PS00523"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43026.1"
FT                   /translation="MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEG
FT                   ILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYS
FT                   ALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFET
FT                   HRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGL
FT                   DASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPT
FT                   LLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSY
FT                   IENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQ
FT                   GVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADR
FT                   GIDEHCS"
FT   gene            361334..363109
FT                   /gene="PE_PGRS5"
FT                   /locus_tag="Rv0297"
FT   CDS_pept        361334..363109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE_PGRS5"
FT                   /locus_tag="Rv0297"
FT                   /product="PE-PGRS family protein PE_PGRS5"
FT                   /note="Rv0297, (MTCY63.02), len: 591 aa. PE_PGRS5, Member
FT                   of the Mycobacterium tuberculosis PE family, PGRS subfamily
FT                   of gly-rich proteins (see citation below), highly similar
FT                   to others e.g. Y03A_MYCTU|Q10637 from Mycobacterium
FT                   tuberculosis (603 aa), FASTA scores: opt: 1884, E():
FT                   0,(53.7% identity in 635 aa overlap). This region is a
FT                   possible MT-complex-specific genomic island (See Becq et
FT                   al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0297"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43027"
FT                   /db_xref="GOA:Q6MX50"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MX50"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43027.1"
FT                   /translation="MSFVIAQPEMIAAAAGELASIRSAINAANAAAAAQTTGVMSAAAD
FT                   EVSTAVAALFSSHAQAYQAASAQAAAFHAQVVRTLTVDAGAYASAEAANAGPNMLAAVN
FT                   APAQALLGRPLIGNGANGAPGTGQAGGDGGLLFGNGGNGGSGAPGQAGGAGGAAGFFGN
FT                   GGNGGDGGAGANGGAGGTAGWFFGFGGNGGAGGIGVAGINGGLGGAGGDGGNAGFFGNG
FT                   GNGGMGGAGAAGVNAVNPGLATPVTPAANGGNGLNLVGVPGTAGGGADGANGSAIGQAG
FT                   GAGGDGGNASTSGGIGIAQTGGAGGAGGAGGDGAPGGNGGNGGSVEHTGATGSSASGGN
FT                   GATGGNGGVGAPGGAGGNGGHVSGGSVNTAGAGGKGGNGGTGGAGGPGGHGGSVLSGPV
FT                   GDSGNGGAGGDGGAGVSATDIAGTGGRGGNGGHGGLWIGNGGDGGAGGVGGVGGAGAAG
FT                   AIGGHGGDGGSVNTPIGGSEAGDGGKGGLGGDGGGRGIFGQFGAGGAGGAGGVGGAGGA
FT                   GGTGGGGGNGGAIFNAGTPGAAGTGGDGGVGGTGAAGGKGGAGGSGGVNGATGADGAKG
FT                   LDGATGGKGNNGNPG"
FT   gene            363252..363479
FT                   /locus_tag="Rv0298"
FT   CDS_pept        363252..363479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0298"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0298, (MTCY63.03), len: 75 aa. Hypothetical
FT                   unknown protein. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0298"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43028"
FT                   /db_xref="GOA:P9WJ09"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ09"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43028.1"
FT                   /translation="MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVA
FT                   LRDYTAKTVPALDIDAYAQRVYQANRAAGS"
FT   gene            363476..363778
FT                   /locus_tag="Rv0299"
FT   CDS_pept        363476..363778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0299"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0299, (MTCY63.04), len: 100 aa. Hypothetical
FT                   unknown protein. Equivalent to AAK44536.1 from
FT                   Mycobacterium tuberculosis strain CDC1551 (49 aa) but
FT                   longer 51 aa. This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0299"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43029"
FT                   /db_xref="GOA:O07226"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07226"
FT                   /protein_id="CCP43029.1"
FT                   /translation="MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRV
FT                   PEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC"
FT   gene            363826..364047
FT                   /gene="vapB2"
FT                   /locus_tag="Rv0300"
FT   CDS_pept        363826..364047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB2"
FT                   /locus_tag="Rv0300"
FT                   /product="Possible antitoxin VapB2"
FT                   /note="Rv0300, (MTCY63.05), len: 73 aa. Possible
FT                   vapB2,antitoxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0301 (See Arcus et al., 2005; Pandey and Gerdes, 2005).
FT                   Weak similarity with others e.g. Rv3697c from Mycobacterium
FT                   tuberculosis (145
FT                   aa),Rv1721c|MTCY04C12.06c|Z81360|MTCY4C12_4 conserved
FT                   hypothetical protein from Mycobacterium tuberculosis (75
FT                   aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38
FT                   aa overlap). This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0300"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43030"
FT                   /db_xref="GOA:O07227"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="PDB:3H87"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07227"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43030.1"
FT                   /translation="MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARV
FT                   TVTAADLRRLRGAVAGLGDPELMRQAWR"
FT   gene            364044..364469
FT                   /gene="vapC2"
FT                   /locus_tag="Rv0301"
FT   CDS_pept        364044..364469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC2"
FT                   /locus_tag="Rv0301"
FT                   /product="Possible toxin VapC2"
FT                   /note="Rv0301, (MTCY63.06), len: 141 aa. Possible
FT                   vapC2,toxin, part of toxin-antitoxin (TA) operon with
FT                   Rv0300,contains PIN domain (See Arcus et al., 2005; Pandey
FT                   and Gerdes, 2005). Similar to others in Mycobacterium
FT                   tuberculosis e.g. Rv2757c, Rv0229c, Rv2546, etc. This
FT                   region is a possible MT-complex-specific genomic island
FT                   (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0301"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43031"
FT                   /db_xref="GOA:P9WFB9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="PDB:3H87"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WFB9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43031.1"
FT                   /translation="MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVG
FT                   FSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAA
FT                   TAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA"
FT   gene            364605..365237
FT                   /locus_tag="Rv0302"
FT   CDS_pept        364605..365237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0302"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably TetR/AcrR-family)"
FT                   /note="Rv0302, (MTCY63.07), len: 210 aa. Probable
FT                   transcription regulatory protein, TetR family (see citation
FT                   below), with its N-terminus similar to N-terminus of
FT                   several repressors and regulatory proteins of TetR/AcrR
FT                   family e.g. ACRR_ECOLI|P34000 potential acraB operon
FT                   repressor from Escherichia coli (215 aa), FASTA scores:
FT                   opt: 172, E(): 3.1e-05, (22.7% identity in 194 aa overlap).
FT                   Also similar in N-terminus to N-terminus of MTCY07A7.24
FT                   hypothetical regulator from Mycobacterium tuberculosis
FT                   FASTA score: (38.7% identity in 62 aa overlap). Contains
FT                   probable helix-turn helix motif from aa 35-56 (Score
FT                   1728,+5.07 SD). This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,
FT                   2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0302"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43032"
FT                   /db_xref="GOA:O07229"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="PDB:5D18"
FT                   /db_xref="PDB:5D19"
FT                   /db_xref="UniProtKB/TrEMBL:O07229"
FT                   /protein_id="CCP43032.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
FT   gene            365234..366142
FT                   /locus_tag="Rv0303"
FT   CDS_pept        365234..366142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0303"
FT                   /product="Probable dehydrogenase/reductase"
FT                   /note="Rv0303, (MTCY63.08), len: 302 aa. Possible
FT                   dehydrogenase/reductase, similar to various NADPH
FT                   dehydrogenases and other NADPH oxidoreductases e.g.
FT                   O48741|PORC_ARATH|7488284|T00897 protochlorophyllide
FT                   reductase C chloroplast precursor
FT                   (NADPH-protochlorophyllide oxidoreductase C) from
FT                   Arabidopsis thaliana (401 aa); Q42850 NADPH dehydrogenase
FT                   (395 aa), FASTA scores: opt: 347, E(): 3.8e-16, (35.4%
FT                   identity in 319 aa overlap). This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0303"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43033"
FT                   /db_xref="GOA:O07230"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O07230"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43033.1"
FT                   /translation="MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAA
FT                   MEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDG
FT                   VEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHP
FT                   PTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYP
FT                   PILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAES
FT                   YDRAKALDLWETSERLLAQVT"
FT   gene            complement(366150..372764)
FT                   /gene="PPE5"
FT                   /locus_tag="Rv0304c"
FT   CDS_pept        complement(366150..372764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE5"
FT                   /locus_tag="Rv0304c"
FT                   /product="PPE family protein PPE5"
FT                   /note="Rv0304c, (MTCY63.9c), len: 2204 aa. PPE5, Member of
FT                   the Mycobacterium tuberculosis PE family (PPE,
FT                   MPTR),similar to others e.g. Z95324|MTY13E10_16 from
FT                   Mycobacterium tuberculosis (1443 aa), FASTA scores: E():
FT                   0,(50.6% identity in 1403 aa overlap); Y04H_MYCTU|Q10778
FT                   from Mycobacterium tuberculosis (734 aa), FASTA scores:
FT                   opt: 989, E(): 0, (42.3% identity in 522 aa overlap). This
FT                   region is a possible MT-complex-specific genomic island
FT                   (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0304c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43034"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MX49"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43034.1"
FT                   /translation="MNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPA
FT                   VNSGLANIGTNIAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGI
FT                   GNTGIFDVGLANLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIG
FT                   FANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSG
FT                   NFGIANSGSFNTGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGN
FT                   TNTGYLNIGNYNTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISL
FT                   GVNIPIDIPITASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTV
FT                   AIGGPNTAITITGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGAN
FT                   SGFWNLASATSGASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTS
FT                   IAGLLRDSTGTMVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGA
FT                   NTGIFDIGLANLGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGF
FT                   ANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTAN
FT                   FGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDV
FT                   DTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQ
FT                   GFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPA
FT                   TSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGF
FT                   YNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNI
FT                   GFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGS
FT                   GNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPG
FT                   NFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWR
FT                   GDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFH
FT                   IHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGN
FT                   STTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNT
FT                   ISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGI
FT                   GNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIG
FT                   IGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSF
FT                   NTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSINTGSFNTGSTNTGSFNLGDHNTGS
FT                   FNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIP
FT                   EIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQ
FT                   VIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGN
FT                   FGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLA
FT                   TPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSN
FT                   LGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSY
FT                   NIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNS
FT                   GSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFN
FT                   PGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIG
FT                   LPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGN
FT                   TISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG"
FT   gene            complement(372820..375711)
FT                   /gene="PPE6"
FT                   /locus_tag="Rv0305c"
FT   CDS_pept        complement(372820..375711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE6"
FT                   /locus_tag="Rv0305c"
FT                   /product="PPE family protein PPE6"
FT                   /note="Rv0305c, (MTCY63.10c), len: 963 aa. PPE6, Member of
FT                   the Mycobacterium tuberculosis PE family (PPE,
FT                   MPTR),similar to others e.g. Y04H_MYCTU|Q10778 from
FT                   Mycobacterium tuberculosis (734 aa), FASTA scores: opt:
FT                   1340, E(): 0,(40.9% identity in 815 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0305c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43035"
FT                   /db_xref="GOA:Q6MX48"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MX48"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43035.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDLQH
FT                   RHGEHRQYQHRRFHLRQPQQRPSVAGRQPGSDRPRHRRRHSRNPDCERRREYPDSHTDH
FT                   RQLHGHRIQRARSSTEHSRHCYFFRTRRYRPLHRPSDTDNRSHTCGHGGWTHYRDQYRR
FT                   HCGRRRHQHPDYPYSSDSRLRQLDRRTVVGLLQ"
FT   gene            375914..376585
FT                   /locus_tag="Rv0306"
FT   CDS_pept        375914..376585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0306"
FT                   /product="Putative oxidoreductase"
FT                   /note="Rv0306, (MTCY63.11), len: 223 aa. Putative
FT                   oxidoreductase, highly similar to
FT                   H83485|9947208|AAG04663.1|AE004557_4|AE004557 conserved
FT                   hypothetical protein from Pseudomonas aeruginosa strain
FT                   PAO1 (218 aa); and to other putative oxidoreductases e.g.
FT                   middle part of CAB76073.1|AL157953 putative nitroreductase
FT                   from Streptomyces coelicolor (1212 aa); Q52685|BLUB protein
FT                   involved in cobalamin (vitamin B12) synthesis from
FT                   Rhodobacter capsulatus (206 aa), FASTA scores: opt:
FT                   318,E(): 2e-15, (35.6% identity in 191 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0306"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43036"
FT                   /db_xref="GOA:O07233"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:O07233"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43036.1"
FT                   /translation="MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAP
FT                   SVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELL
FT                   VVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALL
FT                   AMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHG
FT                   E"
FT   gene            complement(376573..377055)
FT                   /locus_tag="Rv0307c"
FT   CDS_pept        complement(376573..377055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0307c"
FT                   /product="Unknown protein"
FT                   /note="Rv0307c, (MTCY63.12c), len: 160 aa. Unknown
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0307c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43037"
FT                   /db_xref="UniProtKB/TrEMBL:O07234"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43037.1"
FT                   /translation="MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIP
FT                   GLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQ
FT                   LDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP"
FT   gene            377113..377829
FT                   /locus_tag="Rv0308"
FT   CDS_pept        377113..377829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0308"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0308, (MTCY63.13), len: 238 aa. Probable conserved
FT                   integral membrane protein, with C-terminus highly similar
FT                   to C-terminus of other integral membrane proteins or
FT                   phosphatases e.g.
FT                   AAK25788.1|AF336822_1|13430250|AAK25789.1|AF336823_1
FT                   putative phosphatase from Streptococcus pyogenes (201 aa);
FT                   Q06074 hypothetical 24.9 kDa protein (216 aa), FASTA
FT                   scores: opt: 209, E(): 2e-07, (27.9% identity in 140 aa
FT                   overlap). Could be a phosphatase."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0308"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43038"
FT                   /db_xref="GOA:O07235"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:O07235"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43038.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
FT   gene            377931..378587
FT                   /locus_tag="Rv0309"
FT   CDS_pept        377931..378587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0309"
FT                   /product="Possible conserved exported protein"
FT                   /note="Rv0309, (MTCY63.14), len: 218 aa. Possible conserved
FT                   exported protein (has putative N-terminal signal
FT                   sequence),equivalent to AC32053.1|AL583926 putative
FT                   secreted protein from Mycobacterium leprae (218 aa). Also
FT                   similar to others e.g. AB76092.1|AL157956 putative secreted
FT                   protein from Streptomyces coelicolor (238 aa). Predicted to
FT                   be an outer membrane protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0309"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43039"
FT                   /db_xref="GOA:O07236"
FT                   /db_xref="UniProtKB/TrEMBL:O07236"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43039.1"
FT                   /translation="MSRLLALLCAAVCTGCVAVVLAPVSLAVVNPWFANSVGNATQVVS
FT                   VVGTGGSTAKMDVYQRTAAGWQPLKTGITTHIGSAGMAPEAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCQKSQCPFSTADSENLQIPQYKHS
FT                   VVMGVNKAKVPGKGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
FT   gene            complement(378657..379148)
FT                   /locus_tag="Rv0310c"
FT   CDS_pept        complement(378657..379148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0310c"
FT                   /product="Conserved protein"
FT                   /note="Rv0310c, (MTCY63.15c), len: 163 aa. Conserved
FT                   protein, similar to some bile acid dehydratases e.g.
FT                   P19412|BAIE_EUBSP|98749|D37844|1381566|AAC45413.1|U57489
FT                   bile acid-inducible operon protein E from Eubacterium sp
FT                   (166 aa), FASTA scores: opt: 302, E(): 1e-11, (38.8%
FT                   identity in 134 aa overlap); AAF22847.1|AF210152_4 bile
FT                   acid 7a-dehydratase from Clostridium sp. (168 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0310c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43040"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:O07237"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43040.1"
FT                   /translation="MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDV
FT                   TGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDR
FT                   VIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
FT                   "
FT   gene            379172..380401
FT                   /locus_tag="Rv0311"
FT   CDS_pept        379172..380401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0311"
FT                   /product="Unknown protein"
FT                   /note="Rv0311, (MTCY63.16), len: 409 aa. Unknown protein.
FT                   Contains PS00881 Protein splicing signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0311"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43041"
FT                   /db_xref="GOA:O07238"
FT                   /db_xref="UniProtKB/TrEMBL:O07238"
FT                   /inference="protein motif:PROSITE:PS00881"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43041.1"
FT                   /translation="MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEM
FT                   LQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWH
FT                   GEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPAD
FT                   RHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLD
FT                   FGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAE
FT                   RIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTP
FT                   ASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFE
FT                   PRRSLPLTVK"
FT   gene            380556..382418
FT                   /locus_tag="Rv0312"
FT   CDS_pept        380556..382418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0312"
FT                   /product="Conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="Rv0312, (MTCY63.17), len: 620 aa. Conserved
FT                   hypothetical protein with highly Pro-, Thr-rich C-terminus.
FT                   Similar to Pro-,Thr-rich region in
FT                   Rv2264c|AL021925|MTV022_14 from Mycobacterium tuberculosis
FT                   (592 aa), FASTA scores: opt: 1075, E(): 0, (38.9% identity
FT                   in 627 aa overlap). Also some similarity with Rv0350|dnaK
FT                   from Mycobacterium tuberculosis. Possibly membrane protein;
FT                   has hydrophobic stetch in its middle part."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0312"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43042"
FT                   /db_xref="GOA:O07239"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:O07239"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43042.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGSVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTEPPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
FT   gene            382490..382876
FT                   /locus_tag="Rv0313"
FT   CDS_pept        382490..382876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0313"
FT                   /product="Conserved protein"
FT                   /note="Rv0313, (MTCY63.18), len: 128 aa. Conserved
FT                   protein,equivalent only to CAC32049.1|AL583926 conserved
FT                   hypothetical protein from Mycobacterium leprae (130 aa). A
FT                   core mycobacterial gene; conserved in mycobacterial strains
FT                   (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0313"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WL03"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43043.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
FT   gene            complement(382879..383541)
FT                   /locus_tag="Rv0314c"
FT   CDS_pept        complement(382879..383541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0314c"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Rv0314c, (MTCY63.19c), len: 220 aa. Possible
FT                   conserved membrane protein, with hydrophobic stretch from
FT                   residues ~75-100. Similar in C-terminal part to
FT                   Mycobacterium tuberculosis proteins Rv0679c and Rv0680c."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0314c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43044"
FT                   /db_xref="GOA:O07241"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:O07241"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43044.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
FT   gene            383602..384486
FT                   /locus_tag="Rv0315"
FT   CDS_pept        383602..384486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0315"
FT                   /product="Possible beta-1,3-glucanase precursor"
FT                   /note="Rv0315, (MTCY63.20), len: 294 aa. Possible
FT                   beta-1,3-glucanase precursor (has hydrophobic stretch in
FT                   its N-terminal part), similar to others e.g.
FT                   Q51333|AAC44371.1 beta-1,3-glucanase II a from Oerskovia
FT                   xanthineolytica (306 aa), FASTA scores: opt: 76, E():
FT                   3e-14, (34.1% identity in 302 aa overlap); and
FT                   AAC38290.1|AF052745 beta-1,3-glucanase II from Oerskovia
FT                   xanthineolytica (435 aa). Contains glycosyl hydrolases
FT                   family 16 active site signature (PS01034)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0315"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43045"
FT                   /db_xref="GOA:O07242"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="PDB:4WZF"
FT                   /db_xref="UniProtKB/TrEMBL:O07242"
FT                   /inference="protein motif:PROSITE:PS01034"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43045.1"
FT                   /translation="MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPA
FT                   PAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQ
FT                   NVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSN
FT                   DDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMY
FT                   FWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYKVFPVLNLAVGGSGGGDPATGS
FT                   YPQEMLVDWVRVF"
FT   gene            384535..385149
FT                   /locus_tag="Rv0316"
FT   CDS_pept        384535..385149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0316"
FT                   /product="Possible muconolactone isomerase"
FT                   /note="Rv0316, (MTCY63.21), len: 204 aa. Possible
FT                   muconolactone isomerase, showing weak similarity with some
FT                   muconolactone isomerases e.g. O33947|CTC1_ACILW
FT                   muconolactone delta-isomerase 1 (MIASE 1)(96 aa), FASTA
FT                   scores: opt: 179, E(): 3.9e-05, (32.6% identity in 92 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0316"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43046"
FT                   /db_xref="GOA:O07243"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:O07243"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43046.1"
FT                   /translation="MEFLVTMTTRVPDSMPADAVERVRAREAARSRELAAQGKLLRLWR
FT                   PPLRPGEWRTLGLFAADDNGELEQLLASMPPRSWRTDDVTPLGAHPNDPVGQGITIAPG
FT                   KGPEFLIATTIMVPPGTPAQVVDDTVAREARRAPELAGRGHLVRLWALPDGPDGQRTLG
FT                   LWRARDPGELMAILESLPLAGWMTIETTPLSPHPDDPIRMP"
FT   gene            complement(385173..385943)
FT                   /gene="glpQ2"
FT                   /locus_tag="Rv0317c"
FT   CDS_pept        complement(385173..385943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ2"
FT                   /locus_tag="Rv0317c"
FT                   /product="Possible glycerophosphoryl diester
FT                   phosphodiesterase GlpQ2 (glycerophosphodiester
FT                   phosphodiesterase)"
FT                   /note="Rv0317c, (MTCY63.22c), len: 256 aa (start
FT                   uncertain,chosen by homology). Possible glpQ2,
FT                   glycerophosphoryl diester phosphodiesterase, similar to
FT                   others e.g. E75317|6459876|AAF11631.1|AE002044_4
FT                   glycerophosphoryl diester phosphodiesterase from
FT                   Deinococcus radiodurans (285 aa); P10908|UGPQ_ECOLI from
FT                   Escherichia coli (247 aa),FASTA scores: opt: 220, E():
FT                   5.2e-07, (28.0% identity in 250 aa overlap). Also similar
FT                   to MTCY01A6.27 from Mycobacterium tuberculosis FASTA score:
FT                   (27.5% identity in 247 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0317c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43047"
FT                   /db_xref="GOA:O07244"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:O07244"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43047.1"
FT                   /translation="MEFLRHGGRIAMAHRGFTSFRLPMNSMGAFQEAAKLGFRYIETDV
FT                   RATRDGVAVILHDRRLAPGVGLSGAVDRLDWRDVRKAQLGAGQSIPTLEDLLTALPDMR
FT                   VNIDIKAASAIEPTVNVIERCNAHNRVLIGSFSERRRRRALRLLTKRVASSAGTGALLA
FT                   WLTARPLGSRAYAWRMMRDIDCVQLPSRLGGVPVITPARVRGFHAAGRQVHAWTVDEPD
FT                   VMHTLLDMDVDGIITDRADLLRDVLIARGEWDGA"
FT   gene            complement(386204..386274)
FT                   /gene="glyU"
FT   tRNA            complement(386204..386274)
FT                   /gene="glyU"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:complement(386240..386242),aa:Gly,seq:ccc)"
FT                   /note="codon recognized: GGG; glyU, tRNA-Gly, anticodon
FT                   ccc, length = 71"
FT   gene            complement(386305..387099)
FT                   /locus_tag="Rv0318c"
FT   CDS_pept        complement(386305..387099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0318c"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0318c, (MTCY63.23c), len: 264 aa. Probable
FT                   conserved integral membrane protein, with some similarity
FT                   to C-terminus of GUFA_MYXXA|Q06916 (254 aa), FASTA scores:
FT                   opt: 157, E (): 0.0032, (28.3% identity in 198 aa overlap).
