(data stored in ACNUC14830 zone)

EMBL: BX842649

ID   BX842649; SV 1; linear; genomic DNA; STD; PRO; 349697 BP.
AC   BX842649;
DT   30-NOV-2003 (Rel. 78, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
DE   Bdellovibrio bacteriovorus complete genome, strain HD100; segment 4/11
KW   complete genome.
OS   Bdellovibrio bacteriovorus HD100
OC   Bacteria; Proteobacteria; Oligoflexia; Bdellovibrionales;
OC   Bdellovibrionaceae; Bdellovibrio.
RN   [1]
RA   Schuster S.C.;
RT   ;
RL   Submitted (26-NOV-2003) to the INSDC.
RL   Max-Planck Institute for Developmental Biology, Spemannstr. 35, 72076
RL   Tuebingen, GERMANY
RN   [2]
RX   DOI; 10.1126/science.1093027.
RX   PUBMED; 14752164.
RA   Rendulic S., Jagtap P., Rosinus A., Eppinger M., Baar C., Lanz C.,
RA   Keller H., Lambert C., Evans K.J., Goesmann A., Meyer F., Sockett R.E.,
RA   Schuster S.C.;
RT   "A predator unmasked: life cycle of Bdellovibrio bacteriovorus from a
RT   genomic perspective";
RL   Science, e1252229 303(5658):689-692(2004).
DR   MD5; 269898e9a93e158081bba4ce82761be7.
DR   ENA-CON; BX842601.
DR   BioSample; SAMEA3138335.
DR   CABRI; DSM 50701.
DR   EuropePMC; PMC1828422; 17043102.
DR   EuropePMC; PMC1913455; 17416646.
DR   EuropePMC; PMC3526635; 23284639.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF01051; c-di-GMP-I.
DR   StrainInfo; 98330; 1.
FH   Key             Location/Qualifiers
FT   source          1..349697
FT                   /organism="Bdellovibrio bacteriovorus HD100"
FT                   /strain="HD100 = DSM 50701 = ATCC 15356 = ICPB 3268 NCIB
FT                   9529"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:264462"
FT   CDS_pept        complement(86..1468)
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="Bd1107"
FT                   /function="Histidyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="InterPro: Histidyl-tRNA synthetase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:P60913"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60913"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79029.1"
FT                   SI"
FT   CDS_pept        1473..1886
FT                   /transl_table=11
FT                   /locus_tag="Bd1108"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="putative lipoprotein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79030.1"
FT   CDS_pept        1904..2401
FT                   /transl_table=11
FT                   /locus_tag="Bd1110"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79031.1"
FT                   LK"
FT   CDS_pept        2388..3077
FT                   /transl_table=11
FT                   /locus_tag="Bd1111"
FT                   /product="ABC-type antimicrobial peptide transporter,
FT                   ATPase component"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79032.1"
FT                   ESINKVV"
FT   CDS_pept        3074..4339
FT                   /transl_table=11
FT                   /locus_tag="Bd1112"
FT                   /product="ABC-type antimicrobial peptide transporter,
FT                   permease component"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   permease component"
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNW8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79033.1"
FT   sig_peptide     3074..3114
FT                   /locus_tag="sp0297"
FT   CDS_pept        complement(4402..6306)
FT                   /transl_table=11
FT                   /gene="frpA"
FT                   /locus_tag="Bd1113"
FT                   /product="Iron-regulated protein frpA"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79034.1"
FT   sig_peptide     complement(6262..6306)
FT                   /gene="frpA"
FT                   /locus_tag="sp0298"
FT   CDS_pept        complement(6344..6628)
FT                   /transl_table=11
FT                   /locus_tag="Bd1114"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79035.1"
FT   sig_peptide     complement(6608..6628)
FT                   /locus_tag="sp0299"
FT   CDS_pept        6942..7157
FT                   /transl_table=11
FT                   /locus_tag="Bd1115"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79036.1"
FT   sig_peptide     6942..6967
FT                   /locus_tag="sp0300"
FT   CDS_pept        complement(7154..8983)
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="Bd1116"
FT                   /product="Adenylate cyclase"
FT                   /function="Adenylate cyclase family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /EC_number=""
FT                   /note="InterPro: Guanylate cyclase, Adenylate cyclase,
FT                   family 3 (some proteins contain HAMP domain)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNW4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79037.1"
FT   sig_peptide     complement(8950..8983)
FT                   /gene="cyaA"
FT                   /locus_tag="sp0301"
FT   CDS_pept        complement(8997..10610)
FT                   /transl_table=11
FT                   /locus_tag="Bd1117"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="similar to Tenascin-X precursor (TN-X)
FT                   (Hexabrachion-like), human"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79038.1"
FT   sig_peptide     complement(10590..10610)
FT                   /locus_tag="sp0302"
FT   CDS_pept        complement(10610..12421)
FT                   /transl_table=11
FT                   /locus_tag="Bd1118"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79039.1"
FT   sig_peptide     complement(12402..12421)
FT                   /locus_tag="sp0303"
FT   CDS_pept        12493..13044
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="Bd1119"
FT                   /function="Transcription elongation factor"
FT                   /note="InterPro: Prokaryotic transcription elongation
FT                   factor GreA/GreB"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNW1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79040.1"
FT   CDS_pept        13105..13614
FT                   /transl_table=11
FT                   /locus_tag="Bd1120"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR021856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79041.1"
FT                   QYYCKE"
FT   sig_peptide     13105..13130
FT                   /locus_tag="sp0304"
FT   CDS_pept        13617..14621
FT                   /transl_table=11
FT                   /locus_tag="Bd1121"
FT                   /product="esterase/lipase/thioesterase family protein"
FT                   /function="predicted hydrolase of the alpha/beta-hydrolase
FT                   fold"
FT                   /note="InterPro: Alpha/beta hydrolase fold, esterase/
FT                   lipase/thioesterase family active site"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79042.1"
FT   CDS_pept        complement(14565..15284)
FT                   /transl_table=11
FT                   /locus_tag="Bd1122"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79043.1"
FT                   LWRQRWNLFIECAFKTS"
FT   CDS_pept        15284..16804
FT                   /transl_table=11
FT                   /locus_tag="Bd1123"
FT                   /product="putative membrane-bound mannosyltransferase"
FT                   /function="predicted membrane-bound mannosyltransferase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNV7"
FT                   /db_xref="InterPro:IPR019962"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79044.1"
FT   CDS_pept        16801..19029
FT                   /transl_table=11
FT                   /gene="mltE"
FT                   /locus_tag="Bd1124"
FT                   /product="putative soluble lytic transglycosylase"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /note="Exomuramidase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNV6"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79045.1"
FT   sig_peptide     16801..16818
FT                   /locus_tag="sp0305"
FT   CDS_pept        19093..20673
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="Bd1125"
FT                   /product="membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /note="membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNV5"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79046.1"
FT                   IVIPSEVKQ"
FT   sig_peptide     19093..19112
FT                   /gene="mltD"
FT                   /locus_tag="sp0306"
FT   CDS_pept        20873..22312
FT                   /transl_table=11
FT                   /gene="mcp"
FT                   /locus_tag="Bd1126"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="InterPro: Bacterial chemotaxis sensory transducer"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNV4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79047.1"
FT   sig_peptide     20873..20896
FT                   /gene="mcp"
FT                   /locus_tag="sp0307"
FT   CDS_pept        complement(22309..23172)
FT                   /transl_table=11
FT                   /locus_tag="Bd1127"
FT                   /product="LysR-family regulatory protein"
FT                   /function="Transcriptional regulator"
FT                   /note="InterPro: Bacterial regulatory protein LysR family,
FT                   Transcriptional regulator"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79048.1"
FT                   LVQQGF"
FT   CDS_pept        23260..23580
FT                   /transl_table=11
FT                   /locus_tag="Bd1128"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible sugar transport ATP-binding protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79049.1"
FT                   AY"
FT   sig_peptide     23260..23278
FT                   /locus_tag="sp0308"
FT   CDS_pept        complement(23577..25394)
FT                   /transl_table=11
FT                   /locus_tag="Bd1129"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79050.1"
FT   sig_peptide     complement(25368..25394)
FT                   /locus_tag="sp0309"
FT   CDS_pept        complement(25560..30038)
FT                   /transl_table=11
FT                   /gene="yapH"
FT                   /locus_tag="Bd1130"
FT                   /product="putative YapH protein"
FT                   /note="autotransporter or, cell wall surface anchor family
FT                   protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79051.1"
FT   sig_peptide     complement(30017..30038)
FT                   /gene="yapH"
FT                   /locus_tag="sp0310"
FT   CDS_pept        30258..31325
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="Bd1131"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /function="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number=""
FT                   /note="InterPro: Aminotransferases class-IV, Branched-chain
FT                   amino acid aminotransferase/4-amino-4-deoxychorismate
FT                   lyase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79052.1"
FT                   GAQADTLNWLVPLKK"
FT   CDS_pept        complement(32013..32813)
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="Bd1134"
FT                   /product="mrp protein"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="InterPro: Mrp family, similar ATPases involved in
FT                   chromosome partitioning"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79053.1"
FT   CDS_pept        32864..33283
FT                   /transl_table=11
FT                   /locus_tag="Bd1136"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU7"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79054.1"
FT   CDS_pept        complement(33286..38163)
FT                   /transl_table=11
FT                   /locus_tag="Bd1137"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /function="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing proteins"
FT                   /note="InterPro: CUB domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR035914"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79055.1"
FT   sig_peptide     complement(38136..38163)
FT                   /locus_tag="sp0311"
FT   CDS_pept        complement(38216..38662)
FT                   /transl_table=11
FT                   /gene="yhfA"
FT                   /locus_tag="Bd1139"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /note="predicted redox protein, regulator of disulfide bond
FT                   formation"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79056.1"
FT   CDS_pept        complement(38729..39175)
FT                   /transl_table=11
FT                   /locus_tag="Bd1140"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79057.1"
FT   sig_peptide     complement(39146..39175)
FT                   /locus_tag="sp0312"
FT   CDS_pept        complement(39277..40917)
FT                   /transl_table=11
FT                   /locus_tag="Bd1141"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79058.1"
FT   sig_peptide     complement(40875..40917)
FT                   /locus_tag="sp0313"
FT   CDS_pept        complement(41003..41416)
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="Bd1144"
FT                   /product="hypothetical protein ybaN"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="hypothetical protein ybaN E.coli"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU2"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79059.1"
FT   CDS_pept        complement(41413..44514)
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="Bd1145"
FT                   /product="acriflavin resistance protein"
FT                   /function="Cation/multidrug efflux pump"
FT                   /note="Transmembrane efflux pump protein, AcrB/AcrD/AcrF
FT                   family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79060.1"
FT   CDS_pept        complement(44622..44858)
FT                   /transl_table=11
FT                   /locus_tag="Bd1146"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar Photosynthetic reaction center cytochrome c
FT                   subunit"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNU0"
FT                   /db_xref="InterPro:IPR003158"
FT                   /db_xref="InterPro:IPR023119"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79061.1"
FT   CDS_pept        45101..46441
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="Bd1147"
FT                   /product="glycyl-tRNA synthetase"
FT                   /function="Glycyl-tRNA synthetase class II"
FT                   /EC_number=""
FT                   /note="InterPro: Homodimeric glycyl-tRNA synthetase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79062.1"
FT   CDS_pept        complement(46536..47039)
FT                   /transl_table=11
FT                   /locus_tag="Bd1148"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79063.1"
FT                   ELDK"
FT   sig_peptide     complement(47021..47039)
FT                   /locus_tag="sp0314"
FT   CDS_pept        complement(47197..47553)
FT                   /transl_table=11
FT                   /locus_tag="Bd1149"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79064.1"
FT                   YRDNGKNDSNIYLY"
FT   sig_peptide     complement(47519..47553)
FT                   /locus_tag="sp0315"
FT   CDS_pept        47796..50507
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="Bd1150"
FT                   /product="pyruvate phosphate dikinase"
FT                   /function="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number=""
FT                   /note="Pyruvate orthophosphate dikinase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79065.1"
FT   CDS_pept        complement(50560..50721)
FT                   /transl_table=11
FT                   /locus_tag="Bd1151"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79066.1"
FT                   ILVTYFTK"
FT   CDS_pept        complement(50766..51617)
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="Bd1152"
FT                   /function="Paraquat-inducible protein B"
FT                   /note="PqiB family protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79067.1"
FT                   ER"
FT   CDS_pept        complement(51589..52098)
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="Bd1153"
FT                   /product="paraquat-inducible protein A"
FT                   /function="Uncharacterized paraquat-inducible protein A"
FT                   /note="putative inner membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT3"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79068.1"
FT                   RSETEG"
FT   CDS_pept        52220..53749
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="Bd1154"
FT                   /function="Catalase"
FT                   /EC_number=""
FT                   /note="InterPro: Catalase, Catalase isozyme 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNT2"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79069.1"
FT   CDS_pept        53762..54244
FT                   /transl_table=11
FT                   /gene="ankB"
FT                   /locus_tag="Bd1155"
FT                   /product="ankyrin domain protein"
FT                   /function="FOG: Ankyrin repeat"
FT                   /note="InterPro: Ankyrin-repeat"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79070.1"
FT   CDS_pept        54510..55025
FT                   /transl_table=11
FT                   /locus_tag="Bd1156"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79071.1"
FT                   YGQSVRCL"
FT   CDS_pept        55336..58923
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="Bd1158"
FT                   /product="chromosome segregation SMC protein"
FT                   /function="Chromosome segregation ATPases"
FT                   /note="InterPro: SMC family C-terminal domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79072.1"
FT   CDS_pept        59147..60694
FT                   /transl_table=11
FT                   /locus_tag="Bd1159"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79073.1"
FT   sig_peptide     59147..59166
FT                   /locus_tag="sp0316"
FT   CDS_pept        60707..62392
FT                   /transl_table=11
FT                   /locus_tag="Bd1160"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="probable twin-argine translocation system substrate"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79074.1"
FT   sig_peptide     60707..60752
FT                   /locus_tag="sp0317"
FT   CDS_pept        62398..63099
FT                   /transl_table=11
FT                   /locus_tag="Bd1161"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79075.1"
FT                   QVCESPGWQLQ"
FT   CDS_pept        complement(63289..63966)
FT                   /transl_table=11
FT                   /locus_tag="Bd1162"
FT                   /function="Nitroreductase"
FT                   /EC_number="1.6.99.-"
FT                   /note="InterPro: Nitroreductase family, Major
FT                   NAD(P)H-flavin oxidoreductase (FRASE I)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79076.1"
FT                   YIK"
FT   CDS_pept        64087..64500
FT                   /transl_table=11
FT                   /locus_tag="Bd1163"
FT                   /product="transcriptional regulator"
FT                   /function="predicted transcriptional regulator"
FT                   /note="predicted transcriptional regulator"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79077.1"
FT   CDS_pept        64497..65051
FT                   /transl_table=11
FT                   /locus_tag="Bd1164"
FT                   /product="putative ribosomal protein N-acetyltransferase"
FT                   /function="Acetyltransferases including N-acetylases of
FT                   ribosomal proteins"
FT                   /EC_number="2.3.1.-"
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79078.1"
FT   CDS_pept        complement(65138..65293)
FT                   /transl_table=11
FT                   /locus_tag="Bd1166"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79079.1"
FT                   SSENTQ"
FT   CDS_pept        65361..66929
FT                   /transl_table=11
FT                   /locus_tag="Bd1167"
FT                   /product="microtubule binding protein"
FT                   /note="InterPro: Phosphoglucomutase and phosphomannomutase
FT                   family, microtubule binding protein D-CLIP-190 - fruit fly"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS1"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79080.1"
FT                   MDPKK"
FT   CDS_pept        66942..67847
FT                   /transl_table=11
FT                   /locus_tag="Bd1168"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79081.1"
FT   CDS_pept        67848..70232
FT                   /transl_table=11
FT                   /locus_tag="Bd1169"
FT                   /product="large Ala/Glu-rich protein"
FT                   /function="FOG: FHA domain"
FT                   /note="also similar Myosin heavy chain, skeletal muscle"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79082.1"
FT   CDS_pept        complement(70226..70846)
FT                   /transl_table=11
FT                   /locus_tag="Bd1170"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="weak homology Neutral amino acid transporter B
FT                   (Insulin-activated amino acidtransporter) (ASC-like Na(+)
FT                   dependent neutral amino acid transporterASCT2)"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79083.1"
FT   sig_peptide     complement(70829..70846)
FT                   /locus_tag="sp0318"
FT   CDS_pept        complement(70850..71530)
FT                   /transl_table=11
FT                   /locus_tag="Bd1171"
FT                   /product="hypothetical protein predicted, possible
FT                   Zn-dependent protease"
FT                   /note="predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79084.1"
FT                   TLVK"
FT   sig_peptide     complement(71511..71530)
FT                   /locus_tag="sp0319"
FT   CDS_pept        complement(71527..72300)
FT                   /transl_table=11
FT                   /locus_tag="Bd1172"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNR6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011873"
FT                   /db_xref="InterPro:IPR025537"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79085.1"
FT   CDS_pept        72465..73673
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="Bd1173"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /function="Signal recognition particle GTPase"
FT                   /note="InterPro: Cell division transporter
FT                   substrate-binding protein FtsY, cell division ABC
FT                   transporter"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNR5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79086.1"
FT                   LFQ"
FT   CDS_pept        73775..74215
FT                   /transl_table=11
FT                   /locus_tag="Bd1174"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="probable membrane-bound phosphoesterase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79087.1"
FT   sig_peptide     73775..73793
FT                   /locus_tag="sp0320"
FT   CDS_pept        complement(74226..74909)
FT                   /transl_table=11
FT                   /locus_tag="Bd1175"
FT                   /product="nucleoside-diphosphate-sugar epimerases"
FT                   /function="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /note="nucleoside-diphosphate-sugar epimerases"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR014843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79088.1"
FT                   IADQK"
FT   CDS_pept        complement(74933..76495)
FT                   /transl_table=11
FT                   /locus_tag="Bd1176"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79089.1"
FT                   GNN"
FT   sig_peptide     complement(76459..76495)
FT                   /locus_tag="sp0321"
FT   CDS_pept        76658..78292
FT                   /transl_table=11
FT                   /locus_tag="Bd1177"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79090.1"
FT   sig_peptide     76658..76677
FT                   /locus_tag="sp0322"
FT   CDS_pept        78443..79678
FT                   /transl_table=11
FT                   /locus_tag="Bd1179"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79091.1"
FT                   AEICTEPQRRMF"
FT   CDS_pept        79678..81162
FT                   /transl_table=11
FT                   /locus_tag="Bd1180"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="possible ATPases with chaperone activity,
FT                   ATP-binding subunit"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79092.1"
FT   CDS_pept        81287..83020
FT                   /transl_table=11
FT                   /gene="ycbB"
FT                   /locus_tag="Bd1181"
FT                   /product="putative periplasmic protein YcbB"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79093.1"
FT                   F"
FT   sig_peptide     81287..81313
FT                   /gene="ycbB"
FT                   /locus_tag="sp0323"
FT   CDS_pept        83028..84047
FT                   /transl_table=11
FT                   /locus_tag="Bd1183"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79094.1"
FT   sig_peptide     83028..83062
FT                   /locus_tag="sp0324"
FT   CDS_pept        84060..84650
FT                   /transl_table=11
FT                   /locus_tag="Bd1184"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79095.1"
FT   CDS_pept        84796..85104
FT                   /transl_table=11
FT                   /locus_tag="Bd1185"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79096.1"
FT   CDS_pept        85125..85694
FT                   /transl_table=11
FT                   /locus_tag="Bd1186"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number=""
FT                   /note="InterPro: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ4"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79097.1"
FT   CDS_pept        85702..87267
FT                   /transl_table=11
FT                   /locus_tag="Bd1188"
FT                   /product="putative HD superfamily hydrolase"
FT                   /function="predicted HD superfamily hydrolase"
FT                   /note="InterPro: HD domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79098.1"
FT                   EHAR"
FT   CDS_pept        87264..88481
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="Bd1189"
FT                   /function="Tyrosyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79099.1"
FT                   VKIVVK"
FT   CDS_pept        88507..89313
FT                   /transl_table=11
FT                   /locus_tag="Bd1190"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar spore germination protein gerIA"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79100.1"
FT   CDS_pept        89377..90186
FT                   /transl_table=11
FT                   /locus_tag="Bd1192"
FT                   /product="putative hydrolase"
FT                   /note="hydrolase, alpha/beta hydrolase fold family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNQ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79101.1"
FT   CDS_pept        complement(90266..90679)
FT                   /transl_table=11
FT                   /gene="sufA"
FT                   /locus_tag="Bd1193"
FT                   /product="Scaffold protein for iron-sulfur cluster
FT                   assembly."
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Involved in (Fe-S) cluster assembly and resistance
FT                   to oxidative stress."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79102.1"
FT   CDS_pept        complement(90697..91890)
FT                   /transl_table=11
FT                   /gene="spl1"
FT                   /locus_tag="Bd1194"
FT                   /product="putative aminotransferase"
FT                   /function="Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /EC_number="4.4.1.-"
FT                   /note="InterPro: Aminotransferase class-V"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79103.1"
FT   CDS_pept        complement(91952..93547)
FT                   /transl_table=11
FT                   /locus_tag="Bd1195"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79104.1"
FT                   IHDFEAKQKDKVVA"
FT   CDS_pept        93718..96012
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="Bd1196"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /function="Ribonucleotide reductase alpha subunit"
FT                   /EC_number=""
FT                   /note="putative vitamin B12-dependent ribonucleotide
FT                   reductase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79105.1"
FT                   CPNCGTTVGCS"
FT   CDS_pept        96102..97298
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="Bd1198"
FT                   /product="30S ribosomal protein S1"
FT                   /function="Ribosomal protein S1"
FT                   /note="lytB, rpsA; fusion penicillin tolerance LytB domain
FT                   (N-terminus) and S1 ribosomal protein (C-terminus)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79106.1"
FT   CDS_pept        97493..97858
FT                   /transl_table=11
FT                   /locus_tag="Bd1199"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79107.1"
FT                   TKKSFFSKIFSGFKKAG"
FT   CDS_pept        complement(97859..98608)
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="Bd1200"
FT                   /product="nucleotide-utilizing enzyme"
FT                   /function="predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA"
FT                   /note="predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79108.1"
FT   CDS_pept        99062..100348
FT                   /transl_table=11
FT                   /locus_tag="Bd1201"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /EC_number=""
FT                   /note="InterPro: Acyl-CoA dehydrogenase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79109.1"
FT   CDS_pept        100369..101085
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="Bd1203"
FT                   /product="putative RNA methylase"
FT                   /function="rRNA methylases"
FT                   /EC_number=""
FT                   /note="InterPro: tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79110.1"
FT                   AAQYLEEMFSRGTLKS"
FT   CDS_pept        101146..102027
FT                   /transl_table=11
FT                   /locus_tag="Bd1204"
FT                   /product="Protein-tyrosine phosphatase 2"
FT                   /EC_number=""
FT                   /note="InterPro: Tyrosine specific protein phosphatase and
FT                   dual specificity protein phosphatase family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNP0"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="PDB:4NX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79111.1"
FT                   GEGMLWGEWVLR"
FT   sig_peptide     101146..101168
FT                   /locus_tag="sp0325"
FT   CDS_pept        102024..102458
FT                   /transl_table=11
FT                   /locus_tag="Bd1205"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79112.1"
FT   sig_peptide     102024..102044
FT                   /locus_tag="sp0326"
FT   CDS_pept        complement(102455..104020)
FT                   /transl_table=11
FT                   /locus_tag="Bd1206"
FT                   /product="methyltransferase"
FT                   /function="predicted SAM-dependent methyltransferases"
FT                   /EC_number="2.1.1.-"
FT                   /note="predicted SAM-dependent methyltransferases"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNN8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79113.1"
FT                   LRKN"
FT   CDS_pept        104216..104806
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="Bd1207"
FT                   /product="probable lipoprotein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="LemA family"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79114.1"
FT   CDS_pept        104820..105575
FT                   /transl_table=11
FT                   /locus_tag="Bd1208"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /note="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNN6"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79115.1"
FT   sig_peptide     104820..104840
FT                   /locus_tag="sp0327"
FT   CDS_pept        105848..106495
FT                   /transl_table=11
FT                   /locus_tag="Bd1209"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted membrane protein"
FT                   /note="conserved hypothetical protein, Predicted membrane
FT                   protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNN5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79116.1"
FT   CDS_pept        106585..108699
FT                   /transl_table=11
FT                   /locus_tag="Bd1210"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79117.1"
FT                   LYSSTVWLEE"
FT   sig_peptide     106585..106608
FT                   /locus_tag="sp0328"
FT   tRNA            108769..108844
FT                   /gene="trna_0012"
FT                   /locus_tag="trna_0012"
FT                   /note="tRNA created by Simple tRNAscan Autoannotator"
FT   CDS_pept        108984..109577
FT                   /transl_table=11
FT                   /gene="ydeI"
FT                   /locus_tag="Bd1211"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="hypothetical protein ydeI"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79118.1"
FT   CDS_pept        complement(109574..110023)
FT                   /transl_table=11
FT                   /locus_tag="Bd1212"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein, InterPro: DUF188"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79119.1"
FT   CDS_pept        complement(110039..110590)
FT                   /transl_table=11
FT                   /locus_tag="Bd1213"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79120.1"
FT   sig_peptide     complement(110573..110590)
FT                   /locus_tag="sp0329"
FT   CDS_pept        complement(110705..111058)
FT                   /transl_table=11
FT                   /locus_tag="Bd1214"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79121.1"
FT                   NYRVHLSGYCNPL"
FT   sig_peptide     complement(111039..111058)
FT                   /locus_tag="sp0330"
FT   CDS_pept        complement(111055..111795)
FT                   /transl_table=11
FT                   /locus_tag="Bd1215"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative cytochrome b561"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79122.1"
FT   CDS_pept        complement(111909..112514)
FT                   /transl_table=11
FT                   /locus_tag="Bd1218"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79123.1"
FT   sig_peptide     complement(112497..112514)
FT                   /locus_tag="sp0332"
FT   CDS_pept        complement(112511..113269)
FT                   /transl_table=11
FT                   /locus_tag="Bd1219"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011873"
FT                   /db_xref="InterPro:IPR025537"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79124.1"
FT   CDS_pept        complement(113441..114238)
FT                   /transl_table=11
FT                   /locus_tag="Bd1220"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79125.1"
FT   sig_peptide     complement(114215..114238)
FT                   /locus_tag="sp0333"
FT   CDS_pept        114579..116288
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="Bd1221"
FT                   /product="ABC-type dipeptide transport system, ATPase
FT                   component"
FT                   /function="ATPase components of various ABC-type transport
FT                   systems contain duplicated ATPase"
FT                   /note="ABC transporter ATP-binding protein, InterPro: AAA
FT                   ATPase superfamily"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79126.1"
FT   CDS_pept        complement(116358..117320)
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="Bd1223"
FT                   /product="glucokinase"
FT                   /function="Transcriptional regulator/sugar kinase"
FT                   /EC_number=""
FT                   /note="glucose kinase [EC:], InterPro: ROK family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79127.1"
FT   CDS_pept        complement(117322..118764)
FT                   /transl_table=11
FT                   /gene="amy"
FT                   /locus_tag="Bd1224"
FT                   /product="alpha-amylase"
FT                   /function="Glycosidases"
FT                   /EC_number=""
FT                   /note="alpha-amylase (EC precursor , InterPro:
FT                   Glycoside hydrolase family 13"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM3"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79128.1"
FT   sig_peptide     complement(118741..118764)
FT                   /gene="amy"
FT                   /locus_tag="sp0334"
FT   CDS_pept        complement(118774..119817)
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="Bd1225"
FT                   /product="ABC-type maltose transport, ATP binding protein."