FT                   Also similar to O26573 conserved protein from
FT                   Methanobacterium thermoauto (259 aa), FASTA scores: opt:
FT                   173, E(): 5.2e-05, (32.7% identity in 214 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0318c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43048"
FT                   /db_xref="GOA:Q6MX47"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MX47"
FT                   /protein_id="CCP43048.1"
FT                   /translation="MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGG
FT                   VVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVAL
FT                   RRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEV
FT                   LFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAA
FT                   GALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME"
FT   gene            387148..387816
FT                   /gene="pcp"
FT                   /locus_tag="Rv0319"
FT   CDS_pept        387148..387816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="Rv0319"
FT                   /product="Probable pyrrolidone-carboxylate peptidase Pcp
FT                   (5-oxoprolyl-peptidase) (pyroglutamyl-peptidase I) (PGP-I)
FT                   (pyrase)"
FT                   /note="Rv0319, (MTCY63.24), len: 222 aa. Probable
FT                   pcp,pyrrolidone-carboxylate peptidase, highly similar to
FT                   others e.g. PCP_PSEFL|P42673 pyrrolidone-carboxylate
FT                   peptidase from Pseudomonas fluorescens (213 aa), FASTA
FT                   scores: opt: 478, E(): 7.5e-25, (40.2% identity in 219 aa
FT                   overlap). Belongs to peptidase family C15 (thiol
FT                   protease)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0319"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43049"
FT                   /db_xref="GOA:P9WIJ5"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIJ5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43049.1"
FT                   /translation="MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNT
FT                   FFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVG
FT                   EPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLP
FT                   VRAGWIHLPCLPSVAALDHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI
FT                   "
FT   gene            387888..388550
FT                   /locus_tag="Rv0320"
FT   CDS_pept        387888..388550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0320"
FT                   /product="Possible conserved exported protein"
FT                   /note="Rv0320, (MTCY63.25), len: 220 aa. Possible conserved
FT                   exported protein, similar to some hypothetical proteins and
FT                   to the middle part of a peptidase:
FT                   NP_066789.1|10657900|AAG21739.1|AF116907 putative peptidase
FT                   from Rhodococcus equi (546 aa). Also similar to
FT                   Rv1728c|MTCY04C12.13c from Mycobacterium tuberculosis (256
FT                   aa), FASTA scores: opt: 497, E(): 1.2e-26, (41.8% identity
FT                   in 225 aa overlap). Predicted to be an outer membrane
FT                   protein (See Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0320"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43050"
FT                   /db_xref="UniProtKB/TrEMBL:O07246"
FT                   /protein_id="CCP43050.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
FT   gene            388582..389154
FT                   /gene="dcd"
FT                   /gene_synonym="dus"
FT                   /gene_synonym="paxA"
FT                   /locus_tag="Rv0321"
FT   CDS_pept        388582..389154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /gene_synonym="dus"
FT                   /gene_synonym="paxA"
FT                   /locus_tag="Rv0321"
FT                   /product="Probable deoxycytidine triphosphate deaminase Dcd
FT                   (dCTP deaminase)"
FT                   /note="Rv0321, (MTCY63.26), len: 190 aa. Probable dcd
FT                   (alternate gene names: dus or paxA), deoxycytidine
FT                   triphosphate deaminase, equivalent to CAC32024.1|AL583925
FT                   probable deoxycytidine triphosphate deaminase from
FT                   Mycobacterium leprae (190 aa). Also highly similar to
FT                   others e.g. Q9X8W0|DCD_STRCO|7480599|T36613|SCH35.46
FT                   deoxycytidine triphosphate deaminase from Streptomyces
FT                   coelicolor (191 aa); DCD_ECOLI|P28248|DUS|PAXA|B2065
FT                   deoxycytidine triphosphate deaminase from Escherichia coli
FT                   strain K12 (193 aa), FASTA scores: opt: 408, E():
FT                   2.7e-21,(43.1% identity in 188 aa overlap); etc. Contains
FT                   PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to
FT                   the dCTP deaminase family. The transcription of this CDS
FT                   seems to be activated specifically in host granulomas (see
FT                   citation below)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0321"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43051"
FT                   /db_xref="GOA:P9WP17"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="PDB:2QLP"
FT                   /db_xref="PDB:2QXX"
FT                   /db_xref="PDB:4A6A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP17"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43051.1"
FT                   /translation="MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYG
FT                   SSRAGSKYQGQRGPTPSRSYQNFIRST"
FT   gene            389260..390591
FT                   /gene="udgA"
FT                   /gene_synonym="rkpK"
FT                   /locus_tag="Rv0322"
FT   CDS_pept        389260..390591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /gene_synonym="rkpK"
FT                   /locus_tag="Rv0322"
FT                   /product="Probable UDP-glucose 6-dehydrogenase UdgA
FT                   (UDP-GLC dehydrogenase) (UDP-GLCDH) (UDPGDH)"
FT                   /note="Rv0322, (MTCY63.27), len: 443 aa. Probable udg
FT                   (alternate gene name: rkpK), UDP-glucose 6-dehydrogenase
FT                   ,highly similar to others e.g. CAC44517.1|AL596138 putative
FT                   UDP-glucose 6-dehydrogenase from Streptomyces coelicolor
FT                   (447 aa); Q56812 UDP-glucose dehydrogenase from Xanthomonas
FT                   campestris (445 aa), FASTA scores: opt: 713, E(): 0, (41.9%
FT                   identity in 351 aa overlap); etc. Also similar to several
FT                   GDP-mannose 6-dehydrogenase. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop). Belongs to the
FT                   UDP-glucose/GDP-mannose dehydrogenases family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0322"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43052"
FT                   /db_xref="GOA:O07248"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O07248"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43052.1"
FT                   /translation="MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIP
FT                   FYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVI
FT                   DALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDT
FT                   LNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPA
FT                   LNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFID
FT                   LEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH"
FT   gene            complement(390580..391251)
FT                   /locus_tag="Rv0323c"
FT   CDS_pept        complement(390580..391251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0323c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0323c, (MTCY63.28c), len: 223 aa. Conserved
FT                   hypothetical protein, similar to others e.g.
FT                   YPJG_BACSU|P42981 hypothetical 24.8 kDa protein from
FT                   Bacillus subtilis (224 aa), FASTA scores: opt: 182, E():
FT                   1.3e-05, (27.5% identity in 211 aa overlap). Also some
FT                   similarity to MLU15183_8 from Mycobacterium tuberculosis
FT                   FASTA score: (32.0% identity in 147 aa overlap).
FT                   Alternative nucleotide at position 390828 (T->C; S142G) has
FT                   been observed. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0323c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43053"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:L0T643"
FT                   /protein_id="CCP43053.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPSIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
FT   gene            391352..392032
FT                   /locus_tag="Rv0324"
FT   CDS_pept        391352..392032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0324"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly ArsR-family)"
FT                   /note="Rv0324, (MTCY63.29), len: 226 aa. Possible
FT                   transcriptional regulator, arsR family, with its N-terminus
FT                   similar to the N-terminus of other DNA-binding proteins
FT                   e.g. P30346|MERR_STRLI probable mercury resistance operon
FT                   from Streptomyces lividans (125 aa), FASTA scores: opt:
FT                   154, E(): 0.002, (32.2% identity in 90 aa overlap), and its
FT                   C-terminal part similar to hypothetical bacterial proteins
FT                   e.g. P54510|YQHL_BACSU hypothetical 14.6 kDa protein from
FT                   Bacillus subtilis (126 aa), FASTA scores: opt: 159, E():
FT                   0.00097, (35.5% identity in 76 aa overlap). Most similar to
FT                   AJ005575|SPE005575_2 ORF1 required for antibiotic
FT                   production from Streptomyces peucetius (226 aa), FASTA
FT                   scores: opt: 816, E(): 0, (60.7% identity in 211 aa
FT                   overlap). Also similar in C-terminus to MTCY164.26
FT                   molybdopterin biosynthesis moeb protein from Mycobacterium
FT                   tuberculosis FASTA score: (36.8% identity in 114 aa
FT                   overlap). This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0324"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43054"
FT                   /db_xref="GOA:O08446"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:O08446"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43054.1"
FT                   /translation="MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIA
FT                   TATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADV
FT                   AVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADR
FT                   LAELTGDRDIVAYCRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPV
FT                   GHGD"
FT   gene            392039..392263
FT                   /locus_tag="Rv0325"
FT   CDS_pept        392039..392263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0325"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0325, (MTCY63.30), len: 74 aa. Hypothetical
FT                   unknown protein. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0325"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43055"
FT                   /db_xref="GOA:O07250"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O07250"
FT                   /protein_id="CCP43055.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAG"
FT   gene            392273..392728
FT                   /locus_tag="Rv0326"
FT   CDS_pept        392273..392728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0326"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0326, (MTCY63.31), len: 151 aa. Hypothetical
FT                   unknown protein. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0326"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43056"
FT                   /db_xref="GOA:O07251"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:O07251"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43056.1"
FT                   /translation="MVATDFSDVAVAQLRRSAQARGVSARVQPIVHDLRQPLPVKTGSI
FT                   DGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFE
FT                   CAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWRVTVTKPA"
FT   gene            complement(392696..394045)
FT                   /gene="cyp135A1"
FT                   /locus_tag="Rv0327c"
FT   CDS_pept        complement(392696..394045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp135A1"
FT                   /locus_tag="Rv0327c"
FT                   /product="Possible cytochrome P450 135A1 Cyp135A1"
FT                   /note="Rv0327c, (MT0342, MTCY63.32c), len: 449 aa. Possible
FT                   cyp135A1, cytochrome P450, similar to cytochrome P-450
FT                   monoxygenases and other cytochrome P-450 related enzymes
FT                   e.g. FQ12609 putative P450 monooxygenase (506 aa), FASTA
FT                   scores: opt: 276, E() : 1.7e-11, (27.9% identity in 433 aa
FT                   overlap). Also similar to other Mycobacterium tuberculosis
FT                   proteins e.g. MTV039.06|Rv0568 putative cytochrome P450
FT                   (472 aa); MTCI5.10 cytochrome p450 FASTA score: (30.4%
FT                   identity in 434 aa overlap). Contains cytochrome P450
FT                   cysteine heme-iron ligand signature (PS00086). Belongs to
FT                   the cytochrome P450 family. Alternative start possible at
FT                   33706 but no RBS. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0327c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43057"
FT                   /db_xref="GOA:P9WPN1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPN1"
FT                   /inference="protein motif:PROSITE:PS00086"
FT                   /protein_id="CCP43057.1"
FT                   /translation="MASTLTTGLPPGPRLPRYLQSVLYLRFREWFLPAMHRKYGDVFSL
FT                   RVPPYADNLVVYTRPEHIKEIFAADPRSLHAGEGNHILGFVMGEHSVLMTDEAEHARMR
FT                   SLLMPAFTRAALRGYRDMIASVAREHITRWRPHATINSLDHMNALTLDIILRVVFGVTD
FT                   PKVKAELTSRLQQIINIHPAILAGVPYPSLKRMNPWKRFFHNQTKIDEILYREIASRRI
FT                   DSDLTARTDVLSRLLQTKDTPTKPLTDAELRDQLITLLLAGHETTAAALSWTLWELAHA
FT                   PEIQSQVVWAAVGGDDGFLEAVLKEGMRRHTVIASTARKVTAPAEIGGWRLPAGTVVNT
FT                   SILLAHASEVSHPKPTEFRPSRFLDGSVAPNTWLPFGGGVRRCLGFGFALTEGAVILQE
FT                   IFRRFTITAAGPSKGETPLVRNITTVPKHGAHLRLIPQRRLGGLGDSDPP"
FT   gene            394111..394713
FT                   /locus_tag="Rv0328"
FT   CDS_pept        394111..394713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0328"
FT                   /product="Possible transcriptional regulatory protein
FT                   (possibly TetR/AcrR-family)"
FT                   /note="Rv0328, (MTCY63.33), len: 200 aa. Possible
FT                   transcription regulator, TetR/acrR family, similar in part
FT                   to various hypothetical transcriptional regulators e.g.
FT                   T36696|4726006|CAB41735.1|AL049731 probable regulatory
FT                   protein from Streptomyces coelicolor (197 aa). Also some
FT                   similarity with YX44_MYCTU|Q10829 hypothetical
FT                   transcriptional regulator from Mycobacterium tuberculosis
FT                   (195 aa), FASTA scores: opt: 154, E(): 0.00061, (26.7%
FT                   identity in 202 aa overlap). Contains probable helix-turn
FT                   helix motif from aa 27-48 (Score 1408, +3.98 SD). Seems to
FT                   belong to the TetR/AcrR family of transcriptional
FT                   regulators. This region is a possible MT-complex-specific
FT                   genomic island (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0328"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43058"
FT                   /db_xref="GOA:O07252"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:O07252"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43058.1"
FT                   /translation="MQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINY
FT                   HFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVY
FT                   ACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAV
FT                   IDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR"
FT   gene            complement(394694..395320)
FT                   /locus_tag="Rv0329c"
FT   CDS_pept        complement(394694..395320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0329c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0329c, (MTCY63.34c), len: 208 aa. Conserved
FT                   hypothetical protein, showing some similarity with others
FT                   hypothetical proteins and methyltransferases e.g.
FT                   MitM|AF127374_14 methyltransferase from Streptomyces
FT                   lavendulae (283 aa), FASTA scores: opt: 242, E():
FT                   1.8e-08,(37.2% identity in 145 aa overlap); Q48938 from
FT                   Methanosarcina barkeri (262 aa), FASTA scores: opt:
FT                   194,E(): 3.6e-06, (31.1% identity in 119 aa overlap). This
FT                   region is a possible MT-complex-specific genomic island
FT                   (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0329c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43059"
FT                   /db_xref="GOA:O07253"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O07253"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43059.1"
FT                   /translation="MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELL
FT                   APGPGERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLISLYH
FT                   GDGVTLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLVLTSISDDQPLAAR
FT                   FDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPATVWFTATAT"
FT   gene            complement(395347..396087)
FT                   /locus_tag="Rv0330c"
FT   CDS_pept        complement(395347..396087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0330c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0330c, (MTCY63.35c), len: 246 aa. Hypothetical
FT                   unknown protein. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0330c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43060"
FT                   /db_xref="GOA:O07254"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:O07254"
FT                   /protein_id="CCP43060.1"
FT                   /translation="MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTL
FT                   YGYAQGKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAAVVSARLAGEVTDMRLTH
FT                   ALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPELPDLAEVWFGTGR
FT                   NAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELCALWAVHLHFDPSPEPWSIVQPG
FT                   VIDDDAIAATLAEFVVRATTASSD"
FT   gene            396201..397367
FT                   /locus_tag="Rv0331"
FT   CDS_pept        396201..397367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0331"
FT                   /product="Possible dehydrogenase/reductase"
FT                   /note="Rv0331, (MTCY63.36), len: 388 aa. Possible
FT                   dehydrogenase/reductase, similar to various
FT                   dehydrogenases/reductases e.g.
FT                   NP_103779.1|14022957|BAB49565.1|AP002999 flavoprotein
FT                   reductase from Mesorhizobium loti (377 aa); NP_147681.1
FT                   predicted NAD(FAD)-dependent dehydrogenase from Aeropyrum
FT                   pernix (381 aa); DHSU_CHRVI|Q06530 sulfide dehydrogenase
FT                   (431 aa), FASTA scores: opt: 347, E(): 6.8e-15, (25.6%
FT                   identity in 348 aa overlap). This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0331"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43061"
FT                   /db_xref="GOA:O07255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:O07255"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43061.1"
FT                   /translation="MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLS
FT                   LLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIAL
FT                   GAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAA
FT                   PFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRK
FT                   ALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSA
FT                   DNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYV
FT                   ETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT"
FT   gene            397442..398227
FT                   /locus_tag="Rv0332"
FT   CDS_pept        397442..398227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0332"
FT                   /product="Conserved protein"
FT                   /note="Rv0332, (MTCY63.37), len: 261 aa. Conserved
FT                   protein,similar to several conserved hypothetical proteins
FT                   from Streptomyces coelicolor e.g.
FT                   SC6A9.18c|AL031035|SC6A9_18|T35449 hypothetical protein
FT                   (266 aa), FASTA scores: opt: 508, E(): 5.7e-27, (36.7%
FT                   identity in 251 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0332"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43062"
FT                   /db_xref="GOA:O07256"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:O07256"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43062.1"
FT                   /translation="MRKPASSLAKVDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSL
FT                   GQLFRHVGRGDRWAAQIVRDRLDHFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVE
FT                   QTGVETPVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISEFLE
FT                   RIAVQAGSGGTPLPLEDDDTLHLHATDPGLLEAGEWTVRRDERGVTWSHRHGKGAVALR
FT                   GGATELLLAMVRRLSVADTGIELLGDAGVWQKWLDRTPL"
FT   gene            398254..398628
FT                   /locus_tag="Rv0333"
FT   CDS_pept        398254..398628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0333"
FT                   /product="Unknown protein"
FT                   /note="Rv0333, (MTCY63.38), len: 124 aa. Unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0333"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43063"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:O33273"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43063.1"
FT                   /translation="MTTSEIATVLAWHDALNAADIETLVALSTDDIDIGDAHGAVQGHD
FT                   ALRGWASSLTTTAELGRMYVHHGVVVVEQKITSGEDPGIARTGAAAFRVVQDHVASVFR
FT                   HEDLASALAATELTEDDLVD"
FT   gene            398658..399524
FT                   /gene="rmlA"
FT                   /gene_synonym="rfbA"
FT                   /locus_tag="Rv0334"
FT   CDS_pept        398658..399524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /gene_synonym="rfbA"
FT                   /locus_tag="Rv0334"
FT                   /product="Alpha-D-glucose-1-phosphate thymidylyltransferase
FT                   RmlA (dTDP-glucose synthase) (dTDP-glucose
FT                   pyrophosphorylase)"
FT                   /note="Rv0334, (MTCY279.01), len: 288 aa. RmlA (alternate
FT                   gene name: rfbA), alpha-D-glucose-1-phosphate
FT                   thymidylyl-transferase (see citations below), equivalent to
FT                   CAC32020.1|AL583925 glucose-1-phosphate thymidyltransferase
FT                   from Mycobacterium leprae (288 aa). Also highly similar to
FT                   others e.g. AAG29804.1|AF235050 glucose-1-phosphate
FT                   thymidylyltransferase from Streptomyces rishiriensis (296
FT                   aa); RBA1_ECOLI|P37744 glucose-1-phosphate
FT                   thymidylyltransferase from Escherichia coli strain K12 (293
FT                   aa), FASTA scores: opt: 1199, E(): 0, (62.0% identity in
FT                   284 aa overlap). Belongs to the glucose-1-phosphate
FT                   thymidylyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0334"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43064"
FT                   /db_xref="GOA:P9WH13"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="PDB:6B5E"
FT                   /db_xref="PDB:6B5K"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WH13"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43064.1"
FT                   /translation="MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAG
FT                   IRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVAL
FT                   VLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTP
FT                   KSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLD
FT                   TGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYL
FT                   LELLERN"
FT   gene            complement(399535..400050)
FT                   /gene="PE6"
FT                   /locus_tag="Rv0335c"
FT   CDS_pept        complement(399535..400050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PE6"
FT                   /locus_tag="Rv0335c"
FT                   /product="PE family protein PE6"
FT                   /note="Rv0335c, (MTCY279.02c), len: 171 aa. PE6, Member of
FT                   the Mycobacterium tuberculosis PE family (see Brennan &
FT                   Delogu 2002); contains short region of similarity to part
FT                   of the unique N-terminus of the Mycobacterium tuberculosis
FT                   PGRS family of Glycine-rich proteins e.g. Y03A_MYCTU|Q10637
FT                   hypothetical glycine-rich 49.6 kd protein (603 aa), FASTA
FT                   scores: opt: 219, E(): 1.1e-08, (51.5% identity in 66 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0335c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43065"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:L7N648"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43065.1"
FT                   /translation="MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATT
FT                   RPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAA
FT                   FHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRAT
FT                   RGFHNHRQ"
FT   gene            400192..401703
FT                   /locus_tag="Rv0336"
FT   CDS_pept        400192..401703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0336"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /note="Rv0336, (MTCY279.03), len: 503 aa. Part of
FT                   Mycobacterium tuberculosis 13E12 repeat family; almost
FT                   identical to Rv0515|MTCY20G10.05 hypothetical protein from
FT                   Mycobacterium tuberculosis FASTA scores: (99.8% identity in
FT                   503 aa overlap), possibly due to a recent gene duplication.
FT                   Also similar to other Mycobacterium tuberculosis
FT                   hypothetical proteins e.g. Rv1148c, Rv1945, etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0336"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43066"
FT                   /db_xref="GOA:O33266"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:O33266"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43066.1"
FT                   /translation="MPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATRAENRAAAA
FT                   QLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERL
FT                   PKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQV
FT                   DKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTV
FT                   CEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATING
FT                   TGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDL
FT                   TCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTL
FT                   ILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQD
FT                   RAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDPNDDPPPF"
FT   gene            complement(401873..403162)
FT                   /gene="aspC"
FT                   /locus_tag="Rv0337c"
FT   CDS_pept        complement(401873..403162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="Rv0337c"
FT                   /product="Probable aspartate aminotransferase AspC
FT                   (transaminase A) (ASPAT)"
FT                   /note="Rv0337c, (MTCY279.04c), len: 429 aa. Probable
FT                   aspC,aspartate aminotransferase (transaminase A),
FT                   equivalent to CAC32019.1|AL583925 probable aspartate
FT                   aminotransferase from Mycobacterium leprae (437 aa). Also
FT                   highly similar to many e.g. Q48143|U32823 aspartate
FT                   aminotransferase (404 aa), FASTA scores: opt: 1646, E(): 0,
FT                   (57.2% identity in 404 aa overlap). Also some similarity to
FT                   Rv3565|MTCY06G11.12 from Mycobacterium tuberculosis FASTA
FT                   score: (27.2% identity in 383 aa overlap). Belongs to
FT                   class-I of pyridoxal-phosphate-dependent aminotransferases.
FT                   Cofactor: pyridoxal phosphate."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0337c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43067"
FT                   /db_xref="GOA:P9WQ91"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ91"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43067.1"
FT                   /translation="MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPV
FT                   HQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRA
FT                   VVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSL
FT                   AGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLA
FT                   RKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITG
FT                   PKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWT
FT                   KLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAP
FT                   DHLRLVTLPWSRDLAAAIERLGNFLVSYRQ"
FT   gene            complement(403193..405841)
FT                   /locus_tag="Rv0338c"
FT   CDS_pept        complement(403193..405841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0338c"
FT                   /product="Probable iron-sulfur-binding reductase"
FT                   /note="Rv0338c, (MTCY279.05c), len: 882 aa. Probable
FT                   iron-sulphur-binding reductase, possibly
FT                   membrane-bound,equivalent to CAC32018.1|AL583925 probable
FT                   iron-sulphur-binding reductase from Mycobacterium leprae
FT                   (880 aa). Also highly similar to others e.g.
FT                   T36608|5019323|CAB44376.1|AL078610 probable
FT                   iron-sulfur-binding reductase from Streptomyces coelicolor
FT                   (760 aa), FASTA scores: opt: 1658, E(): 0, (49.9% identity
FT                   in 772 aa overlap); BAB07521.1|AP001520
FT                   iron-sulphur-binding reductase from Bacillus halodurans
FT                   (700 aa). Contains PS00070 Aldehyde dehydrogenases cysteine
FT                   active site and two of PS00198 4Fe-4S
FT                   ferredoxins,iron-sulfur binding region signature. First of
FT                   several possible start sites chosen."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0338c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43068"
FT                   /db_xref="GOA:O33268"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:O33268"
FT                   /inference="protein motif:PROSITE:PS00070"
FT                   /inference="protein motif:PROSITE:PS00198"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43068.1"
FT                   /translation="MTTQTLIRLILGMSMTAVVGVFALRRVWWLYKLVMSGQPASGRTD
FT                   NLGTRIWTQISEVLGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFEERFHIPV
FT                   IGRWDALGFLQDFFATAVFLGITTFAIIRILRNPREIGRSSRFYGSHNGGAWLVLLMIF
FT                   NVIWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRPLGQPANEIIETTALLLHIGVML
FT                   AFLILVLHSKHLHIFLAPINVTFKRLPDGLGPLLPLEADGKPIDFENPSEDAVFGRGKI
FT                   EDFTWKGMLDFATCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGQKDA
FT                   SAGGEAGHQEHHHVPESGFGRVPGHGPEQATRPLVGTEEQGGVIDPDVLWSCVTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLETKGNPWGQNASDRTNWIDEV
FT                   DFDVPVYGQDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAELLAVARVKYLVLGAGET
FT                   CNGDSARRSGNEFLFQQLAQQAVETLDGLFEGVETVDRKIVVTCPHCFNTIGKEYRQLG
FT                   ANYTVLHHTQLLNRLVRDKRLVPVTPVSQDITYHDPCYLGRHNKAYEAPRELIGAAGAS
FT                   LTEMPRHADRSFCCGAGGARMWMEEHIGKRINHERVDEALATDATAIATACPFCRVMVT
FT                   DGVNDRQEEAGRSGVEVLDVAQVLLGSLDHDKAQLPAKGTAAKQAQERAPKAAPKAAAP
FT                   VTPVEAPAEAPQAPAPAAPAAPVKGLGMAAGAKRPGAKKAAPTPAAPAAPAAPVKGLGI
FT                   AAGAKRPGAKKTPPPAPGLAEPAAQPQPEAKPQPEPAAPPKPQTDGDPAAPAAPVKGLG
FT                   IARGARPPGKR"
FT   gene            complement(405950..408448)
FT                   /locus_tag="Rv0339c"
FT   CDS_pept        complement(405950..408448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0339c"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0339c, (MTCY279.06c), len: 832 aa. Possible
FT                   transcriptional regulator, showing very weak similarity
FT                   with parts of others. Contains PS00017 ATP/GTP-binding site
FT                   motif A (P-loop); and probable helix-turn helix motif from
FT                   aa 778-799 (Score 1041, +2.73 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0339c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43069"
FT                   /db_xref="GOA:O33269"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:O33269"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /protein_id="CCP43069.1"
FT                   /translation="MQHRGCKNRGQAYDASVTDSLTEVPPAARRALLELANAPTVPVKV
FT                   LITGGIGTGKTTVLAAARDTLRRSGLTVLACPPPDGEPPETALVIDDAQLLTDTELLRL
FT                   TERVADSRLTVVAAAEAREHHRALRALTMALERDRPRISLGPLPVAEHLRDCTAGLPFL
FT                   IHAVSARAQAPAQAAKVALIERLRRLDEPTLDTLLMMSLTHELGVSDVAAALGISVTDA
FT                   RGLVDRAHASGLIESSHTAAFLQSVHDAIAQIVGNAHHHEVETSLLRSQLDISPVSAEL
FT                   ALRLAEHGLRDERLADILTRYAADTRDASVRCARLYRAAVHAGAKGLTVRLADALARTG
FT                   DCTAAATLADDLLSSPDATERAAAVRVAASVAVHDGNTGHAAELFGWLGPHPDTMVSSA
FT                   ATIVFAANGDLATARATLRLKDAGPPTMAARCARNLAEGLLLTMDQPYPVAMAKLGQAI
FT                   ATEQSLSQVIPDSPAALVTLAAIHAGDPVRARSVIGRAVRAGADPLFQRRHLLLSGWIK
FT                   MQEGQLPSASADVAAASAGTHLHRRDALWAAALQTAISRRTGDIGALQQHWYAAMEALA
FT                   EYSLDLFALLPLGELWVAAARMRQVDQLQHTLDQALTLLDSLGNPALWSNSLHWAGVHA
FT                   GILANSPESVAPHGQALGAMVAHSTLAQALSDAGRTWLRVLAENVDADEVTAAARSLSH
FT                   VGLTSDATRLAGQAALQTSDARVSGAMLQLARDLKLGNDFGEPPSGAGDTEPASGTPPA
FT                   PRQPPAGSPLSDREREVAELLLLGMPYRDIGARLFISAKTVEHHVARIRQRLGAGSRSE
FT                   MLSMLRAMLAPESLTADERR"
FT   gene            408634..409173
FT                   /locus_tag="Rv0340"
FT   CDS_pept        408634..409173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0340"
FT                   /product="Conserved protein"
FT                   /note="Rv0340, (MTCY279.07), len: 179 aa. Conserved
FT                   protein; MEME-mast analysis shows similarity to product of
FT                   downstream gene, Rv0341|iniB."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0340"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43070"
FT                   /db_xref="GOA:O33270"
FT                   /db_xref="UniProtKB/TrEMBL:O33270"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43070.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
FT   gene            409362..410801
FT                   /gene="iniB"
FT                   /locus_tag="Rv0341"
FT   CDS_pept        409362..410801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniB"
FT                   /locus_tag="Rv0341"
FT                   /product="Isoniazid inductible gene protein IniB"
FT                   /note="Rv0341, (MTCY13E10.01), len: 479 aa.
FT                   IniB,isoniazid-inducible gene, (see citations below).
FT                   Protein very Gly-, Ala-rich, similar to cell wall proteins
FT                   e.g. P27483|GRP_ARATH glycine-rich cell wall structural
FT                   protein from A.thaliana (338 aa), FASTA scores: opt: 532,
FT                   E(): 5.2e-13, (39.3% identity in 321 aa overlap). MEME-mast
FT                   analysis shows similarity to product of upstream
FT                   gene,Rv0340."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0341"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ97"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43071.1"
FT                   /translation="MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSV
FT                   AANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLA
FT                   SGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLG
FT                   AQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGA
FT                   GVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGA
FT                   AMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGG
FT                   VGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGM
FT                   NPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPV
FT                   THTPPAPIELPSYGLFGLPGF"
FT   gene            410838..412760
FT                   /gene="iniA"
FT                   /locus_tag="Rv0342"
FT   CDS_pept        410838..412760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="Rv0342"
FT                   /product="Isoniazid inductible gene protein IniA"
FT                   /note="Rv0342, iniA, (MTCY13E10.02), len: 640 aa.
FT                   IniA,isoniazid-inducible gene, (see citations below). Shows
FT                   slight similarity to some hypothetical bacterial proteins
FT                   e.g. P40983|YOR6_THER hypothetical protein (402 aa), FASTA
FT                   scores: opt: 242, E(): 1.4e-07, (22.3% identity in 349 aa
FT                   overlap). Also some similarity to downstream ORF
FT                   Rv0343|iniC. Possible transmembrane stretch around residue
FT                   490. Alternative start site exists at 410824. Contains a
FT                   phosphopantetheine attachment site motif suggestive of an
FT                   acyl carrier protein. Note that the iniA gene is also
FT                   induced by the antibiotic ethambutol, an agent that
FT                   inhibits cell wall biosynthesis by a mechanism that is
FT                   distinct from isoniazid."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0342"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43072"
FT                   /db_xref="GOA:P9WJ99"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ99"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43072.1"
FT                   /translation="MVPAGLCAYRDLRRKRARKWGDTVTQPDDPRRVGVIVELIDHTIA
FT                   IAKLNERGDLVQRLTRARQRITDPQVRVVIAGLLKQGKSQLLNSLLNLPAARVGDDEAT
FT                   VVITVVSYSAQPSARLVLAAGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAP
FT                   SPLLRGGLAFIDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAH
FT                   QICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAVTLNDKELN
FT                   EESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVSLGSELSVVNDPNLRDRL
FT                   ASDLERRKREAQQAVQQTALWQQVLGDGFNDLTADVDHDLRTRFRTVTEDAERQIDSCD
FT                   PTAHWAEIGNDVENAIATAVGDNFVWAYQRSEALADDVARSFADAGLDSVLSAELSPHV
FT                   MGTDFGRLKALGRMESKPLRRGHKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAG
FT                   LILGRMAYKEDKQNRLLRVRSEAKANVRRFVDDISFVVSKQSRDRLKMIQRLLRDHYRE
FT                   IAEEITRSLTESLQATIAAAQVAETERDNRIRELQRQLGILSQVNDNLAGLEPTLTPRA
FT                   SLGRA"
FT   gene            412757..414238
FT                   /gene="iniC"
FT                   /locus_tag="Rv0343"
FT   CDS_pept        412757..414238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniC"
FT                   /locus_tag="Rv0343"
FT                   /product="Isoniazid inductible gene protein IniC"
FT                   /note="Rv0343, (MTCY13E10.03), len: 493 aa.
FT                   IniC,isoniazid-inducible gene, (see citations below). Shows
FT                   slight similarity to P40983|YOR6_THER8 hypothetical protein
FT                   (402 aa), FASTA scores: opt: 196, E(): 2.6e-05, (25.9%
FT                   identity in 228 aa overlap). Also some similarity to
FT                   upstream ORF Rv0342|iniA. Contains (PS00017)
FT                   ATP/GTP-binding site motif A (P-loop). Note that the iniA
FT                   gene is also induced by the antibiotic ethambutol, an agent
FT                   that inhibits cell wall biosynthesis by a mechanism that is
FT                   distinct from isoniazid."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0343"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43073"
FT                   /db_xref="GOA:P9WJ95"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJ95"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43073.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
FT   gene            complement(414381..414941)
FT                   /gene="lpqJ"
FT                   /locus_tag="Rv0344c"
FT   CDS_pept        complement(414381..414941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqJ"
FT                   /locus_tag="Rv0344c"
FT                   /product="Probable lipoprotein LpqJ"
FT                   /note="Rv0344c, (MTCY13E10.04c), len: 186 aa. Probable
FT                   lipoprotein, without homology. Has an appropriately
FT                   positioned prokaryotic lipoprotein signature (PS00013)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0344c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43074"
FT                   /db_xref="UniProtKB/TrEMBL:O06295"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /protein_id="CCP43074.1"
FT                   /translation="MRLSLIARGMAALLAATALVAGCNTTIDGRPVASPGSGPTEPTFP
FT                   TPRPTTAPPGTTAPTLPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINRDSVG
FT                   CEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYRTYEAQGWTIDATTD
FT                   GTRFTNNRTGHGMFVSIEKVDTF"
FT   gene            415050..415460
FT                   /locus_tag="Rv0345"
FT   CDS_pept        415050..415460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0345"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0345, (MTCY13E10.05), len: 136 aa. Conserved
FT                   hypothetical protein, similar to other hypothetical
FT                   proteins e.g. AL13282 4|SCAH10_9 hypothetical protein from
FT                   Streptomyces coelicolor (207 aa), FASTA scores: opt:
FT                   188,E(): 1.5e-05, (41.0% identity in 117 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0345"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43075"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:O06296"
FT                   /protein_id="CCP43075.1"
FT                   /translation="MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDV
FT                   ILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAK
FT                   VVARVLGRALVSRSGLAGRGRIPAHSARRRGC"
FT   gene            complement(415502..416965)
FT                   /gene="ansP2"
FT                   /gene_synonym="aroP2"
FT                   /locus_tag="Rv0346c"
FT   CDS_pept        complement(415502..416965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansP2"
FT                   /gene_synonym="aroP2"
FT                   /locus_tag="Rv0346c"
FT                   /product="Possible L-asparagine permease AnsP2
FT                   (L-asparagine transport protein)"
FT                   /note="Rv0346c, (MTCY13E10.06c), len: 487 aa. Possible
FT                   ansP2, L-asparagine permease, integral membrane protein
FT                   belonging to family containing many amino acid
FT                   permeases,highly similar to
FT                   G467030|B2126_F2_85|NP_301937.1|NC_002677 probable
FT                   L-asparagine permease from Mycobacterium leprae (498 aa);
FT                   and NP_301938.1|NC_002677 probable L-asparagine permease
FT                   from Mycobacterium leprae (505 aa). Also highly similar to
FT                   others e.g. P77610|ANSP_ECOLI L-asparagine permease from
FT                   Escherichia coli strain K-12 (499 aa). Also highly similar
FT                   to ANSP1|Rv2127|MT2186|MTCY261_22|O33261 probable
FT                   L-asparagine permease from Mycobacterium tuberculosis (489
FT                   aa), FASTA score: (72.1% identity in 473 aa overlap). And
FT                   shows some similarity to MTCY3G12.14 from Mycobacterium
FT                   tuberculosis. Belongs to the amino acid permease family
FT                   (APC family). Note that previously known as aroP2."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0346c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43076"
FT                   /db_xref="GOA:P9WQM7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQM7"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43076.1"
FT                   /translation="MPPLDITDERLTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAG
FT                   GRLASAGPGLFLVYGICGIFVFLILRALGELVLHRPSSGSFVSYAREFYGEKVAFVAGW
FT                   MYFLNWAMTGIVDTTAIAHYCHYWRAFQPIPQWTLALIALLVVLSMNLISVRLFGELEF
FT                   WASLIKVIALVTFLIVGTVFLAGRYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVV
FT                   FAYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVS
FT                   PFVTFFSKIGIDAAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSK
FT                   TGVPYGGILLTAGIGLLGIILNAIKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMA
FT                   NAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMYFDEQHGPWMIAATVIGVPALIGGWY
FT                   LVRNRVTAVAHHAIDHTKSVAVVHSADPI"
FT   gene            417304..418290
FT                   /locus_tag="Rv0347"
FT   CDS_pept        417304..418290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0347"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0347, (MTCY13E10.07), len: 328 aa (alternative
FT                   start possible). Probable conserved membrane
FT                   protein,similar to Rv0831c|AL022004|MTV043_23 from
FT                   Mycobacterium tuberculosis (271 aa), FASTA scores: E():
FT                   9.6e-21, (33.1% identity in 266 aa overlap). This region is
FT                   a possible MT-complex-specific genomic island (See Becq et
FT                   al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0347"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43077"
FT                   /db_xref="GOA:O06298"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:O06298"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43077.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
FT   gene            418293..418946
FT                   /locus_tag="Rv0348"
FT   CDS_pept        418293..418946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0348"
FT                   /product="Possible transcriptional regulatory protein"
FT                   /note="Rv0348, (MTCY13E10.08), len: 217 aa. Possible
FT                   transcriptional regulator, showing some similarity to
FT                   O53334|RV3188|MTV014.32 conserved hypothetical protein from
FT                   Mycobacterium tuberculosis (115 aa), FASTA score: (30.0%
FT                   identity in 100 aa overlap). Contains probable helix-turn
FT                   helix motif from aa 89-110 (Score 1407, +3.98 SD). This
FT                   region is a possible MT-complex-specific genomic island
FT                   (See Becq et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0348"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43078"
FT                   /db_xref="UniProtKB/TrEMBL:O06299"
FT                   /protein_id="CCP43078.1"
FT                   /translation="MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQ
FT                   FTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPA
FT                   ITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERG
FT                   RYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR"
FT   gene            418949..419608
FT                   /locus_tag="Rv0349"
FT   CDS_pept        418949..419608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0349"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0349, (MTCY13E10.09), len: 219 aa. Hypothetical
FT                   unknown protein. This region is a possible
FT                   MT-complex-specific genomic island (See Becq et al.,2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0349"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43079"
FT                   /db_xref="UniProtKB/TrEMBL:O06300"
FT                   /protein_id="CCP43079.1"
FT                   /translation="MPELETPDDPESIYLARLEDVGEHRPTFTGDIYRLGDGRMVMILQ
FT                   HPCALRHGVDLHPRLLVAPVRPDSLRSNWARAPFGTMPLPKLIDGQDHSADFINLELID
FT                   SPTLPTCERIAVLSQSGVNLVMQRWVYHSTRLAVPTHTYSDSTVGPFDEADLIEEWVTD
FT                   RVDDGADPQAAEHECASWLDERISGRTRRALLSDRQHASSIRREARSHRKSVKLAD"
FT   gene            419835..421712
FT                   /gene="dnaK"
FT                   /gene_synonym="hsp70"
FT                   /locus_tag="Rv0350"
FT   CDS_pept        419835..421712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /gene_synonym="hsp70"
FT                   /locus_tag="Rv0350"
FT                   /product="Probable chaperone protein DnaK (heat shock
FT                   protein 70) (heat shock 70 kDa protein) (HSP70)"
FT                   /note="Rv0350, (MTCY13E10.10), len: 625 aa. Probable dnaK
FT                   (alternate gene name: hsp70), 70 kDa heat shock protein
FT                   (see citations below), equivalent to
FT                   AAA25362.1|M95576|1924344A|738248 heat shock protein 70
FT                   from Mycobacterium leprae (621 aa); and DNAK_MYCPA|Q00488
FT                   (623 aa), FASTA scores: opt: 3678, E(): 0, (92.3% identity
FT                   in 625 aa overlap). Also highly similar to others e.g.
FT                   Q05558|DNAK_STRCO|453231|CAA54606.1|X77458 chaperone
FT                   protein DNAK from Streptomyces coelicolor (618 aa). Has
FT                   probably an ATPase activity. Note that this sequence
FT                   differs from DNAK_MYCTU|P32723 (609 aa), due to a
FT                   frameshift near the N-terminus. Belongs to the heat shock
FT                   protein 70 family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0350"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43080"
FT                   /db_xref="GOA:P9WMJ9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMJ9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43080.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLKRDAE
FT                   AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVDWLVDKFKGTSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDISAIKSAMEKLGQESQA
FT                   LGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK"
FT   gene            421709..422416
FT                   /gene="grpE"
FT                   /locus_tag="Rv0351"
FT   CDS_pept        421709..422416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="Rv0351"
FT                   /product="Probable GrpE protein (HSP-70 cofactor)"
FT                   /note="Rv0351, (MTCY13E10.11), len: 235 aa. Probable grpE
FT                   protein (HSP-70 cofactor), equivalent to
FT                   CAC32012.1|AL583925 Hsp70 cofactor from Mycobacterium
FT                   leprae (229 aa). Also highly similar to others eg
FT                   Q05562|GRPE_STRCO|2127521|PN0643 GRPE protein from
FT                   Streptomyces coelicolor (225 aa). Contains grpE protein
FT                   signature (PS01071). Belongs to the GrpE family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0351"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43081"
FT                   /db_xref="GOA:P9WMT5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMT5"
FT                   /inference="protein motif:PROSITE:PS01071"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43081.1"
FT                   /translation="MTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAA
FT                   ADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLER
FT                   ARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPV
FT                   IGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSAD
FT                   TSGEQAESEPSGS"
FT   gene            422452..423639
FT                   /gene="dnaJ1"
FT                   /gene_synonym="dnaJ"
FT                   /locus_tag="Rv0352"
FT   CDS_pept        422452..423639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /gene_synonym="dnaJ"
FT                   /locus_tag="Rv0352"
FT                   /product="Probable chaperone protein DnaJ1"
FT                   /note="Rv0352, (MTCY13E10.12), len: 395 aa. Probable
FT                   dnaJ1,chaperone protein, equivalent to AAA25363.1|M95576
FT                   DNA J heatshock protein from Mycobacterium leprae (389 aa).
FT                   Also highly similar to others. Contains both DnaJ
FT                   signatures (PS00636, and PS00637). Belongs to the DNAJ
FT                   family. Cofactor: binds two zinc ions per monomer. Note
FT                   that sequence differs from DNAJ_MYCTU|P07881 due to a
FT                   frameshift at the N-terminus. Note that previously known as
FT                   dnaJ."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0352"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43082"
FT                   /db_xref="GOA:P9WNV9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNV9"
FT                   /inference="protein motif:PROSITE:PS00636"
FT                   /inference="protein motif:PROSITE:PS00637"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43082.1"
FT                   /translation="MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGN
FT                   PAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGD
FT                   GAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAK
FT                   GVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGS
FT                   GSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTV
FT                   HVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRG
FT                   RGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR"
FT   gene            423639..424019
FT                   /gene="hspR"
FT                   /locus_tag="Rv0353"
FT   CDS_pept        423639..424019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="Rv0353"
FT                   /product="Probable heat shock protein transcriptional
FT                   repressor HspR (MerR family)"
FT                   /note="Rv0353, (MTCY13E10.13), len: 126 aa. Probable
FT                   hspR,heat shock regulatory protein (see Stewart et al.,
FT                   2001),merR family, highly similar to others e.g.
FT                   HspR|P40183 heat shock regulatory protein from Streptomyces
FT                   coelicolor (151 aa), FASTA scores: E(): 4.9e-22, (55.7%
FT                   identity in 140 aa overlap), that binds to three inverted
FT                   repeats (IR1-IR3) in the promoter region of the dnaK
FT                   operon. Has possible coiled coil region in C-terminal half.
FT                   Belongs to the MerR family of transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0353"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43083"
FT                   /db_xref="GOA:O06302"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:O06302"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43083.1"
FT                   /translation="MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSG
FT                   GGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRA
FT                   NQRREVAVVPKSTALVVWKPRR"
FT   gene            complement(424269..424694)
FT                   /gene="PPE7"
FT                   /locus_tag="Rv0354c"
FT   CDS_pept        complement(424269..424694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE7"
FT                   /locus_tag="Rv0354c"
FT                   /product="PPE family protein PPE7"
FT                   /note="Rv0354c, (MTCY13E10.14c), len: 141 aa. PPE7, Member
FT                   of the Mycobacterium tuberculosis PPE family, similar to
FT                   others e.g. MTCY63_9 from Mycobacterium tuberculosis (2411
FT                   aa), FASTA scores: E(): 3.6e-11, (47.6% identity in 103 aa
FT                   overlap). Possible continuation of ORF upstream, but no
FT                   sequence error apparent."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0354c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43084"
FT                   /db_xref="UniProtKB/TrEMBL:L0T545"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43084.1"
FT                   /translation="MSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQPID
FT                   TAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAAAA
FT                   VSGLGNVFTETSGFFNAGGVGIRASKTSATCCRAGRT"
FT   gene            complement(424777..434679)
FT                   /gene="PPE8"
FT                   /locus_tag="Rv0355c"
FT   CDS_pept        complement(424777..434679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE8"
FT                   /locus_tag="Rv0355c"
FT                   /product="PPE family protein PPE8"
FT                   /note="Rv0355c, (MTCY13E10.15c,
FT                   MTCY13E10.16c,MTCY13E10.17c), len: 3300 aa. PPE8, Member of
FT                   the Mycobacterium tuberculosis PPE family, similar to
FT                   others e.g. AL009198|MTV004_5 from Mycobacterium
FT                   tuberculosis (3716 aa), FASTA scores: opt: 2906, E(): 0,
FT                   (40.9% identity in 3833 aa overlap); MTV004_3 FASTA scores:
FT                   (39.0% identity in 3531 aa overlap); etc. Gene contains
FT                   large number of clustered Major Polymorphic Tandem Repeats
FT                   (MPTR). Related to MTCY13E10.16c, E(): 0; MTCY13E10.17c,
FT                   E(): 0; MTCY48.17,E(): 0; MTCY98.0034c, E(): 0; MTCY03C7.23
FT                   E(): 0; MTCY98.0031c, E(): 0; MTCY31.06c, E(): 5.6e-17;
FT                   MTCY359.33,E(): 2.3e-16. Nucleotide position 426909 in the
FT                   genome sequence has been corrected, A:C resulting in
FT                   W2591G."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0355c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43085"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y7L4"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43085.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGSANLGNSNVGFGN
FT                   IGNANIGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGN
FT                   NNIGIGLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFN
FT                   TGNNNVGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVG
FT                   IGNMGTGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTG
FT                   NTGIGNSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGS
FT                   YNTGMANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIP
FT                   ITGDITNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDF
FT                   GPSPAINLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGA
FT                   GSASGLLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANV
FT                   SGLLNIGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSAN
FT                   IGDFNLGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGNTGT
FT                   GNIGFGNTGNGNIGIGLTGDTMTGFGGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGN
FT                   SGDYNTGIGNTGSTNSGFFNTGLVNTGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGF
FT                   NPGNYNTGYFNPGNSNTGIANSGDVNTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSE
FT                   IPWSYDRFQH"
FT   gene            complement(434830..435474)
FT                   /locus_tag="Rv0356c"
FT   CDS_pept        complement(434830..435474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0356c"
FT                   /product="Conserved protein"
FT                   /note="Rv0356c, (MTCY13E10.18c), len: 214 aa. Conserved
FT                   protein, equivalent to AL023514|MLCB4_12 conserved
FT                   hypothetical protein from Mycobacterium leprae (218
FT                   aa),FASTA scores: opt: 1067, E(): 0, (73.4% identity in 214
FT                   aa overlap). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0356c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43086"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:O06307"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43086.1"
FT                   /translation="MTDASVHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQD
FT                   LAVAADPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTR
FT                   YGTDGVEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRR
FT                   ITPIDVPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
FT   gene            complement(435471..436769)
FT                   /gene="purA"
FT                   /locus_tag="Rv0357c"
FT   CDS_pept        complement(435471..436769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Rv0357c"
FT                   /product="Probable adenylosuccinate synthetase PurA
FT                   (imp--aspartate ligase) (ADSS) (ampsase)"
FT                   /note="Rv0357c, (MTCY13E10.19c), len: 432 aa. Probable
FT                   purA, adenylosuccinate synthase, equivalent to
FT                   AL023514|MLCB4_13 from adenylosuccinate synthetase
FT                   Mycobacterium leprae (432 aa), FASTA scores: opt: 2555,E():
FT                   0, (87.9% identity in 431 aa overlap). Also highly similar
FT                   to many bacterial adenylosuccinates synthetases e.g.
FT                   P12283|PURA_ECOLI adenylosuccinates synthetase from
FT                   Escherichia coli (431 aa), FASTA scores: E(): 0, (51.1%
FT                   identity in 425 aa overlap); etc. Belongs to the
FT                   adenylosuccinate synthetase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0357c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43087"
FT                   /db_xref="GOA:P9WHN3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHN3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43087.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGVLTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAH
FT                   LLMPYHIAIDKVTERYMGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEA
FT                   ACEFKNQVLVKIYNRKALDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGEYLSKTGREFGVTTGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLES
FT                   VPVCVGYEIDGRRTRDMPMTQRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEQLAGAPVSCIGVGPGREQTIVRRDVLQDRP"
FT   gene            436860..437507
FT                   /locus_tag="Rv0358"
FT   CDS_pept        436860..437507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0358"
FT                   /product="Conserved protein"
FT                   /note="Rv0358, (MTCY13E10.20), len: 215 aa. Conserved
FT                   protein, highly similar to ML0281|AL023514|MLCB4_14
FT                   conserved hypothetical protein from Mycobacterium leprae
FT                   (229 aa), FASTA scores: opt: 852, E(): 0, (62.9% identity
FT                   in 229 aa overlap). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0358"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43088"
FT                   /db_xref="UniProtKB/TrEMBL:O06308"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43088.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
FT   gene            437518..438297
FT                   /locus_tag="Rv0359"
FT   CDS_pept        437518..438297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0359"
FT                   /product="Probable conserved integral membrane protein"
FT                   /note="Rv0359, (MTCY13E10.21), len: 259 aa. Probable
FT                   conserved integral membrane protein, highly similar to
FT                   hypothetical or other membrane proteins e.g.