FT                   /note="ABC-type transport protein involved in maltose and
FT                   maltodextrin transport."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79129.1"
FT                   TGLNQRL"
FT   CDS_pept        complement(119819..120637)
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="Bd1226"
FT                   /product="ABC-type Maltose/ Maltodextrin permease"
FT                   /note="Protein involved in Maltose/ Maltodextrin transport"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79130.1"
FT   CDS_pept        complement(120637..122838)
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="Bd1227"
FT                   /product="maltose/maltodextrin transport permease
FT                   homologue"
FT                   /function="ABC-type sugar transport systems permease
FT                   components"
FT                   /note="InterPro: Bacterial extracellular solute-binding
FT                   protein family 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="PDB:6FFL"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79131.1"
FT   CDS_pept        complement(122838..125501)
FT                   /transl_table=11
FT                   /gene="amyX"
FT                   /locus_tag="Bd1228"
FT                   /product="pullulanase"
FT                   /function="Type II secretory pathway pullulanase PulA and
FT                   related glycosidases"
FT                   /EC_number=""
FT                   /note="InterPro: Glycoside hydrolase family 13"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNL9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79132.1"
FT                   QIPGRSTVILIQKAGH"
FT   sig_peptide     complement(125473..125501)
FT                   /gene="amyX"
FT                   /locus_tag="sp0335"
FT   CDS_pept        125530..126873
FT                   /transl_table=11
FT                   /gene="lamB"
FT                   /locus_tag="Bd1230"
FT                   /product="maltoporin precursor"
FT                   /function="Maltoporin (phage lambda and maltose receptor)"
FT                   /note="InterPro: LamB porin; maltose receptor."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNL8"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79133.1"
FT   CDS_pept        complement(126870..127301)
FT                   /transl_table=11
FT                   /locus_tag="Bd1231"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79134.1"
FT   sig_peptide     complement(127273..127301)
FT                   /locus_tag="sp0336"
FT   CDS_pept        complement(127311..128207)
FT                   /transl_table=11
FT                   /locus_tag="Bd1232"
FT                   /product="putative pirin-related protein"
FT                   /function="Pirin-related protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79135.1"
FT                   PGETDIIPLPPEPANKG"
FT   CDS_pept        128287..129060
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="Bd1233"
FT                   /product="AMP nucleosidase"
FT                   /function="Nucleoside phosphorylase"
FT                   /EC_number=""
FT                   /note="InterPro: Purine and other phosphorylases family 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNL5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010944"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79136.1"
FT   CDS_pept        129136..129603
FT                   /transl_table=11
FT                   /locus_tag="Bd1234"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79137.1"
FT   CDS_pept        129793..130332
FT                   /transl_table=11
FT                   /locus_tag="Bd1235"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79138.1"
FT                   VHLISKLQVKIKSGRR"
FT   CDS_pept        130453..130956
FT                   /transl_table=11
FT                   /locus_tag="Bd1236"
FT                   /product="probable DNA-binding stress protein"
FT                   /function="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /note="InterPro: Dps protein family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNL2"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79139.1"
FT                   SMLE"
FT   CDS_pept        complement(131009..131746)
FT                   /transl_table=11
FT                   /locus_tag="Bd1237"
FT                   /product="probable amino-acid ABC transporter"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain"
FT                   /note="(P54535) Probable amino-acid ABC transporter
FT                   extracellular binding protein yqiXprecursor"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79140.1"
FT   sig_peptide     complement(131726..131746)
FT                   /locus_tag="sp0337"
FT   CDS_pept        132034..132468
FT                   /transl_table=11
FT                   /locus_tag="Bd1238"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="putative Sigma 54 dependent transcriptional
FT                   activator"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNL0"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79141.1"
FT   CDS_pept        132539..133744
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="Bd1239"
FT                   /product="carboxy-terminal processing protease"
FT                   /function="Periplasmic protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="InterPro: Tail specific protease"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79142.1"
FT                   LD"
FT   CDS_pept        133916..134533
FT                   /transl_table=11
FT                   /locus_tag="Bd1240"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79143.1"
FT   CDS_pept        134573..135799
FT                   /transl_table=11
FT                   /locus_tag="Bd1242"
FT                   /product="hypothetical protein"
FT                   /function="predicted membrane protein/domain"
FT                   /note="COG1714 Predicted membrane protein/domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK7"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79144.1"
FT                   DFKERYEVP"
FT   CDS_pept        135796..136734
FT                   /transl_table=11
FT                   /locus_tag="Bd1243"
FT                   /product="putative integral membrane protein"
FT                   /function="Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /note="InterPro: Rhomboid family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79145.1"
FT   CDS_pept        136818..137711
FT                   /transl_table=11
FT                   /locus_tag="Bd1244"
FT                   /function="Endonuclease I"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG2356 Endonuclease I"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK5"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79146.1"
FT                   NPFVDHPELADRLFDF"
FT   sig_peptide     136818..136853
FT                   /locus_tag="sp0338"
FT   CDS_pept        complement(138058..142845)
FT                   /transl_table=11
FT                   /locus_tag="Bd1247"
FT                   /product="conserved hypothetical protein"
FT                   /function="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing proteins"
FT                   /note="putative hemagglutinin/hemolysin-related protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79147.1"
FT                   AGTSLNMLHQVRAARF"
FT   sig_peptide     complement(142808..142845)
FT                   /locus_tag="sp0339"
FT   CDS_pept        143056..143676
FT                   /transl_table=11
FT                   /locus_tag="Bd1248"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79148.1"
FT   CDS_pept        complement(143657..144112)
FT                   /transl_table=11
FT                   /locus_tag="Bd1249"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79149.1"
FT   sig_peptide     complement(144094..144112)
FT                   /locus_tag="sp0340"
FT   CDS_pept        complement(144317..147265)
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="Bd1251"
FT                   /product="1-pyrroline-5 carboxylate dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number=""
FT                   /note="1-pyrroline-5 carboxylate dehydrogenase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="InterPro:IPR041514"
FT                   /db_xref="PDB:5UR2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79150.1"
FT   CDS_pept        complement(147372..147959)
FT                   /transl_table=11
FT                   /locus_tag="Bd1253"
FT                   /product="conserved hypothetical protein"
FT                   /function="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-17-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNK0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79151.1"
FT   CDS_pept        complement(147956..148447)
FT                   /transl_table=11
FT                   /locus_tag="Bd1254"
FT                   /product="probable phosphoglycerate mutase"
FT                   /function="Fructose-26-bisphosphatase"
FT                   /EC_number=""
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79152.1"
FT                   "
FT   CDS_pept        148526..149425
FT                   /transl_table=11
FT                   /locus_tag="Bd1255"
FT                   /product="heat-shock protein HSP33 homologue"
FT                   /function="Disulfide bond chaperones of the HSP33 family"
FT                   /note="Chaperone hsp33 homologue"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79153.1"
FT                   SIPEVQELKDKLHKESLH"
FT   CDS_pept        complement(149422..149598)
FT                   /transl_table=11
FT                   /locus_tag="Bd1256"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79154.1"
FT                   VLAGLQAGAHPKT"
FT   CDS_pept        complement(149948..152140)
FT                   /transl_table=11
FT                   /locus_tag="Bd1257"
FT                   /product="hypothetical protein"
FT                   /function="Phosphatidylserine/
FT                   phosphatidylglycerophosphate/cardiolipin synthases and
FT                   related enzymes"
FT                   /note="weak similarity to cardiolipin synthetase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79155.1"
FT   sig_peptide     complement(152115..152140)
FT                   /locus_tag="sp0341"
FT   CDS_pept        152303..153499
FT                   /transl_table=11
FT                   /locus_tag="Bd1258"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="Sensory transduction histidine kinase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79156.1"
FT   CDS_pept        153503..154168
FT                   /transl_table=11
FT                   /locus_tag="Bd1259"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79157.1"
FT   CDS_pept        complement(154165..155070)
FT                   /transl_table=11
FT                   /locus_tag="Bd1260"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79158.1"
FT   sig_peptide     complement(155054..155070)
FT                   /locus_tag="sp0342"
FT   CDS_pept        complement(155070..155570)
FT                   /transl_table=11
FT                   /locus_tag="Bd1261"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79159.1"
FT                   KGE"
FT   sig_peptide     complement(155519..155570)
FT                   /locus_tag="sp0343"
FT   CDS_pept        complement(155574..156296)
FT                   /transl_table=11
FT                   /locus_tag="Bd1262"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="InterPro: Protein of unknown function DUF129"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79160.1"
FT                   QFTPEDDMYLPLYKHLMK"
FT   CDS_pept        complement(156298..157299)
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="Bd1264"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /function="Isocitrate/isopropylmalate dehydrogenase"
FT                   /EC_number=""
FT                   /note="InterPro: Isocitrate dehydrogenase NAD-dependent"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNJ0"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79161.1"
FT   CDS_pept        157794..158435
FT                   /transl_table=11
FT                   /locus_tag="Bd1265"
FT                   /product="metallo proteinase related protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="3.4.24.-"
FT                   /note="probable matrix metalloproteinase 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNI9"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79162.1"
FT   CDS_pept        158544..158774
FT                   /transl_table=11
FT                   /locus_tag="Bd1266"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79163.1"
FT   CDS_pept        158870..159163
FT                   /transl_table=11
FT                   /locus_tag="Bd1267"
FT                   /product="hypothetical protein"
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a HTH DNA-binding domain."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNI7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79164.1"
FT   CDS_pept        complement(159126..160409)
FT                   /transl_table=11
FT                   /locus_tag="Bd1268"
FT                   /product="hypothetical protein"
FT                   /function="Small-conductance mechanosensitive channel"
FT                   /note="COG3264 Small-conductance mechanosensitive channel"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79165.1"
FT   CDS_pept        complement(160441..160833)
FT                   /transl_table=11
FT                   /locus_tag="Bd1269"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79166.1"
FT   sig_peptide     complement(160786..160833)
FT                   /locus_tag="sp0344"
FT   CDS_pept        complement(160975..161292)
FT                   /transl_table=11
FT                   /locus_tag="Bd1270"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR014459"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79167.1"
FT                   H"
FT   CDS_pept        161436..162317
FT                   /transl_table=11
FT                   /locus_tag="Bd1271"
FT                   /product="putative periplasmic protease"
FT                   /function="Periplasmic protease"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNI3"
FT                   /db_xref="InterPro:IPR041110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79168.1"
FT                   LQAEEVSQESAH"
FT   CDS_pept        complement(162520..163269)
FT                   /transl_table=11
FT                   /locus_tag="Bd1272"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79169.1"
FT   sig_peptide     complement(163238..163269)
FT                   /locus_tag="sp0345"
FT   CDS_pept        complement(163461..163901)
FT                   /transl_table=11
FT                   /locus_tag="Bd1273"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79170.1"
FT   sig_peptide     complement(163881..163901)
FT                   /locus_tag="sp0346"
FT   CDS_pept        complement(164047..165597)
FT                   /transl_table=11
FT                   /locus_tag="Bd1274"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative integral membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNI0"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79171.1"
FT   CDS_pept        165617..165892
FT                   /transl_table=11
FT                   /locus_tag="Bd1275"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79172.1"
FT   sig_peptide     165617..165637
FT                   /locus_tag="sp0347"
FT   CDS_pept        complement(165958..166251)
FT                   /transl_table=11
FT                   /locus_tag="Bd1276"
FT                   /product="Transglycosylase associated protein"
FT                   /function="predicted membrane protein"
FT                   /note="predicted membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNH8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79173.1"
FT   CDS_pept        complement(166260..168590)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="Bd1277"
FT                   /product="DNA mismatch repair protein"
FT                   /function="Mismatch repair ATPase (MutS family)"
FT                   /note="InterPro: DNA mismatch repair protein MutS family
FT                   N-terminal domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNH7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79174.1"
FT   CDS_pept        complement(168568..170211)
FT                   /transl_table=11
FT                   /locus_tag="Bd1278"
FT                   /product="Carbon-nitrogen hydrolase: apolipoprotein
FT                   N-acyltransferase"
FT                   /function="Apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="InterPro: Carbon-nitrogen hydrolase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:P61032"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79175.1"
FT   CDS_pept        170212..171033
FT                   /transl_table=11
FT                   /locus_tag="Bd1279"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79176.1"
FT   CDS_pept        171039..171140
FT                   /transl_table=11
FT                   /locus_tag="Bd1280"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79177.1"
FT   CDS_pept        complement(171175..171762)
FT                   /transl_table=11
FT                   /locus_tag="Bd1281"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79178.1"
FT   sig_peptide     complement(171739..171762)
FT                   /locus_tag="sp0348"
FT   CDS_pept        complement(171810..172442)
FT                   /transl_table=11
FT                   /locus_tag="Bd1282"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79179.1"
FT   CDS_pept        complement(172626..174029)
FT                   /transl_table=11
FT                   /locus_tag="Bd1283"
FT                   /product="Serine protease/subtilase"
FT                   /function="Subtilisin-like serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="InterPro: Serine proteases subtilase family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNH2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79180.1"
FT                   GTKQENEGF"
FT   CDS_pept        174174..174683
FT                   /transl_table=11
FT                   /locus_tag="Bd1284"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79181.1"
FT                   DTFCNR"
FT   sig_peptide     174174..174197
FT                   /locus_tag="sp0349"
FT   CDS_pept        complement(174748..176991)
FT                   /transl_table=11
FT                   /locus_tag="Bd1285"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /function="Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /EC_number="3.2.1.-"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNH0"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79182.1"
FT   CDS_pept        complement(177010..177906)
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="Bd1287"
FT                   /product="heat shock protein HtpX"
FT                   /function="Zn-dependent protease with chaperone function"
FT                   /EC_number="3.4.24.-"
FT                   /note="Peptidase family M48"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79183.1"
FT                   THPPLEVRIEALQRGRF"
FT   CDS_pept        complement(177968..180298)
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="Bd1288"
FT                   /product="ATP-dependent Clp protease subunit"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /note="AAA-protein (ATPases associated with various
FT                   cellular activities)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79184.1"
FT   CDS_pept        complement(180295..180639)
FT                   /transl_table=11
FT                   /locus_tag="Bd1289"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG7"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79185.1"
FT                   PLKSTLEEEA"
FT   CDS_pept        180864..181436
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="Bd1290"
FT                   /product="fimbrial protein pilA"
FT                   /function="Type II secretory pathway pseudopilin PulG"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR028188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79186.1"
FT   sig_peptide     180864..180897
FT                   /gene="pilA"
FT                   /locus_tag="sp0350"
FT   CDS_pept        181444..182130
FT                   /transl_table=11
FT                   /locus_tag="Bd1291"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="putative PilG related protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79187.1"
FT                   QSMKQK"
FT   sig_peptide     181444..181487
FT                   /locus_tag="sp0351"
FT   CDS_pept        182216..183544
FT                   /transl_table=11
FT                   /locus_tag="Bd1292"
FT                   /product="hypothetical protein"
FT                   /note="putative rhs-related protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79188.1"
FT   CDS_pept        183554..183760
FT                   /transl_table=11
FT                   /locus_tag="Bd1293"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79189.1"
FT   CDS_pept        complement(183980..184291)
FT                   /transl_table=11
FT                   /locus_tag="Bd1294"
FT                   /product="hypothetical protein"
FT                   /function="Plasmid maintenance system antidote protein"
FT                   /note="probable Plasmid maintenance system antidote
FT                   protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79190.1"
FT   CDS_pept        complement(184281..184562)
FT                   /transl_table=11
FT                   /locus_tag="Bd1295"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79191.1"
FT   CDS_pept        184977..186092
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="Bd1296"
FT                   /product="DnaJ protein"
FT                   /function="DnaJ-class molecular chaperone with C-terminal
FT                   Zn finger domain"
FT                   /note="DnaJ class molecular chaperone, heat shock protein."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNG0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79192.1"
FT   CDS_pept        complement(186185..186307)
FT                   /transl_table=11
FT                   /locus_tag="Bd1297"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79193.1"
FT   CDS_pept        186352..188265
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="Bd1298"
FT                   /product="Chaperone protein dnaK"
FT                   /function="Molecular chaperone"
FT                   /note="Heat shock protein 70 ( hsp70)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79194.1"
FT                   VN"
FT   CDS_pept        188355..188951
FT                   /transl_table=11
FT                   /locus_tag="Bd1300"
FT                   /product="conserved hypothetical protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /note="probable Cyclic nucleotide-binding domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79195.1"
FT   CDS_pept        complement(188934..189794)
FT                   /transl_table=11
FT                   /locus_tag="Bd1301"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /function="Zn-dependent hydrolases including glyoxylases"
FT                   /note="probable Zn-dependent hydrolases including
FT                   glyoxylases"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79196.1"
FT                   LPLRQ"
FT   CDS_pept        189979..190302
FT                   /transl_table=11
FT                   /locus_tag="Bd1302"
FT                   /product="putative molybdopterin biosynthesis protein"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /note="Rhodanese related sulfurtransferase"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79197.1"
FT                   AGK"
FT   CDS_pept        190299..190718
FT                   /transl_table=11
FT                   /locus_tag="Bd1303"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted transporter component"
FT                   /note="predicted transporter component."
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF4"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79198.1"
FT   sig_peptide     190299..190329
FT                   /locus_tag="sp0352"
FT   CDS_pept        190720..191160
FT                   /transl_table=11
FT                   /locus_tag="Bd1304"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted transporter component"
FT                   /note="predicted transmembrane protein with a transporter
FT                   component"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79199.1"
FT   sig_peptide     190720..190746
FT                   /locus_tag="sp0353"
FT   CDS_pept        191171..191950
FT                   /transl_table=11
FT                   /locus_tag="Bd1305"
FT                   /product="putative permease"
FT                   /function="predicted permeases"
FT                   /note="predicted permeases (COG0730)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79200.1"
FT   sig_peptide     191171..191212
FT                   /locus_tag="sp0354"
FT   CDS_pept        192026..193963
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="Bd1306"
FT                   /product="acetyl coenzyme A synthetase"
FT                   /function="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /EC_number=""
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79201.1"
FT                   QELVDNRMNR"
FT   CDS_pept        193968..194495
FT                   /transl_table=11
FT                   /locus_tag="Bd1307"
FT                   /product="hypothetical protein"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79202.1"
FT                   KYAPEFVGAPVK"
FT   sig_peptide     193968..194007
FT                   /locus_tag="sp0355"
FT   CDS_pept        194500..195558
FT                   /transl_table=11
FT                   /gene="nifR"
FT                   /locus_tag="Bd1309"
FT                   /product="Nitrogen regulation protein nifR3"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /note="InterPro: Uncharacterized protein family UPF0034"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79203.1"
FT                   PVEMSLRTELRQ"
FT   CDS_pept        complement(195561..195857)
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="Bd1310"
FT                   /product="glutaredoxin"
FT                   /function="Glutaredoxin and related proteins"
FT                   /note="InterPro: Glutaredoxin"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79204.1"
FT   CDS_pept        195863..196519
FT                   /transl_table=11
FT                   /locus_tag="Bd1311"
FT                   /product="methyltransferase-related protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79205.1"
FT   CDS_pept        196696..198975
FT                   /transl_table=11
FT                   /locus_tag="Bd1312"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79206.1"
FT                   NYNALP"
FT   CDS_pept        199078..199935
FT                   /transl_table=11
FT                   /locus_tag="Bd1313"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted Fe-S oxidoreductases"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR011972"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79207.1"
FT                   PSLK"
FT   sig_peptide     199078..199098
FT                   /locus_tag="sp0356"
FT   CDS_pept        complement(199917..200888)
FT                   /transl_table=11
FT                   /locus_tag="Bd1314"
FT                   /product="Dihydrouridine synthase family protein"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /note="putative NifR3/Smm1 family protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR032886"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR042270"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79208.1"
FT   CDS_pept        complement(200891..201349)
FT                   /transl_table=11
FT                   /locus_tag="Bd1315"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79209.1"
FT   CDS_pept        complement(201346..201741)
FT                   /transl_table=11
FT                   /locus_tag="Bd1316"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79210.1"
FT   CDS_pept        201867..202634
FT                   /transl_table=11
FT                   /locus_tag="Bd1317"
FT                   /product="oxidoreductase"
FT                   /function="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /note="putative short-chain dehydrogenase [EC:1.-.-.-]"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79211.1"
FT   sig_peptide     201867..201890
FT                   /locus_tag="sp0357"
FT   CDS_pept        202634..204034
FT                   /transl_table=11
FT                   /locus_tag="Bd1318"
FT                   /product="fumarate hydratase"
FT                   /function="Fumarase"
FT                   /EC_number=""
FT                   /note="Fumarate hydratase, mitochondrial precursor
FT                   (Fumarase)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNE0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79212.1"
FT                   ENMVGPSR"
FT   CDS_pept        204154..205086
FT                   /transl_table=11
FT                   /locus_tag="Bd1319"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79213.1"
FT   CDS_pept        205101..205541
FT                   /transl_table=11
FT                   /locus_tag="Bd1320"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79214.1"
FT   CDS_pept        205564..207582