FT                   AL133220|SCC75A_6|T50569 probable membrane protein from
FT                   Streptomyces coelicolor (265 aa), FASTA scores: opt:
FT                   642,E(): 0, (43.1% identity in 248 aa overlap); P70995
FT                   hypothetical 24.7 kDa protein from Bacillus subtilis (219
FT                   aa), FASTA scores: E(): 1.5e-12, (31.3% identity in 192 aa
FT                   overlap). Contains neutral zinc
FT                   metallopeptidases,zinc-binding region signature (PS00142)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0359"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43089"
FT                   /db_xref="GOA:L0T550"
FT                   /db_xref="UniProtKB/Swiss-Prot:L0T550"
FT                   /inference="protein motif:PROSITE:PS00142"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43089.1"
FT                   /translation="MSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGV
FT                   FVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIA
FT                   LGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAG
FT                   VAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPT
FT                   LNGWFFGVVYWLFDLSGVSHRLAAAGSVLARFWSIWF"
FT   gene            complement(438302..438739)
FT                   /locus_tag="Rv0360c"
FT   CDS_pept        complement(438302..438739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0360c"
FT                   /product="Conserved protein"
FT                   /note="Rv0360c, (MTCY13E10.22c), len: 145 aa. Conserved
FT                   protein, equivalent to
FT                   AL023514|MLCB4_16|CAA18948.1|AL023514|MLCB4.27c
FT                   hypothetical protein from Mycobacterium leprae (137
FT                   aa),FASTA scores: opt: 793, E(): 0, (85.4% identity in 137
FT                   aa overlap). And similar to AL049754|SCH10_25c|T36537
FT                   hypothetical protein from Streptomyces coelicolor (143
FT                   aa),FASTA scores: opt: 497, E(): 3.2e-27, (55.8% identity
FT                   in 138 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0360c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43090"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:O06310"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43090.1"
FT                   /translation="MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAA
FT                   HPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRG
FT                   FLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL"
FT   gene            438822..439649
FT                   /locus_tag="Rv0361"
FT   CDS_pept        438822..439649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0361"
FT                   /product="Probable conserved membrane protein"
FT                   /note="Rv0361, (MTCY13E10.23), len: 275 aa. Probable
FT                   conserved membrane protein (has hydrophobic stretch from
FT                   residues 132-156), equivalent to
FT                   AL023514|MLCB4_17|AA18949.1|AL023514 putative membrane
FT                   protein from Mycobacterium leprae (292 aa), FASTA scores:
FT                   opt: 1044, E(): 0, (58.6% identity in 292 aa overlap). A
FT                   core mycobacterial gene; conserved in mycobacterial strains
FT                   (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0361"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43091"
FT                   /db_xref="GOA:O06311"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:O06311"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43091.1"
FT                   /translation="MSNAPEPDRSAGESGSEPAGERSADPGEERTESYPLVPHDAETET
FT                   VVITTSDNDAAVTQPEAQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTTPPRM
FT                   PTGMPPKTAVPQSIPPRTEATSVRQRTWGWALAVVVIVLALAAIAILGTVLLTRGKHSK
FT                   MSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDGYVDYDERDWAETYRRVSAAKQY
FT                   PVIASIDQVVVNGAHAEANVTTFMAFDPQVRSTRSLDLQFRDDQWKICQSSSN"
FT   gene            439871..441253
FT                   /gene="mgtE"
FT                   /locus_tag="Rv0362"
FT   CDS_pept        439871..441253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="Rv0362"
FT                   /product="Possible Mg2+ transport transmembrane protein
FT                   MgtE"
FT                   /note="Rv0362, (MTCY13E10.24), len: 460 aa. Possible
FT                   mgtE,magnesium (Mg2+) transport transmembrane protein;
FT                   C-terminal region is highly similar to MGTE|G780283
FT                   putative Mg2+ transporter from Providencia stuarti (314
FT                   aa), FASTA scores: E(): 0, (47.2% identity in 307 aa
FT                   overlap) (N-terminus extends approx. 150 aa further
FT                   upstream compared to P. stuarti ORF). Also similar in part
FT                   to others e.g. AAK20879.1|AF334760_1|AF334760 putative Mg2+
FT                   transporter from Aeromonas hydrophila (455 aa);
FT                   NP_231292.1|NC_002505 magnesium transporter from Vibrio
FT                   cholerae (451 aa); NP_102305.1|NC_002678 Mg2+ transport
FT                   protein from Mesorhizobium loti (454 aa); etc. Also similar
FT                   to Rv1232c|MTV006.04c from Mycobacterium tuberculosis (435
FT                   aa). Extended hydrophobic segment spanning last 130
FT                   residues. Belongs to the MgtE family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0362"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43092"
FT                   /db_xref="GOA:O06312"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:O06312"
FT                   /protein_id="CCP43092.1"
FT                   /translation="MSIRPAENSTLDIRHVIGIGTPKAVDLWLDVVTELPDRARELGSL
FT                   SKAELGKLGPLLDGTNAVELFESIDDKLAAEALHAMDPSLAATFLEALDSDHAANILRE
FT                   FKEPKREALLTLLPLERAMVLRGLLSWPEDCAAAHMVPETLTVRPNMTVSQAVASVRER
FT                   ASGLRSDARTTAYVYVTDADSHLLGVIAFRALVLANPEQRVRELMGDDLIVVSPLTDKE
FT                   LAAQTIMGHNLMAVPVVDADNRLLGIIAEDEAIDIAEEEATEDAERQGGSAPLEVPYLR
FT                   ASPWLLWRKRVVWLLVLFAAEAYTGSVLRAFSDEMEAVIALAFFIPLLIGTGGNTGTQI
FT                   ATTLVRAMATGQVRFRDVPAVLAKELSTGVLVGLTMAAAAVVRAWTLGVGPQVTLTVAL
FT                   TVAAIVVWSSLVAAVLPPLLKKLRIDPAIVSGPMIATIVDGTGLLIYFLVAHLTLTELH
FT                   GL"
FT   gene            complement(441265..442299)
FT                   /gene="fba"
FT                   /gene_synonym="fda"
FT                   /locus_tag="Rv0363c"
FT   CDS_pept        complement(441265..442299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /gene_synonym="fda"
FT                   /locus_tag="Rv0363c"
FT                   /product="Probable fructose-bisphosphate aldolase Fba"
FT                   /note="Rv0363c, (MTCY13E10.25c), len: 344 aa. Probable fba
FT                   (alternate gene name: fda), fructose bisphosphate aldolase
FT                   , equivalent to AL023514|MLCB4_18|O69600|ALF_MYCLE
FT                   fructose-bisphosphate aldolase from Mycobacterium leprae
FT                   (345 aa), FASTA scores: opt: 1995, E(): 0, (87.7% identity
FT                   in 342 aa overlap). Also highly similar to others. Belongs
FT                   to class II fructose-bisphosphate aldolase family.
FT                   Cofactor: zinc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0363c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43093"
FT                   /db_xref="GOA:P9WQA3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:3EKL"
FT                   /db_xref="PDB:3EKZ"
FT                   /db_xref="PDB:3ELF"
FT                   /db_xref="PDB:4A21"
FT                   /db_xref="PDB:4A22"
FT                   /db_xref="PDB:4DEF"
FT                   /db_xref="PDB:4DEL"
FT                   /db_xref="PDB:4LV4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQA3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43093.1"
FT                   /translation="MPIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDS
FT                   YVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIG
FT                   VVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKL
FT                   RPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQY
FT                   AFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGK
FT                   SLTH"
FT   gene            442395..443078
FT                   /locus_tag="Rv0364"
FT   CDS_pept        442395..443078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0364"
FT                   /product="Possible conserved transmembrane protein"
FT                   /note="Rv0364, (MTCY13E10.26), len: 227 aa. Possible
FT                   conserved transmembrane protein, equivalent to
FT                   O69601|Y364_MYCLE|ML0287|CAA18951.1|AL023514|AL023514|MLCB
FT                   4_19 hypothetical 24.3 KDA protein from Mycobacterium
FT                   leprae (222 aa), FASTA scores: opt: 1027, E(): 0, (66.1%
FT                   identity in 227 aa overlap). Shows strong similarity to
FT                   DEDA_ECOLI|P09548 DedA protein protein from Escherichia
FT                   coli FASTA scores: E(): 1.3e-28, (39.5% identity in 195 aa
FT                   overlap). Similar also to Mycobacterium tuberculosis DedA
FT                   protein Rv2637|MTCY441.0."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0364"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43094"
FT                   /db_xref="GOA:P9WP09"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WP09"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43094.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
FT   gene            complement(443067..444197)
FT                   /locus_tag="Rv0365c"
FT   CDS_pept        complement(443067..444197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0365c"
FT                   /product="Conserved protein"
FT                   /note="Rv0365c, (MTCY13E10.27c), len: 376 aa (start
FT                   uncertain). Conserved protein (see citation below), very
FT                   similar to G388212|CAA35191.1, a truncated ORF immediately
FT                   upstream of the Corynebacterium glutamicum fda gene
FT                   encoding fructose-1,6-biphosphate aldolase (304 aa), FASTA
FT                   scores: E(): 7.1e-19, (42.2% identity in 296 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0365c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43095"
FT                   /db_xref="GOA:O06315"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:O06315"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43095.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
FT   gene            complement(444222..444815)
FT                   /locus_tag="Rv0366c"
FT   CDS_pept        complement(444222..444815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0366c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0366c, (MTV036.01c), len: 197 aa. Conserved
FT                   hypothetical protein, showing weak similarity to
FT                   HI1395|P44173|YD95_HAEIN hypothetical protein from
FT                   Haemophilus influenzae (140 aa), FASTA scores: opt:
FT                   152,E(): 0.0015, (27.0% identity in 126 aa overlap).
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   PS00850 Glycine radical signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0366c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43096"
FT                   /db_xref="GOA:O53701"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O53701"
FT                   /inference="protein motif:PROSITE:PS00850"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43096.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDNSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
FT   gene            complement(444844..445233)
FT                   /locus_tag="Rv0367c"
FT   CDS_pept        complement(444844..445233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0367c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0367c, (MTV036.02c), len: 129 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0367c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43097"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:O53702"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43097.1"
FT                   /translation="MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVS
FT                   NQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITT
FT                   VALNDAGDIVEHRPDGTSVVLAATP"
FT   gene            complement(445314..446525)
FT                   /locus_tag="Rv0368c"
FT   CDS_pept        complement(445314..446525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0368c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0368c, (MTV036.03c), len: 403 aa. Conserved
FT                   hypothetical protein, showing some similarity to
FT                   AJ224684|BJAJ4684_4 cooxS protein from Bradyrhizobium
FT                   japonicum (422 aa), FASTA scores: opt: 341, E():
FT                   4.3e-13,(27.4% identity in 387 aa overlap);
FT                   Rv2425c|MTCY428_22 hypothetical protein from Mycobacterium
FT                   tuberculosis FASTA score: (30.7% identity in 238 aa
FT                   overlap). Contains PS00213 Lipocalin signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0368c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43098"
FT                   /db_xref="GOA:O53703"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:O53703"
FT                   /inference="protein motif:PROSITE:PS00213"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43098.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLRLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
FT   gene            complement(446531..447046)
FT                   /locus_tag="Rv0369c"
FT   CDS_pept        complement(446531..447046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0369c"
FT                   /product="Possible membrane oxidoreductase"
FT                   /note="Rv0369c, (MTV036.04c), len: 171 aa. Possible
FT                   membrane protein oxidoreductase, similar to ORF 4 of the
FT                   Pseudomonas thermocarboxydovorans protein of cutA-cutB-cutC
FT                   gene cluster: X77931|PTC2CUTAC_4 ORF4 from Pseudomonas
FT                   thermocarboxydovorans (171 aa), FASTA scores: opt: 226,E():
FT                   9.8e-08, (31.3% identity in 166 aa overlap). Also similar
FT                   to MTV036.05, MTV036.08, MTV036.09, and MTV026.10."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0369c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43099"
FT                   /db_xref="GOA:O53704"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:O53704"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43099.1"
FT                   /translation="MPGAQLIGHEGDEYLGKVKVKVGPVTSEFSGKVHFVEQDRNQHRA
FT                   VFDAKGKEARGTGNAAATVAAQLHEVGERTRVTVDTDLKIVGKLAQFGSGMLQQVSEKL
FT                   LGQFVDSLEAELAAQSSESPQGTPPATEAAPIDLLQLADGGQLKKYGSALLAALTVLLL
FT                   IWVLRRRR"
FT   gene            complement(447147..448043)
FT                   /locus_tag="Rv0370c"
FT   CDS_pept        complement(447147..448043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0370c"
FT                   /product="Possible oxidoreductase"
FT                   /note="Rv0370c, (MTV036.05c), len: 298 aa. Possible
FT                   oxidoreductase, similar to many hypothetical proteins, but
FT                   also similar to ORF4|X82447|OCCOXMSL4_4 Protein of coxMSL
FT                   gene cluster from Pseudomonas/Oligotropha carboxidovorans
FT                   (295 aa), FASTA scores: opt: 851, E(): 0, (48.2% identity
FT                   in 282 aa overlap); AJ224684|BJAJ4684_3 cooxS from
FT                   Bradyrhizobium japonicum (302 aa), FASTA scores: opt:
FT                   881,E(): 0, (47.6% identity in 290 aa overlap). Also highly
FT                   similar to MTCY428_21 from Mycobacterium tuberculosis.
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0370c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43100"
FT                   /db_xref="GOA:O53705"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:O53705"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /protein_id="CCP43100.1"
FT                   /translation="MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPG
FT                   VGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDIS
FT                   EADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPEL
FT                   GTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPGPDRAAAIVRRTVPGATAPLIE
FT                   NATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDD
FT                   RTQIRDAYQAFTECSHA"
FT   gene            complement(448040..448633)
FT                   /locus_tag="Rv0371c"
FT   CDS_pept        complement(448040..448633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0371c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0371c, (MTV036.06c), len: 197 aa. Conserved
FT                   hypothetical protein, similar to other hypothetical
FT                   proteins e.g. AL132824|SCAH10.09c|CAB60163.1|AL132824
FT                   hypothetical protein from Streptomyces coelicolor (207
FT                   aa),FASTA scores: opt: 247, E(): 4.5e-09, (32.3% identity
FT                   in 195 aa overlap). Also weak similarity with
FT                   YURE|D70017|Z99120|BSUB0017_134 hypothetical protein yurE
FT                   from Bacillus subtilis (197 aa), FASTA scores: opt:
FT                   217,E(): 2.5e-08, (27.0% identity in 174 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0371c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43101"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:I6WY86"
FT                   /protein_id="CCP43101.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
FT   gene            complement(448630..449385)
FT                   /locus_tag="Rv0372c"
FT   CDS_pept        complement(448630..449385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0372c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0372c, (MTV036.07c), len: 251 aa. Conserved
FT                   hypothetical protein, showing some similarity with
FT                   CAB76248.1|X82447|COXF CoxF protein from
FT                   Pseudomonas/Oligotropha carboxidovorans (280 aa);
FT                   AJ224684|BJAJ4684_6 cooxS from Bradyrhizobium japonicum
FT                   (176 aa), FASTA scores: opt: 186, E(): 1.6e-05, (41.1%
FT                   identity in 95 aa overlap). Also similar to upstream ORF
FT                   Rv0376c from Mycobacterium tuberculosis (380 aa), FASTA
FT                   scores: E(): 6.8e-07, (31.0% identity in 277 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0372c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43102"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:O53707"
FT                   /protein_id="CCP43102.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
FT   gene            complement(449404..451803)
FT                   /locus_tag="Rv0373c"
FT   CDS_pept        complement(449404..451803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0373c"
FT                   /product="Probable carbon monoxyde dehydrogenase (large
FT                   chain)"
FT                   /note="Rv0373c, (MTV036.08c), len: 799 aa. Probable carbon
FT                   monoxide dehydrogenase, large chain, highly similar to
FT                   others e.g. AAD00363.1| U80806|CUTL carbon monoxide
FT                   dehydrogenase large subunit CutL protein from
FT                   Hydrogenophaga pseudoflava (803 aa);
FT                   S49124|509391|CAA54902.1|X77931|1094915|2107180C|CUTA
FT                   carbon-monoxide dehydrogenase large chain (cut operon) from
FT                   Pseudomonas thermocarboxydovorans (842 aa);
FT                   C56279|809566|CAA57829.1|X82447|OCCOXMSL4_3|COXL
FT                   carbon-monoxide dehydrogenase large chain (cluster coxMSL)
FT                   from Pseudomonas/Oligotropha carboxydovorans (809 aa),FASTA
FT                   scores: opt: 2484, E(): 0, (56.0% identity in 804 aa
FT                   overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0373c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43103"
FT                   /db_xref="GOA:O53708"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:O53708"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43103.1"
FT                   /translation="MTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDD
FT                   VALPGMLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLANDV
FT                   QAVLATDKTRFQGQEVAFVVAEDRYSARDACELVDVDYEPRDPVVDARTALDPSAPVIR
FT                   TDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEIVYPRVHPAPMETCGAVADLDPV
FT                   TGKLTLWTTSQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVAS
FT                   LLLDKPVKWMEDRSENLTSTGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAA
FT                   PAKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCL
FT                   AFELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMNMIGYEALRAEQKQ
FT                   RRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVLRLSVQTQGQ
FT                   GHETTFAQIVAEELGIAPDDIEVVHGDTDQTPFGLGTYGSRSTPVSGGAAALVARKVRD
FT                   KAKIIASGMLEVSVADLQWEKGKFHVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDA
FT                   EVCYNPSNLTYPYGAYFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVD
FT                   GIGMALMEMIAFDEDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGIGES
FT                   ATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI"
FT   gene            complement(451800..452279)
FT                   /locus_tag="Rv0374c"
FT   CDS_pept        complement(451800..452279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0374c"
FT                   /product="Probable carbon monoxyde dehydrogenase (small
FT                   chain)"
FT                   /note="Rv0374c, (MTV036.09c), len: 159 aa. Probable carbon
FT                   monoxide dehydrogenase, small chain, highly similar to
FT                   others e.g. B56279|5822285|X82447|OCCOXMSL4_2|COXS
FT                   carbon-monoxide dehydrogenase small chain from
FT                   Pseudomonas/Oligotropha carboxydovorans (166 aa), FASTA
FT                   scores: opt: 662, E(): 0, (59.3% identity in 150 aa
FT                   overlap); CAA12063.1|AJ224684 putative carbon monoxide
FT                   dehydrogenase small subunit from Bradyrhizobium japonicum
FT                   (161 aa); S49123|509390|CAA54901.1|X77931|CUTC
FT                   carbon-monoxide dehydrogenase small chain from Pseudomonas
FT                   thermocarboxydovorans (163 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0374c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43104"
FT                   /db_xref="GOA:O53709"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:O53709"
FT                   /protein_id="CCP43104.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
FT   gene            complement(452294..453154)
FT                   /locus_tag="Rv0375c"
FT   CDS_pept        complement(452294..453154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0375c"
FT                   /product="Probable carbon monoxyde dehydrogenase (medium
FT                   chain)"
FT                   /note="Rv0375c, (MTV036.10c), len: 286 aa. Probable carbon
FT                   monoxide dehydrogenase, medium chain, similar to others
FT                   e.g. AAD00361.1|U80806|CUTM carbon monoxide dehydrogenase
FT                   middle subunit from Hydrogenophaga pseudoflava (287 aa);
FT                   S49122|509389|CAA54900.1|X77931|CUTB carbon-monoxide
FT                   dehydrogenase medium chain from Pseudomonas
FT                   thermocarboxydovorans (287 aa);
FT                   A56279|809564|CAA57827.1|X82447|OCCOXMSL4_1|COXM|CODH
FT                   carbon-monoxide dehydrogenase medium chain from
FT                   Pseudomonas/Oligotropha carboxydovorans (288 aa), FASTA
FT                   scores: opt: 594, E(): 0, (37.5% identity in 277 aa
FT                   overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0375c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43105"
FT                   /db_xref="GOA:I6Y7N2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y7N2"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43105.1"
FT                   /translation="MDHAIGLLDRLGEGARVVAGGHSLLPMMKLRIANPEYLVDINDLA
FT                   PELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAERVIADPVVRNRGTL
FT                   GGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPYETALAHNEVLIEVR
FT                   IPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLTAVNPDPVALAELSA
FT                   GLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTVRTLRTAAGRVLGAP
FT                   AAPEA"
FT   gene            complement(453230..454372)
FT                   /locus_tag="Rv0376c"
FT   CDS_pept        complement(453230..454372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0376c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0376c, (MTV036.11c), len: 380 aa. Conserved
FT                   hypothetical protein, highly similar to
FT                   T35481|4008539|CAA22508.1|AL034492|SC6C5.10 hypothetical
FT                   protein from Streptomyces coelicolor (395 aa); and
FT                   AAK64260.1|AF373840_20 ORF377 hypothetical CoxI from
FT                   Arthrobacter nicotinovorans (377 aa). And similar to other
FT                   conserved hypothetical proteins e.g.
FT                   NP_101963.1|14021136|BAB47749.1|AP002994 hypothetical
FT                   protein from Mesorhizobium loti (245 aa). Note that
FT                   C-terminus shows similarity with C-termini of
FT                   CAB76248.1|X82447|COXF CoxF protein from
FT                   Pseudomonas/Oligotropha carboxidovorans (280 aa);
FT                   CAB76250.1|X82447|COXI CoxI protein from
FT                   Pseudomonas/Oligotropha carboxidovorans (330 aa); and
FT                   AJ224684|BJAJ4684_6 cooxS from Bradyrhizobium japonicum
FT                   (176 aa), FASTA scores: E(): 1.9e-17, (47.1% identity in
FT                   138 aa overlap). Also some partial similarity with
FT                   AJ224684|BJAJ4684_5 cooxS from Bradyrhizobium japonicum
FT                   (107 aa), FASTA scores: opt: 321, E(): 4.2e-14, (53.3%
FT                   identity in 92 aa overlap); E1184330|Z99120|YURF YURF
FT                   protein from Bacillus subtilis (330 aa), FASTA scores: opt:
FT                   170, E(): 2.9e- 16, (27.5% identity in 345 aa overlap).
FT                   Also similar to downstream ORF Rv0372c from Mycobacterium
FT                   tuberculosis (251 aa), FASTA scores: E(): 2.1e-06, (30.7%
FT                   identity in 277 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0376c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43106"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:O53711"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43106.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRMLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
FT   gene            454421..455386
FT                   /locus_tag="Rv0377"
FT   CDS_pept        454421..455386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0377"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably LysR-family)"
FT                   /note="Rv0377, (MTV036.12), len: 321 aa. Probable
FT                   transcription regulator, lysR family, showing similarity
FT                   with many hypothetical transcriptional regulators lysR
FT                   homolog e.g. P32484|YEIE_ECOLI|M89774 hypothetical
FT                   transcriptional regulator from Escherichia coli (293
FT                   aa),FASTA scores: opt: 265, E(): 4.9e-11, (28.6% identity
FT                   in 266 aa overlap). Also similar to Rv2282c from
FT                   Mycobacterium tuberculosis. Contains PS00044 bacterial
FT                   regulatory protein lysR family signature. Seems to belong
FT                   to the LysR family of transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0377"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43107"
FT                   /db_xref="GOA:P9WMF7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WMF7"
FT                   /inference="protein motif:PROSITE:PS00044"
FT                   /protein_id="CCP43107.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIPGSGVGVTRFRPKVHVTLWS"
FT   gene            455637..455858
FT                   /locus_tag="Rv0378"
FT   CDS_pept        455637..455858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0378"
FT                   /product="Conserved hypothetical glycine rich protein"
FT                   /note="Rv0378, (MTV036.13), len: 73 aa. Conserved
FT                   hypothetical gly-rich protein, showing some similarity to
FT                   Mycobacterium tuberculosis PE_PGRS family; also similar to
FT                   MTCY06H11_16|Z85982 hypothetical glycine-rich 88.5 KD
FT                   protein (1011 aa), FASTA scores: opt: 237, E():
FT                   0.0032,(58.7% identity in 63 aa overlap); MTV043_25."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0378"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43108"
FT                   /db_xref="UniProtKB/TrEMBL:O53713"
FT                   /protein_id="CCP43108.1"
FT                   /translation="MSGRWEAGNADGNGGSAGLIGSGGAGGDGGSGGATGAGGEGGDAG
FT                   ASGSINGNAGDPGNSGERGAVGKPGAPG"
FT   gene            455977..456192
FT                   /gene="secE2"
FT                   /locus_tag="Rv0379"
FT   CDS_pept        455977..456192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE2"
FT                   /locus_tag="Rv0379"
FT                   /product="Possible protein transport protein SecE2"
FT                   /note="Rv0379, (MTV036.14), len: 71 aa. Possible
FT                   secE2,protein transport protein, showing similarity with
FT                   P27340|S61G_SULSO|SECE preprotein translocase SECE subunit
FT                   (protein transport protein SEC61 gamma subunit homolog)
FT                   from Sulfolobus acidocaldarius (65 aa), FASTA scores: opt:
FT                   79, E(): 4.7. (30.3% identity in 66 aa overlap); and
FT                   hypothetical proteins e.g. Q9HPW4|VNG1446H hypothetical
FT                   protein from Halobacterium sp. strain NRC-1 (77 aa);
FT                   Q9I794|PA0038 hypothetical protein from Pseudomonas
FT                   aeruginosa (71 aa); etc. Also highly similar to
FT                   U85467|MTU85467_1 hypothetical Mycobacterium tuberculosis
FT                   protein from a patient isolate (116 aa), FASTA scores: opt:
FT                   443, E(): 7.7e-29, (98.6% identity in 71 aa overlap). Note
FT                   that for Rv0379|MTV036.14, a translation initiation region
FT                   different to the one in U85467|MTU85467_1 was chosen. Could
FT                   be a part of the prokaryotic protein translocation
FT                   apparatus which comprise SECA|Rv3240c,
FT                   SECD|Rv2587c,SECE|Rv0638, SECF|Rv2586c, SECG|Rv1440 and
FT                   SECY|Rv0732."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0379"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43109"
FT                   /db_xref="GOA:Q6MX43"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="PDB:3ONR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MX43"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43109.1"
FT                   /translation="MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDM
FT                   AVDSAGKITYRIKLEVSFKMRPAQPR"
FT   gene            complement(456268..456819)
FT                   /locus_tag="Rv0380c"
FT   CDS_pept        complement(456268..456819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0380c"
FT                   /product="Possible RNA methyltransferase (RNA methylase)"
FT                   /note="Rv0380c, (MTV036.15c), len: 183 aa. Possible RNA
FT                   methyltransferase, equivalent to CAC32002.1|AL583925
FT                   possible RNA methyltransferase from Mycobacterium leprae
FT                   (182 aa). Also some similarity with others
FT                   methyltransferases e.g. P19396|TRMH_ECOLI|78514|JV0043 tRNA
FT                   (guanosine-2'-O-)-methyltransferase (tRNA
FT                   methyltransferase) from Escherichia coli (229 aa), FASTA
FT                   scores: opt: 227, E(): 1.4e-09, (28.9% identity in 166 aa
FT                   overlap). Also similar to Rv0881, Rv3579c, Rv1644 from
FT                   Mycobacterium tuberculosis."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0380c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43110"
FT                   /db_xref="GOA:O53715"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:O53715"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43110.1"
FT                   /translation="MLLRDGDARNVVDAYRYWTREAIIADIDTRRHPLHVAIENFGHDA
FT                   NIGSVVRTANAFAVHTVHIVGRRRWNRRGAMVTDRYQRLCHHDSTTGLLEFAAGAGLTV
FT                   VAVDNVPGAARLEQTALPRECLLLFGQEGPGITDDARAGAAVTVSIAQFGSTRSINAGV
FT                   AAGIAMHAWIRQHADLGRAW"
FT   gene            complement(456915..457823)
FT                   /locus_tag="Rv0381c"
FT   CDS_pept        complement(456915..457823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0381c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0381c, (MTV036.16c), len: 302 aa. Hypothetical
FT                   unknown protein. Equivalent to AAK44616.1 from
FT                   Mycobacterium tuberculosis strain CDC1551 (254 aa) but
FT                   longer 48 aa."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0381c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43111"
FT                   /db_xref="GOA:O53716"
FT                   /db_xref="UniProtKB/TrEMBL:O53716"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43111.1"
FT                   /translation="MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVL
FT                   GWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGD
FT                   AMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPV
FT                   GMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRY
FT                   RDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEIN
FT                   EALLYATVATVGTHAALWTSR"
FT   gene            complement(457841..458380)
FT                   /gene="pyrE"
FT                   /gene_synonym="umpA"
FT                   /locus_tag="Rv0382c"
FT   CDS_pept        complement(457841..458380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /gene_synonym="umpA"
FT                   /locus_tag="Rv0382c"
FT                   /product="Probable orotate phosphoribosyltransferase PyrE
FT                   (OPRT) (oprtase)"
FT                   /note="Rv0382c, (MTV036.17c), len: 179 aa. Probable
FT                   pyrE,orotate phosphoribosyltransferase, equivalent to
FT                   CAC32004.1|AL583925 probable purine/pyrimidine
FT                   phosphoribosyltransferase from Mycobacterium leprae (179
FT                   aa). Also highly similar to many others e.g.
FT                   T36540|4753874|CAB42037.1|AL049754|SCH10.28c probable
FT                   orotate phosphoribosyltransferase from Streptomyces
FT                   coelicolor (182 aa);
FT                   H69115|2622996|AAB86326.1|AE000938_10|MTH1860 probable
FT                   orotate phosphoribosyltransferase from Methanobacterium
FT                   thermoautotrophicum (180 aa), FASTA scores: opt: 389, E():
FT                   2.7e-20, (40.7% identity in 172 aa overlap);
FT                   O08359|PYRE_SULAC|2065444|CAA73352.1|Y12822 orotate
FT                   phosphoribosyltransferase from Sulfolobus acidocaldarius
FT                   (197 aa); etc. Note that also similar to other puridine
FT                   5'-monophosphate synthases (umpA genes; UMP
FT                   synthases),generally in N-terminus that corresponds to
FT                   orotate phosphoribosyltransferase activity. Contains
FT                   PS00589 PTS HPR component serine phosphorylation site
FT                   signature. Belongs to the purine/pyrimidine
FT                   phosphoribosyltransferase family. Note that previously
FT                   known as umpA. Nucleotide position 458282 in the genome
FT                   sequence has been corrected,A:G resulting in Y33Y."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0382c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43112"
FT                   /db_xref="GOA:P9WHK9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:5HKF"
FT                   /db_xref="PDB:5HKI"
FT                   /db_xref="PDB:5HKL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHK9"
FT                   /inference="protein motif:PROSITE:PS00589"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43112.1"
FT                   /translation="MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHR
FT                   ASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQR
FT                   LIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAE
FT                   GLRYRSVLGLADLGLD"
FT   gene            complement(458461..459315)
FT                   /locus_tag="Rv0383c"
FT   CDS_pept        complement(458461..459315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0383c"
FT                   /product="Possible conserved secreted protein"
FT                   /note="Rv0383c, (MTV036.18c), len: 284 aa. Possible
FT                   conserved secreted protein, with hydrophobic stretch in
FT                   N-terminus and Pro-rich C-terminus. Equivalent to
FT                   CAC32006.1|AL583925 possible secreted protein from
FT                   Mycobacterium leprae (286 aa). A core mycobacterial gene;
FT                   conserved in mycobacterial strains (See Marmiesse et
FT                   al.,2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0383c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43113"
FT                   /db_xref="GOA:O53718"
FT                   /db_xref="UniProtKB/TrEMBL:O53718"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43113.1"
FT                   /translation="MVPLWFTLSALCFVGAVVLLYVDIDRRRGRSRRRKSWARSHGFDY
FT                   ERESTEILKRWTRGVMSTVGDVAAHNVVLGQIRGEAVYIFDLEEVATVIALHRKVGTNV
FT                   VVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQNWTLVSMPIASTRAQWDEGLRTVRQFNDLLRVLPPLPQEMPQQTGVGPRGAAPGRP
FT                   VAPGGPAELPPRRAQPDPATTVLPDPARRAPEPIRRDEGRSEGVRRPPPAGRNGQQATN
FT                   YQH"
FT   gene            complement(459456..462002)
FT                   /gene="clpB"
FT                   /gene_synonym="htpM"
FT                   /locus_tag="Rv0384c"
FT   CDS_pept        complement(459456..462002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /gene_synonym="htpM"
FT                   /locus_tag="Rv0384c"
FT                   /product="Probable endopeptidase ATP binding protein (chain
FT                   B) ClpB (ClpB protein) (heat shock protein F84.1)"
FT                   /note="Rv0384c, (MTV036.19c), len: 848 aa. Probable clpB
FT                   (alternate gene name: htpM), endopeptidase ATP-binding
FT                   protein, chain B, equivalent to AC32007.1|AL583925 heat
FT                   shock protein from Mycobacterium leprae (848 aa). Also
FT                   highly similar to others e.g.
FT                   P53532|CLPB_CORGL|1163118|AAB49540.1|U43536|CGU43536_1 CLPB
FT                   protein (heat-inducible expression) from Corynebacterium
FT                   glutamicum (852 aa), FASTA scores: opt: 4113, E(): 0,(74.5%
FT                   identity in 846 aa overlap);
FT                   T36551|4753885|CAB42048.1|AL049754|clpB|SCOEDB|SCH10.39c
FT                   probable ATP-dependent proteinase ATP-binding chain from
FT                   Streptomyces coelicolor (853 aa);
FT                   P03815|CLPB_ECOLI|1788943|AAC75641.1|AE000345 CLPB protein
FT                   (heat shock protein F84.1) from Escherichia coli strains
FT                   K12 and O157:H7 (857 aa); etc. Also similar to Rv3596c|ClpC
FT                   from Mycobacterium tuberculosis. Contains PS00870 and
FT                   PS00871 Chaperonins clpA/B signatures and two PS000017
FT                   ATP/GTP-binding site motives a (P-loop). Belongs to the
FT                   CLPA/CLPB family. Contains probable coiled-coil domain from
FT                   aa 411-503. Conserved in M. tuberculosis, M. leprae, M.
FT                   bovis and M. avium paratuberculosis; predicted to be
FT                   essential for in vivo survival and pathogenicity (See
FT                   Ribeiro-Guimaraes and Pessolani, 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0384c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43114"
FT                   /db_xref="GOA:P9WPD1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="PDB:6DJU"
FT                   /db_xref="PDB:6DJV"
FT                   /db_xref="PDB:6ED3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPD1"
FT                   /inference="protein motif:PROSITE:PS00871"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00870"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43114.1"
FT                   /translation="MDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDE
FT                   YVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK
FT                   YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGEGAMDAGNMIKPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVG
FT                   EPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAE
FT                   LTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQK
FT                   AAVTAVSDAVRRSRAGVSDPNRPTGAFMFLGPTGVGKTELAKALADFLFDDERAMVRID
FT                   MSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIF
FT                   EGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQ
FT                   QAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG"
FT   gene            462135..463307
FT                   /locus_tag="Rv0385"
FT   CDS_pept        462135..463307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0385"
FT                   /product="Probable monooxygenase"
FT                   /note="Rv0385, (MTV036.20), len: 390 aa. Probable
FT                   monooxygenase, similar to
FT                   T37003|5738846|CAB52917.1|AL109949 probable
FT                   flavohemoprotein from Streptomyces coelicolor (435 aa); and
FT                   similar in part (C-termini) to various monooxygenases e.g.
FT                   P19734|DMPP_PSESP|94993|F37831 phenol hydroxylase P5
FT                   protein (phenol 2-monooxygenase P5 component) from
FT                   Pseudomonas putida (353 aa), FASTA scores: opt: 363, E():
FT                   4.2e-16, (31.8% identity in 255 aa overlap);
FT                   S47292|2120861|pir|S70085 phenol 2-monooxygenase chain mopP
FT                   from Acinetobacter calcoaceticus (350 aa);
FT                   P21394|XYLA_PSEPU|94933|B37316 xylene monooxygenase
FT                   electron transfer component [includes: ferredoxin;
FT                   ferredoxin--NAD(+) reductase] from Pseudomonas putida
FT                   plasmid pWW0 (350 aa); AAC38360.1|AF043544|NtnMA|ntnA
FT                   reductase component of 4-nitrotoluene monooxygenase from
FT                   Pseudomonas sp. (328 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0385"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43115"
FT                   /db_xref="GOA:Q7ARS9"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARS9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43115.1"
FT                   /translation="MGLEDRDALRVLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPD
FT                   MGAQRAAFGQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTL
FT                   RDYLGHPSRGAWTDAVDEAAGQSLNLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLA
FT                   VARLQLDRPLHYYPGQYVNVHVPQCPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNA
FT                   IVGETRPGDRWRLSGPHGAFRVDRDGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHL
FT                   FFGARYACELYDLPTLWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTG
FT                   RLPDVVSRYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR"
FT   gene            463411..466668
FT                   /locus_tag="Rv0386"
FT   CDS_pept        463411..466668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0386"
FT                   /product="Probable transcriptional regulatory protein
FT                   (probably LuxR/UhpA-family)"
FT                   /note="Rv0386, (MTV036.21), len: 1085 aa. Probable
FT                   regulatory protein, LuxR/uhpA family, highly similar to
FT                   CAC30706.1|AL583923 possible transcriptional regulator from
FT                   Mycobacterium leprae (1106 aa). Also similar in part to
FT                   other regulatory proteins e.g. CAB95788.1|AL359949 putative
FT                   multi-domain regulatory protein from Streptomyces
FT                   coelicolor (780 aa); N-terminus of CAB92369.1|AL356612
FT                   putative AfsR-like regulatory protein from Streptomyces
FT                   coelicolor (1114 aa); N-terminus of
FT                   NP_107139.1|14026327|BAB52925.1|AP003009 transcriptional
FT                   regulator from Mesorhizobium loti (952 aa);
FT                   AFSR_STRCO|P25941 regulatory protein afsr from Streptomyces
FT                   coelicolor (993 aa), FASTA scores: opt: 224, E() :
FT                   1.1e-06,(26.1% identity in 867 aa overlap); etc. Also
FT                   similar to many putative Mycobacterium tuberculosis
FT                   regulatory proteins e.g. AL0212|MTV008_44 (1137 aa), FASTA
FT                   scores: opt: 3756, E(): 0, (56.7% identity in 1089 aa
FT                   overlap). Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop),PS00622 Bacterial regulatory proteins, luxR family
FT                   signature and probable helix-turn-helix motif at aa
FT                   1042-1063 (Score 1025, +2.68 S D). Belongs to the LuxR/UhpA
FT                   family of transcriptional regulators."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0386"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43116"
FT                   /db_xref="GOA:O53720"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:O53720"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00622"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43116.1"
FT                   /translation="MSKLLPRGTVTLLLADVEGSTWLWETHPDDMGAAVARLDKAVSGV
FT                   IAAHDGVRPVEQGEGDSFVLAFACASDAVAAALDLQRARLAPIRLRIGVHTGEVALRDE
FT                   GNYAGPTINRTARLRDLAHGGQTVLSGVTESLVIDRLPDKAWLVDLGTHALRDLSRPER
FT                   VMQLCHPELRIDFPPLRVANDDVAHGLPVHLTRFVGRGAQITEVHRLVTDNRLVTLTGA
FT                   GGVGKTRLAAQLAAQIAGEFGRAWFVDLAPITDPDLVPVTVAGALGLHDQPGRSTTDTV
FT                   LRFLGGRPALVVLDNCEHLLDATAALVLALVKACRGVRLLATCREPLRVEGEVSYRVPS
FT                   LSLSDEAVEMFCYRAQRVRPDFRLTDDNSAAVTEICKRLDGLPLAIELAAARLRSMTLD
FT                   EIIDGLRDRFALLTGGARTAAHRQQTLWASVDWSYTLLTEPERTLFRRLAVFVGCFFVD
FT                   DAQAVACSGDVQRYQVLDEITLLVDKSLVMADDNSGRTCYRLCETMRHYALEKLSEAGE
FT                   VDAVFARHRDYYTALAARVDNPGPSDYSHCLDQAETEIDNLRAAFVWNRENSDTEGALA
FT                   LASSLLRVWMTRGRIQEGRAWFDSILADENARHLEVAAAVRARALADKALLDIFVDAAA
FT                   GMEQAQQALVIAREVDEPALLSRALTACGLIAVAVARADAAASYFAEAIDLARAVDDRW
FT                   RLAQILTFQAVDAVVAGDPVAARPAAQEARELAAAIGDHSNALWCRWCLGYAQLMRGEL
FT                   AAAAAQFGEVVDEAEASQEVLHKANSLQGLAFALAYQGELSAARAAADAALEAAELGEY
FT                   FAGMGYSALTTAALAAGDVQTAQHASEAAWRNLSLALPLSAAVQRAFNAQAALAGGDLS
FT                   AARRWCDDAVQSMTGHHLAMALATRARIAVAEGKREEAERDAHKALACAAESGAHLDLP
FT                   DVLECLAGLASDAGTHHAAARLFGAAEAIRQQIGSVRFAIYRSDYVQSVTALRDAMGEK
FT                   DFDAAWAEGAALSIKETIAYAQRGHSWRKRPATGWESLTPTEIDVVRLVGEGLANKDIA
FT                   TRLFVSPRTVQTHLTHVYTKLGFTSRLQLAQAAARRT"
FT   gene            complement(466672..467406)
FT                   /locus_tag="Rv0387c"
FT   CDS_pept        complement(466672..467406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0387c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0387c, (MTV036.22c), len: 244 aa. Conserved
FT                   hypothetical protein, showing some similarity to
FT                   MTCI237.20c, and M17282|HUMEL20_1 Human elastin gene, exon
FT                   1, Elastin (687 aa), FASTA scores: opt: 193, E():
FT                   0.35,(34.4% identity in 189 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0387c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43117"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="UniProtKB/TrEMBL:L0T6I4"
FT                   /protein_id="CCP43117.1"
FT                   /translation="MSLLPTLQSFLPPPFDAIPNPIEDLDVLVAAAVAVAAGSLGVSAA
FT                   QLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDLPEVGGRVTSPPQPPVAALTGYS
FT                   ANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSSDGSYAGLAAAGLAGTGLAGLAA
FT                   RGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAAAAGSAIPGLPPGLPPGVVANLA
FT                   ATLAAIPGATIIVVPPSPNANQ"
FT   gene            complement(467459..468001)
FT                   /gene="PPE9"
FT                   /locus_tag="Rv0388c"
FT   CDS_pept        complement(467459..468001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE9"
FT                   /locus_tag="Rv0388c"
FT                   /product="PPE family protein PPE9"
FT                   /note="Rv0388c, (MTV036.23c), len: 180 aa. PPE9, Member of
FT                   the Mycobacterium tuberculosis PPE family, highly similar
FT                   to others e.g. MTCY10G2_10|Z92539 from Mycobacterium
FT                   tuberculosis (391 aa), FASTA scores: opt: 667, E():
FT                   0,(58.3% identity in 180 aa overlap) but much shorter."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0388c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43118"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:L0T6B3"
FT                   /protein_id="CCP43118.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVQTNVFGQNTPAIATSETHYGEMWAHDILAMDGYAGASGAASQ
FT                   LRRSPATGDHQRGRVAE"
FT   gene            468335..469594
FT                   /gene="purT"
FT                   /locus_tag="Rv0389"
FT   CDS_pept        468335..469594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="Rv0389"
FT                   /product="Probable phosphoribosylglycinamide
FT                   formyltransferase 2 PurT (GART 2) (gar transformylase 2)
FT                   (5'-phosphoribosylglycinamide transformylase 2)
FT                   (formate-dependent gar transformylase)"
FT                   /note="Rv0389, (MTCY04D9.01, MTV036.24), len: 419 aa.
FT                   Probable purT, phosphoribosylglycinamide formyltransferase
FT                   2, similar to others e.g. P33221|PURT_ECOLI|B1849
FT                   phosphoribosylglycinamide formyltransferase 2 from
FT                   Escherichia coli strain K-12 (391 aa), FASTA scores: opt:
FT                   481, E(): 1.3e-22, (40.1% identity in 379 aa overlap); etc.
FT                   Belongs to the PurK / PurT family. Cofactor: magnesium."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0389"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43119"
FT                   /db_xref="GOA:P95197"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:P95197"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43119.1"
FT                   /translation="MIDGWTEEQHEPTVRHERPAAPQDVRRVMLLGSAEPSRELAIALQ
FT                   GLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDAL
FT                   DAVEQADGECTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVH
FT                   AGFPLLVSPVAGVAGQGSSVVAGPNEVEPAWQRAAGHQVQPQTGGVSPRVCAESVVEIE
FT                   FLVTMIVVCSQGPNGPLIEFCAPIGHRDADAGELESWQPQKLSTAALDAAKSIAARIVK
FT                   ALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQRLSVFELQARAILGLAVDTL
FT                   MISPGAARVINPDHTAGRAAVGAAPPADALTGALGVPESDVVIFGRGLGVALATAPEVA
FT                   IARERAREVASRLNVPDSRE"
FT   gene            469591..470013
FT                   /locus_tag="Rv0390"
FT   CDS_pept        469591..470013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0390"
FT                   /product="Conserved protein"
FT                   /note="Rv0390, (MTCY04D9.02), len: 140 aa. Conserved
FT                   protein, equivalent to
FT                   AL023514|MLCB4_11|CAA18942.1|AL023514 hypothetical protein
FT                   from Mycobacterium leprae (147 aa), FASTA scores: opt:
FT                   778,E(): 0, (79.0% identity in 138 aa overlap). Also
FT                   similar to hypothetical proteins from several Rickettsia
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0390"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43120"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="PDB:2FSX"
FT                   /db_xref="UniProtKB/TrEMBL:P95198"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43120.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
FT   gene            470010..471230
FT                   /gene="metZ"
FT                   /locus_tag="Rv0391"
FT   CDS_pept        470010..471230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="Rv0391"
FT                   /product="Probable O-succinylhomoserine sulfhydrylase MetZ
FT                   (OSH sulfhydrylase)"
FT                   /note="Rv0391, (MTCY04D9.03), len: 406 aa. Probable
FT                   metZ,O-succinylhomoserine sulfhydrylase, equivalent, but
FT                   shorter 20 aa in N-terminus, to AA18941.1|AL023514
FT                   O-succinylhomoserine sulfhydrylase from Mycobacterium
FT                   leprae (426 aa). Also highly similar to others e.g.
FT                   METZ_PSEAE|P55218 o-succinylhomoserine sulfhydrylase from
FT                   Pseudomonas aeruginosa (403 aa), FASTA scores: opt:
FT                   1175,E(): 0, (47.2% identity in 392 aa overlap); etc.
FT                   Belongs to the trans-sulfuration enzymes family. Could also
FT                   be a cystathionine gamma-synthase."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0391"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43121"
FT                   /db_xref="GOA:P9WGB5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:3NDN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGB5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43121.1"
FT                   /translation="MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSG
FT                   YVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTS
FT                   LGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVF
FT                   FETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHID
FT                   GQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQ
FT                   RIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVL
FT                   DKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIA
FT                   DIDRALS"
FT   gene            complement(471227..472639)
FT                   /gene="ndhA"
FT                   /locus_tag="Rv0392c"
FT   CDS_pept        complement(471227..472639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="Rv0392c"
FT                   /product="Probable membrane NADH dehydrogenase NdhA"
FT                   /note="Rv0392c, (MTCY04D9.04c), len: 470 aa. Probable
FT                   ndhA,membrane NADH dehydrogenase, equivalent to many e.g.
FT                   AF038423|AF038423_1 NADH dehydrogenase from Mycobacterium
FT                   smegmatis (457 aa), FASTA scores: opt: 1991, E(): 0, (67.9%
FT                   identity in 458 aa overlap); MLCB1788_3 NADH dehydrogenase
FT                   from Mycobacterium leprae (466 aa), FASTA score: (62.5%
FT                   identity in 467 aa overlap). Also similar to others from
FT                   several organisms e.g.
FT                   P00393|DHNA_ECOLI|66211|581140|CAA23586.1|V00306 NADH
FT                   dehydrogenase from Escherichia coli (434 aa); and
FT                   Rv0392c|ndhB from Mycobacterium tuberculosis. Has
FT                   hydrophobic stretch in C-terminus. Belongs to the NADH
FT                   dehydrogenase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0392c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43122"
FT                   /db_xref="GOA:P95200"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:P95200"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43122.1"
FT                   /translation="MTLSSGEPSAVGGRHRVVIIGSGFGGLNAAKALKRADVDITLISK
FT                   TTTHLFQPLLYQVATGILSEGDIAPTTRLILRRQKNVRVLLGEVNAIDLKAQTVTSKLM
FT                   DMTTVTPYDSLIVAAGAQQSYFGNDEFATFAPGMKTIDDALELRGRILGAFEAAEVSTD
FT                   HAERERRLTFVVVGAGPTGVEVAGQIVELAERTLAGAFRTITPSECRVILLDAAPAVLP
FT                   PMGPKLGLKAQRRLEKMDVEVQLNAMVTAVDYKGITIKEKDGGERRIECACKVWAAGVA
FT                   ASPLGKMIAEGSDGTEIDRAGRVIVEPDLTVKGHPNVFVVGDLMFVPGVPGVAQGAIQG
FT                   ARYATTVIKHMVKGNDDPANRKPFHYFNKGSMATISRHSAVAQVGKLEFAGYFAWLAWL
FT                   VLHLVYLVGYRNRIAALFAWGISFMGRARGQMAITSQMIYARLVMTLMEQQAQGALAAA
FT                   EQAEHAEQEAAG"
FT   gene            472781..474106
FT                   /locus_tag="Rv0393"
FT   CDS_pept        472781..474106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0393"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /note="Rv0393, (MTCY04D9.05), len: 441 aa. Member of
FT                   Mycobacterium tuberculosis 13E12 repeat family of conserved
FT                   proteins, similar to many e.g. Rv1148c, Rv1945,
FT                   Rv3467,Rv0336|MTCY279_3 (503 aa), FASTA scores: E(): 0,
FT                   (61.1% identity in 347 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0393"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43123"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:P95201"
FT                   /protein_id="CCP43123.1"
FT                   /translation="MAVGRCAIPRFDQAASGSAINGGQVHLSDGSTSPARQLPAPWPGD
FT                   AGAAAEGRAGVCCRGNRLPHVSDVGVSHRFDHRPAGVGAGGCRAGAAGAGLAVDDPGQL
FT                   AAAIDRIVAVADPDAVRQVRERARDREVSIWNSADGMGEVYAQLYATDAQALDARLNAL
FT                   VATVCAGDPRSTDQRRADALGALAAGADRLACRCDNPDCAAEGRPVSAVVIHVVAEQAS
FT                   VKGHGQAPAALLGGDGLIPAELVAELAKTAGLQPIPVPAGTEPGYRPSVKLAAFVRARD
FT                   LTCRAPGCDRPATQCDLDHTIAFADGGATHAANLKCLCRLHHLLATFCGWRAQQLPDGT
FT                   VIWTLPGNQTYVTTPGSALLFPALCTPTGDPPAPEPARADRRGQRTAMMPRRASTRTQN
FT                   RAHCIAAERHRNHQARRIAQAAVIATETHGPPPDPDDDPPPF"
FT   gene            complement(474122..474841)
FT                   /locus_tag="Rv0394c"
FT   CDS_pept        complement(474122..474841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0394c"
FT                   /product="Possible secreted protein"
FT                   /note="Rv0394c, (MTCY04D9.06c), len: 239 aa. Possible
FT                   secreted protein, sharing no homology with other proteins.