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="Bd1321"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP-dependent DNA helicase pcrA"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MND7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79215.1"
FT   CDS_pept        207717..209078
FT                   /transl_table=11
FT                   /locus_tag="Bd1322"
FT                   /product="putative sensory protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79216.1"
FT   CDS_pept        complement(209079..209765)
FT                   /transl_table=11
FT                   /locus_tag="Bd1323"
FT                   /product="Pseudouridine synthase Rlu family protein"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /note="Pseudouridine synthase Rlu family protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MND5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79217.1"
FT                   KEAMKG"
FT   CDS_pept        complement(209762..210172)
FT                   /transl_table=11
FT                   /locus_tag="Bd1324"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MND4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79218.1"
FT   CDS_pept        210289..210543
FT                   /transl_table=11
FT                   /locus_tag="Bd1325"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79219.1"
FT   CDS_pept        210612..211541
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="Bd1326"
FT                   /product="chromosome partitioning protein parA"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="InterPro: ParA family ATPase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79220.1"
FT   CDS_pept        211554..212162
FT                   /transl_table=11
FT                   /locus_tag="Bd1327"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79221.1"
FT   CDS_pept        212167..212499
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="Bd1328"
FT                   /product="BolA-like protein"
FT                   /function="Stress-induced morphogen (activity unknown)"
FT                   /note="InterPro: BolA-like protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MND0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79222.1"
FT                   KHDRRS"
FT   CDS_pept        complement(212496..212990)
FT                   /transl_table=11
FT                   /locus_tag="Bd1329"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79223.1"
FT                   P"
FT   sig_peptide     complement(212971..212990)
FT                   /locus_tag="sp0358"
FT   CDS_pept        complement(213096..213356)
FT                   /transl_table=11
FT                   /locus_tag="Bd1330"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79224.1"
FT   CDS_pept        213560..215230
FT                   /transl_table=11
FT                   /locus_tag="Bd1332"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="putative ATP-binding ABC transporter protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79225.1"
FT   CDS_pept        215230..216063
FT                   /transl_table=11
FT                   /locus_tag="Bd1333"
FT                   /product="conserved hypothetical protein"
FT                   /function="predicted membrane protein"
FT                   /note="putative membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNC6"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79226.1"
FT   CDS_pept        complement(216050..219505)
FT                   /transl_table=11
FT                   /locus_tag="Bd1334"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="putative cell wall surface anchor family protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79227.1"
FT   CDS_pept        complement(219598..220929)
FT                   /transl_table=11
FT                   /locus_tag="Bd1335"
FT                   /product="histidine kinase"
FT                   /note="Membrane associated signal transduction histidine
FT                   kinase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNC4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79228.1"
FT   CDS_pept        complement(220984..221388)
FT                   /transl_table=11
FT                   /locus_tag="Bd1336"
FT                   /product="conserved hypothetical protein"
FT                   /function="DnaJ-class molecular chaperone"
FT                   /note="DnaJ domain, putative (Fragment)"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79229.1"
FT   CDS_pept        221673..222095
FT                   /transl_table=11
FT                   /locus_tag="Bd1337"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro: BAF60b domain of the SWIB complex"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79230.1"
FT   CDS_pept        222540..223304
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="Bd1338"
FT                   /function="Methionine aminopeptidase"
FT                   /EC_number=""
FT                   /note="InterPro: Methionine aminopeptidase subfamily 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNC1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79231.1"
FT   CDS_pept        223338..224753
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="Bd1339"
FT                   /product="adenosylhomocysteinase"
FT                   /function="S-adenosylhomocysteine hydrolase"
FT                   /EC_number=""
FT                   /note="InterPro: S-adenosyl-L-homocysteine hydrolase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNC0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MNC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79232.1"
FT                   SPQGPFKPEHYRY"
FT   CDS_pept        225142..226737
FT                   /transl_table=11
FT                   /locus_tag="Bd1340"
FT                   /product="putative methyl accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="InterPro: Bacterial chemotaxis sensory transducer"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79233.1"
FT                   SMDDWGKVGTTDGF"
FT   sig_peptide     225142..225171
FT                   /locus_tag="sp0359"
FT   CDS_pept        226852..228525
FT                   /transl_table=11
FT                   /locus_tag="Bd1341"
FT                   /product="putative disulphide-isomerase"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79234.1"
FT   CDS_pept        complement(228522..229655)
FT                   /transl_table=11
FT                   /locus_tag="Bd1342"
FT                   /product="putative DNA alkylation repair enzyme"
FT                   /function="DNA alkylation repair enzyme"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79235.1"
FT   CDS_pept        complement(229683..230495)
FT                   /transl_table=11
FT                   /locus_tag="Bd1343"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB6"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79236.1"
FT   CDS_pept        complement(230497..230619)
FT                   /transl_table=11
FT                   /locus_tag="Bd1344"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79237.1"
FT   CDS_pept        complement(230661..231188)
FT                   /transl_table=11
FT                   /locus_tag="Bd1346"
FT                   /product="Oligoribonuclease"
FT                   /function="Oligoribonuclease (3->5 exoribonuclease)"
FT                   /EC_number="3.1.-.-"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79238.1"
FT                   LRHYTDKMHFTK"
FT   CDS_pept        complement(231265..231723)
FT                   /transl_table=11
FT                   /locus_tag="Bd1347"
FT                   /product="putative response regulatory protein"
FT                   /function="Response regulator containing CheY-like receiver
FT                   AAA-type ATPase and DNA-binding domains"
FT                   /note="InterPro: Response regulator receiver domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79239.1"
FT   CDS_pept        complement(231773..232048)
FT                   /transl_table=11
FT                   /locus_tag="Bd1348"
FT                   /product="putative cation-transporting ATPase"
FT                   /function="Copper chaperone"
FT                   /note="putative copper chaperone"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNB2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79240.1"
FT   tRNA            232217..232293
FT                   /gene="trna_0013"
FT                   /locus_tag="trna_0013"
FT                   /note="tRNA created by Simple tRNAscan Autoannotator"
FT   CDS_pept        complement(232356..233099)
FT                   /transl_table=11
FT                   /locus_tag="Bd1349"
FT                   /product="putative amino acid ABC transporter"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79241.1"
FT   sig_peptide     complement(233080..233099)
FT                   /locus_tag="sp0360"
FT   CDS_pept        233315..233848
FT                   /transl_table=11
FT                   /locus_tag="Bd1350"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79242.1"
FT                   AYVASLPAKARDNP"
FT   CDS_pept        234014..234529
FT                   /transl_table=11
FT                   /locus_tag="Bd1351"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79243.1"
FT                   CVHDIKKQ"
FT   CDS_pept        complement(234535..235065)
FT                   /transl_table=11
FT                   /locus_tag="Bd1352"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79244.1"
FT                   ARALVLSSKAHCK"
FT   CDS_pept        235528..236265
FT                   /transl_table=11
FT                   /locus_tag="Bd1353"
FT                   /product="putative oxidoreductase"
FT                   /note="InterPro: Short-chain dehydrogenase/reductase (SDR)
FT                   superfamily"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNA7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79245.1"
FT   CDS_pept        complement(236385..236702)
FT                   /transl_table=11
FT                   /locus_tag="Bd1354"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79246.1"
FT                   E"
FT   sig_peptide     complement(236682..236702)
FT                   /locus_tag="sp0361"
FT   CDS_pept        236713..239046
FT                   /transl_table=11
FT                   /locus_tag="Bd1355"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79247.1"
FT   CDS_pept        complement(239064..239645)
FT                   /transl_table=11
FT                   /locus_tag="Bd1356"
FT                   /function="Dihydrofolate reductase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNA4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79248.1"
FT   CDS_pept        complement(239652..239960)
FT                   /transl_table=11
FT                   /locus_tag="Bd1357"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79249.1"
FT   sig_peptide     complement(239938..239960)
FT                   /locus_tag="sp0362"
FT   CDS_pept        complement(239963..241543)
FT                   /transl_table=11
FT                   /locus_tag="Bd1358"
FT                   /product="putative peptidoglycan-binding protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="putative periplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNA2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79250.1"
FT                   LSQVKGLGR"
FT   sig_peptide     complement(241516..241543)
FT                   /locus_tag="sp0363"
FT   CDS_pept        241781..242635
FT                   /transl_table=11
FT                   /locus_tag="Bd1359"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MNA1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79251.1"
FT                   DVP"
FT   CDS_pept        complement(242636..244006)
FT                   /transl_table=11
FT                   /locus_tag="Bd1360"
FT                   /product="putative membrane associated lipoprotein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MNA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79252.1"
FT   sig_peptide     complement(243948..244006)
FT                   /locus_tag="sp0364"
FT   CDS_pept        complement(244152..244754)
FT                   /transl_table=11
FT                   /locus_tag="Bd1361"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79253.1"
FT   sig_peptide     complement(244712..244754)
FT                   /locus_tag="sp0365"
FT   CDS_pept        complement(244765..245637)
FT                   /transl_table=11
FT                   /locus_tag="Bd1362"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79254.1"
FT                   QNLEIINTN"
FT   sig_peptide     complement(245619..245637)
FT                   /locus_tag="sp0366"
FT   CDS_pept        245885..246307
FT                   /transl_table=11
FT                   /locus_tag="Bd1363"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR025630"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79255.1"
FT   CDS_pept        complement(246342..247523)
FT                   /transl_table=11
FT                   /gene="ydeA"
FT                   /locus_tag="Bd1364"
FT                   /product="MFS family protein"
FT                   /function="Arabinose efflux permease"
FT                   /note="ydeA; MFS family,
FT                   L-arabinose/isopropyl-beta-D-thiogalactopyranoside export
FT                   protein, contributes to control of arabinose regulon"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79256.1"
FT   sig_peptide     complement(247475..247523)
FT                   /gene="ydeA"
FT                   /locus_tag="sp0367"
FT   CDS_pept        247763..248290
FT                   /transl_table=11
FT                   /locus_tag="Bd1365"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /function="Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN95"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79257.1"
FT                   SLFPKYKKEKKK"
FT   sig_peptide     247763..247780
FT                   /locus_tag="sp0368"
FT   CDS_pept        complement(248293..248640)
FT                   /transl_table=11
FT                   /locus_tag="Bd1366"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79258.1"
FT                   GTENISITCQE"
FT   CDS_pept        248893..249435
FT                   /transl_table=11
FT                   /locus_tag="Bd1367"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79259.1"
FT                   ESFEKLKKYLAGPAQGH"
FT   CDS_pept        249597..250226
FT                   /transl_table=11
FT                   /locus_tag="Bd1368"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79260.1"
FT   CDS_pept        250405..251691
FT                   /transl_table=11
FT                   /locus_tag="Bd1369"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR041016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79261.1"
FT   CDS_pept        251810..253192
FT                   /transl_table=11
FT                   /locus_tag="Bd1370"
FT                   /product="RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /note="InterPro: DEAD/DEAH box helicase, ATP-dependent RNA
FT                   helicase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN90"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79262.1"
FT                   KR"
FT   CDS_pept        253288..254982
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="Bd1371"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number=""
FT                   /note="InterPro: Glutaminyl-tRNA synthetase GlnS"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN89"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79263.1"
FT   CDS_pept        255045..256319
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="Bd1372"
FT                   /product="aminopeptidase P"
FT                   /function="Xaa-Pro aminopeptidase"
FT                   /EC_number=""
FT                   /note="InterPro: metallopeptidase family M24"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN88"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79264.1"
FT   CDS_pept        complement(256322..256558)
FT                   /transl_table=11
FT                   /locus_tag="Bd1373"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79265.1"
FT   CDS_pept        complement(256708..256857)
FT                   /transl_table=11
FT                   /locus_tag="Bd1374"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN86"
FT                   /protein_id="CAE79266.1"
FT                   IIAP"
FT   CDS_pept        257079..257453
FT                   /transl_table=11
FT                   /locus_tag="Bd1375"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79267.1"
FT   CDS_pept        257580..259328
FT                   /transl_table=11
FT                   /locus_tag="Bd1376"
FT                   /product="putative ribose ABC transporter"
FT                   /function="ABC-type sugar transport system periplasmic
FT                   component"
FT                   /note="similar to ribose ABC transporter (binding protein)"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79268.1"
FT                   WNIFAL"
FT   sig_peptide     257580..257600
FT                   /locus_tag="sp0369"
FT   CDS_pept        259370..260569
FT                   /transl_table=11
FT                   /locus_tag="Bd1377"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="Region start changed from 1301727 to 1301754 (-27
FT                   bases)"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN83"
FT                   /protein_id="CAE79269.1"
FT                   "
FT   sig_peptide     259370..259410
FT                   /locus_tag="sp0370"
FT   CDS_pept        complement(260566..261522)
FT                   /transl_table=11
FT                   /locus_tag="Bd1378"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79270.1"
FT   CDS_pept        261599..261958
FT                   /transl_table=11
FT                   /locus_tag="Bd1379"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN81"
FT                   /db_xref="InterPro:IPR016924"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79271.1"
FT                   TILIVVLIIFLIKRI"
FT   sig_peptide     261599..261625
FT                   /locus_tag="sp0371"
FT   CDS_pept        261960..262889
FT                   /transl_table=11
FT                   /locus_tag="Bd1380"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022118"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79272.1"
FT   sig_peptide     261960..261983
FT                   /locus_tag="sp0372"
FT   CDS_pept        262958..265555
FT                   /transl_table=11
FT                   /locus_tag="Bd1381"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="InterPro: Histidine kinase C-terminal"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN79"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79273.1"
FT   CDS_pept        complement(265552..267690)
FT                   /transl_table=11
FT                   /locus_tag="Bd1382"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="InterPro: Histidine kinase C-terminal,"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79274.1"
FT                   VDMNLLNDILSRVQGPLN"
FT   CDS_pept        complement(267741..268460)
FT                   /transl_table=11
FT                   /locus_tag="Bd1383"
FT                   /product="Pseudouridine synthase Rlu family protein"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /note="InterPro: Pseudouridine synthase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN77"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79275.1"
FT                   CDKWNQIHELFSWKPPT"
FT   CDS_pept        complement(268457..269092)
FT                   /transl_table=11
FT                   /locus_tag="Bd1384"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79276.1"
FT   CDS_pept        269097..269765
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="Bd1385"
FT                   /product="putative phosphodiesterase"
FT                   /function="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /note="Glycerophosphoryl diester phosphodiesterase (EC
FT          phosphodiesterase)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN75"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79277.1"
FT                   "
FT   CDS_pept        269831..271111
FT                   /transl_table=11
FT                   /locus_tag="Bd1386"
FT                   /product="Cys/Met metabolism lyase (PLP-dependent)"
FT                   /function="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN74"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79278.1"
FT   CDS_pept        complement(271108..271731)
FT                   /transl_table=11
FT                   /locus_tag="Bd1387"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79279.1"
FT   sig_peptide     complement(271682..271731)
FT                   /locus_tag="sp0373"
FT   CDS_pept        271914..272528
FT                   /transl_table=11
FT                   /locus_tag="Bd1389"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79280.1"
FT   CDS_pept        complement(272525..274126)
FT                   /transl_table=11
FT                   /gene="prnA"
FT                   /locus_tag="Bd1390"
FT                   /product="tryptophan halogenase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN71"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79281.1"
FT                   EQLFNDTDTWIMEADV"
FT   CDS_pept        274310..275161
FT                   /transl_table=11
FT                   /locus_tag="Bd1391"
FT                   /product="putative trypsin"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN70"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79282.1"
FT                   RQ"
FT   sig_peptide     274310..274334
FT                   /locus_tag="sp0375"
FT   CDS_pept        complement(275168..277264)
FT                   /transl_table=11
FT                   /locus_tag="Bd1392"
FT                   /product="TonB-dependent siderophore receptor, putative"
FT                   /function="Outer membrane receptor proteins mostly Fe
FT                   transport"
FT                   /note="InterPro: TonB-dependent receptor protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN69"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79283.1"
FT                   QTNL"
FT   sig_peptide     complement(277238..277264)
FT                   /locus_tag="sp0376"
FT   CDS_pept        277529..278629
FT                   /transl_table=11
FT                   /locus_tag="Bd1393"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="putative SAM-dependent methyltransferases"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79284.1"
FT   CDS_pept        complement(278630..280147)
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="Bd1394"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /note="InterPro: DEAD/DEAH box helicase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN67"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79285.1"
FT   CDS_pept        280157..280993
FT                   /transl_table=11
FT                   /locus_tag="Bd1395"
FT                   /product="nucleic acid binding protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="S1 RNA binding domain"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79286.1"
FT   CDS_pept        complement(281040..281171)
FT                   /transl_table=11
FT                   /locus_tag="Bd1396"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79287.1"
FT   CDS_pept        281318..281668
FT                   /transl_table=11
FT                   /gene="rbpA"
FT                   /locus_tag="Bd1397"
FT                   /product="putative RNA-binding protein"
FT                   /function="RNA-binding proteins (RRM domain)"
FT                   /note="InterPro: RNA-binding region RNP-1 (RNA recognition
FT                   motif)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN64"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79288.1"
FT                   GGFGGGNRGGRF"
FT   CDS_pept        281881..282432
FT                   /transl_table=11
FT                   /locus_tag="Bd1398"
FT                   /product="putative transmembrane protein"
FT                   /function="Uncharacterized protein with SCP/PR1 domains"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN63"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79289.1"
FT   sig_peptide     281881..281915
FT                   /locus_tag="sp0377"
FT   CDS_pept        282540..283097
FT                   /transl_table=11
FT                   /locus_tag="Bd1399"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79290.1"
FT   sig_peptide     282540..282567
FT                   /locus_tag="sp0378"
FT   CDS_pept        complement(283094..283633)
FT                   /transl_table=11
FT                   /locus_tag="Bd1400"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79291.1"
FT                   ANEITKIITPRPWCNP"
FT   sig_peptide     complement(283603..283633)
FT                   /locus_tag="sp0379"
FT   CDS_pept        283759..284301
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="Bd1401"
FT                   /product="superoxide dismutase"
FT                   /function="Cu/Zn superoxide dismutase"
FT                   /EC_number=""
FT                   /note="InterPro: Copper/Zinc superoxide dismutase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN60"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79292.1"
FT                   IACGEIKTPPESKPVIK"
FT   sig_peptide     283759..283779
FT                   /gene="sodC"
FT                   /locus_tag="sp0380"
FT   CDS_pept        complement(284302..285099)
FT                   /transl_table=11
FT                   /locus_tag="Bd1402"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR032676"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79293.1"
FT   sig_peptide     complement(285055..285099)
FT                   /locus_tag="sp0381"
FT   CDS_pept        285587..285952
FT                   /transl_table=11
FT                   /locus_tag="Bd1403"
FT                   /product="putative glyoxalase"
FT                   /function="predicted enzyme related to lactoylglutathione
FT                   lyase"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79294.1"
FT                   ATFEDSEGNKVALHAKH"
FT   CDS_pept        286053..286499
FT                   /transl_table=11
FT                   /locus_tag="Bd1404"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="similarity to Microcin C7 self-immunity protein
FT                   mccF"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79295.1"
FT   sig_peptide     286053..286071
FT                   /locus_tag="sp0382"
FT   CDS_pept        286586..286891
FT                   /transl_table=11
FT                   /locus_tag="Bd1405"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79296.1"
FT   sig_peptide     286586..286611
FT                   /locus_tag="sp0383"
FT   CDS_pept        286976..287257
FT                   /transl_table=11
FT                   /locus_tag="Bd1407"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN55"
FT                   /protein_id="CAE79297.1"
FT   CDS_pept        complement(287254..288642)
FT                   /transl_table=11
FT                   /locus_tag="Bd1408"
FT                   /product="outer membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN54"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79298.1"
FT                   VCGN"
FT   sig_peptide     complement(288610..288642)
FT                   /locus_tag="sp0384"
FT   CDS_pept        288828..289232
FT                   /transl_table=11
FT                   /locus_tag="Bd1409"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="putative anti-sigma F factor antagonist"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79299.1"
FT   CDS_pept        289250..289894
FT                   /transl_table=11
FT                   /locus_tag="Bd1410"
FT                   /product="putative Ni,Fe-hydrogenase I cytochrome b
FT                   subunit"
FT                   /function="NiFe-hydrogenase I cytochrome b subunit"
FT                   /note="Ni,Fe-hydrogenase I cytochrome b subunit"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN52"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79300.1"
FT   CDS_pept        complement(289926..290717)
FT                   /transl_table=11
FT                   /locus_tag="Bd1411"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79301.1"
FT   CDS_pept        complement(290826..292796)
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="Bd1412"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="Superfamily II DNA and RNA helicases"
FT                   /note="InterPro: DEAD/DEAH box helicase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN50"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79302.1"
FT   CDS_pept        complement(292856..293671)
FT                   /transl_table=11
FT                   /locus_tag="Bd1413"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79303.1"
FT   sig_peptide     complement(293631..293671)
FT                   /locus_tag="sp0385"
FT   CDS_pept        293885..295516
FT                   /transl_table=11
FT                   /locus_tag="Bd1414"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79304.1"
FT   CDS_pept        295516..296316
FT                   /transl_table=11
FT                   /locus_tag="Bd1415"
FT                   /product="putative Lysophospholipase"
FT                   /function="Lysophospholipase"
FT                   /note="InterPro: Esterase/lipase/thioesterase family active
FT                   site"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79305.1"
FT   CDS_pept        complement(296793..296900)
FT                   /transl_table=11
FT                   /locus_tag="Bd1416"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79306.1"
FT   CDS_pept        complement(297149..298183)
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="Bd1418"
FT                   /function="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /note="InterPro: Bacterial extracellular solute-binding
FT                   protein family 1"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN45"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79307.1"
FT                   IKTH"
FT   sig_peptide     complement(298159..298183)
FT                   /gene="potD"
FT                   /locus_tag="sp0386"
FT   CDS_pept        298225..299103
FT                   /transl_table=11
FT                   /locus_tag="Bd1419"
FT                   /product="Spermidine/putrescine transport ATP-binding
FT                   protein potA"
FT                   /note="Region start changed from 1340522 to 1340609 (-87
FT                   bases)"
FT                   /db_xref="GOA:Q6MN44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN44"
FT                   /protein_id="CAE79308.1"
FT                   RRAMVFGEREK"
FT   CDS_pept        299100..299933
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="Bd1420"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component I"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79309.1"
FT   sig_peptide     299100..299131
FT                   /gene="potB"
FT                   /locus_tag="sp0387"
FT   CDS_pept        299926..300759
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="Bd1421"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /function="ABC-type spermidine/putrescine transport system
FT                   permease component II"
FT                   /note="InterPro: Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79310.1"
FT   CDS_pept        300806..301984
FT                   /transl_table=11
FT                   /locus_tag="Bd1422"
FT                   /product="MDR-type permease"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN41"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79311.1"
FT   CDS_pept        302050..302640
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="Bd1423"
FT                   /product="cell division protein FtsJ"
FT                   /function="23S rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="InterPro: FtsJ cell division protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN40"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MN40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79312.1"
FT   CDS_pept        302637..303314
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="Bd1424"
FT                   /product="putative pseudouridine synthase"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /EC_number=""
FT                   /note="InterPro: Pseudouridine synthase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN39"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79313.1"
FT                   SSL"
FT   CDS_pept        303448..303894
FT                   /transl_table=11
FT                   /locus_tag="Bd1425"
FT                   /product="transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="InterPro: Bacterial regulatory protein MarR family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN38"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79314.1"
FT   CDS_pept        complement(303891..304532)
FT                   /transl_table=11
FT                   /locus_tag="Bd1426"
FT                   /product="putative hydrolase"
FT                   /function="predicted HD superfamily hydrolase"
FT                   /note="predicted HD superfamily hydrolase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN37"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79315.1"
FT   CDS_pept        complement(304547..305389)
FT                   /transl_table=11
FT                   /locus_tag="Bd1427"
FT                   /product="putative cysteine protease"
FT                   /function="Cysteine protease"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN36"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79316.1"
FT   sig_peptide     complement(305361..305389)
FT                   /locus_tag="sp0388"
FT   CDS_pept        305453..305584
FT                   /transl_table=11
FT                   /locus_tag="Bd1428"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79317.1"
FT   CDS_pept        305630..306394
FT                   /transl_table=11
FT                   /locus_tag="Bd1429"
FT                   /product="putative amino acid ABC transporter"
FT                   /note="InterPro: Bacterial extracellular solute-binding
FT                   proteins family 3"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79318.1"
FT   CDS_pept        complement(306396..306716)
FT                   /transl_table=11
FT                   /locus_tag="Bd1430"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79319.1"
FT                   PD"
FT   CDS_pept        complement(306786..307286)
FT                   /transl_table=11
FT                   /locus_tag="Bd1431"
FT                   /product="putative nuclease"
FT                   /function="Micrococcal nuclease (thermonuclease) homologs"
FT                   /note="InterPro: Staphylococcus nuclease (SNase)
FT                   homologues"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79320.1"
FT                   ASR"
FT   sig_peptide     complement(307264..307286)
FT                   /locus_tag="sp0389"
FT   CDS_pept        complement(307323..308234)
FT                   /transl_table=11
FT                   /locus_tag="Bd1432"
FT                   /product="Serine protease, subtilase family"
FT                   /function="Subtilisin-like serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="InterPro: Serine proteases subtilase family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN31"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79321.1"
FT   CDS_pept        308282..308383
FT                   /transl_table=11
FT                   /locus_tag="Bd1433"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79322.1"
FT   CDS_pept        complement(308411..309637)
FT                   /transl_table=11
FT                   /locus_tag="Bd1434"
FT                   /product="GGDEF domain protein"
FT                   /function="FOG: GGDEF domain"
FT                   /note="InterPro: Domain of unknown function DUF9"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79323.1"
FT                   KGSQIKRVA"
FT   CDS_pept        309747..311312
FT                   /transl_table=11
FT                   /locus_tag="Bd1435"
FT                   /product="putative NAD(FAD)-dependent dehydrogenases"
FT                   /function="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN28"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79324.1"
FT                   DHHP"
FT   CDS_pept        complement(311352..311804)
FT                   /transl_table=11
FT                   /locus_tag="Bd1436"
FT                   /product="osmotically inducible protein"
FT                   /function="predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /note="Region start changed from 1354260 to 1354188 (-72
FT                   bases)"
FT                   /db_xref="GOA:Q6MN27"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN27"
FT                   /protein_id="CAE79325.1"
FT   CDS_pept        311903..312880
FT                   /transl_table=11
FT                   /locus_tag="Bd1437"
FT                   /product="membrane protein"
FT                   /function="predicted membrane protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN26"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MN26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79326.1"
FT   sig_peptide     311903..311936
FT                   /locus_tag="sp0390"
FT   CDS_pept        complement(312922..313092)
FT                   /transl_table=11
FT                   /locus_tag="Bd1438"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN25"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MN25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79327.1"
FT                   FVINLVSGRKP"
FT   sig_peptide     complement(313068..313092)
FT                   /locus_tag="sp0391"
FT   CDS_pept        complement(313085..313306)
FT                   /transl_table=11
FT                   /locus_tag="Bd1439"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN24"
FT                   /protein_id="CAE79328.1"
FT   CDS_pept        complement(313441..314241)
FT                   /transl_table=11
FT                   /locus_tag="Bd1440"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79329.1"
FT   sig_peptide     complement(314209..314241)
FT                   /locus_tag="sp0392"
FT   CDS_pept        complement(314386..314553)
FT                   /transl_table=11
FT                   /locus_tag="Bd1441"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79330.1"
FT                   SIVLKFYVSV"
FT   CDS_pept        complement(314541..314849)
FT                   /transl_table=11
FT                   /locus_tag="Bd1442"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79331.1"
FT   sig_peptide     complement(314826..314849)
FT                   /locus_tag="sp0393"
FT   CDS_pept        complement(314979..315500)
FT                   /transl_table=11
FT                   /locus_tag="Bd1443"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79332.1"
FT                   DSALSEIYSH"
FT   sig_peptide     complement(315474..315500)
FT                   /locus_tag="sp0394"
FT   CDS_pept        complement(315575..318730)
FT                   /transl_table=11
FT                   /locus_tag="Bd1444"
FT                   /product="Serine protease, subtilase family"
FT                   /function="Subtilisin-like serine proteases"
FT                   /EC_number="3.4.21.-"
FT                   /note="InterPro: Serine proteases subtilase family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN19"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79333.1"
FT                   DEN"
FT   sig_peptide     complement(318699..318730)
FT                   /locus_tag="sp0395"
FT   CDS_pept        319036..319710
FT                   /transl_table=11
FT                   /locus_tag="Bd1447"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79334.1"
FT                   GR"
FT   sig_peptide     319036..319056
FT                   /locus_tag="sp0396"
FT   CDS_pept        complement(319753..322584)
FT                   /transl_table=11
FT                   /locus_tag="Bd1448"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79335.1"
FT                   EGEIFLGTNLAVF"
FT   sig_peptide     complement(322561..322584)
FT                   /locus_tag="sp0397"
FT   CDS_pept        complement(322656..330386)
FT                   /transl_table=11
FT                   /locus_tag="Bd1449"
FT                   /product="cell wall surface anchor family protein"
FT                   /function="RTX toxins and related Ca2+-binding proteins"
FT                   /note="InterPro: Domain found in Na-Ca exchanger and
FT                   integrin-beta4"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN16"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79336.1"
FT   sig_peptide     complement(330354..330386)
FT                   /locus_tag="sp0398"
FT   CDS_pept        330667..331650
FT                   /transl_table=11
FT                   /locus_tag="Bd1451"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro: Bacterial regulatory protein MarR family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN15"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79337.1"
FT   CDS_pept        331647..332087
FT                   /transl_table=11
FT                   /locus_tag="Bd1452"
FT                   /product="putative Phenylacetic acid degradation protein
FT                   PAAI"
FT                   /function="Uncharacterized protein possibly involved in
FT                   aromatic compounds catabolism"
FT                   /note="InterPro: DUF157"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79338.1"
FT   CDS_pept        complement(332090..332920)
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="Bd1453"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="InterPro: Bacterial regulatory protein LysR family"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79339.1"
FT   CDS_pept        333009..334046
FT                   /transl_table=11
FT                   /gene="pvcA"
FT                   /locus_tag="Bd1454"
FT                   /product="pyoverdine biosynthesis protein PvcA"
FT                   /function="Pyoverdine/dityrosine biosynthesis protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR017133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79340.1"
FT                   LRGEL"
FT   CDS_pept        334043..334879
FT                   /transl_table=11
FT                   /gene="pvcB"
FT                   /locus_tag="Bd1455"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /function="probable taurine catabolism dioxygenase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN11"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79341.1"
FT   CDS_pept        334876..336288
FT                   /transl_table=11
FT                   /locus_tag="Bd1456"
FT                   /product="FAD monooxygenase, PheA/TfdB family"
FT                   /function="2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /EC_number="1.14.13.-"
FT                   /note="InterPro: Aromatic-ring hydroxylase (flavoprotein
FT                   monooxygenase)"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN10"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79342.1"
FT                   LGRARELLSSFI"
FT   CDS_pept        complement(336285..336638)
FT                   /transl_table=11
FT                   /locus_tag="Bd1457"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79343.1"
FT                   LAARGIYELDLDL"
FT   CDS_pept        336957..337544
FT                   /transl_table=11
FT                   /locus_tag="Bd1458"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN08"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79344.1"
FT   CDS_pept        337544..338131
FT                   /transl_table=11
FT                   /locus_tag="Bd1459"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR036490"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79345.1"
FT   tRNA            complement(338385..338460)
FT                   /gene="trna_0014"
FT                   /locus_tag="trna_0014"
FT                   /note="tRNA created by Simple tRNAscan Autoannotator"
FT   tRNA            complement(338488..338563)
FT                   /gene="trna_0015"
FT                   /locus_tag="trna_0015"
FT                   /note="tRNA created by Simple tRNAscan Autoannotator"
FT   CDS_pept        complement(338718..340016)
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Bd1460"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthase"
FT                   /EC_number=""
FT                   /note="InterPro: Adenylosuccinate synthetase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN06"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MN06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79346.1"
FT   CDS_pept        complement(340078..341064)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="Bd1461"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /function="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number=""
FT                   /note="InterPro: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN05"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79347.1"
FT   CDS_pept        complement(341061..342224)
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="Bd1462"
FT                   /product="Aspartate aminotransferase, putative"
FT                   /function="Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="InterPro: Aminotransferase class-V"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN04"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79348.1"
FT   CDS_pept        342234..342881
FT                   /transl_table=11
FT                   /locus_tag="Bd1463"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN03"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79349.1"
FT   CDS_pept        342897..343907
FT                   /transl_table=11
FT                   /locus_tag="Bd1464"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /function="DNA polymerase III delta subunit"
FT                   /EC_number=""
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN02"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79350.1"
FT   CDS_pept        complement(343909..344007)
FT                   /transl_table=11
FT                   /locus_tag="Bd1465"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79351.1"
FT                   /translation="MSSNAGLALFITKLIGLFSYQLEIVCTPASLE"
FT   CDS_pept        344117..344344
FT                   /transl_table=11
FT                   /locus_tag="Bd1466"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MN00"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MN00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79352.1"
FT   CDS_pept        complement(344368..344631)
FT                   /transl_table=11
FT                   /locus_tag="Bd1467"
FT                   /product="30S ribosomal protein S20"
FT                   /function="Ribosomal protein S20"
FT                   /note="CDS"
FT                   /db_xref="GOA:Q6MMZ9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6MMZ9"
FT                   /protein_id="CAE79353.1"
FT   CDS_pept        344684..346255
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="Bd1468"
FT                   /product="putative virulence factor"
FT                   /function="Uncharacterized membrane protein putative
FT                   virulence factor"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q8VNZ2"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VNZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79354.1"
FT                   RRSSQP"
FT   CDS_pept        complement(346227..347906)
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="Bd1469"
FT                   /product="methyl accepting chemotaxis protein"
FT                   /function="Methyl-accepting chemotaxis protein"
FT                   /note="InterPro: Bacterial chemotaxis sensory transducer"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MMZ8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MMZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79355.1"
FT   CDS_pept        complement(348048..349646)
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="Bd1470"
FT                   /product="methyl accepting chemotaxis protein"
FT                   /note="InterPro: Bacterial chemotaxis sensory transducer"
FT                   /note="hypothetical protein"
FT                   /db_xref="GOA:Q6MMZ7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6MMZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAE79356.1"
FT                   FDEDDRAKVGTTDGF"
SQ   Sequence 349697 BP; 83620 A; 83694 C; 94645 G; 87738 T; 0 other;
     cgcttctgtt ctgaaaatct ggtcttgaaa caaaaaaccc gctctttcga agcgggtttt        60
     ttgtttttaa atcacatctg aaaaatcaga tcgaaaacgg gtaggtctga agttccgcac       120
     gggtgatttc tttttgctcc ccggtggtga aattcttcac tgtcactgtt ttattagtca       180
     cttcgttgcc acccaaaatc agagcatagt gtgcgcccag tttgttggct ttttgcatct       240
     tcttgcccat tttaccggac aggaagtttt cagtcttaaa gccgcgaacg cgcatttcgt       300
     gagcgacttt gacgctttcg tcctcgcctt gttcgtcagc acccaccacg gcaatgatca       360
     cttctttttt ggttgccagc tctttcggag tcaggtcggc caagcggtca atgccggcag       420
     cccagcccac gcccggagtt tttggtccac ccatggtttc aatcaggcca tcataacgac       480
     cgcccgcaag cacagtgcct tgcgcgccca gtttggtggt cgtgaattcg aagaccgtgt       540
     ggcaataata atcaagtcca cgaaccagat gatcattaat cttgtaaggg attcccagct       600
     tttcgatgcc cgcgatgacc ttcttgaaga agtcctggga agtctgattc aaggattgtt       660
     caagttttgg tgcgttggca ttcagctttt tgtcgccttc gtctttggaa tccagaatac       720
     gcagcggatt tttctccaga cgcattttgc tgtcttcaga aagctgatcc ttatgggctg       780
     tgaagtaatt caccaaagta tcgcggtaag ccgcacggct ttccgcgtcg cccagtgtgt       840
     tgatttccaa agtgcagtcg tcagagatgc cgattttttt cagcagatcc cacgccaaag       900
     agatcgtttc cacgtcggcc aaaggggact cataacctaa acactctgcg cccaattggt       960
     aaaattggcg atatcgtcct ttttgtggtc gctcataacg aaacatcggg ccggaataat      1020
     agaacttcag tggaagattc tgcatcatgc cttctgaaat aaaagcacga gccacacccg      1080
     cagtgccctc gggtctgagc gtcagacttt cgcctccacg atctgtaaaa tcataagtct      1140
     ctttattcac aacgtcggaa gtttcaccca aagtgcggtg aaaaacgtca gaaaactcga      1200
     aaataggggt ttcgatctct ccgtatccgt acaaaagtgc cttttcatag gctgattctt      1260
     cgacaaaacg gaaaagaatg ctgtcttcag gaagcaggtc tcgagtgccg cggacgcgtt      1320
     gaattttatt gctcatggaa ttggcccttt tttgactaca aaacatcgtt atatcagagg      1380
     cacgggcggt gcgcaaagct attgctttta aagaggggag cgtctttaat ggaattatga      1440
     agaagtgggt attagcagga gcgttcattc tggtggctgt tacagctgcc gtcatctatc      1500
     agttcgccgg atccggtggc gccgcattga atggtgtcga ggtcgactgg cgattgttgg      1560
     gtgagatgga ctatgtgact ggcaactcgt cttcagagct gaaagcgctg gacgggaaga      1620
     ctgtcaagat tccgggcttc atggtgcccc ttgaagacga tcagcgcgaa gtggtggagt      1680
     tccttttggt gccaagcccg caggcttgca tccacgttcc accgccgccg ccgaatcaaa      1740
     tggtgtacgt taagatgaaa cgcggaactg atgcggcggt agggccgatc tgggtccacg      1800
     gaactttgaa tctagtgact aagaagtcta tgtacgggga tgcctcgttc gaattgatcg      1860
     gagaggcgat cgaaccttac aaataacttt caaggaggtc tttatgttga aagttcttct      1920
     gttttccctg atggccatgg cgcattccga tcacagcgcg cacaatcaaa gtgcccacgt      1980
     tcatggcgct ggcaaagtca gtctggcctt tgatggcaaa aaaggaaaat tggagttcca      2040
     tgctccggcg gaatccatct atggatttga acacgcggcc aaatccaaaa aggacaagca      2100
     gaaaaaagaa gcagctttgt ccaagcttgg cgaaaaaata tccgagatgg tggttttgga      2160
     tcctgctttg aagtgtgaaa tcaaactgga catgtacgaa gtcatcgaaa agaaaaacca      2220
     ttccgacgtc gaaggggagt tcaatatctc ctgtgaagcg ccggtggcag gcagtaccat      2280
     cacgttcagt ttccagaaag tcttcccgcg cctgaaaaag gtgcaggtcg aagtgctggc      2340
     cgaccaggtg caaaagtccc tggaggttgg caagaacgga gaaactcttg agctcaagtg      2400
     atctgatcac catccgggat ttgtcttaca cctatgaagg tcagaaaaat cccacgctgc      2460
     acgttcctga atttacggtg aaaaagggcg aagagctgtt tctttacggc cccagtggca      2520
     caggtaaaac aacgttgtta gagattctgg cgggcgtgct tcgtccgacc agcgggactg      2580
     tgcagattct gggacgtgac tttgttaaaa tgtccgattc cgagcgtgat tccttccgcg      2640
     cggaacatat gggctatgtc ttccaaagct tcaatttgat tccgtatctt tcggtgcgtg      2700
     aaaacatcga acttccgctg catctcagtc cggcccgcaa ggcccgtctg ggcagtgtgg      2760
     ataccgaaat ggtgatccgt gctttgtgtg gcaacctggg gatttccgac ttgctggaaa      2820
     aaggtgtcac ggaactgagt gtcggacaac agcagcgtgt ggctgtggcc cgcgcccttc      2880
     tggggaaacc ggatctgctc ttggcagacg aaccgacttc ggccctggat gcagatcacc      2940
     gcgaaaaatt cctgaagctt ctgtttgaac tgtccgagct ttatggcacg actgtcgtgt      3000
     ttgtttccca tgaccgcagc atagaaaaac tctttacgcg ttcaatctcc ttagaatcca      3060
     ttaacaaggt tgtgtgatgg tctttttgaa gttggcaatc aaatccctga agaatcgggc      3120
     gttcgcaaca acgctgacgg tgatctccat tgcattgagt gtggctttgc ttctgactgt      3180
     cgagcgcgcc aagcgggccg cggaagaggg cttcacgcaa accatcagca aaaccgatct      3240
     gatcgtcggc gcacgcagcg gtccgctgca gttgattctg tacactgtct tcaatatggg      3300
     gaatgccact cataacattt cctatgaaac ctatgaaaaa gtaaaagcac acccggcgat      3360
     tgaatggact attccttatt cattgggcga tggccatcgc ggtttccgcg tggtgggtac      3420
     gacgcaagac ttcttcaaac actatcatta tcgtggtgac cagcaggtga agtttgctca      3480
     aggcaaagag tttgctgaca tctgggatgt ggtggtcggt gcggatgtag cccgtaagct      3540
     gaaatacagt ctgggagatc gcattgtggt cgctcacggt gtgaccaagg gcgaaggcat      3600
     cttgcagcac gatgaccgtc cgtttgtgat ttccggtatt cttgagccga ccggcacgcc      3660
     attggaccgt gcggtttaca tgtccctgca ggggatggaa gctttgcacg tggactggca      3720
     agatggcgcc gctccggcaa tggacaaagt cattccgcgt gaacagctga cgaatgaatt      3780
     gaaggttcac actatcacgg cgttctttgt gggggccaag tcccgcatcg aaaccttgaa      3840
     gcttcagcgc gaaatcaaca cttatgaagg cgagccattg ctggcgatca ttccgggggc      3900
     gacattgagc gaactttgga atggattgtc ttacgttgaa ggcgtccttc gcatgatttc      3960
     ctggatggtt gtggccgtgg gcttcatggc catgctgatt gccttgacga caacactgaa      4020
     tgagcgccgt cgtgaaatgg cgatcttgcg tgcggtgggt gcgaaatcca atcagattct      4080
     ggggctattg gtgtttgaat ccgcactttt gacggcagtg ggtgtggcgt tggggcttgt      4140
     gacatcctgg ggtttgatcg cggtgttgaa accgtggatt gaaaccgagt ttggtctgta      4200
     tctggtgggc ccatgggtca ctcgttatga attgatgtat ctgatcatca ctctggttgg      4260
     cgggacgctg attggtttga ttccggcttt gcgtgcgcag aagctggccc tgaaagacgg      4320
     actgagcgtt cgtatctaaa aaaataaaaa accgcaggcg ttgcgacctg cggtttcatg      4380
     tctcttaggt tttggaatta tctactgaac aatttgtgca agctgggcac ctcctacagc      4440
     cggaaggccc gtcgtatcaa cattttccag gatcacacct ggtttagctt taaagaaaat      4500
     atccaccatc agacggaact ccacagcctg accgtctttg tctttgccgg ttgccagacg      4560
     ggtcagcagt tcttcttcgg ccacttcgct ctcgccttgt ttgaacatca ggaacggaga      4620
     gcgcagttcc gtgctgttgc cgtatttgtc tttttcgttg gcataaacca cgtggcaggc      4680
     gttgatcgca gcgactttcg catctgccag actgatcact tcaccggcat ccgccaccgc      4740
     gttgcgattt ttgtccaccc agactttgat tttctggctg tacagttcgc catcccaagg      4800
     gcccaggtaa tgcttctttg gatcttcgga ttgacagtct tttgccgcca gcgccgccaa      4860
     agtttcaaaa ccgttggcaa aagttttctc ttcgccgttc acagacactt tcatctgaga      4920
     accaaacagg ttttgggagc ttgtaatgct gccatccgca ttcggaacca ccaggaagcc      4980
     gtcatcaatt tcacggctga agtgggtttt gttcacattg tttgtggatt cgcgcacaac      5040
     caggttacca cccaaccaag ccgtcatgtg agtcactggc gcctggatat tggcaaggtt      5100
     gaagaagctt ccgccttcaa ggctggaagt gcgaacattt tttacgccca aatccagaac      5160
     cagcggagtg tacttggtgc tcatcgccgt accttcgaca ccggaatgaa ccagccactg      5220
     gatcagttgc ggcacacctt cgtaagcaga cagggtgccg actttggaag tgcgctggga      5280
     ggaaagcacg ttggtcacga aatcacgctc ggtccaaata gttcttaaag agaagatttc      5340
     tttgaaggtc aaacgcactt catcaccacg ggtcaggcct ttgcttagtt tgataaattc      5400
     cggcgtcaga atactgacgg tcttcccgga tttatcgaca acgttttcac gcaagtctgc      5460
     gacatacaga gccacgatgt tcggagttcc atcgcccagt tttttgaaca gtcgggggct      5520
     gccggaatca acgacgtctt cataggattc accatagtac aagttacgca gggaatggtt      5580
     ttgcacggct agcacgtctg ctggagcggt ggcaccttct tgaaagactg tcacggcacc      5640
     cacgtcatca acactggcaa tcgcgcgcac cgtgctgaag aagcattttt tacctgcgat      5700
     gaattcacga cgggcttgct ggtggtcagc aatatagtgg aagtgattgg ttttaaccgc      5760
     cgttttattg cagttcgtgg accatttgca ggcatccgcc gcactgtctt ttttggccgc      5820
     gccaacataa aatggtgtca caccattgga ttctttacgc aggatggatc tttcatgaga      5880
     ccactgtgca attgcgtctt cggcactgcc ggcagacacg gaaaagcgca ctggaatcaa      5940
     agaagtgtcc gctttcgccg ccgccagggc tgcttggcgt tcttcttcat aacggtcact      6000
     gccgtcagca cgctgacgtt cgcagtttga aacagctttg ccgttcaagc cgtcgtcagc      6060
     ggcaatattg ggtgtcatgg aatcgtcacc ctgactgatg tcagacatgt gtttatatgg      6120
     attgaacgga tcgactttcg gttcttcgac ttccgggatc accggcgtct gaccgaacac      6180
     gttgtccgtc aaagagcttt gttcaaggac tgagggggca aaacgtacag gttggctgca      6240
     accgacgaca gcctcaacaa gcgctccaca cagaacaatt tttgaaagtt tagttacttt      6300
     attcacgaaa atccccccgg atttaaaact gaatacttgc gaactagtga ttctggtcgc      6360
     gcagtgattt cacttcgact tcgtcctcca gcaggaatgg attgtatttc accggattgc      6420
     gcgtgctttg cacgacggtg atcacttcac ctttaaaggt gccttctgaa ctgacattgc      6480
     gtgtgatggt gttgttcaga ttcttggcgg cagcgttgtt ttcttcaatc atctgattaa      6540
     agtcgccggt gccgatacca tcttttgcaa aactcttaac tggtgcgatc agtgtgaata      6600
     gtaaaagtcc gcccattacc ttcttcatag catccccccg tggggaatct cctaaagcaa      6660
     cgctcaggcc agcgcttaag tgattgaaat cgcatgaagg gggctgttca cgatttggtg      6720
     gtgttaccgt tccttaatct ctgtgggtgc ttgatttgtc tgggataaac ctgaaaatcg      6780
     cccagtgttt aaacatggga atgggatgta cagtccgcta acagggggtg gggaacgtca      6840
     accagctttt agacagtgac cagggtatca acggcgataa gcaataggtt gctttaaaag      6900
     cggcaaggga aatgcaaggg tagtggattc cggggggaat catgcgtatc aatcttaagc      6960
     tagtgctttt gtgtctgctg cttattaata ttgtatcctg cgccagcgtg ggaacgaagg      7020
     atcccacccg acaggttcac gtgacggaag cctttatata tccggagtat agacagactg      7080
     tttctgtggc agaagagttc agccgcaagc aggtggcggc ggcaagcact tcacgcgctc      7140
     ccgccagcgt gccctaggcg gcgtctttga ttttgacctt gtcagcggct tccgcttcat      7200
     agtcagaata ggccgtgcgc acttcgacca tcgagccatc ttccgctcga taaccacgca      7260
     ccttgaacat tttcaaagcc tccgagcgtc ctttgacctc ggcggcaccg gcaagttcgg      7320
     tcttgaagtc ttcaccgatt ttttcgatga cagtgtctga aatcaacaga tccgcaccga      7380
     aagccttggt ggaggcttca attcgcgaag ccgtgttcac cgtgtttccg atcaccgtgt      7440
     actccatacg ctcatctgaa ccgatggttc cggaaattgc ttttccggcg tgcagcccca      7500
     taccgatgtt gatcggtggc tgttcgcggg caatgcggcg ttcattcagg ccttccaaag      7560
     cacggcgcat ttccaggcac gcacgcaccg cctgctgggc atctttgtcc gagcttttcg      7620
     gagctcccca gacagccatg atcgcatcgc cgatgaattt atccacgacc ccgccatgag      7680
     agttgatgat tttaaccatc acaccaaagt attcgttcag catttcaacg acctcttccg      7740
     gagatctttt ttccgagaaa gcggtgaaac cgcgaatatc cgagaagaag acgacgacgt      7800
     ccttggtctg accgccgaca ccgatatcgt tgttgatcaa gtcttcggcc accgaggaac      7860
     cgtggaattt cgagaacagg tttttcacct tgtcacgttc cttcaaacct tccgtcatgt      7920