FT                   Has hydrophobic stretch at its N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0394c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43124"
FT                   /db_xref="GOA:P95202"
FT                   /db_xref="UniProtKB/TrEMBL:P95202"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43124.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
FT   gene            474940..475344
FT                   /locus_tag="Rv0395"
FT   CDS_pept        474940..475344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0395"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0395, (MTCY04D9.07), len: 134 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0395"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43125"
FT                   /db_xref="UniProtKB/TrEMBL:P95203"
FT                   /protein_id="CCP43125.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSVFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
FT   gene            475350..475742
FT                   /locus_tag="Rv0396"
FT   CDS_pept        475350..475742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0396"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0396, (MTCY04D9.08), len: 130 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0396"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43126"
FT                   /db_xref="UniProtKB/TrEMBL:P95204"
FT                   /protein_id="CCP43126.1"
FT                   /translation="MRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYGEEVLDFEP
FT                   RTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTCAGPEPNLV
FT                   QVEFDDAAMAEAMEEMAEPDDDGEDW"
FT   gene            475816..476184
FT                   /locus_tag="Rv0397"
FT   CDS_pept        475816..476184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0397"
FT                   /product="Conserved 13E12 repeat family protein"
FT                   /note="Rv0397, (MTCY04D9.09), len: 122 aa. Part of 13E12
FT                   repeat family of conserved Mycobacterium tuberculosis
FT                   proteins, similar to downstream Rv0393|Z84725|MTCY4D9_5
FT                   conserved 13E12 repeat family protein (441 aa), FASTA
FT                   scores: E(): 0, (87.7% identity in 122 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0397"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43127"
FT                   /db_xref="UniProtKB/TrEMBL:P95205"
FT                   /protein_id="CCP43127.1"
FT                   /translation="MLATFWGWRAQQLPDGTVIWTLPGDQTYVTTPGSALLFPALCTPT
FT                   GDPPRPDPARADRRGQRTAMMPRRASTRAQNRAHYIAAERHRNHQARRIAHVVTQTATT
FT                   APETNGPPPDPDDDPPPF"
FT   gene            476394..476642
FT                   /locus_tag="Rv0397A"
FT   CDS_pept        476394..476642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0397A"
FT                   /product="Conserved protein"
FT                   /note="Rv0397A, len: 82 aa. Conserved protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0397A"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43128"
FT                   /db_xref="UniProtKB/TrEMBL:I6Y3N9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43128.1"
FT                   /translation="MHALRLVGLAILTAIAPIAVLIGSSPAHADTDIGQPCSPEGAKLW
FT                   GNPGPIYCERTADGQLQWVSIPAWALCVAFCDRPGGP"
FT   gene            complement(476679..477320)
FT                   /locus_tag="Rv0398c"
FT   CDS_pept        complement(476679..477320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0398c"
FT                   /product="Possible secreted protein"
FT                   /note="Rv0398c, (MTCY04D9.10c), len: 213 aa. Possible
FT                   secreted protein, sharing no homology with other proteins.
FT                   Has potential signal sequence with hydrophobic stretch from
FT                   aa 7-25."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0398c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43129"
FT                   /db_xref="GOA:P95206"
FT                   /db_xref="UniProtKB/TrEMBL:P95206"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43129.1"
FT                   /translation="MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPV
FT                   IGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLG
FT                   CQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPT
FT                   SMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG"
FT   gene            complement(477327..478556)
FT                   /gene="lpqK"
FT                   /locus_tag="Rv0399c"
FT   CDS_pept        complement(477327..478556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqK"
FT                   /locus_tag="Rv0399c"
FT                   /product="Possible conserved lipoprotein LpqK"
FT                   /note="Rv0399c, (MTCY04D9.11c), len: 409 aa. Possible
FT                   lpqK,conserved lipoprotein, showing some similarity to
FT                   penicillin binding proteins and various peptidases e.g.
FT                   DAC_STRSQ|P15555 d-alanyl-d-alanine carboxypeptidase
FT                   protein (406 aa), FASTA scores: opt: 348, E():
FT                   5.6e-16,(29.2% identity in 301 aa overlap). Also similar to
FT                   other Mycobacterium tuberculosis PBPs and esterases. Has
FT                   possible N-terminal signal sequence and appropriately
FT                   positioned prokaryotic lipoprotein lipid attachment site
FT                   (PS00013)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0399c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43130"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:P95207"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43130.1"
FT                   /translation="MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIV
FT                   RDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLK
FT                   LVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQ
FT                   WTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGL
FT                   TATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIY
FT                   DMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGH
FT                   WLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAP
FT                   NDAPPMPPGR"
FT   gene            complement(478566..479753)
FT                   /gene="fadE7"
FT                   /locus_tag="Rv0400c"
FT   CDS_pept        complement(478566..479753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE7"
FT                   /locus_tag="Rv0400c"
FT                   /product="Acyl-CoA dehydrogenase FadE7"
FT                   /note="Rv0400c, (MTCY04D9.12c), len: 395 aa. Probable
FT                   fadE7, acyl-CoA dehydrogenase, similar to many e.g.
FT                   CAC12923.1|AL445403 putative acyl CoA dehydrogenase from
FT                   Streptomyces coelicolor (397 aa); G624219 glutaryl-CoA
FT                   dehydrogenase precursor (438 aa), FASTA scores: opt:
FT                   1161,E(): 0, (48.1% identity in 391 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0400c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43131"
FT                   /db_xref="GOA:P95208"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:P95208"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43131.1"
FT                   /translation="MSTPTPPALDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVA
FT                   AWFEDGDLPVARDLAKQFGELGLLGMQLHGHGCGGASAVHYGLACRELEAADSGIRSLV
FT                   SVQGSLAMFAIASFGSDEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRDGP
FT                   DWVITGGKMWITNGSVADVAIVWAATDDGIRGFIVPTDTPGFTANTIGHKLSLRASITS
FT                   ELVLDNVRLPADAMLPGATGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQ
FT                   FGRPIAGFQLTQAKLVDMAVELHKGQLLSLHLGRLKDRVGLRPDQVSFGKLNNTREALK
FT                   ICRTARTILGGNGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGLAAFR"
FT   gene            479789..480160
FT                   /locus_tag="Rv0401"
FT   CDS_pept        479789..480160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0401"
FT                   /product="Probable conserved transmembrane protein"
FT                   /note="Rv0401, (MTCY04D9.14), len: 123 aa. Probable
FT                   conserved transmembrane protein, equivalent to
FT                   AL023514|MLCB4_9 putative integral membrane protein from
FT                   Mycobacterium leprae (122 aa), FASTA scores: opt: 548, E():
FT                   4.4e-32, (66.9% identity in 121 aa overlap). A core
FT                   mycobacterial gene; conserved in mycobacterial strains (See
FT                   Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0401"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43132"
FT                   /db_xref="GOA:P95210"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:P95210"
FT                   /protein_id="CCP43132.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
FT   gene            complement(480355..483231)
FT                   /gene="mmpL1"
FT                   /locus_tag="Rv0402c"
FT   CDS_pept        complement(480355..483231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL1"
FT                   /locus_tag="Rv0402c"
FT                   /product="Probable conserved transmembrane transport
FT                   protein MmpL1"
FT                   /note="Rv0402c, (MTCY04D9.15c), len: 958 aa. Probable
FT                   mmpL1, conserved transmembrane transport protein (see
FT                   Tekaia et al., 1999), member of RND superfamily, highly
FT                   similar to other Mycobacterial proteins e.g.
FT                   YV34_MYCTU|Q11171 hypothetical 106.2 kDa membrane protein
FT                   from Mycobacterium tuberculosis (968 aa), FASTA scores:
FT                   opt: 3551, E(): 0, (55.4% identity in 933aa overlap);
FT                   YV34_MYCLE|P54881 hypothetical 105.2 kDa protein from
FT                   Mycobacterium leprae (959 aa), FASTA scores: opt: 3615,E():
FT                   0, (55.5% identity in 941 aa overlap); etc. Highly similar
FT                   to many other mycobacterial MmpL proteins from
FT                   Mycobacterium tuberculosis and Mycobacterium leprae e.g.
FT                   Rv0450c, Rv0676c, Rv0507, etc. Belongs to the MmpL family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0402c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43133"
FT                   /db_xref="GOA:P9WJV9"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJV9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43133.1"
FT                   /translation="MRSQRLAGHLSAAARTIHALSLPIILFWVALTIVVNVVAPQLQSV
FT                   ARTHSVALGPHDAPSLIAMKRIGKDFQQFDSDTTAMVLLEGQEKLGDEAHRFYDVLVTK
FT                   LSQDTTHVQHIENFWGDPLTAAGSQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVD
FT                   SVPPPPGIKAYVTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIML
FT                   LTVGLELLAVRGIISTFAVNDLMGLSTFTVNVLVALTIAASTDYIIFLVGRYQEARATG
FT                   QNREAAYYTMFGGTAHVVLASGLTVAGAMYCLGFTRLPYFNTLASPCAIGLVTVMLASL
FT                   TLAPAIIAVASRFGLFDPKRATTKRRWRRIGTVVVRWPGPVLAATLLIALIGLLALPKY
FT                   QTNYNERYYIPSAAPSNIGYLASDRHFPQARMEPEVLMVEADHDLRNPTDMLILDRIAK
FT                   TVFHTPGIARVQSITRPLGAPIDHSSIPFQLGMQSTMTIENLQNLKDRVADLSTLTDQL
FT                   QRMIDITQRTQELTRQLTDATHDMNAHTRQMRDNANELRDRIADFDDFWRPLRSFTYWE
FT                   RHCFDIPICWSMRSLLNSMDNVDKLTEDLANLTDDTERMDTTQRQLLAQLDPTIATMQT
FT                   VKDLAQTLTSAFSGLVTQMEDMTRNATVMGRTFDAANNDDSFYLPPEAFQNPDFQRGLK
FT                   LFLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIYLAGTSSTY
FT                   KDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLIWQ
FT                   HILHMPLHWLVLPMAIIVMLAVGSDYNLLLIARFQEEIGAGLKTGMIRAMAGTGRVVTI
FT                   AGLVFAFTMGSMVASDLRVVGQIGTTIMIGLLFDTLVVRSYMTPALATLLGRWFWWPRR
FT                   VDRLARQPQVLGPRRTTALSAERAALLQ"
FT   gene            complement(483228..483656)
FT                   /gene="mmpS1"
FT                   /locus_tag="Rv0403c"
FT   CDS_pept        complement(483228..483656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpS1"
FT                   /locus_tag="Rv0403c"
FT                   /product="Probable conserved membrane protein MmpS1"
FT                   /note="Rv0403c, (MTCY04D9.16c), len: 142 aa. Probable
FT                   mmpS1, conserved membrane protein (see citation
FT                   below),highly similar to other Mycobacterial proteins e.g.
FT                   YV33_MYCLE|P54880 hypothetical 16.9 kDa protein from
FT                   Mycobacterium leprae (154 aa), FASTA scores: opt: 458, E():
FT                   1.6e-26, (46.9% identity in 143 aa overlap);
FT                   YV33_MYCTU|Q11170 hypothetical 15.9 kDa protein from
FT                   Mycobacterium tuberculosis (147 aa), FASTA scores: opt:
FT                   362, E(): 1.1e-19, (42.1% identity in 140 aa overlap); etc.
FT                   Also similar to other MmpS proteins from Mycobacterium
FT                   tuberculosis e.g. Rv0677c, Rv0451c, etc. Belongs to the
FT                   MmpS family. Predicted to be an outer membrane protein (See
FT                   Song et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0403c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43134"
FT                   /db_xref="GOA:P9WJT5"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJT5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43134.1"
FT                   /translation="MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLD
FT                   PIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVV
FT                   ARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA"
FT   gene            483977..485734
FT                   /gene="fadD30"
FT                   /locus_tag="Rv0404"
FT   CDS_pept        483977..485734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD30"
FT                   /locus_tag="Rv0404"
FT                   /product="Fatty-acid-AMP ligase FadD30 (fatty-acid-AMP
FT                   synthetase) (fatty-acid-AMP synthase)"
FT                   /note="Rv0404, (MTCY04D9.17-MTCY22G10.00), len: 585 aa.
FT                   fadD30, fatty-acid-AMP synthetase, similar to many e.g.
FT                   MBU75685_1|AAB52538.1|U75685 acyl-CoA synthase from
FT                   Mycobacterium bovis (582 aa); MASC_MYCLE|P54200 masc
FT                   protein from Mycobacterium leprae (372 aa), FASTA scores:
FT                   opt: 888, E(): 0, (44.2% identity in 342 aa overlap). Also
FT                   similar to Y06J_MYCTU|Q10976 hypothetical 67.9 kDa protein
FT                   (626 aa), FASTA scores: opt: 1463, E(): 0, (42.4% identity
FT                   in 568 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0404"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43135"
FT                   /db_xref="GOA:P9WQ57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQ57"
FT                   /protein_id="CCP43135.1"
FT                   /translation="MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRV
FT                   TAVSAYLISYGRHADRRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLRDKRT
FT                   GLAVLDCAADVVLTTSQAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSD
FT                   WSSYLQYTSGSTANPRGVVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHD
FT                   MGLMVGLFIPLFVGCPVILTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTS
FT                   EEDMAGLDLGHVNTIINGAEQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLAT
FT                   TKAGSPPTSTEFDADSLARGHAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELG
FT                   PGRIGEIWIHGKNVSTGYHNADDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDE
FT                   FYIVGRMKDLIIQDGVNHYPDDIETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHG
FT                   PDKVTIMDFSTIKRLVVSALSKLHGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGAN
FT                   KLQRVATFP"
FT   gene            485731..489939
FT                   /gene="pks6"
FT                   /locus_tag="Rv0405"
FT   CDS_pept        485731..489939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks6"
FT                   /locus_tag="Rv0405"
FT                   /product="Probable membrane bound polyketide synthase Pks6"
FT                   /note="Rv0405, (MTCY22G10.01), len: 1402 aa. Probable
FT                   pks6,membrane-bound polyketide synthase (see citation
FT                   below),highly similar to others e.g. CAC29643.1|AL583917
FT                   putative polyketide synthase from Mycobacterium leprae
FT                   (2103 aa); Y06K_MYCTU|Q10977 probable polyketide synthase
FT                   (1876 aa),FASTA scores: opt: 2303, E(): 0, (38.7% identity
FT                   in 1232 aa overlap); etc. Contains PS00606 Beta-ketoacyl
FT                   synthases active site, 2 x PS00017 ATP/GTP-binding site
FT                   motif A (P-loop), and PS00012 Phosphopantetheine attachment
FT                   site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0405"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43136"
FT                   /db_xref="GOA:O86335"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:O86335"
FT                   /inference="protein motif:PROSITE:PS00606"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /inference="protein motif:PROSITE:PS00012"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43136.1"
FT                   /translation="MTDGSVTADKLQKWFREYLSTHIECHPNEVSLDVPIRDLGLKSID
FT                   VLAIPGDLGDRFGFCIPDLAVWDNPSANDLIDSLLNQRSADSLRESHGHADRNTQGRGS
FT                   INEPVAVIGVGCRFPGDIDGPERLWDFLTEKKCAITAYPDRGFTNAGTFAESGGFLKDV
FT                   AGFDNRFFDIPPDEALRMDPQQRLLLEVSWEALEHAGIIPESLRLSRTGVFVGVSSTDY
FT                   VRLVSASAQQKSTIWDNTGGSSSIIANRISYFLDIQGPSIVIDTACSSSLVAVHLACRS
FT                   LSTWDCDIALVGGTNVLISPEPWGGFREAGILSQTGCCHAFDKSADGMVRGEGCGVIVL
FT                   QRLSDARLEGRRILAILTGSAVNQDGKSNGIMAPNPSAQIGVLENACKSARVDPLEIGY
FT                   VEAHGTGTSLGDRIEAHALGMVFGRKRPGSGPLMIGSIKPNIGHLEGAAGIAGLIKAVL
FT                   MVERGSLLPSGGFTEPNPAIPFTELGLRVVDELQEWPVVAGRPRRAGVSSFGFGGTNAH
FT                   VIVEEAGSVGADTVSGRADVGGSGGGVVAWVISGKTASALAAQAGRLGRYVRARPALDV
FT                   VDVGYSLVSTRSVFDHRAVVVGQTRDELLAGLAGVVAGRPEAGVVCGVGKPAGKTAFVF
FT                   AGQGSQWLGMGSELYAAYPVFAEALDAVVDELDRHLRYPLRDVIWGHDQDLLNTTEFAQ
FT                   PALFAVEVALYRLLMSWGVRPGLVLGHSVGELAAAHVAGALCLPDAAMLVAARGRLMQA
FT                   LPAGGAMFAVQAREDEVAPMLGHDVSIAAVNGPASVVISGAHDAVSAIADRLRGQGRRV
FT                   HRLAVSHAFHSALMEPMIAEFTAVAAELSVGLPTIPVISNVTGQLVADDFASADYWARH
FT                   IRAVVRFGDSVRSAHCAGASRFIEVGPGGGLTSLIEASLADAQIVSVPTLRKDRPEPVS
FT                   VMTAAAQGFVSGMGLDWASVFSGYRPKRVELPTYAFQHQKFWLAPAPSVSDPTAAGQIG
FT                   ASDGGAELLASSGFAARLAGRSADEQLAAAIEVVCEHAAAVLGRDGAAGLDAGQAFADS
FT                   GFNSLSAVELRNRLTAVTAVTLPATAIFDHPTPTELAQYLITQIDGHGSSAAAAANPAE
FT                   RIDALTDLFLQACDAGRDADGWKMVALASNTRERMSSPVRNNVSKNVALLADGISDVVV
FT                   ICIPTLTVLSDQREYRDIANAMTGRHSVYSLTLPGFDSSDALPQNADMIVETVSNAIID
FT                   VVGGSCRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDTYLPSQIANPSMNEGFS
FT                   PNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPGRSMAPVLNIVAKDRIA
FT                   TVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMSTSSEAIATEIHDWISGLVRGPHR
FT                   "
FT   gene            complement(489887..490705)
FT                   /locus_tag="Rv0406c"
FT   CDS_pept        complement(489887..490705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0406c"
FT                   /product="Beta lactamase like protein"
FT                   /note="Rv0406c, (MTCY22G10.02c), len: 272 aa.
FT                   Beta-lactamase-like protein, equivalent to
FT                   AAD38170.1|AF152397_1 beta-lactamase-like protein from
FT                   Mycobacterium phlei (243 aa); AL023514|MLCB4_8 hypothetical
FT                   protein from Mycobacterium leprae (251 aa), FASTA scores:
FT                   opt: 1284, E(): 0, (74.9% identity in 243 aa overlap); and
FT                   AAD38164.1|AF152394_2 beta-lactamase-like protein from
FT                   Mycobacterium avium (247 aa), FASTA scores: opt: 1301, E():
FT                   0, (74.2% identity in 244 aa overlap); etc. Also slight
FT                   similarity to others beta-lactamases and hypothetical
FT                   proteins e.g. P52700|BLA1_XANMA|628530|S45349
FT                   metallo-beta-lactamase L1 precursor (beta-lactamase, type
FT                   II) (penicillinase) from Xanthomonas maltophilia (290
FT                   aa),FASTA scores: (34.4% identity in 96 aa overlap).
FT                   Recombinant protein has beta lactamase activity (See
FT                   Nampoothiri et al., 2008)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0406c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43137"
FT                   /db_xref="GOA:O86336"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:O86336"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43137.1"
FT                   /translation="MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVT
FT                   DDTGVLLIDAGYPGDRAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTP
FT                   VYCHAEEVGHAKREYRENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTA
FT                   EAAAGLPGQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHS
FT                   QQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHVFR"
FT   gene            490783..491793
FT                   /gene="fgd1"
FT                   /gene_synonym="fgd"
FT                   /locus_tag="Rv0407"
FT   CDS_pept        490783..491793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgd1"
FT                   /gene_synonym="fgd"
FT                   /locus_tag="Rv0407"
FT                   /product="F420-dependent glucose-6-phosphate dehydrogenase
FT                   Fgd1"
FT                   /note="Rv0407, (MTCY22G10.03), len: 336 aa.
FT                   fgd1,F420-dependent glucose-6-phosphate
FT                   dehydrogenase,equivalent to others from Mycobacteria e.g.
FT                   AAD38165.1|AF152394_3 from Mycobacterium avium (336
FT                   aa),FASTA scores: opt: 2082, E(): 0, (89.9% identity in 336
FT                   aa overlap); AL023514|MLCB 4_7 from Mycobacterium leprae
FT                   (336 aa), FASTA scores: opt: 2069, E(): 0, (89.0% identity
FT                   in 336 aa overlap). Also similar to other dehydrogenases
FT                   e.g. CAA77276.1|Y18730 F420-dependent alcohol dehydrogenase
FT                   from Methanofollis liminatans (330 aa). Also similar to
FT                   many proteins from Mycobacterium tuberculosis e.g.
FT                   Rv0953c,Rv0791c, etc. Note that previously known as fgd."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0407"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43138"
FT                   /db_xref="GOA:P9WNE1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="PDB:3B4Y"
FT                   /db_xref="PDB:3C8N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WNE1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43138.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWR
FT                   HQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLG
FT                   VGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIY
FT                   DVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSV
FT                   DGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIA
FT                   KRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG"
FT   gene            491786..493858
FT                   /gene="pta"
FT                   /locus_tag="Rv0408"
FT   CDS_pept        491786..493858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="Rv0408"
FT                   /product="Probable phosphate acetyltransferase Pta
FT                   (phosphotransacetylase)"
FT                   /note="Rv0408, (MTCY22G10.04), len: 690 aa. Probable
FT                   pta,phosphate acetyltransferase, highly similar to others
FT                   e.g. PTA_ECOLI|P39184|11279789|JX0357|B2297 phosphate
FT                   acetyltransferase from Escherichia coli strain K12 (713
FT                   aa), FASTA scores: opt: 1303, E(): 0, (38.0% identity in
FT                   718 aa overlap); etc. Belongs to the phosphate
FT                   acetyltransferase and butyryltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0408"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43139"
FT                   /db_xref="GOA:P9WHP1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHP1"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43139.1"
FT                   /translation="MADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRL
FT                   SAERDYILELLLAHTSAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVV
FT                   VGSDYTDVTSPTELSVNGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAH
FT                   TAAVVANRCELSAIPAVTDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVA
FT                   LREREVMGVLAAGMTADHVLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVL
FT                   NGGFQLHPAIAALVSGLRLRLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELM
FT                   DRHVDVAGLLAQLTIPIPTVTTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLL
FT                   QRGIVDLTILGDEAKVRLRAAELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITV
FT                   EHAREIMNDATYFGTMLVHNCHADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFL
FT                   MCLPDRVLAYGDCAIIPNPTVEQLADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGAD
FT                   VDKVRAATELVRAREPQLPVEGPIQYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTG
FT                   NNTYKAVQRSAGAIAIGPVLQGLRKPVNDLSRGALVDDIVNTVAITAIQAQGVHE"
FT   gene            493851..495008
FT                   /gene="ackA"
FT                   /locus_tag="Rv0409"
FT   CDS_pept        493851..495008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="Rv0409"
FT                   /product="Probable acetate kinase AckA (acetokinase)"
FT                   /note="Rv0409, (MTCY22G10.05), len: 385 aa. Probable
FT                   ackA,acetate kinase, highly similar to others e.g.
FT                   ACKA_BACSU|P37877 acetate kinase from Bacillus subtilis
FT                   (395 aa), FASTA scores: opt: 974, E(): 0, (43.5% identity
FT                   in 393 aa overlap); etc. Contains PS01075 Acetate and
FT                   butyrate kinases family signature 1, PS00758 ArgE / dapE /
FT                   ACY1/ CPG2 / yscS family signature 1. Belongs to the
FT                   acetokinase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0409"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43140"
FT                   /db_xref="GOA:P9WQH1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WQH1"
FT                   /inference="protein motif:PROSITE:PS01075"
FT                   /inference="protein motif:PROSITE:PS00758"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43140.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
FT   gene            complement(495062..497314)
FT                   /gene="pknG"
FT                   /locus_tag="Rv0410c"
FT   CDS_pept        complement(495062..497314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknG"
FT                   /locus_tag="Rv0410c"
FT                   /product="Serine/threonine-protein kinase PknG (protein
FT                   kinase G) (STPK G)"
FT                   /note="Rv0410c, (MTCY22G10.06c), len: 750 aa.
FT                   PknG,serine/threonine-protein kinase (see citations
FT                   below),equivalent to
FT                   PKNG_MYCLE|P57993|13092623|CAC29812.1|AL583918 probable
FT                   serine/threonine-protein kinase from Mycobacterium leprae
FT                   (767 aa). Also similar to others e.g. AB76890.1|AL159139
FT                   putative serine/threonine protein kinase from Streptomyces
FT                   coelicolor (774 aa); etc. Contains PS00108 Serine/Threonine
FT                   protein kinases active-site signature. Contains Hank's
FT                   kinase subdomain. Belongs to the Ser/Thr family of protein
FT                   kinases. Structure of PknG with inhibitor AX20017 reveals
FT                   that the inhibitor-binding pocket is shaped by a unique set
FT                   of amino acid side chains not found in any human kinase
FT                   (See Scherr et al., 2007)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0410c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43141"
FT                   /db_xref="GOA:P9WI73"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="PDB:2PZI"
FT                   /db_xref="PDB:4Y0X"
FT                   /db_xref="PDB:4Y12"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI73"
FT                   /inference="protein motif:PROSITE:PS00108"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43141.1"
FT                   /translation="MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN
FT                   FPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKR
FT                   FCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLG
FT                   WIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR
FT                   HGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN
FT                   IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL
FT                   DLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV
FT                   VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLV
FT                   DPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGD
FT                   VAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLAL
FT                   AATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH
FT                   FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK
FT                   DNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF"
FT   gene            complement(497314..498300)
FT                   /gene="glnH"
FT                   /locus_tag="Rv0411c"
FT   CDS_pept        complement(497314..498300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="Rv0411c"
FT                   /product="Probable glutamine-binding lipoprotein GlnH
FT                   (GLNBP)"
FT                   /note="Rv0411c, (MTCY22G10.07c), len: 328 aa. Probable
FT                   glnH, glutamine-binding protein, membrane-bound lipoprotein
FT                   (see citation below), equivalent to
FT                   AL035159|MLCB1450_15|T44736|4154051|CAA22704.1
FT                   glutamine-binding protein homolog from Mycobacterium leprae
FT                   (325 aa), FASTA scores: opt: 1747, E(): 0, (79.3% identity
FT                   in 328 aa overlap). Also similar to others e.g.
FT                   GLNH_BACST|P27676 glutamine-binding protein precursor from
FT                   Bacillus stearothermophilus (262 aa), FASTA scores: opt:
FT                   493, E(): 7.5e-22, (37.8% identity in 193 aa overlap); etc.
FT                   Contains PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site, PS01039 Bacterial extracellular
FT                   solute-binding proteins, family 3 signature. Belongs to the
FT                   bacterial extracellular solute-binding protein family 3.
FT                   Presumed attached to the membrane by a lipid anchor."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0411c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43142"
FT                   /db_xref="GOA:P96257"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="PDB:6H1U"
FT                   /db_xref="PDB:6H20"
FT                   /db_xref="PDB:6H2T"
FT                   /db_xref="UniProtKB/TrEMBL:P96257"
FT                   /inference="protein motif:PROSITE:PS01039"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43142.1"
FT                   /translation="MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTP
FT                   VGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNL
FT                   FSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTM
FT                   SITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAP
FT                   PPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGIN
FT                   LDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD"
FT   gene            complement(498300..499619)
FT                   /locus_tag="Rv0412c"
FT   CDS_pept        complement(498300..499619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0412c"
FT                   /product="Possible conserved membrane protein"
FT                   /note="Rv0412c, (MTCY22G10.08c), len: 439 aa. Possible
FT                   conserved membrane protein, equivalent to
FT                   AL035159|MLCB1450_16|T44737 probable membrane protein from
FT                   Mycobacterium leprae (403 aa), FASTA scores: opt: 2027,E():
FT                   0, (80.4% identity in 403 aa overlap). Also some similarity
FT                   with CAB71201.1|AL138538 putative secreted protein from
FT                   Streptomyces coelicolor (429 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0412c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43143"
FT                   /db_xref="GOA:P96258"
FT                   /db_xref="UniProtKB/TrEMBL:P96258"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43143.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSDISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
FT   gene            499713..500366
FT                   /gene="mutT3"
FT                   /locus_tag="Rv0413"
FT   CDS_pept        499713..500366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT3"
FT                   /locus_tag="Rv0413"
FT                   /product="Possible mutator protein MutT3
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase) (8-oxo-dGTPase)
FT                   (dGTP pyrophosphohydrolase)"
FT                   /note="Rv0413, (MTCY22G10.10), len: 217 aa. Possible
FT                   mutT3,mutator protein (see citation below), showing some
FT                   similarity with e.g. MUTT_PROVU|P32090 mutator mutt protein
FT                   from Proteus vulgaris (112 aa), FASTA scores: opt: 151,E():
FT                   0.0008, (40.7% identity in 59 aa overlap). Seems to belong
FT                   to the NUDIX hydrolase family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0413"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43144"
FT                   /db_xref="GOA:P9WIX9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIX9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43144.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
FT   gene            complement(500350..501018)
FT                   /gene="thiE"
FT                   /locus_tag="Rv0414c"
FT   CDS_pept        complement(500350..501018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="Rv0414c"
FT                   /product="Thiamine-phosphate pyrophosphorylase ThiE (TMP
FT                   pyrophosphorylase) (TMP-PPASE) (thiamine-phosphate
FT                   synthase)"
FT                   /note="Rv0414c, (MTCY22G10.11c), len: 222 aa. thiE, thiamin
FT                   phosphate pyrophosphorylase, equivalent to
FT                   Q9ZBL5|AL035159|MLCB1450_17 probable thiamine-phosphate
FT                   pyrophosphorylase from Mycobacterium leprae (235 aa), FASTA
FT                   scores: opt: 1095, E(): 0, (78.0% identity in 223 aa
FT                   overlap). Also similar to others e.g.
FT                   T34974|5689976|CAB52013.1|AL109663 probable thiamin
FT                   phosphate pyrophosphorylase from Streptomyces coelicolor
FT                   (223 aa); THIE_ECOLI|P30137 thie protein from Escherichia
FT                   coli strain K12 (211 aa), FASTA scores: opt: 275, E():
FT                   7.8e-12, (37.8% identity in 196 aa overlap); etc. Belongs
FT                   to the TMP-PPASE family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0414c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43145"
FT                   /db_xref="GOA:P9WG75"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="PDB:3O63"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG75"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43145.1"
FT                   /translation="MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKG
FT                   SPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPV
FT                   NVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVA
FT                   AELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
FT                   "
FT   gene            501148..502170
FT                   /gene="thiO"
FT                   /locus_tag="Rv0415"
FT   CDS_pept        501148..502170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="Rv0415"
FT                   /product="Possible thiamine biosynthesis oxidoreductase
FT                   ThiO"
FT                   /note="Rv0415, (MTCY22G10.12), len: 340 aa. Possible
FT                   thiO,thiamine biosynthesis oxidoreductase, equivalent to
FT                   T44739|4154054|CAA22708.1|AL035159|MLCB1450.24 hypothetical
FT                   protein from Mycobacterium leprae (340 aa), FASTA scores:
FT                   opt: 1867, E(): 0, (82.0% identity in 338 aa overlap).
FT                   Shows some similarity to other thiO proteins e.g.
FT                   THIO_RHIET|O34292 Putative thiamine biosynthesis
FT                   oxidoreductase from Rhizobium etli plasmid pb (327 aa) (see
FT                   citation below); AAG31046.1|AF264948_8|THIO putative amino
FT                   acid oxidase flavoprotein ThiO from Erwinia amylovora (349
FT                   aa); NP_106392.1|14025578|BAB52178.1|AP003007|THIO thiamine
FT                   biosynthesis oxidoreductase THIO from Mesorhizobium loti
FT                   (333 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0415"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43146"
FT                   /db_xref="GOA:P96261"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:P96261"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43146.1"
FT                   /translation="MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASW
FT                   VAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADV
FT                   ADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDC
FT                   ERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLP
FT                   QRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEY
FT                   ELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
FT                   "
FT   gene            502167..502373
FT                   /gene="thiS"
FT                   /locus_tag="Rv0416"
FT   CDS_pept        502167..502373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="Rv0416"
FT                   /product="Possible protein ThiS"
FT                   /note="Rv0416, (MTCY22G10.13), len: 68 aa. Possible thiS
FT                   protein, equivalent to
FT                   T44740|4154055|CAA22709.1|AL035159|MLCB1450.25 hypothetical
FT                   protein from Mycobacterium leprae (74 aa), FASTA scores:
FT                   opt: 303, E(): 2e-18, (71.6% identity in 74 aa overlap).
FT                   Shows weak similarity with O32583|THIS_ECOLI|THIG1|B3991.1
FT                   this protein from Escherichia coli strain K12 (66 aa),FASTA
FT                   scores: opt: 103, E(): 0.052, (30.9% identity in 68 aa
FT                   overlap). A core mycobacterial gene; conserved in
FT                   mycobacterial strains (See Marmiesse et al., 2004)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0416"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43147"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:P96262"
FT                   /protein_id="CCP43147.1"
FT                   /translation="MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSD
FT                   WATKICELRKPVRLEVVTAVQGG"
FT   gene            502366..503124
FT                   /gene="thiG"
FT                   /locus_tag="Rv0417"
FT   CDS_pept        502366..503124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="Rv0417"
FT                   /product="Probable thiamin biosynthesis protein ThiG
FT                   (thiazole biosynthesis protein)"
FT                   /note="Rv0417, (MTCY22G10.14), len: 252 aa. Probable
FT                   thiG,thiamin biosynthesis protein, equivalent to
FT                   AL035159|MLCB1450_20|T44741|THIG probable thiamin
FT                   biosynthesis protein from Mycobacterium leprae (261
FT                   aa),FASTA scores: opt: 1380, E(): 0, (86.8% identity in 250
FT                   aa overlap). Also highly similar to others e.g.
FT                   SCOEDB|SC6E10.03|T35490|THIG probable thiazole biosynthesis
FT                   protein from Streptomyces coelicolor (264 aa);
FT                   F82761|9105679|AAF83593.1|AE003919_4|XF0783|THIG thiamin
FT                   biosynthesis protein thiG from Xylella fastidiosa (275 aa);
FT                   P30139|THIG_ECOLI|7448315|B65206|409790|AAC43089.1|U00006
FT                   THIG protein thiamin biosynthesis protein from Escherichia
FT                   coli strain K-12 (281 aa); etc. Belongs to the THIG
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0417"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43148"
FT                   /db_xref="GOA:P9WG73"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="PDB:5Z9Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG73"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43148.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGSRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
FT   gene            503496..504998
FT                   /gene="lpqL"
FT                   /locus_tag="Rv0418"
FT   CDS_pept        503496..504998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqL"
FT                   /locus_tag="Rv0418"
FT                   /product="Probable lipoprotein aminopeptidase LpqL"
FT                   /note="Rv0418, (MTCCY22G10.15), len: 500 aa. Probable
FT                   lpqL,lipoprotein aminopeptidase, similar to others e.g.
FT                   B83278|9949035|AAG06327.1|AE004720_3|AE004720|PA2939
FT                   probable aminopeptidase from Pseudomonas aeruginosa (536
FT                   aa); P80561|APX_STRGR|SGAP|S66427 aminopeptidase from
FT                   Streptomyces griseus (284 aa) (homology only with
FT                   C-terminus of Rv0418); P37302|APE3_YEAST|1077010|A54134
FT                   aminopeptidase Y from Saccharomyces cerevisiae (537 aa);
FT                   etc. Contains PS00013 Prokaryotic membrane lipoprotein
FT                   lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0418"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43149"
FT                   /db_xref="GOA:P96264"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96264"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43149.1"
FT                   /translation="MVNKSRMMPAVLAVAVVVAFLTTGCIRWSTQSRPVVNGPAAAEFA
FT                   VALRNRVSTDAMMAHLSKLQDIANANDGTRAVGTPGYQASVDYVVNTLRNSGFDVQTPE
FT                   FSARVFKAEKGVVTLGGNTVEARALEYSLGTPPDGVTGPLVAAPADDSPGCSPSDYDRL
FT                   PVSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDEQAMGGTLGANTDVKIPVVSV
FT                   TKSVGFQLRGQSGPTTVKLTASTQSFKARNVIAQTKTGSSANVVMAGAHLDSVPEGPGI
FT                   NDNGSGVAAVLETAVQLGNSPHVSNAVRFAFWGAEEFGLIGSRNYVESLDIDALKGIAL
FT                   YLNFDMLASPNPGYFTYDGDQSLPLDARGQPVVPEGSAGIERTFVAYLKMAGKTAQDTS
FT                   FDGRSDYDGFTLAGIPSGGLFSGAEVKKSAEQAELWGGTADEPFDPNYHQKTDTLDHID
FT                   RTALGINGAGVAYAVGLYAQDLGGPNGVPVMADRTRHLIAKP"
FT   gene            505086..506582
FT                   /gene="lpqM"
FT                   /locus_tag="Rv0419"
FT   CDS_pept        505086..506582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqM"
FT                   /locus_tag="Rv0419"
FT                   /product="Possible lipoprotein peptidase LpqM"
FT                   /note="Rv0419, (MTCY22G10.16), len: 498 aa. Possible
FT                   lpqM,lipoprotein peptidase ; has potential N-terminal
FT                   signal peptide and contains PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site, PS00142 Neutral zinc
FT                   metallopeptidases, zinc-binding region signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0419"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43150"
FT                   /db_xref="GOA:P96265"
FT                   /db_xref="UniProtKB/TrEMBL:P96265"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /inference="protein motif:PROSITE:PS00142"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43150.1"
FT                   /translation="MHGRGRYRPLVRCVRPRRVAASVRTPIACLAAVVVIAGCTTVVDG
FT                   RALSILNDPFRVGGLPATNGPSGARPDAPAASGTVINTNNGAIDKLSLLSVNDIEDYWM
FT                   AVYSESLKGTFRPVGKLVSYDSNDPSSPIVCHIDTYQLVNAFFSSRCNLIAWDRGVFMA
FT                   VAQEYFGDMSVNGVLAHEFGHALQVMANLVTRKDPTIVREQQADCFAGVYLWWVAEGKS
FT                   TRFTLSTADGLDHVLAGIITTRDPVMEADAENDDEHGSALDRVSAFQLGFINGTPACAA
FT                   IDEDEVERRRGDLPTALRVDASGNPETGEVGINEETLSTLMELMGKIFSPKNPPTLSYQ
FT                   PAGCPDAKPSPPAAYCPATNTIVVDLPALARMGKVASAAEHSLPQGDDTSLSIVMSRYA
FT                   LAVQHERGLPMQSPWTALRTACLTGVAHRKMAVPIDLPSGQQLVLTAGDLDEAVSGLLT
FT                   NRMVASDADGVSVPAGFTRIAAFRAGVGGDMDACYARYPG"
FT   gene            complement(506561..506971)
FT                   /locus_tag="Rv0420c"
FT   CDS_pept        complement(506561..506971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0420c"
FT                   /product="Possible transmembrane protein"
FT                   /note="Rv0420c, (MTCY22G10.17c), len: 136 aa. Possible
FT                   transmembrane protein; has potential transmembrane domains
FT                   aa 53-99 and aa 100-122."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0420c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43151"
FT                   /db_xref="GOA:P96266"
FT                   /db_xref="UniProtKB/TrEMBL:P96266"
FT                   /protein_id="CCP43151.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
FT   gene            complement(507132..507761)
FT                   /locus_tag="Rv0421c"
FT   CDS_pept        complement(507132..507761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0421c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0421c, (MTCY22G10.18c), len: 209 aa. Conserved
FT                   hypothetical protein, showing similarity with
FT                   NP_103507.1|14022684|BAB49293.1|AP002998 hypothetical
FT                   protein from Mesorhizobium loti (214 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0421c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43152"
FT                   /db_xref="GOA:P96267"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:P96267"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43152.1"
FT                   /translation="MNLDQIAGVAHQPAGPPHGVVVLTHGAGGSRESTLLQQVCAEWTR
FT                   RGWLAVRYNLPYRRRRPTGPPSGSGSGDRAGIVEAIQLCRGLAEGPLIAGGHSYGGRQT
FT                   SMVVAAGQAPVDVLTLFSYPVHPPGKPERVRTEHLPGIAVPTVFTHGTADPFGTLAQVR
FT                   SAAAMVSAPTEVVEITGARHDLGSKTLDVARLAVDAALRLSAGQIA"
FT   gene            complement(507758..508555)
FT                   /gene="thiD"
FT                   /locus_tag="Rv0422c"
FT   CDS_pept        complement(507758..508555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="Rv0422c"
FT                   /product="Probable phosphomethylpyrimidine kinase ThiD
FT                   (HMP-phosphate kinase) (HMP-P kinase)"
FT                   /note="Rv0422c, (MTCY22G10.19c), len: 265 aa. Probable
FT                   thiD, phosphomethylpyrimidine kinase, equivalent to
FT                   AL035159|MLCB1450_21 phosphomethylpyrimidine kinase from
FT                   Mycobacterium leprae (279 aa), FASTA scores: opt: 1386,E():
FT                   0, (77.8% identity in 266 aa overlap). Also highly similar
FT                   to others e.g. HIU32725_3|P44697|THID_HAEIN
FT                   phosphomethylpyrimidine kinase from Haemophilus influenzae
FT                   (269 aa), FASTA scores: opt: 605, E(): 0, (42.1% identity
FT                   in 259 aa overlap). Belongs to the ThiD family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0422c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43153"
FT                   /db_xref="GOA:P9WG77"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG77"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43153.1"
FT                   /translation="MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQN
FT                   TLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLV
FT                   VDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAK
FT                   ALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAA
FT                   ALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS"
FT   gene            complement(508582..510225)
FT                   /gene="thiC"
FT                   /locus_tag="Rv0423c"
FT   CDS_pept        complement(508582..510225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="Rv0423c"
FT                   /product="Probable thiamine biosynthesis protein ThiC"
FT                   /note="Rv0423c, (MTCY22G10.20c), len: 547 aa. Probable
FT                   thiC, thiamin biosynthesis protein, equivalent to
FT                   Q9ZBL0|THIC_MYCLE|11279601|T44743|AL035159|MLCB1450_22
FT                   thiamine biosynthesis protein from Mycobacterium leprae
FT                   (547 aa), FASTA scores: opt: 3283, E(): 0, (90.1% identity
FT                   in 547 aa overlap). Also highly similar to others e.g.
FT                   P45740|THIC_BACSU thiamin biosynthesis protein from
FT                   Bacillus subtilis (590 aa), FASTA scores: opt: 2295, E():
FT                   0, (65.2% identity in 580 aa overlap); P30136|THIC_ECOLI
FT                   THIC protein from Escherichia coli strain K12 (631
FT                   aa),FASTA scores: opt: 2141, E(): 0, (62.1% identity in 568
FT                   aa overlap); etc. Belongs to the ThiC family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0423c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43154"
FT                   /db_xref="GOA:P9WG79"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WG79"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43154.1"
FT                   /translation="MTITVEPSVTTGPIAGSAKAYREIEAPGSGATLQVPFRRVHLSTG
FT                   DHFDLYDTSGPYTDTDTVIDLTAGLPHRPGVVRDRGTQLQRARAGEITAEMAFIAARED
FT                   MSAELVRDEVARGRAVIPANHHHPESEPMIIGKAFAVKVNANIGNSAVTSSIAEEVDKM
FT                   VWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPIYQALEKVKGDPTELTWEIY
FT                   RDTVIEQCEQGVDYMTVHAGVLLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYT
FT                   NFEELCDIFARYDVTFSLGDGLRPGSIADANDAAQFAELRTLGELTKIAKAHGAQVMIE
FT                   GPGHIPMHKIVENVRLEEELCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAM
FT                   LCYVTPKEHLGLPDRKDVKDGVIAYKIAAHAADLAKGHPRAQERDDALSTARFEFRWND
FT                   QFALSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRITQDVREYAAEHGLETEA
FT                   DIEAVLAAGMAEKSREFAEHGNRVYLPITQ"
FT   gene            complement(510377..510652)
FT                   /locus_tag="Rv0424c"
FT   CDS_pept        complement(510377..510652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0424c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0424c, (MTCY22G10.21c), len: 91 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0424c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43155"
FT                   /db_xref="UniProtKB/TrEMBL:P96270"
FT                   /protein_id="CCP43155.1"
FT                   /translation="MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAY
FT                   YGGLAALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA"
FT   gene            complement(510702..515321)
FT                   /gene="ctpH"
FT                   /locus_tag="Rv0425c"
FT   CDS_pept        complement(510702..515321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpH"
FT                   /locus_tag="Rv0425c"
FT                   /product="Possible metal cation transporting P-type ATPase
FT                   CtpH"
FT                   /note="Rv0425c, (MTCY22G10.22c), len: 1539 aa. Possible
FT                   ctpH, metal cation-transporting P-type ATPase
FT                   (transmembrane protein), showing some similarity with
FT                   CAA17934.1|AL022118|13093871|CAC32203.1|AL583926 putative
FT                   cation-transporting ATPase from Mycobacterium leprae (1609
FT                   aa). Also similar to others ATPases e.g. AE000873_1
FT                   cation-transporting P-ATPase from Methanobacterium
FT                   thermoautotrop (844 aa), FASTA score: (30.5% identity in
FT                   827 aa overlap); AB69720.1|AL137166 putative transport
FT                   ATPase from Streptomyces coelicolor (1472 aa); etc.
FT                   C-terminal region similar to other ATPases from
FT                   Mycobacterium tuberculosis e.g. Y05Q_MYCTU|Q10900 putative
FT                   cation-transporting ATPase C (855 aa), FASTA scores: opt:
FT                   770, E(): 5.3e-32, (44.9% identity in 820 aa overlap).
FT                   Nucleotide position 511518 in the genome sequence has been
FT                   corrected, T:G resulting in I1268I."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0425c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43156"
FT                   /db_xref="GOA:P96271"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:P96271"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43156.1"
FT                   /translation="MPVRAVATGFRATATLTGASITAATAVSATLAKTGVGTGMKVAII
FT                   PLRAGAKALSGELSRETLGRNCWRGERRAWIEVRGLRSGGDDELGRVVLNAIQAHPGVG
FT                   SASLNYPLSRVVVAIDDPDTSLRELCRIVDDAEKAERHRHPDQAADQLAQSPGSLPGDG
FT                   VLLAVRAVTVAATAAGLGLALGGRALRWPRFPLVIEAAVAAVDHQPLLRRLLEDRIGTE
FT                   ATATVLELAMAAAHTVTLSPAALSVDLTIQALKAAECRAGARAWRRHEPQLALHADEPA
FT                   DQPQSLWPRPARSTQPVQRSVARFALIQALSAVLVGAGTRDADMAATATLVATPKASRT
FT                   TPEAFAAALGQGLADQHAVLPLRPESLRRLDRVDAIVIDPRVLCTDDLRVARIRGCGAD
FT                   ELSTAWNRAQLVLTESGLRPGWHRVPGVSASGSDSAVEALFRPMHDRLASAVVAEAHRT
FT                   GADLVSVDVDALGELRPVFDDIRPLDDGASGSLDEALARAVAELRQAGRTVAVLSSVGK
FT                   QALSAADVALGVLPPPGAGAPPWYADVLLPDLGAAWRVLHAIPAARAARQRGNEISGGA
FT                   SALGALLMLPGVRGLGPGPVTTGAAAGLLSGYLLARKVVDAQAPRPAPAHEWHAMSVEQ
FT                   VRKALPSPDEQAPAKAPPSPYPARALAGGLHTAKRGAQITQAPLNALWQLTKAMRAELS
FT                   DPLTPMLALGAMASAVLGSPVDAVMVGSVLTGNSILAASQRLRAESRLNRLLAQQIPPA
FT                   RKVLAGADDQPRYIEVRAEELRPGDIIEVRTHEVVPADARVIEEVDVEVDESALTGESL
FT                   SVTKQVEPTPGVDLIERRCMLYAGTTVVSGTAVAVVTAVGPDTQERRAAELVSGDLSSV
FT                   GLQHQLSRLTNQAWPVSMTGGALVTGLGLLRRRGLRQAVASGIAVTVAAVPEGMPLVAT
FT                   LAQQASARRLSHFGALVRIPRSVEALGRVDMVCFDKTGTLSENRLRVAQVRPVAGHSRE
FT                   EVLRCAAHAAPASNGPQVHATDVAIVQAAAAAAASGTDGAEPGAAEPAAHLPFRSGRSF
FT                   SASVSGTELTVKGAPEVVLAACEGIGSSMDDAVAELAANGLRVIAVAHRQLTAQQAQSV
FT                   VDDPDEIARLCRDELSLVGFLGLSDTPRAQAAALLADLHEHDLDIRLITGDHPITAAAI
FT                   AEELGMQVSPEQVISGAEWDALSRKDQERAVAERVIFARMTPENKVQIVQTLEHSGRVC
FT                   AMVGDGSNDAAAIRAATVGIGVVAHGSDPARVAADLVLVDGRIESLLPAILEGRQLWQR
FT                   VQAAVSVLLGGNAGEVAFAIIGSAITGTSPLNTRQLLLVNMLTDALPAAALAVSKPSDP
FT                   VTPATRGPDQRELWRAVGIRGATTAAAATVAWVMAGFTGLPRRASTVALVALVAAQLGQ
FT                   TLVDSHAWLVVLTALGSLAALATLISIPVVSQLLGCTPLDPLGWAQATAAATAATVAVA
FT                   VLNRVLTGRDKSGQPNPQPPETDALSRDASPGAPPGPRRRRRATARRKAPVKAPSATRQ
FT                   TTKPKGPPAHRSSSTYPRR"
FT   gene            complement(515373..515816)
FT                   /locus_tag="Rv0426c"
FT   CDS_pept        complement(515373..515816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0426c"
FT                   /product="Possible transmembrane protein"
FT                   /note="Rv0426c, (MTCY22G10.23c), len: 147 aa. Possible
FT                   transmembrane protein; has potential transmembrane domains
FT                   aa 19-41, and aa 61-83."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0426c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43157"
FT                   /db_xref="GOA:P96272"
FT                   /db_xref="UniProtKB/TrEMBL:P96272"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43157.1"
FT                   /translation="MSVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAA
FT                   KGIQKGLSSGSKSTAAAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPV
FT                   KAKLAPVPDKPAAAKEAPAKASKTTARKTSGRRAGTAELRSTN"
FT   gene            complement(516017..516892)
FT                   /gene="xthA"
FT                   /gene_synonym="xth"
FT                   /locus_tag="Rv0427c"
FT   CDS_pept        complement(516017..516892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /gene_synonym="xth"
FT                   /locus_tag="Rv0427c"
FT                   /product="Probable exodeoxyribonuclease III protein XthA
FT                   (exonuclease III) (EXO III) (AP endonuclease VI)"
FT                   /note="Rv0427c, (MTCY22G10.24c), len: 291 aa. Probable xthA
FT                   (alternate gene name: xth), exodeoxyribonuclease III
FT                   protein (see citation below), similar to others e.g.