     gatcaaaggc ctcggccaga tcgcccactt cgtcatggga tttcacctgg gcgcgggctt      7980
     tgacattgaa gttgcccttt gaaacgaggt tgatcatttc cgccagtttt tcaatcgggg      8040
     aggtcagggt catggagaac aggaagataa agaagatcgc catggaaata gcggaacccg      8100
     caacaaagat cgcccggcgt ttgacctcgc gggaaacttc caggatggtt tcttctgacg      8160
     tctgggaaat cacagtcgca ccgtaagacg tttttacgga cgcgccaaaa tagtccttgt      8220
     cgttgtcagg attcaggaac ttggtttgaa attgcggaga tttctgtgtc agggcttttt      8280
     gcacgatcgg gtacttcgcc atgttcaggc gcgccatggc tttttgttcg tccttatggg      8340
     ccagaagctc accatgacgg tcaatcaggt attgagtgcg ttctgacggg tccgtgaagg      8400
     gtttttcaaa cggcgccagg gacacatcgg ccagggccac gtgagtgatt ttgccctgtt      8460
     catcgcggat caggggaatg ccaattgtga tcatcgccgg agcctttggg taagtggcat      8520
     tcttaatttc gatgcttccc tgagccacgg aacggatcgg gaacttctgc caggaacgca      8580
     cgtgaatcat ataagtggag ttaagaccat aaggcttcag cacgtcctct ttcacacgac      8640
     gagccacggt ttccacgctg gtgccgtcca gcttcagaac ttccagggaa ataaagtttt      8700
     tgtctttggt gaaattgaaa tcaaagtcgt cgccggtttc cacttgagag ctggcgccct      8760
     tggtcagcag ggaggccgtg ccgcgggtct tgtccaccag attggcgatg atgttttcga      8820
     tttcttttgc tttggcagcg gcggattcca ggttcgcgat gtcaacctgc tcggccgctt      8880
     ttttctcaaa gtaagaggat gaaatccagg tgatcgtccc ggtggcggcg accaggatca      8940
     ggattgtgac tgtaatgagt tttgtcgaaa tcggtattct catagttctc tcctgatcag      9000
     aagctccact cggcaaagac gtttagatag ttaccaatga tggtggactc gttgacgtct      9060
     ccgtcagagg cgaagctgtc cgttccggtt ttcgccttgt aggacatttt gtcttctcgc      9120
     atggcatagc caatcaaccc ggtgaatctt ggtgtgaaac gataacttcc caggaagccg      9180
     aattgagtcg acattttggg ttccatcggc tcaccgttgg gtgtgctgat tttcatcagg      9240
     gacatgtaaa ggtgggcatt cacctgaatt cccagtttcg gtgtcaggga gtaccagtac      9300
     tcggcaccga agtgcgggcc ggcagagctg atttttagat cttctgaaga tccagagaag      9360
     gggtcaccca cagtttcagg cagttccttg tagtaagggc ctgcctggaa acgcacttca      9420
     ccacggtcac ccaaggcgcg gcggtaaacg gcattggctt cggcggaagc gaatgtctgg      9480
     gtttttccat tgaaggtgaa accactcatg tcgatgattc ctaaaaagcc ccaaggtgtg      9540
     tgcggactga accagcccac acccagacga cctgtgccgc ccagagcttt atagcccacg      9600
     gacgagtttt tctccgggtt gacgccctga taggacattt ctgtgatcag atagcttgca      9660
     accgcatacc atccggtgac gcgatcaatg gatttacgaa ccaaagcggt gtattccgcg      9720
     gccggagaac gatccccact gcgcaccgag aaggattgtt tcgccagggg agcagacggg      9780
     cgcagatcag actttgcgcg aaccacaacc tggtattttc cgcccggaag actttcatca      9840
     aatggcaggg tgtcttgctg atagttttca tagactttca gtttttccca ttttttatcg      9900
     gctgtgttgt acttcaacag gtagacgtca tagctggaga catgatctgg acgagtccat      9960
     ttcagctccc ggacgaaatc actttctggt ttttcaatgc gtggattttc aaccggcttg     10020
     cccagcaggg tgaactgacc cacggcggtc gcatcactgg tgatgccttc actgttgctt     10080
     gatgaaactt tccacgtata gtgcgaagcc acggggactt tcaccttata ggacggatcc     10140
     ttcagcgttt ccgtgatctg ggttttgccg tcatcagaag tcagaacgaa gtgatattgg     10200
     tcggcgccgc ccaccggagc ccatttgaac tccagcgaag tggtgtcggt ttctttggtg     10260
     gccattttca cacgggcccc cgggaatttc agcacggcgg tttccagtcc gacgttgaat     10320
     tcgctcggtt cactccagtc gccgggaacg ccacgatagt cgcgcgaacg cagcttcatc     10380
     atgtatttgc ccggagtcag ccggccattc caggcggcct cagtgacttt gaaggtgaaa     10440
     gttttggcgt cttcgccttt ggctttgact tgtttcagct cgatttcata ggacttggcg     10500
     ttctcaatgg cctcccactc gaagttcacc agacggcgat aaggcgccgc cagaaccatc     10560
     gaggtccaga aagagatcat taataaaatg aacgcactgc ctaacttcat cagttaacct     10620
     tgatcttctt taaagtaggg gctcgcacat tggacttgtc cggaaccagc agttttcggg     10680
     ccgggccgga ttggctgttt cttccatagg tgtcgacagc tgtcagttcc acttcatatt     10740
     cacccggcaa aagatttttt aatgccgtgg agttttgcat gtatttgctg cgtttgagtt     10800
     ccttgccatc tttgcgaatg gtcagccagt attccttcgc accttccacc gcgttccagg     10860
     tcagctgcgt gcggccgtcc atagaagcct gcaaagttcc ttcggctggc gtgaaacttg     10920
     gagcttccag caatggcagg ggactgacag tcagaatctg cgaacttgtt gtgcccagaa     10980
     ctttgccgtc tttattcaaa gcctcaatag aggcgatgta acggcctggt tttgcgacag     11040
     gagcctggac ttgtgtgttt tgaacttctt tgacgtcaaa gctttgcgcc agggccgggt     11100
     cttcttcttc agtgtgatac ttcacacgcc aagcagacac attttcagat ttgtccacct     11160
     tccaggaaag tcccaggcgt ggtttttcaa catagtactg aaccatgtct ttttcaggca     11220
     tggtaaagtt gatctgcacg gggacgaact ccacttttgc attcacctgg ctggcgggtt     11280
     tgatcgtgaa cttttgaact ttgcccagag aaggtttttc cgtatccagg aagtatgtgg     11340
     tcatgcgcca gtaataggag cctgccttca gaccccgggc cgtgaaagag tcttccttgg     11400
     tgaaggtgtt ggtggagatt ttgtttttca actggtcatc cgcccacagt tccaaagtca     11460
     tctggcgggt gtcctcaccc atttgccatt tgaatggcat gtcgtaaggt gtctgcatgg     11520
     caggcacttc cgcatccgct gtcgggaaaa ccatggtcgg cgcatagcgg gccaggactt     11580
     ctgttttgta aatagcactt tcggcagcca ccgacccttg cggatttgtc gctacaagtt     11640
     tccagtagtg acggccgaag ggcagtgaag ccataagttg atttgtattt ggagcggcct     11700
     tcagcagcgg tttcagctgt tttcggctgg ggccgaccca caacgtgacg ttggagttgg     11760
     ccgggaaccc ctgccattgg aatggcaccg attccgggtt ttcagcatcc atggccaccg     11820
     gcttttgtgg cagtggagtc aggattttaa cttcttcacg ggtggtcagg tctttgcttt     11880
     gaccgtcaga acctttgatg gacgctttac cttccagaac ctgaacgtcg acagaatctc     11940
     cgcggccttt ggaaagactt gcggaagcct gggacagatc gactttaccg ttggcagagt     12000
     tcagcaccag tcccggggca tcgccttcgg cggtgccggt tttggcgtta acgaacaaac     12060
     taccttccat caaatccagg gcgatttcgc cttcggactt tttgatcaca atcagtgatt     12120
     ccggctccag atccagatag cgatccgaac ccacaaactg gatgcgcact tcgcctcgct     12180
     cactggtacg gatggcttca ccgttgtaca aaggctcacc agtgttgacg agctgccata     12240
     atagacggga tgccgggcgg cgctgaatgt cttcaacgac ttttccgacg taggccagcg     12300
     gtttttcatt ggaattggag gaatgtgtgt cagctgtgga ctgataccag aaccacgtcg     12360
     cagcaaaaac ggatgacgag cttaatgcgg cgataagcag acgtttccac tgttttttca     12420
     tcgattcctc ctcatgcttt tttcggagta aatgtctcac tattaaaggg agctaaagtc     12480
     taggtccgcc gtttgggcga tggaattatg gaatcaaaat caaattcccg ttggaccggt     12540
     ctggaagatg gtctagagtc ttgcggtatg gataacaata agaactacat cacccccgaa     12600
     ggtctggcta agttgaaggc ggaatatcac gcgttgatgc acgtggagcg gcctaaattg     12660
     gtagaggttg tggcgtgggc ggccagcaac ggggatcgtt cagaaaacgc ggattatcag     12720
     tatggcaaac gtcgtttgcg tgaaatcgac cgtcgtgtgc attttttgac caaacgaatc     12780
     gaagatgctg agctcgtgga tccaaaacaa atgaaaggca cgaccgtgct tttcagtgcc     12840
     acagtcacac tggttaatga agacggtgat gaagtggtgt atcagatcgt cggcgaagat     12900
     gagtttgatc cgaaagcggg caagatttcc tggaagtctc ctgtggcgcg tgcgcttctt     12960
     ggaaaaaagt tgggagatga ggtgcgaatc atcaaacctg caggcgaaga gttcgttact     13020
     atcgagaacg tagagtttaa gtaaatttta cagttgtctt tgtctgtaca tttttgcaca     13080
     ctcctgcgca tagcaggggg agctatgaag ttcatcacta aagtcagtat ttatcttttc     13140
     gccttcgtcg ttgttttcgc tcacgttgaa acagttgaag ccaaacgccg caacaatcat     13200
     gaggaatcct gggaaaaaaa tcgccagagt gaagactcta gttacgagtc gggcgcattt     13260
     ttggatgaat ctgccagtga ttccgatctg gtacgggcgg tgaatgagcg ccgtcgtgag     13320
     gactttgtgg aggggggccg tctgacagtt gtaaaaatcc tgccggacga caacagtgga     13380
     ctggagcatc aaaagtgggt ggttcgtctt tccaatggcg agcttatgca ggctgtgtat     13440
     aatctggata tgtgcccacg tgttcctttg aatgttggcg acgtaatcgc catgggtggg     13500
     cagtttattt ggaccaacaa aggtggactg ctgcactggc ttcaccacga tccccgcggc     13560
     agacgcccgg atggatatgt gtacgtgaac gggcagtact actgtaagga gtagacttgc     13620
     aacgactgaa cctgattcca tgtgcagcgc ctttttgggc cgacagtggt cacggtcaga     13680
     cattgtgggc tcacttcctg aagtccgcag agctttcaca tttcggcaaa aaatttgaag     13740
     tcgatcttcc tgacggggat cgactttttt gttcctggct cgagggccac accaatctgg     13800
     tggtcagtct gtttcacggt ctttccgggg atgtcacctc ggactatatg caaagaaccg     13860
     cgctgatctg tcagcaattg gggcattctg ttgtgctggt caatcaccgt ggagctggtg     13920
     agggcgcgcc ctttgcaaaa cgtccgtatc attccggcag tgccgaggat gtgtccgtgg     13980
     tgctgggaca gcttcgtcag atgttcccga ataaaaagca catctcggtc ggatattcgt     14040
     tgagtggcaa tatcatgctg tgcctgctgg gcgggtatgg tggaaagcac aaacctgacg     14100
     gtgcgatcac cgtcaatgcg cccttaaatc tgcaatcagg ctcattgctt ttaaaatcgg     14160
     gctttaaccg tgtgtatgac atgcgttttg ttctgcgcct gcgcaagctg gtggaagaaa     14220
     agcaccgcct ggggctgatc acggaaaaat atgaaattcc gaagtgggcc acggtgtggg     14280
     atatggatca gatttacaca gcgccggcgt ccggctttgc cagtcgcgag gactactatc     14340
     agcgttgttc ttcgattcag tacgtttccg gtattgatgt gccgacttac accctgactt     14400
     cggcggatga tccgtttgta gatgtcagtg actatctgcg ggcaccattc tccaagcacg     14460
     tccaactgca tattgaaaag cgcggcgggc acatgggcta tctgcaccgc cagtctttgc     14520
     ctgtgggggg aacgcgctgg ctggattatt atttgtatga agccttaaga ggtcttgaag     14580
     gcacactcaa tgaaaaggtt ccagcgctgt ctccaaagtg agaagcctgg caatgtctgt     14640
     cctgattcaa acaccggaat ttccaaaacg cgaagctgct gacggcgaag gccccccagc     14700
     agttggggtc ccagatacca gccggtgaat ttgccgggat ggtcggcggc cagcttttca     14760
     atcgcggctt ttttaaacag cagaatctcg cttaaagggt cgtgggggca tcgcgggaat     14820
     ttgtcgcgca aaatgcggtt gaagctgtct tccatctgct gacgcggatg cgggcctttc     14880
     aggaaggggc tgtctttttt cttgtagcga tcgccccagc agatttcata accttcttcg     14940
     gtcatcaggt tttgcagtaa tttgaagtaa tcccccagag gcgtattcat gtccacggat     15000
     gtgatggctg aaaacggggc ctggctgttt ttcaagccca gccacaaact ggccgcacgg     15060
     ccgagctttt ttgaattctg caaaatgcgc acggggcctt cggtcggggg caccacgcag     15120
     cctttttctg ccacaacgat aacttcatag tttagcggga acttggcaaa aaaaccgcgc     15180
     agatcgcgca ggtacgccgg aagcatttca ggctgttcca aataaacaat cagtgagcag     15240
     tgcggggttg acacggaaga ttccatcttt acgatagtta acaatgaaat ctctcaaggt     15300
     cacgaacttc tctcatgcgg ctttctgggc ggggcttttc ctgctggcat tgatcagtcg     15360
     ttttgctctt ttgaccaaca aacccattca ttttgacgaa agcatcaacg gctggttcgt     15420
     gatgcagatg tctaagctgg gttattacaa gtacgatccc aacaactatc acggtccgat     15480
     gtacttttat atgctgcagg ggtttgagtc cctgtggggc cgaagtctgg aaactctgcg     15540
     agcagtgccc gcggtattca gcgtgctcag tgtggttgtt ctggcctggg gggcgcttcg     15600
     tcccaaggct gtgaacatgg tgatggcagt actggtgctg ctcagtccgg cctttgtctt     15660
     ttttggccgt tcgggaattc atgaaatgcc ttttgtgttt ttccaactgg tggcgggtat     15720
     gggaatcttg cgctggatcg gacgtcagga tgaaaaagcg ctggggcttt tcctgatcgg     15780
     gctgtggggc atgatggcgc tgaaggaaac attcgtgatc acgatgtttg cctgggtggt     15840
     ggcctttttg actctggggt ggaatcaatt gcgcacgatg ttttccccgg aaacaattcg     15900
     cttggcgtgg agtggtcgtc tgactgtttt gacggtgttg ctgcttttga tcttcctgca     15960
     gttgttcacg ggcttttatc agaatctttc aggcatcatc gatttcttta aagcggtact     16020
     gccatggttg aaaaccgggg tgcatggtca tggtcacgaa aaaagcgtgt ggtactggct     16080
     gcaggtcctt tacacggctg agccattggt gcttttgggc ggcttgctgg cggtcgtggg     16140
     tatcttctcc aaacgcaggg aactgcgtgc tgtcagtgtg ttttcattgg tgcagctttt     16200
     ggtgtattcc ctgatcccgt acaagacggt gtggtgtgtg ctttcgctgg tgtggggttt     16260
     ttactttgtt ctggcgatgt cgctggtcaa tgcctttgaa tcccgctttg tgggccgcca     16320
     tgtgctggcg ggtgtggcag tgttgttggc ggccgtgggc cttcgtagtg cgtggatctc     16380
     agtgtatcaa agacctattg atttgacgca tccttatgtt tacgtcaatt ccacctacga     16440
     gctggtgcag gtttctgacc ttatcaccaa aaatattctg gaaaaacctt cgttggccca     16500
     acaaagaatg caagtcggca tgaaagaaca gtggccatgg ccgtggcttt tgcgctatgc     16560
     aaataatttg tcctatgagc tttgcagcaa acgcgttcag gaaaatgccg ctgtgtattt     16620
     ctgtgactac ggggtcgccg atcctctgga gttgttgttg aacgagccgt attggaagct     16680
     ggaagtggtc ttccgccagt cgcgagaacc aagtctgata tatctgcgca aagctgattt     16740
     tgacatgagt gattacaagg ggcgcctgca aagcgtgggg ccagagttgg aggagtctcc     16800
     gtgaaaaaaa ggatcatggc cagcggcctt ctgttgggaa gtgtcgcttt cgcccaagtg     16860
     caaaaagtgg acgtgaaaaa agagctgccg aaagctgcgg tggtggatct ttataaaatt     16920
     tcagatgcga aaaaaacgac caaactttca ccgctgtcgc agttgaaaga ctatgaaatt     16980
     catctgaaat gggccgagtg tgcacgactg gcgccacaag tgttcaccgc taacaaagac     17040
     cttcgtggct ggattggtgt gagctggctg cactgtctgg atgaagccca gaagaaagcc     17100
     aaagaccgtg cagcggtgga tcgtgcgctg accacgatgg aagcccacaa agatcttttc     17160
     cgcaacggtc cgtggtcggt aagtcttgaa aagtactatc tggatttcaa gatggtgcag     17220
     ttggaagatc aagtgacccg taaaaacaaa aaggccgccg ccagcattga tgctttgtta     17280
     tccagtgctg catccctgag tcgtgaacag aaatccaagg cttatcagct gctgggcgat     17340
     ctggcgatgc ttgataacaa ctacaacgaa gcgcagttct tttttgagca ggcccaggac     17400
     cagaaagact ccaaatacct tcaggaaaag ctggatttca tcgccaagac caaaacaaca     17460
     gtgacgccac cggcaaaagc ggccaccacg tcatctgagg tggcaggaga tgaagccaag     17520
     attgaagaac gcatccgtct ggcgcaaaag cagaacgatc ctgtcgccgc actcaaagac     17580
     agtgtgcaga ttctgaatga atacccgggc agccgcgctg cgcgccgtct gaaagacagg     17640
     ccgctggaaa tttacaattc cctgagtgaa aagctggcca aagtcaaagc tctgaatgaa     17700
     atggaagaag ctgacaccgc gcgattgatg gagtgggcac acagcatgca tcgccgtgcg     17760
     gattactccg gctcgttgtc tttggccacc aaggctttgg acaaaaaccc gcatgcccca     17820
     tccacgacgt cggctttgtg gatcgccagc cgctcggcgc atttcatggg tcagtacgac     17880
     aaagcgctgg agctttataa aaagctgtac acttatcatc tgggttcgga tgaagcggca     17940
     gaagctttgt tccgggccag tctgatttat ttccgcaagc aggactacac aagttcttcg     18000
     gccttgctgg agcgcctgtt gcagcagggg cgtgatcgct atgatctgaa cggacagtac     18060
     tggcttgtgc gctctttaca ggaaagcaaa tccgagcgtg cggcgcaggc tgcagctgat     18120
     ttgatcgaac gttatccgtt ttcttactat ggccttcgtc tgcgggccga gtcacaaaaa     18180
     ggcaaattgt cctggcccga gaataaagac aaggctcctg ctttgggatc tgagttcttt     18240
     gtcgtggggg cgcaaaaagg tgcatggcgc agattcaaag tcctgtccga agcgggttgg     18300
     gtcagtgaag ctcaggaaga gctttcctct gtgccgttcc tgaaggatgc gactttgaaa     18360
     gttcaattgg cggaaaaact agtggaacga catcagtatg ttactgccat tcgttggatc     18420
     aatgaagcca tggaggcgga tccgcgtctg cgccgcgagc agtttgtgaa gatcggatac     18480
     ccggaagcct ttgccagtct gtatcaggct gaggcggaac gttatggcat cgacgcggtt     18540
     ttgtttaaaa gcctgactcg tcaggaaagt gccttcaatc tgaaggcagt ttcaacctcg     18600
     aatgctctgg gtctgatgca gatgattcca ccaacggccc aggaagtgtc caagaaactg     18660
     ggcatgaagg tggagcttcc ggatgacatg ttccgtcctg aagtgaacat tccgatgggc     18720
     tcttactatg tctcccagat gttagaccag ttccagggaa gcgttccttt cgctctggcg     18780
     gcttataacg caggacccta tcgcgtgaag ctgtggatcg acgcaagagc tgaggtcagc     18840
     gaattacttg ccaagcccag ctccgcccct gtggatgagc tgtggtttga tgagctgcca     18900
     tggacggaaa caagcttcta tgtgaaggcc attcttcgca acgtcctgct gtatcggctg     18960
     tcagagaagg gcaattacga ggtaaatccc gtcttatggc aggatttgct taacaaaaag     19020
     gcaaaataag ggcgatgttt tattgaaaaa tccctctgag ttttgtagcc tgaaaactca     19080
     gtcggaggac tcatgaggag acttttaaca ttgagtttgg tcctggcctt tgtgtcaggg     19140
     tgtgctcata aggatttggg cacaaaagct ggcagaccag ctaccaacag tgaaggggat     19200
     ttgaaggaca tcggttcgtt ccgtttgtct gaccccgaag gccccaaggt ggtggatcag     19260
     gaattggaat ccatccctac tgaagttaac cccctagttg aaaaatggat tgcctacttc     19320
     cagggtcgcg gtcgcccgca catggaacgt tacctggccc gttccactcg ttacgaaaaa     19380
     ctgatgaaga aggttttgcg tgacaatgga cttcctgaag atctgtttta catcgctttg     19440
     atcgaatccg gattcagctc gcgcgcgacc tctcacgctt cagcggtggg gtactggcag     19500
     ttcatccgtg gtacgggcaa acgttatggt ctggacatca atgccttcgt ggatgagcgt     19560
     cgtgacccgg tctttgcaac tcaggctgcg gccgagtact tcaaaggtct ttatagcgtg     19620
     tttggttcct ggtatctggc gatggcttcc tacaacgtgg gtgaaaatcg cgtgaagcgt     19680
     gaagtgatga atcactacac ccgtgacttc tgggagctgg ctcgtaaaaa acgtctgcca     19740
     gctgaaacca tcaactacgt gccaaaattc atcgcggcta aaatgatcgg taaggatccg     19800
     gcgaagtacg ggtttgacga catcgattat cttccgccga ttgagttcga tcacatcacc     19860
     gtttcccagc cagtgaactt gcgtcagatg gccgagaaaa tgaacctgaa ctatgaggac     19920
     ttcaaagctt tgaatcccaa gttcaagggt gaagtggcga tcctgaaggg cagtgacctg     19980
     attctgcgta ttcctccggg cacgacagag caatccaaag tggctgcggc agaaagtttt     20040
     gtttcccgtg ttcagtttgt ggctgacact ggtgacacgc agacctaccg catacgtcat     20100
     ggtgacactt tgagcacggt ggctcgtcgt tatcgcacga cggtggcatt cctgcgtgac     20160
     ctgaatgatc tgcctcgtcg caagcccttg aaagtgggca tgcgcatcca ggttccggat     20220
     cgtacgccgc tgaaggaccg ttcacaaact cgttctatgg tggcaaagaa atccgatgct     20280
     cctaagaaca cagtgacaat cagcagtgat ggtcgttact acatcgttca gtccggggac     20340
     tctttgttca cgattgcgcg caaatatgcc accagcgttt ctgagcttca gcgtatgaac     20400
     aacatcaaac gtggtcgcac attgaaagtg ggcatgaaac tgaaagtccc aactccaggc     20460
     agctcgtctg cacgtgaagt ggctactgaa gttgctcaaa gcaaaaaagc gaaatccaaa     20520
     gttcacgtgg ttcgcagagg tgaaaacctt tctgtgatcg cggcgaaata caatgtggca     20580
     gtttctgata tcaaagaaag aaacaagatc cgcaacccgg cttctctggt tgtgggggca     20640
     cgcatcgtga tcccatcgga agtgaagcaa taagactttt ctcgcaattg tcttaactcg     20700
     accccaaaat cacgacggga agtaaagccg gtctcagatt ttggggtctt tttttatctt     20760
     ctctcaggtt ctattgtgac atcctgtcgc cttccttgaa ccttgtctta gtgtaatgaa     20820
     gtttcctggt ttgtgggccg aagaacgctg cacttatatt aagggagcgt tcatgaaaca     20880
     actgagtcta agtcagaaaa tgagtcttat cgttgccatc ctctgtgcgg gtatcgtggg     20940
     tgtggccggc gtcggactgt acaatttaaa gcgtgtcgga gacgtggttt ccaatgtcac     21000
     cgatgtccag tttaagagcg ttgttgaagc cctgaacctg aaggatgcct ttcacgggca     21060
     gatgatctat gaaagaaact atgtgctttt ctatgataat ctggaaaaac gtgccaacaa     21120
     ctcggcccag attaaaaaac tcgacagcgg gattcgcacc attgttgccg atcgtatgca     21180
     ggtcgccgat gcgacggaaa aaagcagtct ggaaaagttt ctgaccacgt acaatcgttg     21240
     gtcggacaac gatctggaaa ttcaaaaaat catggccgat gctgatggcc accaaaaagc     21300
     attgggtctg atttcttccg tgggccgtga tacacgtctg gaaggcgaca aggccctgga     21360
     tgaaatcctg actcatcatc aggcccagtt ggaagagcaa aagaaaaaat cggcagatgc     21420
     catctccagt accttccaga ttctgatctg gaccggcagt gcggtgattt tactgggcgt     21480
     gctgttggcg gcaatgaccc tgcgaaagat gtcagcggcg atcagcagcg ttcttagaaa     21540
     cctgggtgaa aatgcctttc aggtgaatca cacggcaaca cagattgcga ccgcatccca     21600
     ggggctttca caaagtgcca ccgagcaggc ttcttctctg gaggagacgg tggcaaccat     21660
     cgaagagctg accgccatgg tgcgtatcaa tgctgaaaat gcggcctcgg ccacggatct     21720
     ggcagaaggc acccgacgaa gtgctgaaga cggtgaacgg aaaattcaag gcctgcttga     21780
     ggcgatgaaa gtcattgatc aggattccaa aaaaatccag gaaatcacca gcgtcgttga     21840
     tgatctggcc ttccagacaa atttgctggc gctcaatgcc gccgtggaag ccgcccgtgc     21900
     cggcgagcag ggaaaaggat ttgcagtggt cgccgaagcc gtgcgcacgc tggcgctgaa     21960
     aagcagtgac gcagccaagg acatctccaa tctgatcaac tccagtgtgg agcgcattca     22020
     ggccggattt gagcgggcca atgaaagtgt cgattctttg actgaaattg tgggctcggt     22080
     gaaaaaggtt tctagcttaa actctgaaat cgccagcgcc accagcgagc agtccaatgg     22140
     catcacgcaa atcggcaagg cgatgaatca gctcgacacg gtcactcagg aaaatgcggc     22200
     ggcttccgaa caagcggcgg cgtcttcgca ggagctggcg gggcaggcga cagttctgaa     22260
     caaagtcgtg gaagaacttc gtgtggctat caagggcagt gcttcggctt agaaaccctg     22320
     ctgtaccaga gatttaacaa agacccgggc gggtttggcc aattggtgct cgcccaggtg     22380
     aatcagatat atcttatagc ggatcttgcc agcccagatg ttttgttctt cagcggcttt     22440
     gaggccgctt tgattttcag cgataaagtc cgggacaaag ccgacgccca tacccagcag     22500
     actcatctga ctgatgacct cccagttttc gaccgtcaga gcggcgcggg cgtcggtccc     22560
     cgtatggcga cgccaggcct tttgcagctc agaccaaccg ggactttcct gtgttgccag     22620
     gaaccggggg gccgccggcc attgtgctcc ggtgcgaatc acacatgtga agccaccctc     22680
     gcccagcagt cggttttcaa atccgggcag gcggttttct tcgataatga tcccaaagtc     22740
     ggctttgccg ccgcgaacca gctcggcaat ttccggtact gtgccgaagt gaatttcggg     22800
     ctgaacttcc acatgggctt tcatgaagtc cttcaggcgg ggaggcagta gatagtgggc     22860
     tacggcgctg gaggtcgcaa tactcaaaga gcctgtaaca atttcagagc ggcccttcag     22920
     ttcagctttt agatcttcca gctggctcag aatcccgcgg gatctttcca gcagcaggcg     22980
     gccttcttcg gtcagtttga agcggttttt ggtgtgcagc agaagctcgc agcccagagt     23040
     gtcctccagc ttgcgtatag cctggctgat ggccggctga ctgacattca gggccttggc     23100
     ggcagcggcc aggctttgca gttcggcggc ttttgaaaaa tacttcaaat gataaatatt     23160
     cggctctgac ataataagaa tatcttatta ttaaattcat aattattcaa tttcgattgt     23220
     aaagcttgtg cgttataagg gccgacaaag aggtttacta tgacaaaagc tatcgtgtcc     23280
     ctgtttgtga tcctgtcttc ttctgcgtcc ttcgcggctc cagtctgcgt gcttgaaacc     23340
     aagaacaccc tgcgctctga agagctggtt ttggaagtga aagaaaacac ggatctggcg     23400
     gcttatgttc tgcgcactca agaaagtggt tttaatgtgt ccgtggtttt ggtggacggc     23460
     cgctatatcg gaaacgtttc caaaggtgac agctcggcca gcacggttgt tgagggtgat     23520
     ctggatcttt ctttgaaaaa tagcagtgac cgtctgacgg tgtcttgccc ggcttactag     23580
     ttgttttgaa ttgtcatcag caagacggcc tgtttgatct ttttgattga ggcattcttg     23640
     tctggtgttg cagtggcgtc gcggatttcc cagcggcgtc cctgataaag gtaatacaga     23700
     tagtcctgca ggttttcttc aataatgtcc gggtgctgcc aggccacgtt gcgcaggtct     23760
     tttagcagat ccgcactgaa agccagggtc gcgatggctg cggacttcgg gtccttcaag     23820
     tcgctttttt ccattttgta tttttcaatt atcacctgcg ggatgcgttt gatctgagtt     23880
     ggtccgcggc tgttttcatc ggtatccaga ccgttgcctt taagcagggc aatggccacc     23940
     ggagccagct ctttcagtcg gtatttccag tttttaccaa agttggtttc aggggacatc     24000
     acaccgaagg cgaattctgc cagcatgttg tattcatcgt cctcgatatt caaaagaccc     24060
     atcaaagtcg ttttttcgtc ctgcagggcc tgcgcataaa tttttgcaaa gttgtcgtcg     24120
     atgtcgacct tgatctttac ggttttaaat tcacggttca tcgggctgta gttataggcc     24180
     agacggttgc ggaaaacctt ggccgctcca aacgtcaggc ggtgattgcg gatgcggaag     24240
     cggtggtcgg ccgtttccgg caggacgtac acgatcatat cgcgggaaag ggaggcattg     24300
     gttttaaagg ccgcccggat ctgcaggtcg cgttcagctt gcaggaagac gaatccatcc     24360
     tgttgcgagg tgaagtgata gatgccagcc ccaccggagt tcagttcatc gcccggatag     24420
     gtttcaatag cgttgcggga caattcctga ccgtcgacgc ggaagaactg aatcagcttt     24480
     gcctttttat ttacgacggc aaacggggca tctccgtaat gggtgtggaa gaaacggatg     24540
     acttccagat tgtccctgcg gttgatgtca tgtcttttgt tgatgtaggt gcggaagtct     24600
     tcgttagtgt aagttttcaa agtgacgggg cggggttcgc ccagacgcag tttctgatca     24660
     ggcaggcgca aagcgggaat gtccgccagg acatcctgat tcaggaacac tttggttcca     24720
     acggcccgag tggcctgttt gtttctaaga gtcagccaga aatcctcccg cagtttcttt     24780
     tgcagggttt cttgagtgat gttggcacag tctttaccca aagcgcgaag gctgacggtg     24840
     tattcggcta cggtcaggtg acggcgttta tccaaagctc ccgacaattg cgccagttga     24900
     cgggttagag actggccctc ttgtgcaggc cagttctggc ttatccacag ggcttcgatc     24960
     tcggctgtgt tcaggtgaat ttcacccata tggcgggcta atgcggctac cagggccacg     25020
     taggcattag gcagtcgcaa agaagacttc cagtagtcag cttttttgat gatttgaagg     25080
     aaggcttcgt aagtctctgc ctgggcaaag cgagtgtatt cggctttgaa gctttcagtt     25140
     tgttccttgg tcaggcgcaa agacagggtg tgagcatagg actcaaccgt attcaagttc     25200
     tcaaggctaa ggcgctgagc cagcttcagg aaggctcttt gatagagcgt gccagtcagt     25260
     tggggatgaa gaatttcttc atcttgaatg tctcgaattg agacaatcgg ttttgcgcag     25320
     acgtcggcca cggccaaacc tgaggccgga gatatcatga gcaagccaaa taaaaagaca     25380
     aaacagcgac gcatgacttt ttacgaagca aaacagtggc cacgtcggga tccattcaaa     25440
     tgcggatgga cgaaaggggg ctgtcgaaat ggttaacaga ggacttgggg cggcactgaa     25500
     atcgcgagac ttgaatgtat ttttgacttt gtccgccatc gtagcgaggg cggatggcgt     25560
     catttgcggc agactttggc tttcggattc acttcgcaga tggcgtcttt caaggcctgg     25620
     ttctgctgtt ccaaagactg aaccttgtga accagaacgg cgttgttttc tttgagcgag     25680
     gcaatctcac gatcctgctt tttgttttca gaaatcacga tctgataaag ttctttgatg     25740
     gaattgatca gtggtgccac cagtttttga taggccacgg atttggatcc gtctttgtca     25800
     gtacgaaccg cttcagggaa tactttttcc acttcctgcg cgatcaaacc aatttgtttt     25860
     tctttgtttt ccggattttt ccagtagtag ctgtaaccgt ttagaccgag caccttattc     25920
     aaactgtctg gcaggatttg gatgtcggtt ttcagacggg catcagacgc ttccgtcaaa     25980
     ttgccggcga tccacatgtt cccattggta tcaagataga atttctggga acacactccg     26040
     cctggacagt aatagaactg cgcgatgttt gcggcattat tggtctggtg aatcgtgaag     26100
     ccacgttttg tcgcgtggtt attatttaca ttcagtgctg aatctgcgcg ggaaagcagc     26160
     tccagataag aagatccgtc gtggatatag cccgtaccac tgacatgcaa tggatagcct     26220
     ggattgttgg tgccgattcc cacatttccg ttgttcgcaa tacgcatgcg ttcggacacg     26280
     gtgacggcgc ttgccgcagt gacggtttgc acgtcggaac tgtagaagcg aataccgtca     26340
     gtaccaccga cattgatcgc cgcgcgagcc aaaccagctg agctcgacga agagaggaag     26400
     cttccggggg atccagcagg ataaacacca taaccaattg atggggcgcc actggagtat     26460
     tccgtaccga tgttggttat gttgccatta gagtagttgt ctacgagcag taaactgccg     26520
     gaaacggagg aggccgtacc agcacgaatg gcgccgccgg aaagatccag tttctgcgcg     26580
     ggattggtca caccaatacc gatgttacca acgttgttga tgcgcatgcg ttccgtgcgc     26640
     gtgcttcctg tggcaaagat gatagtgctg tttccaacag acatacccat gccgttggca     26700
     gggataccgt tgacagtagc tccggagaag ttcacaccga gccacagacc accgaagctt     26760
     gagttcaaaa gatccaggga agttacagaa gaaccgctga cggcaattcc gtttgtggcg     26820
     tcagagttgt tacccacatg cagcttgtag cttgggctgg tctgtccaat gcccacattc     26880
     ccattggagt gaagacgcat gcgttctgaa cgggaagctg cgccgttgat ggtggtttca     26940
     aagatcatgt aagagccacg agttgaggtc gtgtggtttt gaccggcact gacttcgatg     27000
     gccgagttcg tggtgcccgt gctggtgcca tcatgggcgc ggaaatagaa gccacccaat     27060
     gtatcgccgg aagtcactgc gctgttggaa gccagggtgc cacgcgtgcg ggtcatcatc     27120
     atcgcagagc catcgtactg accatcggaa gaatgccaca ggcgagcctg gaaggcgtca     27180
     gcgctttgaa tgtccagatt gaagcttggg gatgttgttc caatcccgac agcaccacca     27240
     ttggaaatgg tcatgcgagg ggtgccgttg gtttcaaagt tcaagccata gttgtcgttg     27300
     gttcccaagg tcgccgcggc accaaagctg tttccgccgt tggcgaacag agatgtcgct     27360
     gaatagcttg tacaacccat cacccctgaa gcattaaagg tgatggtctg acccacggca     27420
     caggtgaagg ggatcacagc tgtgccggtg ccgttagaaa ccaacagtcg gtcggctgtg     27480
     atggaagtgg caccggtacc acctttagtg acaggaaccg cagaagggaa gttcgccgga     27540
     tccgcactga ttgtgcctga agaaaccgcg ataccagaac ccacttgaac aaccccacga     27600
     gcgccggttg ttgccggatc cacagagatg acaggtgtcg ttgtgcccgt tgcaacttga     27660
     accggagccg tgcccgtgac actggtcaca gtacccacag tcggagtagc ccatctcaaa     27720
     cccgaagctt gagccgagtc cgccgtcagc acctgaccgt tcgtacctgc aggcaggcga     27780
     acgtcgttgg tgccgtcatt ggcaagaaca tcccctttgg ttgttagcgg ggaaagacca     27840
     ttgaaggccg caatcgctgt tgttgctccg gtaccaccat ttgcaattgg caaagttcca     27900
     gtcacatcag aagccagatt gatcgccgca ccactggatg ccgccgtcag acgaccttga     27960
     gcatccacag tgatggaagc gcgagtgtaa gaacccgctg ttacagcggt attagctaaa     28020
     gcaatagtgc ctgtcgaagt tatcggacca ccagtcaaac cagtgccggt tgcgatgttc     28080
     gtcactgtac cgccggaaga cgtgtcggta tccgtatcgt tcgcacattc ccaacgactg     28140
     ttagcagcaa cccatttcaa cacctgcccg tcagtacaag cggtgttgtt cggacgataa     28200
     gtcagatatt tgccagcgcc gctggtgatg tcggcggcat ctagtaccac agcaccagtt     28260
     ctgccagcca cggtcgtgac tgggaaggca atcgctgcat ttgaagccgc cgtcagacgg     28320
     ccctgagcat cgacagtgaa agtgcccact gaagtcgtgg agccatatcc gccgggcgtt     28380
     accgccgtat tagccaaaga aatcgtacca gttgccgtga tcgggcctcc ggaaagtccc     28440
     gtgcctgtcg cgatgttggt gacggtacca ccggaggaag tgtcagtatc agtaccgcac     28500
     tcccaacgat tgtttgccgc aacccatttc aacacctgcc cgtcagtaca agcggtgttg     28560
     ttcggacgat aagtcagata tttgccagcg ccgctggtga tgtcggcggc atctagtacc     28620
     acagcaccag ttctgccagc cacggtcgtg actgggaagg caatcgccgc gttcgaagcc     28680
     gcggtcagac gcccttgagc atccacagtg aaggtgccca cggaagtagt ggagccataa     28740
     gctgccggag tcaccgctgt gtttgccaaa gaaatagttc cggtggaagt gatcggacca     28800
     ccagacaaac cggtgcccgt cgcaatattc gtaacagtcc ctccagagtt ggcgtcattg     28860
     tccgctgccg gagcccactt ggtgccgtcg tacttcaaaa tctgaccagc caccagaccc     28920
     gttgtatcca ccgtcacacc tttgatttta ttgacagaag aggcgccgat cgtgccacca     28980
     acgtctccgg ccagggacac attgatcgcc tggcaagaaa agccggccac ggcattccag     29040
     tacatggttt cgtgagccgc acagcccgcg ttgaccacgg cggcgctgaa ctccgcatcc     29100
     gtcatataag aatttaaagt ggccgaaagg ccggtcacat cactttgtgc gatggccgat     29160
     ggagtccacg ctgtcccatt gtatttcagg aagttgccat tggccggagc cgcattggaa     29220
     accgctgtgc cctggatttt tgctacggat ggattcggat aagtgccgtc cagatcaccc     29280
     gccgcggctc ctgatggaac acgcgcatca gagaagcggg cgtcgttacc ggcagccacc     29340
     gtgcctgcgg ttgtgcccac gttcagagtc agcgccggag tcgaagtgcc gttggcaatc     29400
     gtaatataag cattggaaga agtgacatca gtcacagtgc cgccgttagc gccactgatc     29460
     cctgcacacg tcaaagctgt tccattccac gtcaggaagg tgccgcccgc gcacgttggc     29520
     agaccggctt ttagcaggaa gtcgtcgacg attttatcgc ccagggactc tgcagacaga     29580
     gcgtaggcgg aaaaaggaac cgagcgaatt tcattggacg gggagatgac cttccagcca     29640
     ttgccgtcgt ggaattgcac tttcaaaaga cgggtgtcgc cggatgcggc tgtgtaggtc     29700
     gaacctcccg aacagttgtg tgccaatgag ttcttaaatg catccagcat tttaaaagtc     29760
     ggggaagctg ggaacagttt tgtgcctgaa ccgatcggca catcaaacac tcccttggag     29820
     ttcagcatgt tcacatcgtc tacttgttcg cggtagatga cacaagttcc ggtcgggttt     29880
     gtgatttcaa acaggaagct gacatgagca tattcgagag cggccccatc ggacttgata     29940
     atccgtccct gataggtcaa agaattgggg gcgccatggc tgacagcagc cataaaaagg     30000
     agtgctaaga atgacacaag cgacgttccg tttctcatgt ctttcttatc ggttttttga     30060
     ccgaaaaaac gagtttttca cgatgaagaa tccttaatat gtgagtctct ttcttaggtg     30120
     attccgcgag tgttctttaa tgagacaagt cagcctcaga ttgcagggcg ttagccgagg     30180
     ccggggactg cctgtcaaaa tgtaaaaaag gccaatggat gtttgaccat tccgaccatg     30240
     ttcgataggt cctttctatg accacaatta cgaagaatct aaccaacact ccgaaagccc     30300
     ttccaccctc tgatcagctt ggattcgggc agcatttttc tgaccacatg tttgtggcta     30360
     aatacactga aggcaagggc tggtctgaag ccagcgtcgt cccttatggg ccgctttctt     30420
     tggatcccgg ggcttcggtg tttcattatg gtcaggcttt gtttgaaggc atgaaggcct     30480
     tccgcaaaga aagcggcgaa gtggtcttct tccgtcctga gttcaattat caccgtttgg     30540
     ctgaaggcgc tgctcgtttg tgcctggaag ctccgccaat ggaccttttc atggaaggtc     30600
     tgcaccaggt ggtggcggct gatgagcgct ggattccaaa agggccgaac acgtctttgt     30660
     atatccgtcc gaccttgatt gggtctgagc cgttcctggg ggttcgtcct tcccgtgaaa     30720
     cgttgttctt tattctgttg tctccggtgg gttcttatta ttctgaaggc acaaaaccaa     30780
     tcaagatttg gaccgaggaa aagtacctcc gtgcagctcc agggggcctg ggtgcggtga     30840
     aggccggggc gaactatgcc tcgagtttaa aggcggcctt ggaagccaag aagaagggct     30900
     atgcccaagt tctgtggctg gatgtcgagc accagggtat tgaggaggtc ggcacaatga     30960
     acgtgttctt cgtcttcgat aatgaaatcg tcacgccggc attgaatggc agcattcttt     31020
     ctggtggcac ccgcgatgcg attctgcagt tgttgcgctc taaaaatctg ccagtggtgg     31080
     aaagacgtat cacgatcacg gaagtggtgg atcgtctggc aaaaggtgaa ttgaaagaag     31140
     ctttcggcac gggtacggcg gcggtgattt ccccagtggg tgttttgcac tatcagggga     31200
     aagactggac aatcaacaac aacgaaaacg gacctctgag cacacagttg tacaacgaga     31260
     taacggcgat ccagcgtggc gctcaagccg ataccttgaa ctggcttgtt cctttgaaga     31320
     agtaattttt cagggatttt gtcttaagaa attcgttcgc caaaaaaagt gctagcgagg     31380
     aatcgtcagt gataactcgc tagctaaggg gaatgaaacc aatccttgta tgtatttgtt     31440
     ccttccatat gcacacctct gattcctcag gtgactcatg acctttggca gctggctggc     31500
     gtggctttgc accgacaccc ctttagcttt gcgtcccgcc gtttccgacg gtttgccttg     31560
     aggcaaagga aggatctata tcctaacgag tataacccta ggaacctcct tatgagttat     31620
     tcatcagatc caaccagtcc attcttcttt agagaggcat gaacccaacc tctttgtagt     31680
     aatcctggtg acgcatcttc acttcagttc gtcatcgtga tgttcatgtg ttctcatccg     31740
     tgtcctcctt cgcttggccc tactagcgtt cacttacccg aggtaagtct cccgagcctt     31800
     gtggtttcaa caaaatcagg atagctcgac caaagtttta ttttcaaggg gaccacgtgc     31860
     gattctcaaa ttacgtcaga tttgcgtatc agcgtgggaa aacagacgga tatttgttca     31920
     gacttgaaac agaaaaagcc cctcgatgag gggctttttg aaattgaaaa ttagaaattg     31980
     gatgaaaaaa gaaacctgtt acaggtttct ttttaaaccg gcagcagttc gcggatttca     32040
     tccgcaattt tcatgaaggc ttgcgcttcg gcgccgttgc tgttggcttc tacgattgga     32100
     atgccggctt cgcacgccag accgacagac gggttgaagg ggatctcacc cagtttgttg     32160
     atgcctttgg attgggcgta ggagtcgatt tcgcccttcg ggaacaactg cattttttcg     32220
     ccgttggccg ggttgatcat gtaggccatg ttttcaacca tgcccaacaa aggcacgttc     32280
     acacgggcaa acatgtcgac ggcttttttc acgtccacca acgccacgtt ttgcggagtg     32340
     gaaaccatca ccgcaccaga cactggaact ttctgcgcca gggtcagctg gatgtcacct     32400
     gtgcccggag gcaggtccac aaccagataa tccaactcgc cccagtttac gtcgcgcagg     32460
     aattgatcca tcgctttgaa cagcataggt ccacgccaaa ccacggccgc accttcctcg     32520
     accaggaagc cgatgctcat cagtttgatg ccgtaacgga ccaccggttc cagttggttg     32580
     gtgtccgggt tgatctgagg tttttgcgcc agggaaccca acatacgagg aatgctggga     32640
     ccatagatat ccgcatccag aaggccgact ttgccgcctt ttctgcccaa agccatggca     32700
     agattcgttg ccacagtact tttacccacg ccacctttgc ccgaactgac ggcaataatg     32760
     tgtttcactc cgggaatcgc ggtctgcttt tcaaaaggat ttggggctgc catgaatggg     32820
     actccttgct aattttgtcc acccaaccaa taatagaact tggatgaata gccaagactt     32880
     tttgacattg aacctagtgg gagcgggggc tttcattgcc tggtatcttc tttctcgagg     32940
     aggcagccgt cggccgacgc agctgaacct gaatgcgaag gacagcgctc cccctttgat     33000
     ggaggcggct ccccctgaaa aggcgggtct tgagcctttg cgtcgtcagg cctcaacccc     33060
     tcaggtgcat cctgatctat ctggagtaaa aaccaagtgt ctgaatgtga tgtttaatta     33120
     caacggccac agctgggacg cctatgaggt tttgggcgtg ccggccggag cgtcgctgaa     33180
     gctggttact gaagcctatc agactgcaat tcgccgcagc gacaaagaat ccctggagtt     33240
     tctggaaacg gcttacaaag ccatcctgaa taaaacagcc taggcttact gtcgtcggta     33300
     cggcatatag cgtggagttg agacaaaatt cccatcccat ctgtttttcg agcaccacag     33360
     atgccccgac gcattcatcg cgcagtacgt attgccctcg ccgtgacctt tgatgctggt     33420
     gaagttttgg cttgaagcga tcgccagcgg cgcttggtcg aagcgagccg aaggccaata     33480
     gtgcaatttt ccgccggtgg tgagtcccag agccgagttg ctgcccacct gaatatccag     33540
     ataggtttca ctgccattga ccactgtcgg ggaggtgacc gtcatgttac cggtgtaatc     33600
     accccagtag ccccagcact tcaaaacctg tccgctggtg atggcgcaaa ctgcgttagt     33660
     ccccacactc agcttcgtga agttttctgt tgagtcgacg gtgtaaggga cgctggtatt     33720
     ggtggtcgtg ccatttccga ccttaccctg gttgttggct ccccagcatt tcagcttatc     33780
     cgcagaagtc agtccgcaga tatgcgcata agagacagcg atcgatttat aaagagtccc     33840
     accatccaga acagttggcg tggtgcgcga gaccccgccc agatgacctt tgccgtcgtc     33900
     atagccgtag cacttgatct gatcacctgt cgtgatggcg caggccagac tgctggcaac     33960
     aaccaaagag tcagttctgt aggaggtgcc cgcatccacc attgtcggag ttcgacttgg     34020
     gcagtttgac tctgcacccc aggcatacag ctttccggcg gtggaaagac cgtaaccgca     34080
     atagaaagtt tctcgggccg tcatggcaaa gctcacagaa ggagcgacca tcgacatgta     34140
     ttgaacggaa gagtccatgg attcgttccc caccgcaccg aagccattgg caccagcaca     34200
     catcatgcgc ccgctgccat tgatgacaca gctgccgttg ttggaagggg aggcctttcc     34260
     gccagtaaag tcggagccat tatccacaac ggctggtgtg gaaactgtgt acccggagcc     34320
     cgcatagctt cccacacaca cggcctggcc attgcttttg atggcacagg ctccggcaga     34380
     gcccacacca tagtgggcaa tcgtggtatt gggatccaga gttgccatat caaagagcgg     34440
     cagaggctcg aaccagttgt tgtagttgtc tcccatgcag acaatttgtc cgtcagtgga     34500
     aattccgcat gcgccgtacg atgcggcggc tatttgcgag tactttatac catcgttgac     34560
     gagcgtcggc gtgttcagaa tggtggtttg ttccgagctg acggtgccac gcacttcccc     34620
     ccagcatttc aaatcattgg cggcagtgat cgcacagcga tagccgcttt catccgagac     34680
     agaaagatag tccgtggcgg catcgatggt ggtgcgtgtg acgacgggat tggtacccgt     34740
     catggcgccg acgactgagt tgccattcca gccccagcac ttcagcttct ggccagtcgt     34800
     cacaccgcaa agggtagcgc cgccggcaac tgaaagatag cttgtgccgg cgtccacaac     34860
     tgtcggtgag agcacgttgg ttgtgctgcc gggaatgatt tgctgttgat tgtttccgcc     34920
     ccagcatttc agctcctggg tgtccgtgat accacaggtg gtggaggatt ttctgtgaat     34980
     gcttgtatag ttgacggtcc catcgatcag gaccggggaa taccggtctg tggttgtgcc     35040
     atctccgaca ttgccggagt tgttgcggcc ccagcatttc actttaccca gctcggtcaa     35100
     tgcacaggct ccctgggcgc ctgtggaaat tttgacataa ttttcaccac tgtcgacgtc     35160
     caccgggctg gtctgttcgg tggtgttgcc attaccaagc tggccataat agttgtagcc     35220
     ccagcatttg attttttttg ccgtggtgac agcgcaggca tattggtctg tgattgaaac     35280
     atccaggacg gtgaagccag caagaggttc gactttggtg ccgacgcggt ttttgtggcc     35340
     gacgcccagc tgaccgttgt agttgtcgcc ccagcagaac atgcggccgt cagaataaat     35400
     ggcgcattgg ttgtagcgtg cagagacaat ctttgtggcc gtcgtaaaga cagcatcgtc     35460
     gtccttgatt agatgataga ccaggctgga ggttccgatg cggaccgccg cttggtcggt     35520
     gtgactgata aagactctga gattgcgatc attttcggtc agaccattgt cgaaagtgtc     35580
     ataagaaatg gatgctgaca gcgagcctgc cgggatggtg acaaagccgg gggcaaggtt     35640
     gtggtcgacc atatagatct gatcaccgaa atagttatag taaactttca cgtcataagt     35700
     tttggttccg gatagtgtga aggtcacggc gttgttggtg gttccttcgt tgatggaaat     35760
     atttttggaa gtgatcgaag ccacaacctc ggaatccttc gtccagctga cactggtggc     35820
     agcggcaaaa tcctgccaca gtccgttgac actgctttta ccgatagcgc agacggtgat     35880
     gtcgccattg ctagctccgg aaagatccag ggttcggctg gcgggcgcag ccgcttccgc     35940
     agtgtagccg ctcaaggacg agcaatcgac agagtttccg actttgtagc ggaaggcact     36000
     gactgtggcg ccgccgaaat tcacactgac cgagttcagg acactgacgc ccgacggggc     36060
     tccggtgatc tgaatcgtgg gtggtgtcgt ggacagcgtg tagctggcgg ttttggtttc     36120
     ttgaacgatc gcattttgca tcaactgggc ggtgaaggtg atggcagctc cgtcggcgcc     36180
     aggcacgctg atggctgaag accatgttcc accgctgcac gtggttgagg ttgtcaccgg     36240
     gctggtgatg ttgatggtgg ctccgttcac gttgcaagaa ccgctgaatt gtgtgctggg     36300
     cccgatgatg gcaccgttgg ccggagattg aatcgacagg gtgcgggtga ttgtgaaggt     36360
     cttgctgtcg ctggccagag tgatgtcatt gtctttcagt gtggcagtga cattcactgt     36420
     agagctgttg gcaagattgg aagtgtctag agtgtagtac cactcctgat ccacggtgca     36480
     ggtggttgtc gcactcagcg ttccgctgag ttgaacctgc ttgttcggga cagaacaata     36540
     gccccccagc tccagcgagt tgccaatctg gtcagaggtg gcaggatagt cgatgaagat     36600
     ttcaggaact tccagcgtga ctgtcgcaac agagcagaaa gtttcgctgt taaaggcatc     36660
     gcggaatttc acataaagtt ctttgggccc agaggtggcg tcagagaatg tccagtttgt     36720
     cgtggcggaa aaggacgccc acgctccccc ggcagaacag ctggggtctt cggtcagata     36780
     tgtctgactc ataggtgatg gggcactgag tgctacactg acggtggcac tgactgcgat     36840
     gggatcgccg ccattcaggg tcattatggg ggctggggcc gggtctgccc cggtggcttc     36900
     ccagcgaata tcaaagccat tgtccgtcac gctgccatcg gattcaaact caacacgaac     36960
     tgtgctggag gtcgtgttca ctagcatagg tgtaaccacg ccggattcgc tgaagacctc     37020
     ggtgccgttg tcatagattc ttacaaagtc atagccgttt tctgtatcaa gcagatcgat     37080
     gtaaaacttg gcgggaccgg tcagtgtcag atccagggtg cagagttcgt cattctggta     37140
     tactcctgcc aagccgccgg agtcgacaat acggccgcgg gaaagactgg aagtggtgtt     37200
     ggtgcacatg gtgtgggtgg tgtatgtcgg ccattgaata gagtcgtggt aacacgggga     37260
     ttcatccagt gtggccgttc ggaatttgac gctgacgtag gctgtgccac cttgggcgcc     37320
     cgcatccaga ttccagttgt caataaaggt cgctgtactg acccatgaag gggtaccagt     37380
     gcaagtttga ttgttgaaca gggccatctc tggtaatgag gccggtgcca ggatgttcag     37440
     atcctccacg ccatttaaag ttgtggattt gatcagtgtg ccaatgaaaa tctggggagt     37500
     gccgacataa atctgaactt gctggggagc agataggttt tgggccttgt cagcggcttg     37560
     aacgtaaaga tagcgaatgc ccggggtggc tagtgttgta ttgtttgttg ctgtaaaatt     37620
     ctctgtgata aaaacgaatg ccggggacgt actgtccaga tagcggaact gacacagatc     37680
     tgcaggatcc agacagctcc acgccgccga ctggggttca gccggaatga tgatattgtt     37740
     gagattgctc aattggggca aaaccgtgtc ctttagaatc gtggctgatt cggtgcgggt     37800
     ttcgccggtg gtcaaggttt cttgaacttc taaaatcagg gcgctagagt ccggcaccgc     37860
     ggagaaatcg taggtcactg accactggtt gttgtcgcag gttgtggatg ccacaactgt     37920
     ggaatcaagt ttgatttgaa gcgaggtttc gttattgccg caggtcccgg aaatgagttt     37980
     ggccgagaca ttgccggcgt tgacgatgat atagggatct atatcagaaa tcttgagttc     38040
     agcttgcact ggctctgatg acaatagatc ctgaagtttt gccgagatgt tacagcccgt     38100
     caaaataaga gacagcaata gcaataaggt gccagttgat ccgagacgtc ccgagtagtt     38160
     catgaactat ttatcggatt aaaacctcac gttatttagg aaccctaaaa ttttatcaga     38220
     atgatacgaa gtgaacctgg tcctcggcga cttttttatc attcacccaa accgagtaat     38280
     aaatcgggca ggcttttgaa agcatcgccg ctgtcccgct atattggtgg gtcgagcgct     38340
     ttgccgcttc cacagcctga gtggcatcca ccgacgagcc tttcaaatga tagctcaaat     38400
     caatgcggga aaagacttta gggtgcttgt ccgtcagggg ggctttggct tccagttcaa     38460
     aagaatcgta ctgaacctga aacttcgcca ttagatcaat gacatccgtg ccggtgcagc     38520
     agcataacgc cgccagcagc atttccttcg gagtcggccc ttggggagct tgatcaggag     38580
     ctgtgacgtc gatgtcacct tccatgccac gaacattgaa tttaaagtgg tgaccatcga     38640
     ttcgtttaac ctgagcgcgc atgaatccat cctttgaaag gtgccgaaga tggatctgat     38700
     tttagagcag ggatttgcga tgacaagact attttgaata aagacagcta aacccacgac     38760
     cgttgcggct gtgctcccag aggaatttat caggcccgtc ctgaatgacg gtgtcttcct     38820
     gcatcagact cagtgaattg tctttatcga tgtagatggt ggtttcctgt ttgcgcacat     38880
     agttgtcgcg actgacaact tcgctcaaga ttttttgtcc gggtttttgc tgaaccttga     38940
     agcctttgtt gatctggcaa aagcgcacac tttcgtgggc cacaccatcg gacgatggat     39000
     gcagggcaaa gccgtcgcag tcttcgctgc gctcaatttc aaacgggcag ttgtcggtgc     39060
     cactgtttaa gcggtaaagt ccatcggatg aagccgggcg tgattgctgc gcaaaagcag     39120
     aacccgaaac cagcagtccc aaaatgagaa tcagataaga ccagtgcatc cacactcctt     39180
     cattctttta tgaaggagca agctttgtgc gcagcttaga actaactcaa agggtgtaga     39240
     gagcggcatt ctcactctgg aatgtcgatg tgccgattac tggcacaaca cctgcccgat     39300
     gacgtggcag tcgccgccgt ttttgtcgta ttcgcggcag gaataattca gataggtcga     39360
     accgacggaa gctctcaccg aggcgctgcc agagcttatc gcaacgttat ctatttggca     39420
     gcggccgtcc ttgactttat cagaggctct ttgtaccgac gccacattca ggccgacgcc     39480
     gttgatgtaa gaggcgggca ctcggccgtt ttcaaggttg caggccgctc gaactccaat     39540
     gattctttgc cctgaatcgc agcgcacagt gcctccgcaa cccgagttgt tgccagaagc     39600
     ctgacagtca aacggtttgg ttttgacgct gaccccttgg caggtggcct tggcagtgga     39660
     aagcacaccg tcagtacagg tgtattttgt ttccttgcag accacggccc cgctgattag     39720
     gaattgctgg gttgatagtc cgtgccccag cagttcagac ggaaaggccg ctttcaggta     39780
     acagcccgaa gcacgttttt tatcggcaga aacagtttcg ttcgccagca gatagttggg     39840
     agagtcgctg acgcgcacga ttttttccgg ctggaactta tagaactgat tttgagcaat     39900
     cacgttattg cgggccagat cgttgttgtt ggtgctgctt ccgaaggcat agccgttgtc     39960
     ggcattgcag tagttacggt tgccattgcg ggacgccacc cagatggccg gattcttgcc     40020
     gtcgtatttg ttgtaataaa agatattgtt gatgatgtga tttccgctcg gggtttgatg     40080
     acgaacggtg ccgccttcgc cgcagttgcg gtaaagatag ataccgccgt tatcgagcgc     40140
     agaaagacga ttgccgatga tgcggttgtt ggcagagcca tcaatggcga tcagctcacg     40200
     tttttcagta tccgtatgaa tggagttgtt ctgaatcagg ttgtgcccgg attcagcatc     40260
     cagatagacc gccacactgg tggaagagcc actgatattg gaatttatca gtttcacata     40320
     ggtcacaccc ggagaaatat agagcggaat gcgtgagctt gcctgaattt tcatcttgtc     40380
     caaaacgatg cgggtcgggg cggcagcctg ggcccgctcg gtgtgacctt cggaaatgga     40440
     agaagcgcgc aagtcagccc cttccccgtt ggtgttcatt ccatagatac gcacagcccc     40500
     cagcactgtg cagtttttga tggtcacgtc actggggcgt tcccacagcg tttcaccgtt     40560
     tttctgcacc ttgcgggaaa aaacctgaat catgtcttta ccggcattaa tcccggcttc     40620
     gttcaggatg ctgccattac aatcaaaggt gacacccgag gcttgggggc ctcggaactg     40680
     aagtcttttg gatatggatt ttccttttgg cagctgggcg gagcagtcca ccacagctgc     40740
     actggattcg gccgtggcgg gagccagaat ttcatttatt ttggattcac tgcagacgcg     40800
     tgaattcaaa ttgctgggag tgaagttctg aaaggcaaac aatagaactg agccaccaca     40860
     gattgctgcc agtttgtgca agtacctgaa attgagcatt ctgatccccc tggacaagac     40920
     tcttcggcgg gttgctgcta tgagaacagg ggggtgcctg taatcttgaa aaaaaattaa     40980
     ggagcttttt tggctgtaaa acttatgaac gtgtacccat ctgagaccgg ctggatttgg     41040
     cctgcgaagg ccttgtccag atgaaaatca gaacgcaact gcacacgact gccgcggata     41100
     ttttggcgta gatgggaaca ttaccaaaga acaatgacgc ggaaacaaga ggcaccatca     41160
     gtccggtggc catcagtttg gcgcgagtgc ggatcacacc atgtttttgc cagtctaaaa     41220
     tcaacggccc catgtggggt tgcgctaaaa gccacttgtg ccagcggata gaacttcggg     41280
     cgaaacagta agcggtcaaa agcagaaacg gggttgtcgg aagcagcggc agaaagatgc     41340
     cgacaaatcc caaccccaga aagatccagc ctgctacaaa gtaggcggtt cttcttgtct     41400
     gcttaatcag cttcacagat cgacctcttt ctttttgctt tcaagtggtg acagcatcaa     41460
     atacaaagcc ggaaccacga acaaagtcaa cagtgtcgaa acgattgttc cgccaatgat     41520
     ggacagaccc atcggcaccc gggtttccga accgatgcca tgtccgatca ccagtggcat     41580
     ggctgccgcc acggtcgcca ccgatgtcat cagaatcggg cgcaggcgga tcgggcaggc     41640
     ctgaagcaag gctttggaaa tatccttttc gccgtgatag cgcacttggt tggtgaattc     41700
     gaccagcaag atcgagttct tttttgcaat acccatcaaa acaatcaagc cgatgaaact     41760
     gaacaggttc agtgacacat caaacatcca caaagccacc agggcgccgg tcacactgaa     41820
     gggcagggcg accagaactg acaccggatg gatgaaagag ttaaactgaa ttgccaaaat     41880
     cagatacgcc accagaatcc ccaccagcat ggcggaataa agacttttga atgaatccgc     41940
     aaatccggcc gaggcgcctt ccagggcgaa ggaataccct gtcggcagaa tttctttggc     42000
     aatggcgctg gtgcggtcca gaacctttgc ctgcgactgt cccggtgcca gattgccgaa     42060
     gacggaaatc gcacgctgac ggttcacgcg gctgatgccc tgaatggcgg attgttcttc     42120
     gattttcacc aactgggaca gcgggatcag gtttccgaag ttgttgcgca catacagttt     42180
     tttgaaatcc tccggcttct ggatctgatc ttccaggaat ttaaagcgga tgtcatagcg     42240
     acggccatcg gcggtgtagc ggccttcccg caagcctccg acgccggctg aaagaatgcg     42300
     gcccacgtct tcgacagaga ctccccgggc ggccatggct ttgcggtccg gggtcagaac     42360
     cagctccggg atccctttac ggaaatccga atccagatcc accgccagat tttctttttc     42420
     caggcgctcc atcagctgct gggatttttc aaatagaaca ttcaagtccg gtccacgcaa     42480
     attgatcgct accggattct gacggcctga agaaagattt cgcgccgaaa tatcacgcat     42540
     ggaaacacgc atgtccttca gcttgcgaaa ctcggcacgc catttgttca tgatttcaag     42600
     gtgaccttgc tgccgatccg cacggggttt cagggccacg ggcagaaaga cctgattgac     42660
     gttggaaccc ccaccgccgc caccgacaga aacgacaaag ccttcaacgg atgcatcctg     42720
     cttcaggatg gcttcgattt tttcagcttc gcggctggtt ttttcaagcg aagtgcccgg     42780
     aggcatctgc gcattgatga tgataaagtc ctggtcttgc gccggtacga attcctgacg     42840
     gactttggcc accaggaaca gggacacaac gaagaacacc aaagagccga tcaccaccac     42900
     atatttgaat cgcaaagtgc cgtgcagaat tttttgatag gagtgcgcga acttttcaaa     42960
     cagttcgtcc agccagtgct ccagtttgga aactttgggc tcactggaca acagggcggc     43020
     agcacgcatc ggggtgatcg taaccgcttc aagcagcgac agcgacaccg ccgcactcat     43080
     cgtgacaccg aattggaaga agaacttccc gataatgcca tccataaaga ccaccggcag     43140
     aaacacggcg atgaccgcca atgtcgccgc gatggcggcc ggcagaacct ctttggagcc     43200
     atccgaggcg gctttggccg atggttttcc catgcgatag tggcgcacga tattttcaag     43260
     cagcatgatg gcatcatcca cgacgatgga aatcgacaat gtcagtgcca gcagggtgaa     43320
     caaattcagg gtgaaccctg agaagtacag gatgacaaat gttcccacaa tcgacgtcgg     43380
     gatggaaaac agaatgttga cggcagccga gatgcttccc aggaacagga agcagaccag     43440
     aatggtgatc aatgccgcca cccacagttt ttcaatggtc agattcacgg tcgcatcggt     43500
     cggacgggtg aagtcgacat tcacgcggaa gttgaagcct ttaggaaagt tgtccttgat     43560
     gctggtcagt ttttcacgaa cctcgttggc gacggtgacc tcatttgtgc cccgctgctt     43620
     tcgcacgatg atggaaacgg cctgacggcc atccacccgg gcaacacggc ggatatctga     43680
     aagcccgtcc tcaacccggg cgacatcccg gataaagata ttgcggtcgt ggatgcgctg     43740
     gccgccccgt cgcagaatct ggatgttggc gacatcttct acattggtgg cttcccccaa     43800
     ccagcgcaca cgcagttcgc gttcgccttc ggtgaattgg cctgcggcac tttccagatg     43860
     ctgggagctg atggcatcca caacatcagt cagggtcaga tacaaggctg aaagtttttt     43920
     cggatccacc cagatgcgca gattgcgctg actgaatcca ccgatgctga cctcgcccac     43980
     gccctccagg aagcggactt ggtcgagcag atagttttcg gtccagttga tcatctcttt     44040
     gagcggagcc tcgccataga cggaaagaat gatgatcggg tcttcttcag gattttgttt     44100
     gcggatggtg gcagggtcca cacccggagg ccagcgcatg cggctgaggg cggtttgcac     44160
     ttcctgcaag accacgtcga cattgcggtt gatatcaaat tccagcgtga cagagccgga     44220
     cccctgacgg gccgaagagc gcatttcctt gatgccctcg atggcaagca gtctttcctc     44280
     gataggatcc agcagctcgg cttcgacgac ttcaggggca gcgccctcat agtccacaga     44340
     aacgctgaca atcgggaagt ccacatcggg aagctgcgag atacccatgc ggttcatgca     44400
     aatggcgcca aaaacaatta atgcaaacat gagaacccat gcaaacaccg ggcgtcgaat     44460
     cgagaggtca atcaggttca tagtggtcct ttcgcacaat acatttttcc ccaattggcg     44520
     tcggagtcaa tgcggggaca ttaaggcatg tcagtttaga cgaaaagaag gggggtgagg     44580
     ttcacaccca agggaacttt tttgtgaaat tacgggactt cttagaaagc cttcgcgtta     44640
     gcgggttctt tgtagtcggg catcagtttg ccgcgatgac acatgtagca ggtggcttta     44700
     gcgctcttct ttccatccat gccgttttct cgaagcatct gagtcaattt catatgctct     44760
     ttgccgacct tgaaagcctt tttatcatca gccttgaagt tctgaacatt gtggcaggca     44820
     ttgcaggtca cacccagttc gcgggagatc acgatcatct cttcgcggat tttttcttct     44880
     tttgtcacaa atttggacac agactcggag tgagcctgtg gaatcagaag gaccagcaag     44940
     aagggaagga agaaccattt tcggatgcgc tgcataggaa tagcttgtcc gaggacccgc     45000
     cctcaggcaa ggcaagaccc tgatttcttg actggttctg gacccaagtg taacgataag     45060
     caccgggact ttgtcccttt ttcaaaactt ggagccctgc atgaaaatta agcatcttga     45120
     ggacctaaac actcttgtga gcctcagcaa acgtcgtggt tttgtattcc aatccagtga     45180
     gatctatggc ggtcttggaa gttgctggga ttacggtcct ctgggctctt tgatgaaatt     45240
     gaatgtgaag cgtgcttggt ggaatgccat gacccgcaga cctgatatcg tgggtctgga     45300
     tgccgcgatc ctgatgcacc cgatggtgtg gaaagcctcc ggtcacgtgg atggtttctc     45360
     cgatccattg gtggactgta aggagtgtaa aacacgcttc cgtgcggata acacggattc     45420
     ctatatcaac gaaaagaaat gcccgaactg cggcagcaag aatctttctg aagaaagatc     45480
     cttcaacctg atgttcaaaa ctcacatggg tcctttggaa gattccggca gcgtggtgta     45540
     tctgcgtccg gaaactgctc aaggtcactt cgtgaacttc cagaactgtc agcaggcatc     45600
     ccgttataaa attccattcg gtatcgcggc gattggtaaa tccttccgta acgaaatcac     45660
     accaggaaac ttcatcttcc gtacccgtga attcgaacag atggaaatgc aatatttcgt     45720
     agagccaggc acggacgaac agttcttcaa agaatggaaa gagcgtcgct ggaatttcta     45780
     tatcaagttc ggtatcaaac cagagaattt gaaattcaaa gatcacgaca agctggcgca     45840
     ctatgcgaaa gcggctgtgg acgtggaatt caagttccca atgggcttct ctgaattgga     45900
     aggtatccac aatcgttcgg acttcgattt gtcccagcac atgaaattct ccggtaaaaa     45960
     cctggagtac ttcgacgaac cgaacaaaaa gaaatacatc ccttatgtga ttgaaacagc     46020
     cgtgggttgt gatcgcctgt tcctggcgtt cctgtgtgat gcttaccgtg aggaagtgac     46080
     gacagacgaa gcgggtaaag aagacgttcg cgtggtgatg ggtctgcacc cggaaatcgc     46140
     tccgttcaaa gtggcagttc tgcctctgtc caaaaaagag gagctaagct ctatctctga     46200
     aaaactgcgt gaccaattgg ctgaagactt cgacgtgaac tatgacgaat cccagtccat     46260
     cggtaaacgt taccgtcgtc aggacgagat cggcacaccg ttctgcgtga ctgtggactt     46320
     tgacaccatc aatgatcagg cggtgaccgt tcgtcaccgt gacaagatga ctcaagagcg     46380
     cgtggcgatc actcagttga acgcatacat cgcagccaag ttgaagacct ttaatcagta     46440
     gcccgacagg ggcagagctg aagctgcttt aaattaaaaa gggagtgcat cgcactccct     46500
     ttttttattt ccatgatatc acaagctcgg tgagcttatt tgtccagttc ccagcagctg     46560
     taagaaccgt tgttggtcag aagcacgatg ctgccgtcac cattgtgagc cacgggcttc     46620
     aaagttttgt tatcaaagat caatccataa ggattgtcgc ccggataggt tttcacgtga     46680
     gtgtaaacgc ggccggtggt tttggatttg aaagtgatga cgtacagatc gttgtaggcc     46740
     tggtcgccac caggaccgaa caaagctttg agctctgcaa aagtcagggc attggctgtg     46800
     tactcatgat ccaccaggtg agcgttcacc atcgccagat ctttgtcgct gatggattga     46860
     acttccttga tgtcaaactc gctaacgtcc gcgaaggctt tttcaaaagc gaattcatct     46920
     tcgttgccag cgtccattgc gcaaagctct ttcaaagcag gcagggaata ggattgaggt     46980
     gccgcaaagg cagttgcgga agtcaaagtc agggccaaag ccaggatctg gtgtttcata     47040
     gtctctcctt gagtgtttcg atttcgaggg tattcctatc aagctgattc gtttgtgtga     47100
     agtgcataga atcaaagtta atatgctttt taggaatacc tgctgcttca gcttgcgggg     47160
     gctgccgccc cttctgctct gcccggcggg gccggattag tacagataga tgttggagtc     47220
     gtttttgccg ttgtcgcgat agaagatgcc gtcgatgcgg ccttcatgca cgcgattgca     47280
     attgatgatc acgccggaaa ccagaacttc atccagggaa agcgggcagt tgtaagccgg     47340
     actgaacatc tttacgccgt tgattttggc gcggcactga gtttcgttca agacttcaac     47400
     ggaagaaacc agagcgatgc cttgagcctc ttcaagagtg cagtcttgag cgaaagagct     47460
     gcttacggac atcaaaacag acagggcaag aacggccttt ttcatgaatt tctccttggg     47520
     tttttgggat gcgcgatttt ctagcacagg cactgccgaa agacccgtta ggatttggtc     47580
     gggaagggct tcctgtaaaa actcctaagt gctcgataaa cgtgtggttt tttaagggaa     47640
     gcagaagtcc ccggaacacc cttcctgggg tggaatggaa gctctataac tcagagcata     47700
     ctgggcccca aaatttcatt gatattaagg gcttagggat gttctatgtc tactagatag     47760
     gacaactaat tttacttttc cggtggggga gactaatgca ccagaatgta aactctgaca     47820
     aacaagcatc caaaacagcc gttccacaga agttcgtcta cttctttgct gccggggatt     47880
     ccgaaggcaa tgcaggcatg aagaacatcc tgggtggtaa aggcgccaac ctggccgaga     47940
     tgacctcttt gggcattccg gttcctccgg gcttcacgat ctccactgag atctgcgctc     48000
     acttctatga agccggtggc aagctgcctg actgggttcg cccggcggtg caggagtcca     48060
     tgaacaaagt ggaatccaag attggcaaaa aattcggcga tgtgaacaac ccacttttgg     48120
     tttctgttcg ttccggggct cgcgcttcca tgccaggcat gatggatacg atcctgaatc     48180
     tgggcttgaa tgatcagact gtggaaggct tggcgaagtc ctctaacaat ccgcgctttg     48240
     cgtgggactc ttaccgtcgt ttcattcaga tgtattctga tgtggtgatg gggatgaact     48300
     cttcacttct ggaagtgact ctggaagaca tgaaagagga aaaacactac aaacttgaca     48360
     ccgaaatgac ggtcgatgac ctgaagcttc tggtgaaaaa attcaaagac ctggttcatc     48420
     agatgaccgg tcagtccttc ccggcagatc cttgggagca gctgtggggc gcgatttccg     48480
     cggtcttcca ttcctggaac acgccgcgtg cgatcactta ccgtgaattg cattcgatcc     48540
     cggcagcctg gggtacagcg gtgaacgttc agtccatggt ctttgggaac atgggggatg     48600
     actctgcaac gggtgtggcg ttcacgcgca atccatccac aggtgaaaaa gccttctacg     48660
     gcgaattcct gatcaatgct cagggcgagg acgtggtggc gggcatccgc accccgcaac     48720
     cgatcaccaa gattgccgca gccgcggcgg gtgtcatgtc tttggaagaa gctcttcctc     48780
     aggcctacgg tcagttggtt gaaatctata aaaagctgga aggtcactac cgcgacatgc     48840
     aggacatcga gttcacgatc gaacgcggtg ttttgtggat gctgcaaacc cgtaacggca     48900
     aaagaaccgc agcggcggct ttgaaaatcg cctgtgacat gatcgatgaa aagttgatca     48960
     cgcaggacga agcgattctg cgtctggatc cttcctcatt ggatcagctt ctgcatccga     49020
     ctttggatcc aaaagcggca aagaccactt tggccaaagg tttgcctgcg tctccgggcg     49080
     gggtgaacgg ccagatcgtc ttcacttctg aagaagcggt cgagtggaga gagcaaggca     49140
     agaaagtcat cctggtgcgc attgaaacct ctccggaaga cattgccggc atggtggcag     49200
     cacaaggtat cctgacaact cgtggtggta tgacatcaca cgcggccgtt gtggcgcgtg     49260
     gtatgggtaa atgctgtgtg gcgggttgtg gtgacatcga agtcgactac cgcaatgaaa     49320
     ccatgaaagt gaaagggtac gttctgaaaa agggcgacgt gatcactttg gacggctcca     49380
     cgggtgaagt ttatctgggc gaagttaaaa ccatcgaacc gaaactggat ggcaacttcg     49440
     agcgcatcat gaaaatcgct gatggcattc gcagactgaa agttcgcacc aatgccgaca     49500
     cgccaaaaga cgcgcaaacg gcgcgcaact tcggtgcaga aggcatcggc ctttgccgta     49560
     ctgagcacat gttcttcggc gcagaccgca tcgatgcggt tcgtgagatg atcattgctg     49620
     acaacaaaat ggaccgtgaa aaagcattgg cgaaactttt gccaatgcag cgtgaagact     49680
     tctatcagct gttcaaaatc atggacggcc tgccagtgac gatccgtttg ttggatccac     49740
     ctctgcatga attcgttccg cacacggatg aagaaaccaa ggaattggca aaacgtctga     49800
     acacggacta tgagcgcctg cgctctaaag taaaatccct gcatgaattc aatccgatgc     49860
     tgggtcaccg tggctgtcgt ctggcgatca cttatcctga aatttaccag atgcaggttc     49920
     gtgcaatcgc ggaagctgcg gctcagttga tggctgaagg caaaaccttg gcgccggaaa     49980
     tcatgattcc gctggtggcg acagacaagg aactggacac tttgcgcggt caggccgtgg     50040
     cggaagtgaa caaggttcaa tctgaaaaga acgtgaagtt tgaatacaca gtgggcacga     50100
     tgattgagct tccaagagct gcgatcacgg cggacgccat tgcagaacac gcggacttct     50160
     tcagtttcgg tacgaacgat ttgactcaga cgactttggg cttgtcccgt gatgactccg     50220
     gtcgcttcct gggcacttac gtgtctcatg gaattctgcc gaaagatccg ttcatgtcca     50280
     tcgatcaggt gggtgtgggt tctttggtga aaatgggtgt ggacctgggc cgtcgcacga     50340
     agcctgacct gaaagtcggc gtgtgcggtg agcacggtgg ggaccctgaa tccatcgagt     50400
     tcttccacaa ggtggggctg gattacgtgt cctgctctcc gttccgtgtg cctatcgcca     50460
     gactggcggc agcccgcgca gccctgatcg gtaagaaaat ccactaagca aaaaacgaaa     50520
     aagccctctg atgaagaggg ctttttttgt ttcaccggtt cactttgtaa aataggtgac     50580
     cagaattcct aacaccatgg tggtgaaaag aatgcgaaaa gcaatctcac cattggtggc     50640
     ggatgctttg tatccgacct ctgtattttt gtattgcata ggtcctcctt ggtaaagaca     50700
     ttctagcgtc tttaatctca aggatttctt aaatcctgtg tggaccagat aaagatttta     50760
     taaaactacc tttctaatga aggattccac ttctgccagt ctttcggggc tgagccctgc     50820
     aaagggaacc gcgcattgaa tttggcgatg tcgccaggcg ggtcgggtgt gaagaactca     50880
     atcccgccgt gaagcagagt ttccagtgaa ttgattttta gttctgattt gaacagaccc     50940
     agtttggcct gcacgccgac cttgcgccag aactgggtgt tggtgcgcac caggcgggcg     51000
     tacttgcttt gcagattgat ctgcacatac agggattggg cggtcttgct taaggacacc     51060
     ttcgtgacgg tgccgacatt catgccacga aagctgacgt tgtctccggg gttgatggac     51120
     tcggcgttgt tggtctcaag ccggtaagtg accgtgtctt ccaaaggatc ctgcgtggcg     51180
     ctttcctgtt tgccttcgaa ctctttcgtc tcggagcctt ctcctggttg ggccgctatg     51240
     taagggcctc cgattaaagt ttcaaggccg gtgatgccct ggatgctgac tttgggggtg     51300
     acgatccaga acttggcacc ttcctgggcg aagctttttg cgcttttatc caggcgggcg     51360
     tgcaccagaa ccttcttttg gtcttcagac agggccactt ctgtgacttt gccgacggtc     51420
     acaccgcgat agctcagacg cgttttttcc gcttcgatgc tgctgccttc atcaaaggaa     51480
     atgatgatct ctggccccag cgacgtcaga tactgtacca gcagccaggc ggaaatcgcc     51540
     acggcaaaag ccgggaacaa ccagacatac cagtgagaac cgatcttttt agccctctgt     51600
     ttcagatctt tttccatcac ggtccttttc gttaaaagca ctgcggtcga agtaagccga     51660
     agccagcatt gtaaatatca ccaccagagc aaataacagc gctccgggtt tgggttccac     51720
     cgtggcccat tttccaagtt ttagaattgc gatcatgatc gacagcagga agatgtccag     51780
     catggaccag cggccaatag cctccacgat tcggtacaga ttgtctttca gccggggctg     51840
     acggtccgag gaatccagtg acagatagaa aagaataatg agtttcagca gcgggatcag     51900
     aatactggcc aggaacacga taatggcgat gggccatgaa cccgctttcg ccagcgagac     51960
     aattccatcc cagatggtcg ctgtgtttct gcgtccataa agttcgatgc tcataaatgg     52020
     gaacaggttc gccggtatgt aaagcaccag tgcggtaata gaaaacgcca gggtcagagg     52080
     ctgagcttgt gtattcattt cgtcatctta cccccttgat gcaggcagga tatttgtatt     52140
     tccacagcca gggaggaccc gcagatttcg tctgacatag ctgaaaaata caactcacgg     52200
     cggaatattc tttgtcctta tgcttaaggg gtcgttcaaa attcaagaaa ggatgcatga     52260
     tatggctcaa tcaaagaagg gtttgaccac cagtgctggt gcgccggttt cagacaatca     52320
     gaattcgttg acggtggggc ctcgtgggcc gttggtactt caggatgtgg cgctgattga     52380
     aaagctcgcg caccaaaacc gcgagcgggt gccggaaaga acagtgcatg ccaagggctc     52440