FT                   EX3_ECOLI|P09030 exodeoxyribonuclease III from Escherichia
FT                   Coli strain K12 (268 aa), FASTA scores: opt: 360, E():
FT                   1.2e-17, (29.3% identity in 270 aa overlap); etc. Belongs
FT                   to the AP/EXOA family of DNA repair enzymes."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0427c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43158"
FT                   /db_xref="GOA:P96273"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:P96273"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43158.1"
FT                   /translation="MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWL
FT                   GRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFD
FT                   GQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTA
FT                   EGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVV
FT                   RPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDH
FT                   APVLVDLHAG"
FT   gene            complement(516895..517803)
FT                   /locus_tag="Rv0428c"
FT   CDS_pept        complement(516895..517803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0428c"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="Rv0428c, (MTCY22G10.25c), len: 302 aa. Probable
FT                   acetyltransferase. Contains GNAT (Gcn5-related
FT                   N-acetyltransferase) domain in C-terminal part. See Vetting
FT                   et al. 2005."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0428c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43159"
FT                   /db_xref="GOA:P96274"
FT                   /db_xref="UniProtKB/TrEMBL:P96274"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43159.1"
FT                   /translation="MVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKT
FT                   GTIVEFSPVDVVALRVLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGHGAVL
FT                   AANSAVPLDISAHTNTITEISAWYASRDLQPWLAVPDRLLPLPADLAGERREQVLVRDV
FT                   STGEPDRSVTLLDHPDDTWLRLYHQRLPLDMATPVIDGELAFGSYLGVAVARAAVTDAP
FT                   DGTRWVGLSAMRAADEQSATGSAGRQLWEALLGWGAGRGATRGYVRVHDTATSVLAESL
FT                   GFRLHHHCRYLPAQSVGWDTF"
FT   gene            complement(517803..518396)
FT                   /gene="def"
FT                   /locus_tag="Rv0429c"
FT   CDS_pept        complement(517803..518396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="Rv0429c"
FT                   /product="Probable polypeptide deformylase Def (PDF)
FT                   (formylmethionine deformylase)"
FT                   /note="Rv0429c, (MTCY22G10.26c), len: 197 aa. Probable
FT                   def,polypeptide deformylase, equivalent to
FT                   CAC30884.1|AL583923 polypeptide deformylase from
FT                   Mycobacterium leprae (197 aa). Also similar to others e.g.
FT                   DEF_ECOLI|P27251|95874|S23107 polypeptide deformylase from
FT                   Escherichia coli (169 aa),FASTA scores: opt: 179, E():
FT                   1.8e-05, (34.6% identity in 162 aa overlap); etc. Belongs
FT                   to the polypeptide deformylase family. Cofactor: binds 1
FT                   zinc ion."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0429c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43160"
FT                   /db_xref="GOA:P9WIJ3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="PDB:3E3U"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WIJ3"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43160.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
FT   gene            518733..519041
FT                   /locus_tag="Rv0430"
FT   CDS_pept        518733..519041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0430"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0430, (MTCY22G10.27), len: 102 aa. Conserved
FT                   hypothetical protein, equivalent to AC30882.1|AL583923
FT                   conserved hypothetical protein from Mycobacterium leprae
FT                   (102 aa). Also highly similar to
FT                   CAB93047.1|SCD95A.20|AL357432 hypothetical protein from
FT                   Streptomyces coelicolor (84 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0430"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43161"
FT                   /db_xref="GOA:P96276"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:P96276"
FT                   /protein_id="CCP43161.1"
FT                   /translation="MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            519073..519567
FT                   /locus_tag="Rv0431"
FT   CDS_pept        519073..519567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0431"
FT                   /product="Putative tuberculin related peptide"
FT                   /note="Rv0431, (MTCY22G10.28), len: 164 aa. Putative
FT                   tuberculin related peptide; almost identical to
FT                   D00815|MSGAT103_1 AT103 from Mycobacterium tuberculosis
FT                   (172 aa), FASTA score: (99.4% identity in 163 aa overlap).
FT                   Highly similar to to CAC30881.1|AL583923 tuberculin related
FT                   peptide (AT103) from Mycobacterium leprae (167 aa). Some
FT                   similarity to G550415|HRPC (282 aa), FASTA scores: opt:
FT                   120, E(): 0.36, (33.3% identity in 111 aa overlap).
FT                   Potential transmembrane domain at aa 19-37."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0431"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43162"
FT                   /db_xref="GOA:P96277"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:P96277"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43162.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
FT   gene            519600..520322
FT                   /gene="sodC"
FT                   /locus_tag="Rv0432"
FT   CDS_pept        519600..520322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="Rv0432"
FT                   /product="Periplasmic superoxide dismutase [Cu-Zn] SodC"
FT                   /note="Rv0432, (MTCY22G10.29), len: 240 aa.
FT                   sodC,periplasmic superoxide dismutase [Cu-Zn], equivalent
FT                   to CAC30880.1|AL583923 superoxide dismutase precursor
FT                   (Cu-Zn) from Mycobacterium leprae (240 aa); and
FT                   AAK20038.1|AF326234_1 copper zinc superoxide dismutase from
FT                   Mycobacterium avium subsp. paratuberculosis (226 aa). Also
FT                   similar to others e.g. SODC_PHOLE|P00446 superoxide
FT                   dismutase precursor (Cu-Zn) from Photobacterium leiognathi
FT                   (173 aa), FASTA scores: opt: 214, E(): 5.2 e-06, (36.5%
FT                   identity in 181 aa overlap). Contains PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site. Belongs to the
FT                   Cu-Zn superoxide dismutase family. Possibly localized in
FT                   periplasm, membrane-bound."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0432"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43163"
FT                   /db_xref="GOA:P9WGE9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="PDB:1PZS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGE9"
FT                   /inference="protein motif:PROSITE:PS00013"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43163.1"
FT                   /translation="MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGT
FT                   TPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTG
FT                   VGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQ
FT                   VRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETT
FT                   LTTGDAGKRVACGVIGSG"
FT   gene            520324..521454
FT                   /locus_tag="Rv0433"
FT   CDS_pept        520324..521454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0433"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0433, (MTCY22G10.30), len: 376 aa. Conserved
FT                   hypothetical protein, similar to other hypothetical
FT                   proteins e.g. P77213|YBDK_ECOLI hypothetical 41.7 KD
FT                   protein from Escherichia coli strain K12 (372 aa), FASTA
FT                   scores: opt: 555, E(): 2e-30, (28.2% identity in 365 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0433"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43164"
FT                   /db_xref="GOA:P9WPK9"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPK9"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43164.1"
FT                   /translation="MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIA
FT                   EIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHP
FT                   FARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPH
FT                   LLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDH
FT                   MDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMP
FT                   PWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVS
FT                   DIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI"
FT   gene            521514..522167
FT                   /locus_tag="Rv0434"
FT   CDS_pept        521514..522167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0434"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Rv0434, (MTCY22G10.31), len: 217 aa. Conserved
FT                   hypothetical protein, similar to AE002052_2 from
FT                   Deinococcus radiodurans (213 aa), FASTA scores: opt:
FT                   258,E(): 4e-10, (31.9% identity in 213 aa overlap);
FT                   SYCSLRB_122|Q55701 hypothetical 24.5 kDa protein from
FT                   Synechocystis (214 aa), FASTA scores: opt: 156, E():
FT                   0.00041, (28.4% identity in 204 aa overlap);
FT                   MXABSGA_1|LON2_MYXXA|P36774 ATP-dependent protease la 2
FT                   from Myxococcus xanthus (826 aa), FASTA scores: opt:
FT                   160,E(): 0.00068, (28.4% identity in 197 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0434"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43165"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:P96280"
FT                   /protein_id="CCP43165.1"
FT                   /translation="MADFAPVELAMFPLESAPLPDEDLPLHIFEPRYAALVRDCMDTAD
FT                   PRFGVVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCDWLPDD
FT                   PYPRAKVRFWPDQPGHPVTAAQLLEVEDRVVALFERIAAARGVRLPAREVVLGYPVVDP
FT                   ADTGQRLYALACRVPMGPADRYAVLATPSAADRLVRLGDALDSVAAMVEFELST"
FT   gene            complement(522347..524533)
FT                   /locus_tag="Rv0435c"
FT   CDS_pept        complement(522347..524533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0435c"
FT                   /product="Putative conserved ATPase"
FT                   /note="Rv0435c, (MTCY22G10.32c), len: 728 aa. Putative
FT                   conserved ATPase, similar to others e.g. SAV_SULAC|Q07590
FT                   sav protein involved in cell division from sulfolobus
FT                   acidocaldarius (780 aa), FASTA scores: opt: 897, E():
FT                   0,(34.5% identity in 693 aa overlap);
FT                   NP_148637.1|7435761|B72479 transitional endoplasmic
FT                   reticulum ATPase from Aeropyrum pernix (699 aa); etc. Also
FT                   similar to Rv3610c and Rv2115c from Mycobacterium
FT                   tuberculosis. Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop), and PS00674 AAA-protein family signature."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0435c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43166"
FT                   /db_xref="GOA:P96281"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:P96281"
FT                   /inference="protein motif:PROSITE:PS00674"
FT                   /inference="protein motif:PROSITE:PS00017"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43166.1"
FT                   /translation="MTHPDPARQLTLTARLNTSAVDSRRGVVRLHPNAIAALGIREWDA
FT                   VSLTGSRTTAAVAGLAAADTAVGTVLLDDVTLSNAGLREGTEVIVSPVTVYGARSVTLS
FT                   GSTLATQSVPPVTLRQALLGKVMTVGDAVSLLPRDLGPGTSTSAASRALAAAVGISWTS
FT                   ELLTVTGVDPDGPVSVQPNSLVTWGAGVPAAMGTSTAGQVSISSPEIQIEELKGAQPQA
FT                   AKLTEWLKLALDEPHLLQTLGAGTNLGVLVSGPAGVGKATLVRAVCDGRRLVTLDGPEI
FT                   GALAAGDRVKAVASAVQAVRHEGGVLLITDADALLPAAAEPVASLILSELRTAVATAGV
FT                   VLIATSARPDQLDARLRSPELCDRELGLPLPDAATRKSLLEALLNPVPTGDLNLDEIAS
FT                   RTPGFVVADLAALVREAALRAASRASADGRPPMLHQDDLLGALTVIRPLSRSASDEVTV
FT                   GDVTLDDVGDMAAAKQALTEAVLWPLQHPDTFARLGVEPPRGVLLYGPPGCGKTFVVRA
FT                   LASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRRARDSAPSLVFLDELDALAPRRGQS
FT                   FDSGVSDRVVAALLTELDGIDPLRDVVMLGATNRPDLIDPALLRPGRLERLVFVEPPDA
FT                   AARREILRTAGKSIPLSSDVDLDEVAAGLDGYSAADCVALLREAALTAMRRSIDAANVT
FT                   AADLATARETVRASLDPLQVASLRKFGTKGDLRS"
FT   gene            complement(524530..525390)
FT                   /gene="pssA"
FT                   /locus_tag="Rv0436c"
FT   CDS_pept        complement(524530..525390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="Rv0436c"
FT                   /product="Probable CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase PssA (PS synthase)
FT                   (phosphatidylserine synthase)"
FT                   /note="Rv0436c, (MTCY22G10.33c), len: 286 aa. Probable
FT                   pssA, PS synthase (CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase) (see citation below), integral
FT                   membrane protein, equivalent to AL035159|MLCB1450_9|T44730
FT                   from Mycobacterium leprae (300 aa), FASTA scores: opt:
FT                   1506, E(): 0, (77.9% identity in 285 aa overlap). Also
FT                   highly similar to others e.g.
FT                   NP_108059.1|14027250|BAB54204.1|AP003012 phosphatidylserine
FT                   synthase from Mesorhizobium loti (248 aa); PSS_BACSU|P39823
FT                   cdp-diacylglycerol--serine o-phosphatidyltransferase from
FT                   Bacillus subtilis (177 aa), FASTA scores: opt: 277, E():
FT                   9.9e-12, (33.3% identity in 183 aa overlap); etc. Contains
FT                   PS00379 CDP-alcohol phosphatidyltransferases signature.
FT                   Belongs to the CDP-alcohol phosphatidyltransferase class-I
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0436c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43167"
FT                   /db_xref="GOA:P9WPG1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPG1"
FT                   /inference="protein motif:PROSITE:PS00379"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43167.1"
FT                   /translation="MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMA
FT                   LIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWV
FT                   VVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGW
FT                   WTSGWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLI
FT                   WVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRK
FT                   PGRRL"
FT   gene            complement(525387..526082)
FT                   /gene="psd"
FT                   /locus_tag="Rv0437c"
FT   CDS_pept        complement(525387..526082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="Rv0437c"
FT                   /product="Possible phosphatidylserine decarboxylase Psd (PS
FT                   decarboxylase)"
FT                   /note="Rv0437c, (MTV037.01c), len: 231 aa (start
FT                   uncertain). Possible psd, phosphatidylserine decarboxylase
FT                   , equivalent to CAC29819.1|AL583918 conserved hypothetical
FT                   protein from Mycobacterium leprae (243 aa); and highly
FT                   similar to MLCB1450.11|T44729|4154044|CAA22695.1|AL035159
FT                   hypothetical protein from Mycobacterium leprae (202
FT                   aa),FASTA score: (74.6% identity in 197 aa overlap). Also
FT                   similar to other phosphatidylserine decarboxylases e.g.
FT                   NP_108058.1|14027249|BAB54203.1|AP003012 phosphatidylserine
FT                   decarboxylase from Mesorhizobium loti (232 aa);
FT                   AAK86872|g15156090|AGR_C_1963 phosphatidylserine
FT                   decarboxylase from Agrobacterium tumefaciens (244 aa);
FT                   AAG12422.1|AY005137|Psd phosphatidylserine decarboxylase
FT                   from Chlorobium tepidum (216 aa); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0437c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43168"
FT                   /db_xref="GOA:P9WHQ5"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WHQ5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43168.1"
FT                   /translation="MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRY
FT                   RWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPL
FT                   PRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAE
FT                   VVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVA
FT                   GETVLAECR"
FT   gene            complement(526143..527360)
FT                   /gene="moeA2"
FT                   /gene_synonym="moeA3"
FT                   /locus_tag="Rv0438c"
FT   CDS_pept        complement(526143..527360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA2"
FT                   /gene_synonym="moeA3"
FT                   /locus_tag="Rv0438c"
FT                   /product="Probable molybdopterin biosynthesis protein
FT                   MoeA2"
FT                   /note="Rv0438c, (MTV037.02c), len: 405 aa. Probable
FT                   moeA2,molybdenum cofactor biosynthesis protein, highly
FT                   similar to many e.g. Y10817|ANY10817_2 from A.
FT                   nicotinovorans (429 aa), FASTA scores: opt: 786, E(): 0,
FT                   (39.2% identity in 398 aa overlap); etc. Also similar to
FT                   MOEA1|Rv0994|MTCI237.08|O05577 probable molybdopterin
FT                   biosynthesis protein from Mycobacterium tuberculosis (426
FT                   aa), FASTA scores: opt: 667, E(): 2e-32, (36.5% identity in
FT                   425 aa overlap). Note that previously known as moeA3."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0438c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43169"
FT                   /db_xref="GOA:P9WJQ5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WJQ5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43169.1"
FT                   /translation="MRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPV
FT                   FDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPT
FT                   GATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAA
FT                   ALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATA
FT                   TAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVA
FT                   MQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTA
FT                   SLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQL
FT                   QVWDLT"
FT   gene            complement(527379..528314)
FT                   /locus_tag="Rv0439c"
FT   CDS_pept        complement(527379..528314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0439c"
FT                   /product="Probable dehydrogenase/reductase"
FT                   /note="Rv0439c, (MTV037.03c), len: 311 aa. Probable
FT                   dehydrogenase/reductase, equivalent to
FT                   AL035159|MLCB1450_6|T44727 probable oxidoreductase from
FT                   Mycobacterium leprae (304 aa), FASTA scores: opt: 1360,E():
FT                   0, (69.2% identity in 302 aa overlap). Also highly similar
FT                   to various oxidoreductases, generally
FT                   dehydrogenases/reductases e.g.
FT                   PA5031|C83017|9951320|AAG08416.1|AE004916_5|AE004916
FT                   probable short chain dehydrogenase from Pseudomonas
FT                   aeruginosa (309 aa); Q03326|OXIR_STRAT probable
FT                   oxidoreductase from Streptomyces antibioticus (298
FT                   aa),FASTA scores: opt: 400, E(): 1.2e-18, (34.6% identity
FT                   in 298 aa overlap); etc."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0439c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43170"
FT                   /db_xref="GOA:O53726"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:O53726"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43170.1"
FT                   /translation="MTANDNKTRKWSAADVPDQSGRVVVVTGANTGIGYHTAAVFADRG
FT                   AHVVLAVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPRIDVL
FT                   INNAGVMWTPKQVTKDGFELQFGTNHLGHFALTGLVLDHMLPVPGSRVVTVSSQGHRIH
FT                   AAIHFDDLQWERRYNRVAAYGQAKLANLLFTYELQRRLGEAGKSTIAVAAHPGGSNTEL
FT                   TRNLPRLIRPVATVLGPLLFQSPEMGALPTLRAATDPTTQGGQYYGPDGFGEQRGHPKV
FT                   VQSSAQSHDKDLQRRLWTVSEELTGVSFGV"
FT   gene            528608..530230
FT                   /gene="groEL2"
FT                   /gene_synonym="groEL-2"
FT                   /gene_synonym="groL2"
FT                   /gene_synonym="hsp60"
FT                   /gene_synonym="hsp65"
FT                   /locus_tag="Rv0440"
FT   CDS_pept        528608..530230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL2"
FT                   /gene_synonym="groEL-2"
FT                   /gene_synonym="groL2"
FT                   /gene_synonym="hsp60"
FT                   /gene_synonym="hsp65"
FT                   /locus_tag="Rv0440"
FT                   /product="60 kDa chaperonin 2 GroEL2 (protein CPN60-2)
FT                   (GroEL protein 2) (65 kDa antigen) (heat shock protein 65)
FT                   (cell wall protein A) (antigen A)"
FT                   /note="Rv0440, (MTV037.04), len: 540 aa. GroEL2 (alternate
FT                   gene names: groL2, groEL-2, hsp65, hsp60), 60 kDa
FT                   chaperonin 2 (see Shinnick 1987). Purified 65 kDa antigen
FT                   can elicit a strong delayed-type hypersensitivity reaction
FT                   in experimental animals infected with M. tuberculosis. This
FT                   protein is one of the major immunoreactive proteins of the
FT                   mycobacteria. This antigen contains epitopes that are
FT                   common to various species of mycobacteria. Contains PS00296
FT                   Chaperonins cpn60 signature. Belongs to the chaperonin
FT                   (HSP60) family. Phosphorylated in vitro by PknJ|Rv2088 (See
FT                   Arora et al., 2010)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0440"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43171"
FT                   /db_xref="GOA:P9WPE7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PDB:1SJP"
FT                   /db_xref="PDB:3RTK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WPE7"
FT                   /inference="protein motif:PROSITE:PS00296"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43171.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVS
FT                   SKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAI
FT                   AGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLE
FT                   PGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAV
FT                   VADKPEKEKASVPGGGDMGGMDF"
FT   gene            complement(530296..530724)
FT                   /locus_tag="Rv0441c"
FT   CDS_pept        complement(530296..530724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0441c"
FT                   /product="Hypothetical protein"
FT                   /note="Rv0441c, (MTV037.05c), len: 142 aa. Hypothetical
FT                   unknown protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0441c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WKW3"
FT                   /protein_id="CCP43172.1"
FT                   /translation="MGAKKVDLKRLAAALPDYPFAYLITVDDGHRVHTVAVEPVLRELP
FT                   DGPDGPRAVVDVGLIGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDD
FT                   TARCGVVPIRALLHRDAAPDSPTAAKGCLHDCVVFSVP"
FT   gene            complement(530751..532214)
FT                   /gene="PPE10"
FT                   /locus_tag="Rv0442c"
FT   CDS_pept        complement(530751..532214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PPE10"
FT                   /locus_tag="Rv0442c"
FT                   /product="PPE family protein PPE10"
FT                   /note="Rv0442c, (MTV037.06c), len: 487 aa. PPE10, Member of
FT                   the Mycobacterium tuberculosis PPE family, nearly identical
FT                   to hypothetical protein from Mycobacterium tuberculosis
FT                   (strain Erdman) and to AN5S46909_1 protein fragment from
FT                   Mycobacterium bovis (302 aa); P42611|YHS6_MYCTU
FT                   hypothetical 50.6 kDa protein (517 aa), FASTA scores: opt:
FT                   3144, E(): 0, (98.4 identity in 492 aa overlap); and
FT                   S46909|S46909_1 (302 aa), FASTA scores: opt: 1897, E():
FT                   0,(98.0% identity in 302 aa overlap). Nucleotide position
FT                   532097 in the genome sequence has been corrected, T:C
FT                   resulting in K40E."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0442c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43173"
FT                   /db_xref="GOA:P9WI41"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WI41"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43173.1"
FT                   /translation="MTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASI
FT                   ASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAAL
FT                   AATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASA
FT                   AVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGS
FT                   GNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGN
FT                   VGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGS
FT                   EAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAP
FT                   VGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGS
FT                   GIPKSNFYPSPDRESAYASPRIGQPVGSE"
FT   gene            532396..532911
FT                   /locus_tag="Rv0443"
FT   CDS_pept        532396..532911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rv0443"
FT                   /product="Conserved protein"
FT                   /note="Rv0443, (MTV037.07), len: 171 aa. Conserved
FT                   protein,highly similar to AL049863|SC5H1_23|T35339
FT                   hypothetical protein from Streptomyces coelicolor (171 aa),
FT                   FASTA scores: opt: 561, E(): 2.3e-32, (49.7% identity in
FT                   165 aa overlap); and CAC42482.1|AJ318385 hypothetical
FT                   protein from Amycolatopsis mediterranei (163 aa)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0443"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43174"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:O53728"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43174.1"
FT                   /translation="MASTDAAAQELLRDAFTRLIEHVDELTDGLTDQLACYRPTPSANS
FT                   IAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTGYGHRPEDVAKVRAP
FT                   ADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARLVSIVDDCAQHLGQA
FT                   AYLRGIAR"
FT   gene            complement(533091..533789)
FT                   /gene="rskA"
FT                   /locus_tag="Rv0444c"
FT   CDS_pept        complement(533091..533789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rskA"
FT                   /locus_tag="Rv0444c"
FT                   /product="Anti-sigma factor RskA (regulator of sigma K)"
FT                   /note="Rv0444c, (MTV037.08c), len: 232 aa. RskA, regulator
FT                   of SigK (See Said-Salim et al., 2006); C-terminus similar
FT                   to P12752|Y24K_STRGR hypothetical 24.7 kDa protein from
FT                   Streptomyces griseus (238 aa), FASTA scores: opt: 207, E():
FT                   2.2e-05, (32.9% identity in 158 aa overlap). Cleaved by
FT                   Rip|Rv2869c, in M. tuberculosis Erdman (See Sklar et
FT                   al.,2010)."
FT                   /db_xref="EnsemblGenomes-Gn:Rv0444c"
FT                   /db_xref="EnsemblGenomes-Tr:CCP43175"
FT                   /db_xref="GOA:P9WGX5"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="PDB:4NQW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P9WGX5"
FT                   /experiment="EXISTENCE: identified in proteomics study"
FT                   /protein_id="CCP43175.1"
FT                   /translation="MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFN
FT                   DEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLG
FT                   AFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPP
FT                   SRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPT
FT                   GTILAELPLG"
FT   gene            complement(533833..534396)
FT                   /gene="sigK"
FT                   /locus_tag="Rv0445c"
FT   CDS_pept        complement(533833..534396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigK"
FT