     cggcgctttt ggcacgctga cgatcaacgg agatatttcc aaatacaccc gcgcaaagtt     52500
     ccttcagccg ggaacaaaaa cagatctgct gattcgtttt tcaacggttg ccggcgaaag     52560
     gggcgctgca gatgctgaac gcgacgtgcg gggatttgcg ctgaagtttt acaccgaaga     52620
     aggcaacttt gatttggtcg gcaacaacac gccggttttt ttcgtgcgtg atccttataa     52680
     atttcccgac ttcattcaca cacaaaaacg cgatccgcgc accaacttac gaagccccac     52740
     ggcaatgtgg gacttctggt cactaagtcc cgagtcctgc caccaggtga caattctatt     52800
     ctctgaccgt ggtttaccgg cgtcatatcg gcacatgcac ggatttggtt cgcacaccta     52860
     ttccctgatc aatagcaagg aggaccgtca ctgggtgaag ttccacttca aaacccagca     52920
     agggatcaaa aatctgacca atgatgaagg ggcagagctt gtggggcgca cgcgcgaaag     52980
     ccatcaggag gatctgtaca attcgatcga agaaaaaagc tttccgaaat ggcgcatgta     53040
     cgtgcagatc atgagcgaag agcaggccaa gaaaacctgg tacaatccct ttgatcttac     53100
     caaagtgtgg ccgcacggag agttcccgat gattgaggtg ggcaccatgg agctcaaccg     53160
     caatccgaca aactattttg ctgaaataga gcaggcggct ttcaacccga acaacatggt     53220
     accgggtgtt tcctggtcgc cggacaagat gctgcagtcg cgcacttttg cgtatgctga     53280
     tgcccatcgc tatcgcatcg gcactcacta cgaaatgctt cctgtgaaca aacccaaagt     53340
     ggaagtgaac cactatcatc tggacggggc catgcgcctg gatgttcctg aatacaatca     53400
     tgcctattat gaaccgaact ctttcggggg acctgctcag caggaacagt accgggaacc     53460
     gccattgaag ctggatgatg ccaccatgga ccggtttgat catcatcagg gcaatgatga     53520
     ttaccgtcag gcaggggatt tgttccggtt gatggacgcc gataaaaaaa ggcagctgct     53580
     ggataatatc gccgaacaca tgaagcgcgg aaatgtgcct gaagaaatcg tacgccgtca     53640
     gatcgaggtc tttatgaggt gcgatcctgc ttacggtagc ggcttggccg agcgcatggg     53700
     tgtaaaggtt tattcagaca aatatgaaag tggcagtgcc catcattagg gcggaggatg     53760
     tatggcgacc tgggaagaat ataaaaagac aatggtggtg gaaccgctga tttttgaaga     53820
     ggcccgcaac ggcaactgcg aggccttgaa gcagtatctg gattttggcg gaggtttgga     53880
     aattcgtaat ttcaaagggc acacgctgtt gatgctggct gcgtataaca atcaggagga     53940
     cgccgccgag tttctgatcg aacgcggggc ggatgtgaac tccaccgatg atatggggaa     54000
     ctcggttttg atgggggttt gttttaaggg acatgcccgt cttgcggagt tgttgctcag     54060
     taacggcgct cgcttggagg accgcaaccc ccacggcatg acggctttgg atctggccaa     54120
     ggttttcggg cgcaaggaag tggtgtcttt attaagtgac cggccggctt cctgggcgga     54180
     cccgatggaa gtcgcctgcc ggctgattgc gcgcaagctg tcgcggccaa caccggaagc     54240
     ttgatatcat atatagagaa agcactgcca gattgtgtaa acactgtgca gtgctaagtg     54300
     ccttgtttca ttgtggtacg tgatggtttt gtagagacgc ttttcagaaa gccaattgtc     54360
     gtcactgtct aacctaaaga cagcctgaac ttattccatg atccttcctg aatgctctaa     54420
     gtgttcgaaa ttcgttggtg aaacgcgtgc caggggtttt tggccgctga attgctttaa     54480
     ggattggcat agagaaggaa acaaatttta tgaaattcaa aaactatgtt ctgacgatct     54540
     tgaaagccct tgtactgact gccatgactg taggtttggc gaactgtagc aaggatgaca     54600
     ataacagcgg caccagcaat atctattact ggggtgctaa caacatctgt tatcagaatg     54660
     taaacgggca ggcggttcaa gtgaaccaga cttactgctc tacgaattcg acttactctt     54720
     acaatgctaa cggccagtgc atcatcacat ccacgggtca gcaagtggcg cagtcttact     54780
     gcacaaccag cacgacaacc ggtcaatacg tgatgagcgg caaccagtgc taccaagtca     54840
     gcggcactca gtacatccca gtaaattaca cttactgcat gaacaacaca ggtggtgcga     54900
     cgacgtccca gacttgttcc ggtgtgtact actacaacaa tcaacagtac aactgcggtg     54960
     tgactcacaa ctgttctggt gtgatcatgc aaaaccagta cggccaatcc gtacgctgcc     55020
     tgtaagatcc gcgcgaaaaa ttccttctta atatcgccat tcacggcgct ccgcttaccc     55080
     ggtgcgccgt tttgcatttg gtgcctggtt gtttttttct ggctacggcg catcatgcga     55140
     tggaaactat ctaggcaact tttcatgatg cagcaggtaa atcagttgta agtctgctta     55200
     agttttcagc gttaggccct cttttaagag cctatggttg acatgcttcc caacactcgc     55260
     gaaattctaa tggtctttgg tctagctaga ccaagggctt gtatttgagg ggaagtactc     55320
     aagaggggat ataccttgag aattaagaag attgaactca ttggttttaa atcgttcaaa     55380
     gaccgcaccg tcattcactt tgatgccggt atcactggta tcgtcggacc gaatggttgc     55440
     ggtaaatcca acatcgtgga tgccttgatg tgggttatgg gtgaccagtc cgcgaaggac     55500
     ttgcgtgcat cccaaatgac tgacgtcatc ttcggtggag cggaaggtta tgctccactg     55560
     ggtatgtgtg aagtgtccct gacacttgaa aatgacggtg gtccgttccc ggcaaaatat     55620
     attaaacatt ctgaaatcat ggtgacccgc cgtttgcaca gaaacggtga aggtgagtac     55680
     ttcatcaata aagagcctgc tcgtttgaaa gacctgcagg agatcttcat ggacacgggt     55740
     gccggttcca aaggtttctc catcatcgct cagggtatga tcggtaagat catcactgcg     55800
     aaacctgaag accgccgcat gcttatcgaa gaagctgccg gtatcaccaa gttcaaagcc     55860
     cgtaaaaaag aatcccagcg caaactggtt gcgaccgatc agaatctggt gcgtttgcag     55920
     gacatcatcg gcgagttgaa acgccagatc gattctttgc aaagacaggc tcagcgtgca     55980
     gaacgctatc gcaatatcaa aaatcagatt gaagatctgg acctgtggct ttccactgcc     56040
     cagtacgttg aattgaaacg tgctgcggac gaagctcagg cgatcttcaa cgaagcgcaa     56100
     agcatggaag tggaaggcga aacgaacctt tccactttgc agggccagct ggaagttctg     56160
     aaattgcaga tcctggaaaa ggaaaaggca gttgaagaac aacagactga atacttcacc     56220
     aaacaatcca ctgttcaaaa gaaagagatg gagatccagg agcttcgctt cgagatcgaa     56280
     caggctcgcc gcaatgaaca gatgaccggc accatcctgc aggagcagca agcccgtaaa     56340
     gagcttcttg cccgcgacaa agccgcattg gatgaacagg tgaccgagct gaaagaagag     56400
     tccgagtctc tgtcggccgc tttcgctgag aaaaatgaaa tcttccagaa cttcaattcc     56460
     cgcatcggca ctgtggacga ggacctgacg acgaaacgtc gtgagttgtt cgccgtcggt     56520
     cagaccgaat cctctttgga tgcgcgtgtg aattccctgt cctctcagat cgcggacctg     56580
     acagaccgtc aggacaacga gcagcaggtg ttgaacgaac ttcgtgaaaa acaagttgag     56640
     ttcgaaaacc gccgtaaaaa agtgatcacc gagctggata aagagcgtca gatgcagctg     56700
     gatcttgcca gcgatgtgga ctctttcgaa gccaacaaaa aaatccttca ggattccgtg     56760
     gcgactaaaa aagccgaagt ggattccttc aaggattctt tgaacgaagt ggcgtcccgc     56820
     ctttacggtc tggaaaacct gcaaaataac tttgaaggtt tccaggaggg tgtgaagcag     56880
     gtcatgctat ggcagaaaac ccgcactcag gaaatgatgg cggatggttc tgttgtatct     56940
     cacttccagc cggtttctga ggttgttgaa gttccggctg aatacgaagt ggcgatggaa     57000
     gcggctttgg gttctcgctt gcagatgttg ttgtcctctg atgccaatat cgctgtggac     57060
     gctgtttccc acttgaaaga aaataaatcc ggtcgttcca gctttatggc tgctgacggt     57120
     caggggctta ctttcaaccg tgctgaagca ccaatgggtc aggacggcgt tcaagccatc     57180
     ctgaaagacg tggttcaggc ggctgacaaa ttcaaaaata cagtgaccta catgcttgat     57240
     ggcgtggcga ttgtggattc tatccgcacc gctttgaact tgcgcccaag atatgaaggc     57300
     tggacattcg tgactcttga cggtgacacg ctgacagctg acggtgtttt gacagggggc     57360
     tcttccgagt ctgctgattc tggcatgctg aagcgtcgtc gtgaaatcaa agaattgtcc     57420
     gagaaaaaag acgaattcgc aggaaaactg cagctggctc agatggctct taaaaagacc     57480
     gaagaacagc tggccaacgt attgaatgac ttcgaaggcg cgcaaaaacg caagatcgat     57540
     caggagatca aagttgccga attgagaaaa gacgctgagc gcgctgaaaa tgaagttcag     57600
     aacgctttgg cggcagttga gcgccaggaa cgcgaagtca aaaaactgac agagcaactg     57660
     gaagttcaag agcagaaact tgaagaactg aacgaggctc tgatcgaggc tcgtgaaaga     57720
     aaagttctgc ttgagactga agtggagact ttgaactctg agatgaactc tgttcgtctg     57780
     ggctttgacg gtcttcaggc ggaagtgacg gatcttcagg tgaagtccgc ttccaaaacc     57840
     caggaataca ctggtgtttt gagacagctt gaaatggtga ccaaatccct gacggatctg     57900
     gaagctcagt tggcacgtat gagtgaagag gctgaagggt acaactccca gatgaccgac     57960
     actcaggtga ctctggaaga aaagaaaatt gaatttgaac gtcttttgga cgaagtcgag     58020
     accctgaagc ttcaggcggc tcgcgcgaaa gacgaatacg aagtgatgtc tgaatcaatc     58080
     cgtgcgatcg aagatgaagc ttccgcttct cagcgtgcac gcaatgaaag acagcacaaa     58140
     atgaacgact cccagttgaa actggagcag gcgaagatga aagagcagta cctgattgat     58200
     caggtgcgcg agcgctacat gctgaacctg cctgacgttg ttgagaaata cgtgaaccgc     58260
     gaaggcgact tcctggaagc ggatgctcaa ctgaaagacc tgcgtgagaa actggcgaag     58320
     atcggtgaag tgaacctgtc tgcgattgaa gagtacgaag agaccgctca acgttacgaa     58380
     ttcctgacca aacagcacgc ggacctgacc gaggccaaag atcagttgcg caaggttatc     58440
     gagcgtatta acaaaatctg ctccaagcgt ttcaaagaaa ccttcgagct ggttaacgac     58500
     cgtttcaccc gcgtattccc ggtcttgttc ggtggcggtg aggcttggtt ggagcttgtt     58560
     gaagaaactg aaaagaacga agcgggtatc gagatcatcg cacgtcctcc aggcaaaaag     58620
     actcagaacg tgtctttgat gtcgggtggt gagaaagctt tgactgcggt ggcgctggtg     58680
     ttctctatct tcctggtgaa accatctcca tggtgtttgc tggatgaggt tgacgctcca     58740
     cttgatgacg ccaacgtatt ccgtttcaac gacctggttc gtgagatggc caaacgttct     58800
     cagatcatcg ttgttaccca caacaagcac accatggaag tggcgggcaa gttgtatggc     58860
     gtgacgatgc aggagcgcgg tgtttccacg atggtttctg tttccatcca ggacatcaaa     58920
     tagtctgaag aaaacaaaac gaatgccaaa aaccccgttg aggaactcaa cggggttttt     58980
     ctttttccgg gttgtagcaa agtgagacgt tccgcgaaag tgtttctttc gtgttccgga     59040
     atcttcagtc taaacagcaa aggaacgccc cattgtgaga actacagtcg cgttcccgac     59100
     aaaagctccg ataagataag ggaactaacg gaacttcttt gggggaatga ccgtgaccaa     59160
     gttaatcttt gcattcacgt tgctgatggc accgtttgct tctgctcaag ttttgagtga     59220
     agcaggcttg ttcaatcgtt gctactccca tttgaccggg aaaccggtgc ctttggggca     59280
     cgcaacgatg gcgcagatcc gtgccggtaa aatcaaggcg ctggacgcct gtaattcttt     59340
     gttggacaag gccgaactgg atgcttccgg tccgttggtc aatcgttctg acaaagaagc     59400
     ccgcgccgtt ctaaacacct tctataattt ccaccgcacc tggttcaccg ccaacacggt     59460
     tgaacaaatc caggaataca atgaagagat gtcccgcggg acgatggata tttatgactc     59520
     gacagagcct ggtctggcgc tgacacgtgc gatgtttgcc cgcaatgccc agtaccgtga     59580
     tgttctgact ctggggcagg gggtgcgtgc ccagcgtgaa gaggacatgg ccgtgcgcaa     59640
     tcgcatcggc tttaatgtga ctttcccggg ccgtcgtatt tccggtaaca acgcaggctt     59700
     ggacctgaat cttttcaact tccgtgcact ctctggcggg ttcaatggca attcggacac     59760
     aacccaagcg atgtttgtga cattgccaaa aattgaagtg ggggagctgg tcggtgtgcg     59820
     catcgccaca gataatgcga ccattccgaa tctgtcattg cagcctttgg gggctgataa     59880
     gcgcggcagc gaccagccgg gtttgaattt cagtttcaat cttttccaga ctcaaggtgg     59940
     cggtgtgctg ggtacaccta tttatctgat gctgaactat ggtcatggcc gtggtcttga     60000
     ggccaatgga accaccaagg ttccgcgccg ctggtctcag accaacatgg aatctttctt     60060
     gtgtgcagag cttccggctt tgcgtgaaaa cgacattcgt cagtatgtgg tggggaattc     60120
     ttctgcgcca tttagaaact ccagcagctg cgtgatgtgc catgcgactt tggatccgat     60180
     ggcttacacc gcccgtaacg tggtggtcgg aaattctgac tatgcggcgt tgagtgctgg     60240
     cagcagaact cactctaaaa cggcattgca tttggcgacc tatcgcccgg attttccttc     60300
     tgtggccggc tggccttcgg agccggtggc aaacttccat cgtcaggtgc cttcaggtcg     60360
     tctgttcttc cgctcaatga ccggagcttt gattgatcgt ccggtgacgg gcattgccca     60420
     gttgggtgcg gcgatggctg aaaccaagga ttactattac tgcgcggcta aaagatactt     60480
     tgaatatttc accggaatca cagtggctct ttatgaccgc tccaatccgg caaatgaaga     60540
     attaaataag aaactatcca ctgaaagcta tgaagaccgt aagttcgttg aggctcttgg     60600
     ggaagagctt cagcgcaacc agtctgtgcg ccatatggtg aagcagatca tgtcttcaaa     60660
     atactatcgt gacgtgaact atcgggaaaa ataatccggg ggcattatgg gggacggaaa     60720
     aaatctgact cgcaggggct ttatcgcagg tggtgcggtg gccggggcag cggccctggt     60780
     ggcaacacca tatgaaagac ttctgaatgc tcttagcaca ggctttattc atcaagccca     60840
     ggctgaagca accggaaatc tgggagctcg caactatatc aatattctga ttgccggtgg     60900
     gccgatgcgc tacacgtttg atgcgtggat gcgtacgaat ccttcagatg cgcctttgga     60960
     atacaatccc atggtggcaa cgaaactggt tcgttcaggc aacaacattg tcggcactga     61020
     atacgcgacg ttcaactata acggcgtgat ggtgccacac atgttttcac aatctgtgac     61080
     gacatctgcg ggtgccaaag ctttgacgga gcttctgaat aatatgctgg tgatccgtgg     61140
     cttcggctcc ggttttgacg gtcatccttt caatgcgaca attcaacagg ctccggtggg     61200
     cggtgtgtcc tcggtgatgg gtttggctgc cgactattcc aagaaaacct ttgaggcggt     61260
     ggagtggccc gatcgtggag cttacggcaa ctatgcttcc atgagtggca aagcactgaa     61320
     tattctgacg ggcaatccac tgaattcttt gttggagggg tttggcggtc cagccgcaga     61380
     ccgtgccaag gggcgcagcc tgaaagaccg caaccgtgag gcttttgatc tggctcaggc     61440
     acgcttgcgt gcctattcgc agtctgaatt tgcgggttcg acaattcttt ccaaaaatct     61500
     ttccaatgcc tcagatctga tgaaaaaagg cattgggaat atcggttctt actgggacgg     61560
     ggccgtggcc cgttatcggt ccgtgattga ggccagcatg cgccagcagg ggcttgtggg     61620
     cattaatgac gtggcgatga tttctgacca ggggaacttc tggcgggttc acgtcgctgc     61680
     gggcaaccgc ggtctggtgg tcagtcgtga ttcggatctg cgtgattcca tcaaaactat     61740
     gacggctccc ggttcattgg cagaaggttt ggcattggct gaatacgttc tgaaagaagg     61800
     cctggtcagc acgatgaatc tgcaaatggg tgatccggca ggtttgatga ttaaggatgc     61860
     cgcagatggt gtggttggaa atcacgtggc tatcaaagac atgcacgaaa ccggtgcgat     61920
     tccgggcgtg ctgatcacga cggcatacta tcgaggcctg tgtgcgggaa tgatggagct     61980
     gatcgaacaa ttgaaaaaaa ccaaagtcaa cggtgtggac ctgtggtctg aaaccgtgat     62040
     tcaggtgatc tctgaattca accgcacggc aagaaccaac ggtacaggca gtgaccatgg     62100
     tttcaatcag atggtgacca gtgtgttctc gggcgcaatc cagcgcggtc catttgttgt     62160
     gggtaacatc tatcgtgctg gtcacggtgg cggttacgtc ggcactcagg gacgtgcggc     62220
     accgatagat ggttacaatc aaaaaggcat gccgtccccg acgatggcag catccacagt     62280
     gacagcactt ttgcgagttc caaaaaatcc atacgagaat ctggctgaac cactgattcg     62340
     cctgaatggc gatcagctgc agattcttaa agcggcgaag ctggtggggt aagaacaatg     62400
     atcacagcca agaataaatt ttttatgttg ctgttatccg gagctgttct gactcagatg     62460
     taccaaaact gtggtcagat gggcgagttc gctgttctgg atcaggcgtc attgaatctg     62520
     gatatgggtt cctccgggga cacggatcag agtcatccca gtcaaaaaga tgtgacactg     62580
     ccgacccaga aagttcaagt ggtgaaccgc gaatacgtgg cttccctgat gcgcgaggtt     62640
     ttcacccgtt cttccggtcc ggtcccgaat cttgagagtc tgctggagca gtggattatc     62700
     cggcgcgggg cgcagtatgg tttgggctgc aatccttaca gcacctacag cggccgcgat     62760
     tgtgggggcg acatttcaaa tgcgaatctg ccaattaaaa ccgatgacaa cactgtgcgc     62820
     gaatccttcc gtgtccagtt ctgtgaaaac gtgctgggga tggatgaagg tgtgaacgcg     62880
     atcttggaaa agatctcgaa tcgtccggca gcgccaactg cggatgccgt tcgccaggtg     62940
     tacggattgt tctatcgcgg tgacggagcg tcggacatta tcgtggcaag cttgcttgac     63000
     tatgacaaag ctttggcgct gaaaggggag ccggcgatgg aaagatggcg ggctctggct     63060
     ctgcaagttt gcgaatcacc cggttggcag ctgcaataga atcttaaaat ctaaaaaaga     63120
     cgatccccgg gattccaaag aaccccgggg atttttttta agacagcctt tgaagggatc     63180
     acaacaaagg caccttggag aaggaacctc cgctgccgat ggagacctgc aagggaaaat     63240
     ctggggagac tctttgcagg tccgccgaga gcagcggaaa atccggaatt acttgatgta     63300
     ttggatcagg tcgtcttcag tgaagcgaac cttcttttga ttttgtaaag catcttcctg     63360
     gtggcggtac cccaaagcca cagtggccac ggttttccag ccggagcctt caaggcccag     63420
     gattttgtcg taagccaccg gatcgaagcc ctccatcgga gtggcgtcaa ttttcagcag     63480
     cgctgccgtc tgcagcagga aacccatggc tatgtaagtc tggcgctggg accagacgcg     63540
     gattttttct tcctgcgctt ttaccaggtt ttcaaccagc atatttttgt atccgtccaa     63600
     agcttccaga ggggcgctgc ggacttcagc cacacggttt atgaactttt gtacgaagtc     63660
     tgcatccatc ttttccttgt aaaggaaaac cacatagtgg ctggcgtcag tcacttgggt     63720
     ttgattccag gacaccggtt tcagctgttt acggacgtcg ggattttcga tgaccaggaa     63780
     tttccacggc tgcacgccgt aagaggacgg cgccaaagtc agggaatttc gcagggttgt     63840
     ccagtcggca tccgagatct ttttggtcgc atcgtacttt ttagtggcgt agcgccactc     63900
     cagggcatct tgaatcgttt tatgggtcat gggaagggct cctttaattg tgtcaaatac     63960
     aggcacagta tgccgtggtt ggaatttaaa tgcaacagta aaagatacat ttaaggaagc     64020
     ctcgggtcct tagggactta attccttgat attgtttatt tttgaggctt aaggtaagat     64080
     ctagacatgg ttgatcaaag gttttctgtc tcagttcata ttatgactgc cctggcttac     64140
     cacaagggcg atctgatgac gtctgaagaa ttgggcgcga gcattcgcac caatccgacg     64200
     gtgatccgcc gtttgatctc caaacttgtt gatgccggac tattgacgtc cttcaaaggc     64260
     aaggcgggcg gtgtgaagct ggccaaagcc ccgaaggaaa tttcccttcg tgatgtctat     64320
     gtggcgatca ccgacaagaa gctgattgcg actccggata aagagccctt caaaaactgc     64380
     gttgtcagct gttcaatgaa aaagctgatg tgcgagctgg tggatggcat tgagaacaac     64440
     tctatggatt atctgggcgg gatccgtttg tctgatctga cgtccaaaat cgccaaatga     64500
     agtccgtcta tcctgccgaa gaaattcgcg ccgaacgaat cactctgaaa aaacacaaaa     64560
     ttgaaatggc tgaaaccatg tttcagtatg tcgaccagga ccgcgaacgc ctggggcgct     64620
     ttctgccatg ggtgccatta atcggtggag ttcacgatga acgtgattac atcgaaatga     64680
     ctcaagcgca gtggcaggat ttcaaaatgt tcgactatgg catgtacctg aacgaaggtg     64740
     acatctatat ggggaacgtc ggcgtgcaca cgatcagctg ggacaatgac cgctgtgaac     64800
     tgggctactg gatccttggg aaattcgagg gacaaggtta tgtgcgcgag gcggtgctgg     64860
     ctttggaaaa ggtcctgttt gagcttggat tttatcgaat tgagattcat tgttcaggtc     64920
     ttaacagccg cagcagctct gtagctgaaa attgtcatta caaattcgag gcccgtttac     64980
     gacatcacgc cgttgaaaac ggccaaagac gagacactct ggtgttcgcc aaacttcgtg     65040
     atgaacgata aaaatcgcga aatcgaagaa cttcatcgca atgcttgcga gtccggaaag     65100
     gactcctatg tcgatcctgc gacaggatac actgttttta ctgagtattt tcacttgaag     65160
     cgcggtcact gctgcggttc aggctgcaga cattgcccat ggaaaaagaa tagtcagaaa     65220
     aatccaaaag aacccaccga ccggacgtaa gtgttgaaac cttcggcatt ttctccgaaa     65280
     gaaaaacact caattctgtt tttgagccac cgaaaagaag atcgtcactg ttatgatttg     65340
     tgcaggtggg gtgcgttggt atgtcgttta attatcaaaa aaacaaagaa cattcgagcg     65400
     acagtttttg gacgtcgtat tcggatttat tcttgggttt aagcacgatc ttccttcttt     65460
     tgtatgtcac atccagtttg cgcacaggca ccgatgcttt gcgtggccag gtggaaaacc     65520
     agaagctttc catgaaggtg gaagaactgg aaaaccagtt gaagatgtac gagaacgtga     65580
     agaacgaata tctggccagt caggcaccta aagacgaggt gcaggagtat gaagagctta     65640
     tggacaagct gacattgctt caggaggacg ccaaaactga aaaagagcgt ctgatccagg     65700
     aagcccgtga aaacggggaa aaggtcaaag ctctgaacaa gtaccagcag atggtgcgca     65760
     atgttcttaa tgccaacaag atggccaagt ccaagctgat caatcgtgat gatttgatta     65820
     aagagcagga cgtggaaatc gaaacccagg aaaccgaaat tgctgatctg aataaagaca     65880
     ttcagaacaa aaagcagttg atcgcccagg gtgaacagaa gatcgcggtc acacaggctc     65940
     agttgcaaaa acgtctgacc gagctgcgtg tggcctacaa gaacaacaag ctgtccaaac     66000
     agttgtttga acagaaaatg gcgcaagccc gcgctgaggg aaatcaaaag gtggcccagc     66060
     tgaatcaggt caatgcccaa tatcaaatgc aactgaacca ggccaatgtg caattgggtc     66120
     aggtgcaggg cgaactttcc aaaactcagg ggttgctggc gcagaaggaa gacgaagcaa     66180
     ctcatctggc gggcgcgttg tcccgcacca aggctgaggc cggtgcgaaa atcgcaggat     66240
     tgcaacaggg ctttgcggaa gaaaaagcgg ctttggcggc aggctttggc aaggaaaagg     66300
     caaagttgca gggtgctttg agcgacacgc aagggcagtt ggcgaaagca cgtgctgaaa     66360
     ttgaagcgcg taaatccgtg gcgggtgaga ttcaaaaagg tttcgccaag gcagggatca     66420
     aagctgacat tgatatgcag acgggcgacg tggttctgga tttcggacag gcttactttg     66480
     acagtgactc cgaccgcctg aaacacgaga tgaaaggtgt ccttgaaaaa gcgatgccga     66540
     tttattcgcg ctctttgttc ggcaacccaa aggtgtcgga taaaatttcc gcggtggaga     66600
     tcatcggttt tgcgtcacca acatatcagg gccgtttcgt cgatccgcac agttccaagc     66660
     cggcggacaa agccgctttg aagtacaaca tggatctaag ctatcgccgt gcgaattcca     66720
     tcttcagtta catgctggat gaaggaaaca tgagatttga acatcaacgc gaactattgg     66780
     cccttatgaa ggtttccgga cgaagcttcc tggaagtcat gaaggtgcaa aatcgcaacg     66840
     tcgccacagc agccgaattc tgcaagcaga acgactgtaa gaaggcgcag cgggtaatca     66900
     tccgctttaa catggatccg aagaaataaa aggggtgggt tgtgacaacg aaggcatttg     66960
     ctgaatattt tattataagt ctgccgtatg tgatgggcgc cgtctttctg gtcggtttgt     67020
     tcttccgcgc ggtaatctat tacacggtcc gccgccatga atccttcgcg cgtgaatttg     67080
     aaaaacgtgt gaatcgtttc atcgaagctg aagttcccgg caaagtcgag aacgtgtctt     67140
     tctatgtgct gaccaaaaag cttttggaaa gaacctatta cgaagtattt gaaatccgcg     67200
     accgcatgaa acgcagaaag cccgacaatg tcatgtccgc cagtgaccgt gtgttcctgg     67260
     ttcgtcaggg ctgtgcctgg ctggtgaaag acatcctgaa acaggtgaag ttcctgcgct     67320
     ggacggatga caatccgaag ctgttaaata tcaccaaggc gactttgcaa cataatcctt     67380
     gtttcaacaa ggtgtttggc gtgatcccga tggtgggtat gaacgacttg atctctattt     67440
     tgccaggtct gtttgtcgtg gcggggatcc taggtacctt catcggtatc gcgggtggtt     67500
     tgcaggaact gggcacgatg aatctgcagg atctggaaaa caccaaaaac atcatggatc     67560
     gtttccttca cgagatctct ttcgcgatga aaacatccat tgcggggatc atcttctcgt     67620
     tgatggccca tgtggcgaac gtgattcttt ccccggaaag agcttatgtg tccatgatcg     67680
     accgtttcga gagctctttg gatttgttgt ggtatcgcgc ggacaacaat aatttcccag     67740
     ctcatgagcg cccatttgat gaacatcgtg atgccgttga agctttggcc gaagatgccc     67800
     tgaacaagga aatcggaaaa actgcggcgg tggtcagagg agcttaattg aacaagttta     67860
     tagtcacaat ccacaggaag gatcaggtgc taagccgtga ggtgaacaag gactcgttca     67920
     ccatgggccg ctctttggac tgtgacttgt ccttgaacga caacaacatc agccgggttc     67980
     atctggttgt gagccgtcgt tggaatcaga tctggattga ggataaaaac tcctccaacg     68040
     ggaccttcat caacggcact cgtatagtgc aagggacccc ggtgaacgtg gttccttcag     68100
     atcgcattca gttgggccgt tcagaataca tcctgaacct ggatcttttc gtcgaagagc     68160
     ccgcaccgga accagaaccc gagccgtcga tttctcaatc cgcggcaacc gtgccggaag     68220
     aagaagacgc cccactggaa gccacggtgg ccatgccggc accaaacatg gcgcctttcc     68280
     aggcggaaaa aatcctgcac gaagccaagc gcaaagcggc gcaaatcatc atggaaggcg     68340
     aaacccaggc tgaacgccgg gtgcaggtca tctatcagaa agcccgcgaa gctcaggctc     68400
     aggctgagct gttctatcag acccgcatgg cagaagcgca caaggaagcg gatgccatct     68460
     tggcggactt ccaaaagcag gggcaaagcc tgctgcatga ggcgcgcaat atgtcccagg     68520
     aactgcgtga agaagtcgat tcttacgttc agagcctgcg ccagaaggct cgcaaagaca     68580
     ctgaagacat catttcggaa gccacacttg cggccgagaa aatgaaagac gaagccattg     68640
     cccacggtcg tgagctggcc cgtcaggaaa gcgaagcgct gcttaaaacc agccgcgagg     68700
     aagcggaccg tattctggat ttctcgaaac ttcagatcga ggaaactcaa gcccgtattc     68760
     gcacggatct ggaaaatgcc caggaactga atcagcgcac tttgcaggag gcccaggctg     68820
     aagccgaaag actgctgaat gaatcccgca tgcagattcg cgatgcggag gcgcgcttgc     68880
     gcgaagaatc tgaacaagcc cgcaatgaca atgcttcttt gattgccaca gccaaggaaa     68940
     ccgccgacca gcttttgcag aaggccaagg ccgactgtga acagcagatt caaatggcga     69000
     acgaaaaagt tcaggaaatc acggctgtca gcaatgaaaa gcagaccgtt ttaaacgaac     69060
     ttatgaataa cgttgcggcc cgcacggcgg aactgcaaaa agccactgaa gagttgagca     69120
     aaacccgtac tgataattcc gatctgctgt cgcaggtgga aaaaggccag gctttgctga     69180
     aagagcttca gacttcccat acggagctgg aaaaacaaaa agccgcattg gaagcttctt     69240
     tgaaaggtct gcaggaaaag caggcccatc tgacaatgga cgtgcatgac atcgaatcca     69300
     aaaaggctca tttgtttaag gaatacgatg cgcaaaagat cttcctgaac gaaaagctgg     69360
     aaaaagaaaa gacccagatg gcgaagtccg aagaggagcg tctggaagaa atgcgtctgg     69420
     atatgtccaa acgcctgcag aaaatggagc gcgatctgct ggatgatgtg atccgcaaga     69480
     agaactccat ggtgaaggac atccactcgg ctattgaaaa agagatcgtg atgctgatgg     69540
     agcctgaaaa atggcgcaac gtcagccagt ccgtggaaaa tcatattgct gaagccatcg     69600
     acggtaaagt ggcgtccctg tcccagtcgt caatgagtga aaaaccggtc gatctgatga     69660
     aaaaacgcaa aagcgaaaaa cttcgctggg tcaccatggg tcttgccatg ggggccgtgg     69720
     gttatttcgt cagtcagatt gtcgtggacc gtgtcgtgaa agaccagagt cccatgcaga     69780
     ccatggtcag caacgaagcg aagaaacgtc aggacgatct ggaaaaacgc aaattcaatc     69840
     ctccgcaggc ggaggagatc aaagactctt atacagatgc agttatttac acgcgtaact     69900
     atatggatat ctataccgat gcccagttcc agcagaagct ttacaaggcg gcttcccagt     69960
     atctgctgaa aacctggcgt gtggatgaag acaagtccat tcaggtcatt tcatccgcca     70020
     atgccttggt gaaggaactg gccgacaaga aatcaaaaat ccatccggac tttatcaaag     70080
     aaggtatcga aaagatgcgc gagctggaaa accagacttt ggcgcgcatg aaagatgtcc     70140
     tgggtaccga agtccgcctg gaatcctatc gccgtttcga gcgcaatttc tataaagaag     70200
     aagtccaacg ccgccgcatg gccaactatt gatataacgg cactttcatt tgtcggatga     70260
     tcttccagta ctcggcaggt ttgtctttct gggcattttc actgaaaaga tatgcattca     70320
     gctggcgggc cttgatggag tcatcctcgc ccagcttata gaaatgttca tagatgatct     70380
     catgcagaat caagccggct ttgccgcgct cggatagttt gttccacaga tcctgatcta     70440
     ccaggaaccg cttggaggcg gcggacgcct cttttttgcg gatcgcaatc tgctgaactt     70500
     tgcaggcttc atctctgggc tggaacagat gtcgggagtc tttgatgtcc gccaaggtga     70560
     cttctgattt gaaatcactt tcatcgataa actggctcag acgacggaca tagtttcgcg     70620
     attgagtcgg gctgaagcgg gacagattct tcagaacctg ttctgcaata tgccggtagc     70680
     ctgcagtgct ttcaaagtcg tgcaggatta aagaggactc gtaaaagtcc agcagctctg     70740
     ttttttcggg acaggagaca acgtcgccgc cgttgccgac gcggttacca cttgcaaaag     70800
     ctgataacga agctgttaga atcaggaaga agaagattgt tttcataaat cacttcacca     70860
     gagtaagttt gtaatccagg gtctggcctt cgatggtctt cagcttcaga tgagcctgtc     70920
     gactgatgcg accactcggt acattgatca gaacccagcg tttggccaga ctcatggagg     70980
     ggacgctgaa aggtgagtac agatgagttt cgggaacgcg cgcaacgcct tgagcattgg     71040
     cttttgcgcc ttgaacgcca tctacaacgg aatagactgc ggcaccggtg taggcggcag     71100
     tgcccaccgc ggtcaaggca tcactatttg aaataacacc cgcaacaata agggcgcccc     71160
     cggttagtgc cgtcaaaccg acgccgacac ttttattgtg cagacccatg cgacgttctt     71220
     cagctttggc ttctgcccag gtcaccaggt ccttgccgac tataatattg aagggttcgt     71280
     tgtcagcatt ggacagatcc agctcggcat tgtccactcg cagccatttg ccatctttgc     71340
     tgacaaaatt gatttgcaaa agcagattat agtcatcgga aaattcacga atgatatcgg     71400
     cagacacttc cacattataa ggattggcct gatcgaccgc atctgccgtg gccatttttt     71460
     cgcccttgat ggcaagttcc ttactggcgc aagaagccag cagaaggcaa agaagaatgt     71520
     actttttcat gattgagtcc tttcaagtga gaaaagctga catgcgataa taaaaatctc     71580
     ttttgaattc ggggtctgca gaaactcagc caactgatcc tgaaattctt caaccatttt     71640
     acgggcctga ggaattttgg cgggatcggc cgcgaaggtc attgccgaaa aatctctttt     71700
     gtctaaaggg gtctgaggca ttttggtcag ggccagctcc agaacacttt ggtgatagct     71760
     ttgaatcgcg cgagacggga cttcgctaac cacattcaac ggtgcagatt tttgtttcag     71820
     agctttgccg tcttcgatga tatccattcg gcgcagacgc tccaaggctg cgcgggcgtc     71880
     actgactgaa atccccaggc gatcggaaat ccagtgagga tctgccttgg ctccgcgaat     71940
     ttttcccagg ctgagaatcg cgaagtgata ccattccgaa atcaaacgga actcatcttc     72000
     ctgcaactgt cttttggcgc gttcttgggg aggcgtctgc gctttttcca aaagtgtccg     72060
     ggtgagtagc gaacgctctt cttcggggga caggtgcagg ccgcgggaaa tcgtgcccag     72120
     cacctcagtc gtgaagttac gtttgccgga aagaagctgc gaaagctgcg ctgggctgat     72180
     gcttaagctc tgagcaaaag cccgcagcga atagttgctg ttgcgctctt tgcggcgagc     72240
     cagttcatct ttcagaagcg tgatcgcatc gtttgtgtgt ttgttggatt gtgtttccat     72300
     agacccaacc tattttaggg cagttccggc ggtcaacgac atgttgtaaa cagtgtttca     72360
     gactttgaaa cgctgggaaa atgctctggt ctcggcttct aaaatgcggt acataggttg     72420
     tgttttctta tcttaatgac gcacattgtt gcggaggttc atttatgatg tcacctgggc     72480
     atgctcagca gatggaaatt ttggtggggg ctatcgttct tattttcgcg gtgattgtcg     72540
     gtgctctgat cttgggcatg atgaaaaatg cgaaaaaacg tgaacagctg cgcgcacagg     72600
     agctttctca cgaagccaaa cgcgagatgc cgacaacttc tgaacagtca gaagaacttg     72660
     cgctggcgca catagattcc acgggcaatg tggtttctga tttgtccgtg ccggatctgc     72720
     atgatgcggc ggtggtgatt gaagaaaagg ccgtggacct ggccgtggca ctgaagaaaa     72780
     ccgaagaaaa tcttttcggc cgtattcgca acctgttcaa atctgaaacc agcaacaaac     72840
     atctggaaga gatcgaagag atcctttaca ccagcgatct gggcccggcg acagtacagc     72900
     gtctgatggg tgcaattgaa gacaagcttt ccaaaaaaga gcgtgcggat tacgacaccg     72960
     ttcgtgaagc gctgaaagaa gaaatcaaaa acatcttcca gggttctcat tccacttcgg     73020
     tggggacagg catcctttcc aagattcagt tcgcggcgga aggcccgaca gttctgatga     73080
     ttgttggtgt gaatggggcc ggtaaaacca cctctatcgg taaaatttca gcgcaactgg     73140
     ccgctgaagg caaaaaggtt ctggtggcgg caggggatac attccgtgca gcggcgggtg     73200
     ggcagttgaa ggtttggacc gatcgtgctc aggtcgagat tttttctccg gaaggcgtga     73260
     ccgatcctag tgccgtggca tttgatgccg tagccaaagg taaagcccag ggctatgacg     73320
     tggtgatcgt ggatacagcg ggtcgcttgc acactcaagc caacttgatg gaagaaatca     73380
     aaaagatgaa acgtgtgatg tccaaggtga tcccggaagc tccacacgag actctgatcg     73440
     ttttggatgc gaactcgggc cagaatgcct tgatgcaggc taaagaattc cataatgccc     73500
     tgactttgac cggagcagtt ctgactaaaa tggatggcac cgccaagggg ggcgtggctg     73560
     tgggccttgc gcaagaactt catatcccaa tcaagttgat cggtgtggga gagcgcattc     73620
     aggacctgcg cacgttttct tctcaagagt tcgttaactc tctgtttcaa tagtgtggct     73680
     cgggggattg cccccgggat ctgaccaatt cctgacggaa ttcccggaac aattcggtta     73740
     taagaagggc ctcaaaacct aaaagggggc tcttatgaaa tccgtcgttc ttgcttttgt     73800
     tcttttggcg ctgccagctt tttcccaggc tcaaacctgc ttccgtgcca ccgcggcttt     73860
     gcctgacggt gttgcctctg ttctatgcgt tgataaagtg ctgttgacgt ctgatgaaaa     73920
     gcaactggag ttggtgggtc aggattattc tgtaccggca ttcctggatg tgattcatac     73980
     cagccgtcac aatgaagaca aattgaattt caaagctcaa ggtgccttgg ttgatatctg     74040
     gcagagcggt tgtggtgatg gattgtcagc aaaactgatg gtgagtggtc gcactgaata     74100
     tggtgaaatc tatcctcagt ctttgagcgt gtctgttgaa gtggcagaga ccaatgacac     74160
     ctgccactct gaaccttcga aacacacagt tccctatgca ctgatcaccg aatagtcttt     74220
     tgcgattact tctgatcggc gatgcgctgg atgtgatctg atttataaac atgaaagccc     74280
     gggtggaagt tcaaggtggc aatagccata gcccgggcaa tgtcgttggc ctttatcgca     74340
     cggtacttct tcaagggccc caccatcagc ttgttcagga cggggctgag cttctgggcg     74400
     atgtcttcgc ctggtcgcga ttctttgcgc tcacccaaaa tcaatgaagg gcggaaaact     74460
     tcgatctgcg ggatcttcag tttgcgcagt tcattttcca tttcgccttt gacccgattg     74520
     tagaagatct tggattcggc gtccgcgccc atggctgaaa tcaccagaag tttttgtgcg     74580
     ccacaggctt cggcgacttt ggcaaagttc acgacatagc tatagtccac cttgcggaag     74640
     gcttcttgag agccggcctt tttaatagtg gttcccaggc aacagatgaa gaccccggcc     74700
     ttcagcacat cttggcgctg ctcaaggctg tcaaaatcca gaatgatatt ttcaacgtgg     74760
     ggaggaatgc ggcccatcgg gctgcgcgag accgctttga tagagcggac ttcatcaagg     74820
     tgggctaaaa gcaaaaggag ctcgtgtccc acgagccccg ttgcgcctgc aatgcagata     74880
     tcagttggat aagtcattga tgtggtcatt ctcctgactt cgcagaagag gcctagttgt     74940
     tgccgcctct tcttgtcgtg tcgttttcgt tttcagttct gtaaacgatc ttcggaggat     75000
     tgtgtttgcc tgaagttgtc aggaattcag gtacagaatc tctgaagtcg gccagaccgc     75060
     tgacgcggat cacgccttta gtgcgtgttc tgtccggatg tttgtaatcg atgaaacgac     75120
     cttcgtccac caggaagtaa ccggtgaagt ttgttttcgc cgcatctttt tcccagccag     75180
     agtcgattct gtaacggtcg ccggaattgc cggaagccgc ggatctgcca taattcaact     75240
     cgttggcgtt cgggtactgg tccacgtcat atgtaccttg ttcgatcaga ttttgaccag     75300
     caataaccgg gatcgcctta tcgatgatgt ttttcgcgtc agctgacaaa ccaccgcttc     75360
     tttgtgcgcc gtcagtcaac aggatgtagt tccaaaccat cggcttttca aagttgtgcg     75420
     cataacgtgg caatggagtt gtcttctttt tgaagatacc agtgatcact tccgcttcac     75480
     gagtggattc acgagcgtag acacggtaga tgtctgtgcc cggagtcagg atggatcgca     75540
     ggtaggcaat cgcacggttt tccagacgag tacaacccgc agagcctgga ttggagaaca     75600
     tgttcatgaa gaacccgcga gtcagctcaa tcgctgccgc gccgtcttta ccccagccca     75660
     tggttccatg cagccactga tagttcatac cgttgatttc gtcagccgga gtgatcttgg     75720
     cagcatacca accgaaagca ccatagatag tggaattgcc ctgggcatcg tctaccatcc     75780
     acttgcggga gctgatcagt ttggacatgc catccgtgat cgggcctgga attgttttca     75840
     gatcctgacc ggctttatac cagtgaggat agtgaccctg accgtcttga tagaatttga     75900
     tccactcaga aatacgcgca tggcccagcc aggttttgaa ggcgtgagga tccgttttag     75960
     taccctcttc agggcggccc acaaccattt cagtttccat cacaagtttg tgcgggcagc     76020
     ttggtgtttc tgtgcagcgc tcataaacac gggttttttc tgtcgcaata ttctgaatca     76080
     caaaatactt ggaggctgct gtttgcagtt gttttgcact cagatagtcc ttggaaacaa     76140
     acagttccgc agaaacatcc gcttttactg tcgctgattt gatgattttg atctgaacca     76200
     gcggggttgc ttcgttcagc aggtcataga tctcaacttc atcattaata gacaatttac     76260
     caacaatgtt ggaggccgtc gttgagttgc tgctgcgaac attcagagca tccgcagaga     76320
     taaagtatct gccacccact tgcagactgg ctttggacaa acctacagcc gcagcattca     76380
     cgctggcgtt ggcatcactg gaagtgattt cctgggctac ccccagcata ggggagctgg     76440
     caatcaacaa actcaaaact gcagagcaga gtcggcgcgt attaatcttt gtcatgaacg     76500
     tcctccagaa acgtatatct attaaactta tgtcattgac tcaaatcctc tcagcaagaa     76560
     gcgtgacagc ctccagacct gcggtatttt tgaaaggatt gttttcagcc gtcaaactgt     76620
     ttatcaacgg agcccttttt gggcacatgg aggtttcatg aagatgagta attttttgct     76680
     gttgggtttg atgcttttgc cagggttggc tgaagctcag acggcttcca aagcatggcg     76740
     tatcaccaag ccgtcgtgga ccgcagcgga tgaacagcgc tttggagagt tcgtcaccca     76800
     attgggtaat gctgtggaaa ggcgcgaatg tgccaccgtg gacgaatgtc tgcgcagccc     76860
     ggcgaatccc tatgccggaa cagatccggc ggatctgcgg ctgtttgccg attgtgcgga     76920
     tctgccttac tatctgcgct cttatttcgc ctggaaaaac ggacttccaa tgtctcttgt     76980
     cagcagtgtt aacactctgc cgggatctga aaacaaagac cctcgctatt ccaaattcgg     77040
     caatgctgtc ggcgggcgct acgacatcat ccctagccgc accagcaatc ccaatgcggt     77100
     tcaactatta aatagaacca ttgtggacat gacctattca gcgaccttcc gtatgatggg     77160
     tgacaaagat gcagctcgtt ttaccgattt ctatccggtt aaattaaacc gcgaaggcat     77220
     tcgtcctgga acagtgattt atgatcccgc tgggcatgtg gcgatcattc atcgggtaac     77280
     agatgacgga cgtatttttt atatcgactc ccacccggat aacactctga cttcgggaat     77340
     gtacacaccg aagttcaccc gcagctttcc agggcatggc gctggattca aaaacttccg     77400
     tccactggca ctgcagggag cttcgcgcaa ggccaacgga gaatactatg gtggaaaaat     77460
     tgtcggagcg ctgaacaccc agcttgcgaa cttcagtgtc gagcaattct atggcaattc     77520
     gccagacccg gccggggaat ggaacaaagg caagttcctg catcgcgggg tgcagtatcc     77580
     gtactatgac tatcttcgta tcgcgatggc cagcggggat ctgaaaattg atccgcttca     77640
     ggacatgcgt cagatggtgg cggatatttg tgtgaacttg aaggaccgtg tggtggcggt     77700
     cgatatggcg atcaaagcgg gggtggatcg taaaccgcat ccagagcgtc tgccgacgaa     77760
     tatctttggt acgacaggcg agtgggaaga ctatgcgtct ccgtcccgcg atgcccgttt     77820
     gaaggtgggc tttatggata tcttaaatca ggcccgcact ctggttcagc gtcagcgttc     77880
     tggcgatccc gcgatcgtgt atagcggtgc caacattgcc gaggatcttt tggcgacgta     77940
     cgaacgtgaa gcccgcttct gtcagttcac ctatcgcaat tcggcgggtg ggtctgtaac     78000
     tctgaatttg gaggaagccc gtcagcgcgt cttcgatatc agctttgacc cgtatcactg     78060
     tgtcgagctg cgctggggtg ccaaatcccc gcaggagctt gcgacctgca tggatgatga     78120
     aaataaacgt ctgtggtatg accgggaaag atggctgcgc aatcagtggg agcgtcgcta     78180
     tgacgcccgc atggattatt cactggatga gctgaccggt ccgaaaccag gcgccgggat     78240
     cgcccagcca ccggatgtgg atatcatccg tttgctgaat tccctgagat agccacttta     78300
     agggcccggt tccgggccct ctctcatttt gagacacttt caaagtggcc gcccttaaat     78360
     gtctctttgg atagtgtctt gacggccaaa ggcctttcaa aagctcatat tacgggtata     78420
     gggcttgcaa atatcgaaga ttatggaagt gtcacttcgt tttgccatgt ctggattgct     78480
     ttgcctgttg ctgatcgcaa cgggcgggtg ttcttttaag aaggacccgg caaacggcaa     78540
     gggagccccg gtcaccctga tcgaagaaaa ggtcctgcct gaacatgtgg ccagcctgga     78600
     tgagattatt gccggagacg acgaggaaaa ggccatcgaa gccctggttc aacgcaaaga     78660
     cgagctggcg gcattgtccc gcggtggtgc agtcaacgcg ctggatctgg cgatcaaaca     78720
     cggaaaacag aaagtcgcgc aattcctgct gatcagcggg cacagtccgt ttgtgctgaa     78780
     tcaggaaagc cgagagaagc tgacctacga tgcggcgatg ggcaagctga ttgagtcggc     78840
     tcagcttgat gggatgatgg atattctgcg cagttatccg aagaagacgc atgaaggaat     78900
     ttcgccagat acttccatgc agaagttccg cgatcgcatt aatgagtaca aacttgacta     78960
     tcgtggctgt gagaaattcg caaatatgct gatggagagg gaatatctta ccagaaaccc     79020
     gacgaagcca ggcttatact acgaggcatt cagtcagttg aagcctcggg aggtattcag     79080
     cgatctattg aaagacactt cttgttctgg tgagacgaca cgcttttcta cggaattgat     79140
     taataaatgg gttggttacg agtacttgta tcagtttcaa tccagcttca agtcaatcga     79200
     atttatcaaa tcattggtat ctatgcgcaa aggcgcggca ctactgatag ttgtgccagc     79260
     tagtggatgg catgaggatc atctgggttt gatctcaagt caggtgaagg tgagcccatt     79320
     ggcgatgttg atgctaaaac gagattgctt tgcaagcgag ggacagcgcg atgagtgggt     79380
     ggacttggtt cgtgagctga tgctacagtc tgggcaggaa tattcttatc cttattatat     79440
     gcctgacgac attccagatg gtttaggatc gtgcatgggc gaaaataaat actgtgccag     79500
     caatcctcgc aatgtggaga gtctgtataa gatcttccgc tatacaaatt caaaatctca     79560
     gctatcgcag acagatttct attctctata tacagaggag cgtcgcgagt tcgttaaaat     79620
     gaaacttgat cagttcaaag ccgaaatctg tactgaacca caaaggagga tgttctaatg     79680
     aagcaccttc tggttttggt ggcattcgtc ttcctggctg catgctcgtt tgataacggc     79740
     aagtttgacc ctgtggaaaa gaaggtttca acaaagaaag agatgtctcg aggtcaaaag     79800
     gatctcttga cggccgctcg ccttggaaat gtttcgttgg tcgaaaaggc tattgccgga     79860
     cttgctgtgc atgagttttc ttattccggg ttttcagaaa ccccgatggg tttggcggtc     79920
     gctgccgata atctggaggt cgtgaaggtt ttgtgggcac agtctattga tgcctttaat     79980
     ctgggaagtg agcaaaataa ctttgaaagg caggtgctga ggtctcgaat ccaggagcag     80040
     ttccgtactc taaaacatgt aaagcgggct gaatctataa gagttgtatt gaataagtct     80100
     gctgctctat tagcaaccga atacgcaaag aagactcaat ctgtattgga acttgttgct     80160
     cagtctgact ttgcagctgc gcaagggctt ataaaccgta caggattgtc ctgccagttt     80220
     gtacggaacc agattgttca ggatcttcag gcagacgtaa tcaaagactc cgctgcagtc     80280
     gataagtttc taaagcagct cagttgtgcg gaggaaattt catctcaaga tttgcaattg     80340
     ctgtatgaag cggagctgat tcgacaattc caacgctact ttaatgctcc tgcgctgttg     80400
     gcctatttga gtaaccgccc gagcttgaaa tcgaccctgt ggaatatcga tgagtctggt     80460
     ctatggatgt caccggcttt gttgatgcga atttcctggt catatgaaaa tcattggagt     80520
     cgacaggatt tgctgtgccc aaagttggag gttggagctt tgaactgcaa ggagtttgcg     80580
     gatgatgatt ttaattcgtc agactattta attgggaaat acgggattaa gaagacagag     80640
     tttgacttga tttacatgaa gcaggggcag gtgcttggga gctaccgtag atttaagcgg     80700
     caatcacgca gtaacggccg gaaggcggat cctgtataca ggaacgctag tatgtatatt     80760
     catagaattc catactatgg ggaattagga atgcctagtc gcaatgagga tgggcaagtt     80820
     gagtatgagg aagagcgtct tccttggaca gtcggcattc aacagatgtt ggaaaatcat     80880
     tattttgaaa gtgacagctt tgacgacggg caatgggaag agattcaaga ggcgcgtcgt     80940
     aattctgaag aggctgaaag attgagaagg caggaagaac aaggggatca agaagagttc     81000
     gttgaagaga gcgcagagga aaatgcggaa caccggaatg agcagactcc gggggatccc     81060
     gacactatct ttggagactt gcctggtctg gacgaaccag gtgatcttcc gccacctcca     81120
     cctccactgc cggggccgac cgatcttcct gaagttgagt agtcccatct caaactgaga     81180
     cgggtgacaa attggggccc ctgtctagta aacatttccc gtacgcaagt ataggccccg     81240
     tacagctggc acttttattg gatatataga acctgaagag gtttctatgt ctatgaagag     81300
     cttgtttaaa aagactttcc tgatcggtat gtccatgatg actctggcgc cccagtttgc     81360
     ctccgcagca ctggagtcgc aactcagtgg ctatctgaat aaagaccttc aagaaatccc     81420
     ggttattttt gtccgtggat ccaacttcta tcttcataaa gcgacgttga tttctttgta     81480
     tgaaaaacgt ggctattccg ccatttgggt tgatgcgaat ggtaaaccta acgcaatggc     81540
     ggcggccgta cgtgaggctc ttaagtatgg tgcgaccttg aatggtctta atcccgatga     81600
     ttattgggat agaattgttg aaaatatcta tacttcaaac actgatggca gattcggacc     81660
     aacatttgag ttggcagtat ctgaagccgt cattcgctat gtgacccacc tttccacagg     81720
     tcggtttgat ccgatggaaa ttgatactga tattaaaatc tccaaaaaga aattcacgga     81780
     atacgcagag ttgaaccaag tgatcagttc tgtacaggcg aatgtcagtg caaaggcgtt     81840
     ggtagcgggt ttggataagt ttgctccggc gcatcttcgc tatgtggatt tgaaacagct     81900
     gctggcttat ttccgcagta ttcagactgc gggtggctgg tctcagatca aacttgctaa     81960
     aaagagtctt cgccaaggta accaggaccc ggcgattccg gctatacgtg gtcgtttgca     82020
     gagtctgggg tatgctgtgc catcaacagg tgatatttat gatgccgagc taaagcgtgt     82080
     gatcgaggat gttcaaggcg taaatggtat gggcgtcgat ggtgttatcg ggaatgaggt     82140
     aatgaccttc ctgaatacgt ctgtggcgga ccgcgtattc caacttgaag tgaacatgga     82200
     aaaacttcgt tggttgccaa aggctatgga atcccgtcat gtattcgtga atctggcaac     82260
     gacagagttc cagttctttg atgaaggccg caagatcatg catttcaaaa caatcaatgg     82320
     tcaaagctac agacgtactc cagtgctgag aaatatgttg agcttcgtag aactgaatcc     82380
     gacgtggact gctccagagt caattatctt taaagacaag ataaatacgc tgcgaggcaa     82440
     ggatggtcag gagtatttga gaaagcaccg catgcgactc ataagaaaat cagatggtaa     82500
     agaggtaatt ccatcagacg aactgttaca aagtctttct cgcagcaatt ttccatacct     82560
     attgcgccaa gatccttgga gaaagaatgc tttgggttct atcaagtttc cattgccaaa     82620
     tgaatggtcc atttatttgc atcatacgga taatccagat ctgtttgatg agagcaagag     82680
     acacttaagt tcagggtgcg ttcgcctgga agatccattc acttttgctg agtatatctt     82740
     gcgtaacaac gtggcggtca agtcaacgca gacagatgac tactggccca aggataaact     82800
     ggagtccttt gtgccgccgg aaaagtcaga agcttatgtc gatcgtgaaa actgggaaaa     82860
     gcgcattcac ttgaaggtgc cagttccagt ttacctgatg tatctgacgg tggatcgcgc     82920
     ccaagacggt gcggtgagat tcgtgaaaga cgtctatggt caggacgagc gtgtggcaaa     82980
     aacaatgaaa gcagtgagac atggcaatga actattctaa aggagccatg aatatgaaaa     83040
     agcagctttg gacagtattg tctgtgatgt tgtttgctgg ttcagcctgg gctcaggcta     83100
     tgggatcgct ggcagtgaat ggtgtggggg gcgaaaatca gggcttccgc aaagtgaagg     83160
     ccgttcggtg cgacacaacc aagcgtggca gttgcgataa ccctgtgttc tttgatttga     83220
     ataagccgac tgcagttccg gctggcatgt atatcgtcgg ctttgagaat tcgatcaatc     83280
     ccgacctggt ggaggtccgt caaggatcga cgacgacttt gcaattggag agaatcgata     83340
     ttcctgtgaa catgagagat caaaaagtcc gtgtctatcg tgatatgtct aagctggttg     83400
     agcagcagaa gatctacatg acaatgttct atatgaaacg tcatttcttc ttcctggata     83460
     aagataactt cggtgatctt tatcttgcgg gtgcttggga gcgtgacttt gttcagcgtt     83520
     ttacctacga agcttgcgat aatgttcaag acggtgatga tgctcccgca tcagttaagc     83580
     gggctgtgaa gatttgtgag gcttggggcg cagcaagatc ccccaaggat cttagaagtc     83640
     tgttcaattt caacgtggtt gaacaacaga aggatggctc attcgatcag atatgggtgt     83700
     ctgcaccttc ggactcactt gttatgaggc atcctccata tttggttgct gtacctttga     83760
     agaactcgac cttcgtgtcc gtcttccccg gcgcgtatcg cattaacgtc gaaggcaaag     83820
     atgctaatgg gaaaacaatc aaaaacgtct caattgaagt cggaaactac tccaaatccg     83880
     gcagtacttt gggtttttca ttgaacgtgg atggcctttt cactaaccta ggtgaagggg     83940
     attgcgcatc ggcacgtaca tgggaaactg aatcccgtgc gtattgcacg agtgatgatc     84000
     aggaaggttg cgaccgttct gccgcatcaa gctgcactcc catgtaatgg gaaaagggaa     84060
     tgcataaaat tgttgtaagt ttattgtttg tttttgggcc tcactttgcg ggggctcaag     84120
     gcataaaacc agtctctgtt tcgtatgaaa acctcatgcg atgcttcccc gagcttcaag     84180
     atgaaaagct gtcattcaag gtcgacctca accgactgaa ggacatcatg gacgaaaagt     84240
     tcgtgacctc ccaatcgcag ctgcgtcaaa gaaagatcca ctatctgaac gctgacaaag     84300
     agctgatgaa cctgatcctg cgaaccaagt ttgccggggc caagaaggtc gaaactgaac     84360
     ttattttgca gcaagtcgac gaaaagggtg tcatcaccga tatcaagctg acaaacaatc     84420
     agcgtctgaa tccaaaccag gacacgatca acaacttcct gctcaatgga gtgattaaat     84480
     cagacgaata ctcctataat gacacgaagc ttaataatgt gatctcgacc taccgccgga     84540
     actttaaaga gatccaggag attgacctga acgaccggga aggcaaacgc tccgtccact     84600
     gtgaaaacca gaaggatctc ggcattatat gcacctgttc taaaaaataa atctgttgaa     84660
     tatcgacctt ttagatatat acttttcctt gtgttgatct aggatttttc tagagtttta     84720
     aaaggtttag gcattcgagg tcgaaaagtt cgaaagactt ccagacccat agattctgca     84780
     gctgttgagg tgctagtgac atctgagaaa aaaacctaca atttcctaat tgcgggtgtc     84840
     ccttacaaat taaaaacctc tcatgacgac gcgactgttg aagagctcgt tgaatttgta     84900
     aattccagaa tgaatcaagc ccttggtgtc accaagaatg gctcctatca gaatgcagcc     84960
     gtgctgacgg cgatgaatct tgctgaagaa cttattctat tgaaacgcaa agcccaccgc     85020
     gagttggaaa aacttgaaga gaaggccttg caactttcaa tggatctgga aaattccaag     85080
     agcaacaagg ttttgaacaa ctgactttgt tttgatttct tggagtgtcc atgccagttt     85140
     cctggagctc taaaaaggac tgccggtcct tctttaaatc tctttgtgcc caagagtttg     85200
     cacaaggtct agttcaacaa caacagcagc tcgacgccca tctgcgtgat tttatgaaat     85260
     cacagacggg ggtttgggga gcctaccggg ccttgcccga agaggctcag gtcgaagagg     85320
     tgtttcacat ccttcacctg aaatgggcct tccccaaaat gcgcgagggt cttttggaat     85380
     tctatgagac ccgggatttc gatctcgggc cctacggagt gcgggaacca aaacccggct     85440
     ctttccaaag atccctggcc gaaatgtccg gtctgctggt tcccggtttg gtttttaata     85500
     agaatggcaa tcgcctcggt aaaggaaaag ggttttacga taaaaccttg aaatccttcc     85560
     cgggggtgaa agtcggaata ggctttgatt ttcaagtcac tgccgatccg cttcccaccg     85620
     agcctcatga tgtgaaaatg gatttcctca tcacagaatc aggactggtc gattgcaaga     85680
     agcatcagga gtaaatgaat catggagatc gtaatcagcg ccattatcgg cctgctcatc     85740
     ggtggaacag tcgtcttcgt tattaaacgt ctgcaggaca acaacaaaaa gaaatctgca     85800
     cgtttcgaag cagaacgcat cgtcaacaaa gccaactcgg aagcggctaa aatcaaaaaa     85860
     gagtccgaaa acaaagccaa ggatttcgaa tcccgcgccc gcaagaatgt cgagcaggac     85920
     attcacaaac aaaaatccac tttgaaaaac aaagagtccc agctggagcg ccgtttgaaa     85980
     gaggtcgaag accagttcaa acaaaagatg gaagaaaacg agcgctatct gaactctttg     86040
     aaagaccgcg aggaaaaaat cgcgatctct gaaaaccgca tcaaagatct tgagaaaaaa     86100
     ggcgaggctc acattgggga gctgaagcaa aagcttgagt ccgtagccgc catgagccag     86160
     gacgaagcgc gccgccagtt gctgacagct ttggaagacg aagcgaaaca ggaagcagcg     86220
     aagaaaatcg cccagatcga agaagaagca aacaaagaat ccgagaaaaa agccaagcgc     86280
     attctggcaa cagctttgtc ccgctttgct tccgagtaca cgtctgaaag aactgtcagc     86340
     gttctggctc tgccaaacga cgagatgaag ggtaaaatca tcggccgtga aggtcgtaac     86400
     atccgcacgt tggaagccca ctgcggtgtg gatctgatcg ttgatgacac gccagaagca     86460
     gttgtgattt ccggtttcga tccggttcgc cgtgaactgg ctcgtcgtac catcgaaaag     86520
     ctgatggaag acggtcgtgt tcacccggca cgtatcgaag aagttgccga aaagcagcgc     86580
     aacgaactga tgaaatccat gaaagaggaa ggcgagcgcc acgtgatgga gctgggcatt     86640
     ccgaacatgc accctgaact ggtgaaaatc atcggtggtt tgaaataccg ttcttaccag     86700
     gggcaaaatg ccttgaatca gtctttggaa gtggcgacga ttgccggtct tctggcggct     86760
     gaactgggtg tcagcgtgaa gctggctcgc cgtgcaggtc ttttgcacaa tatcggtaaa     86820
     gcgatcgatc acaccgtgga aggcagctat gctttcgtgg gtgctgaagc cgctaagaaa     86880
     tacaatgaat ccgaagatgt ttgtcatgcg atccgcgccc acgatgaaga ggaaaaacct     86940
     cactccatcc tggcttggat tgttcatgca gcttacactc tttccagctc tcgtccgggc     87000
     gcacgtcgtc cacagatgga taccttcatc catcgtttgg aagacctgga aagcatcggc     87060
     aacagcttcg acggcgtttt gaaaacattg gccctgcaag ccggtaaaga catccgcgtg     87120
     ttggttgaat ccagccgtgt gaccgatgat caggccgtga tgttgtcccg tgatatcgct     87180
     cgtaagatcg aacgcgagat gcctcaggcc ggtcaggtga aagtcactgt ggttcgtgaa     87240
     acccgttctg tggagcatgc aagatgatga gtcctcagga gcagctggaa agaatcaaat     87300
     tcggcacggc cgacttcatc aatgacgagg acatgcttaa aaaacttaag cgctcgatcg     87360
     agacgaagaa acctttgaat atcaaactgg gtgcagatcc aacacgtccg gacatccatc     87420
     tgggccacac cgttgtgatc aacaaactga aaaccttcca ggatctgggg cacaaggtgt     87480
     ccttcctgat cggcgatttc acagcgatga tcggggaccc ctccggtaaa aacagcacgc     87540
     gtccgatgct gactcgcgaa gagatcgagg aaaacggccg ctcttacgca aaacaaatct     87600
     tcaagattct ggatccggaa aaaaccgaga tcgtgtataa ctccagctgg atcatgaaaa     87660
     tgacaccggc ggaattcatc accatgactt ccaagtacac cgtggctcag ttgctagagc     87720
     gcgaggactt caccaaacgt tacagatccg gcactccaat cggtattcac gaattcatct     87780
     atcctttgac tcaaggttac gattccgtgg ctttgaaaac ggatgtcgag ctgggtggga     87840
     cggatcagaa gttcaatctt ctggtcggtc gtgcgatgca ggccgcttac ggaatggaag     87900
     cacagtgtgt gctgaccatg ccgattctgg aaggtatcga cggcgtgaac aagatgtcca     87960
     agtctttgga caactatatt tctgtagtgg atactccaaa agacatgttc ggaaaaacta     88020
     tgagaatttc cgacgagctg atgtaccgct ggtacgagct tttgactgac gtcggtgctg     88080
     ctggtttgaa tcagctgcgt gcggatgtgg ccgaaggccg caagcacccg cgcacagtga     88140
     aagtggagct ggcaaaattc cttattaaac gtttccattc ccaggctgaa gcgcaagcgg     88200
     cggaagacga gttcaaccgc atcttcgtgg aaaaaggtct gccggatgaa gtgcctgact     88260
     ttgaagtcga agccgagacc caaatggggc tggcggcatt gatggtgaaa gcccagctgg     88320
     cggcttccaa cagtgaagcc ggtcgcctga tccagggtgg aggtgttcag attgacggcg     88380
     agaaggtttc cgaccctcgt ttgaaaatcg acctgaagtc cggagcaagc ttcgtgctga     88440
     aagccggtaa aaagaaattc gttaagattg ttgttaagta gtcagaactg atcggggatc     88500
     cgagttatga aaatcaaatt tcttccgcag aatatcgaag tcgaaggaac tcctgacaag     88560
     agccttttgc agattgcaac ggagaacaaa ctggaaatcc gatccatctg caaaggtgtt     88620
     ccatcctgtg cggaatgccg ggtgcgtatc gccgagggcg agtccaacac tctgcccccg     88680
     acgaaagccg agttgagcct gatcggaacg agtcacttta ttgatggccg ccgtttgagc     88740
     tgccaggttc gttgttatgg cgatgtcacc gtggatctga ctgaacaggt tcaaaagagt     88800
     gaaaacaaag tcaaaaaaat caggggcttc cgcgccaaca aacaggttga atccaaggcc     88860
     gtcaacgaca cgatgctttt gactgaaaag ccggaagacc gtccacagca tcagcaggca     88920
     gaccgcagtg ctgactcagc tgaaatttct tctgagatgg ccgctgaagg tgaggcgaca     88980
     gagcaatctc aaagtcagcc aaagcaacag cagcagcaac aacaaaagca gcgtcagcag     89040
     caacagaacc gcccgcagca gcaaaagcag cagggtggtg gcggtggcaa tcgcaaccag     89100
     cagcagaatc aaaagcaagg tcagcagaaa caaggcggcc agcaacagaa gcagggccag     89160
     caaaaacagg ggcagccgaa gcagcagcaa aatcaaaagc cgcagcaaca gcagaaccag     89220
     aatcgcaatc agaatcaaaa tcgcaatcag cagcagggcc agaagccccc gcagaatcag     89280
     cagccaaagc cggaccgtaa ggacgatcaa taatccacgc ggtctggacc tgtgggcagt     89340
     gtcctgtaaa cagatcttta ccgataagtt tcaaggatgt cacacaagat cactttccgg     89400
     gaacggggac aagggccact gctaatactt cttcatggtt atggaggaag tgttcaccat     89460
     tgggaatcca tcgcggaaac cctgtcggct cattaccgtg tgatcgttcc taatctaagc     89520
     cacatctaca tgagcagcga taagctgttc tttactgtgc aaatcgaagc cgtcgccaag     89580
     tttatccgtg aaaacttccc gggtgaaaag gtcagtcttg caggtttaag ttacggtggc     89640
     gctttgtcct ggggcctggc cacgcagcat ccggatctgg ttgaaaaaac tgttttgatc     89700
     aatccgatgg tgaccgatcc tattcgccac ttcctgccta aagaattgaa attctttttc     89760
     gccattccgc tcaacttaaa aagtgtctat gtgatgcttt caactccgat ggggcgggcg     89820
     ttcctgaagc gttcggcgca gatcttccgc gatgagcgca gtgaaggggt ggtttcggtg     89880
     gaaacactca aaggccgcaa gctgcagttt gtggcgcaca tgattcatca ttttgcctgg     89940
     atcctgcgtt ccgaggactg ggcttactgg cacacgcgtt tgtacgctta ccgcggtgaa     90000
     tgccggttga tctttgatga aaaggatctg ctttttgatc agacggccta tcgtcatttt     90060
     gccaaccata tcggctgtga ggatgttgtg attttgacgg gtgcggggca cctggcaatt     90120
     aaaacgcaac ccgaagaaat ctcccgtctc atacgtgagt ttttaagcga atccgtcgca     90180
     gcttaagatc agattctatt ttgaccgaaa aagaaaaagg gagtcgtgaa gactcccttt     90240
     tttgtttttg catgtaagga taaaactaaa cgttgaagct ggaaccgcag ccgcagtgtt     90300
     tgttggcgtt cgggttgttg aacacaaacc ctttaccatt caagccgccg gagtattcca     90360
     gggtcatacc cagcagatag agcatgcttt gagagtccac ggccactttt tggccctggg     90420
     attcaaagaa cttgtctccg tcacgagtca cggtatcgaa atccattttg taagacaggc     90480
     ctgaacagcc gccttttttc acctcaacgc gcagaaaagc cgcgtcgtct tttccttcat     90540
     ctttttttag ggaagccagt ttagttgctg cttcaggtga aatagtgatc atagaaagct     90600
     cctttaacgt cgcagccagt ataacacagc tgtcaagggc tggggagccc cggatagacc     90660
     ctccggggag attgttcaaa ttattgtatt tactagctat ttttgaatag cctgcttcag     90720
     gatctgagcc gcacggctta attcgtcctg agtcgtccag cggcccaggc tcaggcgcag     90780
     ggagcattgg acttcctcgg tgctcagtcc caggccttta agaacgtggc tgaccaccat     90840
     cgcaccggtg ccgcaggctg agcccgtgct cacacccagt ttctgcaatc gaggcaggat     90900
     ctgttcggtt ttgattcccg gcaaggtgat gttcaagttc gccggggacc tgtccgtcgg     90960
     gtgaccgttc agttttacac ccgggatgtt ttgctgaagt tcagaccaca ggaaatcacg     91020
     caggtctttc atgtgctgca cttctgcggt gaagttttgc tggcaaagct cgcaagccgt     91080
     tccgaagcca accaccgctg gcacattgac ggtgccagag cgaagaccac gttcttgacc     91140
     gccaccataa atcaatggat tcagttgaac cttcggatct tttccgcgga tgtaaagagc     91200
     gcccacacct ttggggccat agattttgtg acccgagaaa gacatcagat caatgcccat     91260
     ttcagtcaca ttcaccggga ttttgccgac agcctgagtg gcgtctgtgt gcagatagat     91320
     ttgtttttct ttgcaaagag cggcgatttc cggaatcggg ttgatggatc cgatttcgtt     91380
     gttcacccag ataaagctca tcagtttcgt gtgtggtttg attgccgctt tcaccgcttc     91440
     aagttcaacc acaccgaatt tattcaccgg caggaagtcc acttccacac ccattttctg     91500
     agcggcggcc atgcccttca tgatcgagct gtgctcgatg ttgctggtga taaaatgaat     91560
     cggggcttcc ggattttctt cacgcagttt cgaaatcagc ccgaagatca cccagttgtt     91620
     ggattcggtg gcgccaccag tgaaagtgac ctccatgctc ttgcagccga tgaagctggc     91680
     gacttgggtg cgggccttgg caactgcatt ttccgcgatc cagccccagt gatgaccggc     91740
     gctggctggg ttgccgaaga attctttgaa gtagggctcc atcgtggaat aaacacgcgg     91800
     gtccaccggt gtggttgcgt tgtaatcaag atagatgccg gtgtcctgct gcaaagtctt     91860
     tcccatcggg cgttcggtgc tcgtttccat aatgcctatg agctaaacct tgcccgggcg     91920
     ccgggtcaac gaaaaacgcc gggaggcgtc tttaggcaac gactttgtct ttctgttttg     91980
     cctcaaaatc atggattttt tcgttcagga agttctgggc gcggtatttg tccagatcct     92040
     ggatatcggc cttcaagata tgcaggttgg aaataccctg gttttgcaga cgttgctttt     92100
     gaacatcgaa aaactttgat ccacggggcg tatataggac gtacttgtta ttttttggaa     92160
     gataaatata aacgttgaat tccacggcca catcgcccgc cagttcgttc aggtgaatgc     92220
     tggccatttc ttcgtccgcg gaatctccga aggtggtttt gatgtcctgg cgcgggaaga     92280
     aggccatggc aacctcgttg ccttcgtgca cagatttgcg caggaactcg gcctgttcca     92340
     gtgcccactc ttcaaatggc acttccttga tgttcagctg cattgattcg ctgtcctcaa     92400
     ttttctcacc attttccttc agaaagcgga acaggcgttc acggactttt cgcagaaaag     92460
     catcgtccag cttgcggtct ttgcccatgg cggtgatcaa atagccggaa aagcgggtgg     92520
     actcaatcac gatgcaggaa atgttggtgg agttttcgat ggcctcggat tctgcaaagc     92580
     tggttttaat gcaggatttt tccagtgcgt ctttggttcc gcgcaggatg atggagtctt     92640
     ttttcgccga caggggattg tcttcaatct gctctggtgt cggacgttcc ttgcggcggg     92700
     ttgtggtggg catcggcgcc cagcctgctg ccgctttgtt ggctgcgttc tgccgcatca     92760
     gcatcgcatt gagcgtttcg tcactttcat cgataccgga acccatgctg ttcccggcac     92820
     cgtgcccttg ttgggcccag cccggcccca ggccgttgtt ttggccggac ggttgcatca     92880
     gccccagatt cagttctgag ttggttccag gcatatatcc gatattggat ttgttttgct     92940
     ggccgccggc agagattgaa gagtcggtgg tgtggccgcc agaaaactga ttgctgccgt     93000
     catccccccc aagcagctgc tgtaatatgc tttgtgcatt ctgggaagac agggtgccac     93060
     cctcaccttt gatggcaatg acactgccgt cttcggcggt gctggagcca gtgcgctgaa     93120
     acggattggt gacacctttg gcctgctggt ctttatagaa cttgttgacg gttctttcca     93180
     cggcggggcc tgtgatcgga ggatacagga cgtactcgct gttgctggtg ttgagcatgt     93240
     tgaaactggc tgcggaattt tcttcagcga aaacaatcac gcacaccgga aaagcctgtg     93300
     ccagaatctt gggcaggttt cgtactttgc ggttggggtg atcgatgctg accatcacaa     93360
     actgcggctg ctcctgaacc aaaaagatca gggcctcttt caaattggtc gtggacttga     93420
     tggtccagtc gcggttcttt agaaagccct cgacggttcc caggcttgtc ggcttggatt     93480
     tgatgatgag gagctttttc ttgatcgagt cttgactcat tccccacgtc ctttgaaacg     93540
     tactcatgtt tttcttaacg gaacgttgtc gctaacaaac aagagtttgg ggttacagcg     93600
     cggttagatt gccgaggctt aacagaacac aggcccttgg gccatgcttg tatcgcacat     93660
     ctgtactgtc caaatcgtgg gcttggctca gaaggaaaga atctctagac tgaatgtatg     93720
     aaaaaacaaa ctctgcacag cccgtcgtac tttgtttctg gaggcaaaaa tccagagagt     93780
     cttttcgcct ggaaaaatgt gaattgcgaa attcgcaacc gcaagggcga agtgtttttc     93840
     gaaatgaaga atgtggaggc acccgagggc tggtcccaat tggcaattga tattgccgcc     93900
     agcaagtact ttagaaaagt cggtgttccc aagaccgggc atgagacttc ggttcgtcag     93960
     atggtggacc gggtggtgaa ggcgattgtg gcctctgcga ttcgccaggg gggatacttt     94020
     gccacgcgca aagaggccga catctttgcc aaagaattga agttcattct gctgtcccag     94080
     cggggcgcgt tcaacagccc ggtgtggttc aatgccggtt tgtgggaggc ttacaaagca     94140
     caaagcccca gtgaacattt cgcctgggac gaaaaaaaga aatccattca ggccaccaaa     94200
     aatgcctatg agcggccgca gtgttcagcg tgtttcattc aaagtgtcga tgacagtatc     94260
     gagagcatct ttgatctggc caaaactgaa gccaagcttt tcaaatatgg ttcgggcacg     94320
     ggcagcaact tctcaaaaat tcgcagcaag tacgaggcca ccggatcggg cggaaaaagt     94380
     tcgggcctga tttccttttt ggaggttctg gacaagggcg cgggtgcgat caaatccggc     94440
     gggaccaccc gccgggccgc caagatggtg gtggtggaca tagatcaccc cgaggttctg     94500
     gatttcattg actggaaaat gcgcgaagag caaaaggcgc atctgctgat tgccgcagga     94560
     ctcagtgcgg atttcgaggg cgaggcctat cgcacggtat ccgggcagaa cgccaacaac     94620
     tcggtccggg tcagcgatgc cttcatgaaa gcggtggaac aagagcgacc gtggaagctc     94680
     aaggcgcgtt tgaccggaaa agtcttgcgt gaaattccag ccggcgaagt ctggaaccgt     94740
     atcacacgcg cggcgtggat gtgcgcggat cccggcattc agttccatga caccatcaac     94800
     aagtggcaca catgtcctga gacagacatc attcattcca gcaacccgtg ttctgaatac     94860
     atgttcctgg atgattccgc ctgcaatctg gcttccatca acctggtgaa gttcttaaac     94920
     gacaccggag actttgattt tgaatccttt attcatacgg cccgcacgct gtttgtggcg     94980
     caggaaattc tggtggacta ttccagctat ccaacccaaa gagttgcgca gaattcccat     95040
     gactatcgtc ctctggggtt gggctttgcc aatctgggca gcctcctgat gcgaaagggc     95100
     gtagcctatg acagcgacga gggccgcgcg tgggcggggg ctttgacatc gttgatgtcg     95160
     ggggtggctt atctgaccag ttccgagatg gcccgggcca aggggccgtt tgcgggatat     95220
     cgcaaaaaca gcaaatcgat gctgaaagtg atgaagatgc acgagcgtgc cctgaatcag     95280
     gtggcgtgga agatgcttcc cgccggcata gacaaggccg tccggaattt atggaagggc     95340
     gtcttgtaca acggcgaaaa gtacggctat cgaaacgctc aagccacggt gatcgcaccg     95400
     accgggacta tcggactttt gatggattgt gacaccaccg ggattgagcc ggacttttct     95460
     ttgatcaagt tcaagaaact ggtcggcggt ggcgaaattc agattgtgaa ccagtccgtg     95520
     gacgcggctt tggcgtccct gcaatacttc gaagacgaac gtcaggcgat tttgaaatat     95580
     gtcgaagaaa acaactcggt cgtgggcgct ccgcaaatgc acccggaaga cctgccggtc     95640
     tttgacaccg ccacggcaat gccaggccag cgggttttgt ccccggaaag tcatgtgaag     95700
     atgatggcgg cagtgcagcc gtttatcagc ggggccatct ccaaaaccgt gaacatgcca     95760
     agcacggcca ccgaagagga catcagccgc atttacttcc tggcctggaa gctgggggtg     95820
     aaggccgtgg cggtgtaccg cgatggcagc aaacaaagcc agcctctgaa cctgaaggaa     95880
     aagcccaaag tggtggagga agtcggtgtt ccgaatttca ctatgaaatg cccggaatgc     95940
     gggagtgaca cagtgcttac gagcggctgt tacagatgtc caaactgcgg cacgacggtg     96000
     ggttgttcct aaagacttga agggcaactc gctgcggcgg tgctggtcaa agtttggtgg     96060
     gacctttatc ctctctgttc tctttaacta aggactgctt tatgtctaaa aaagatattt     96120
     ttggtgatga tattaacgag acaaaagact tcgcaagttt cgaagaactt tttgctcaat     96180
     ctgaaaaagg gatgaagacc aaactttccg tgggcgatca ggttcatggc gagatccttt     96240
     ccatcggtaa agaagaggcc tttgtggcca cgggcactcc gacagacggc atgatcctga     96300
     ccaaggatct tttggatgaa aacaaagaag taaaatacaa agtcggcgat tacatcgact     96360
     gcgttgtgac ttccatcaaa ggtggcgaag ttcgtctggc gaaaaaaggc tcgatgaatg     96420
     cttccacaga ttctttggaa gacgctttcg acatggaact tccggtggaa ggccgtgtga     96480
     ctgaaacctg caatggcggt ttccgcgtga gcatccaggg taaaacggcg ttctgcccaa     96540
     tcagccagat cgacagccgc tttgttcagg atgccaatga atacgttggt aaaaaattcg     96600
     acttcatgat cactcagctg gatccaaaag ggcgcaacat cgttgtctcc cgccgcaagg     96660
     ttctggatct gcaaaaagct gaaaacgaag gtacgttcat gctgaaacat cagccgggcg     96720
     ctttgctgga aggcaagatc gttcgtctgg aaaaattcgg tgcgttcgtg gagctggaag     96780
     caggcatcga aggtctgatc cacgtttctg aactttcctg gtcccgcgtt catgacccta     96840
     aagaagtggt gatggccggt cagccagtga cagtgaaact gatcaaaatg gaagaagtcg     96900
     acggacgtct gaaaatttct ttgtccctga aacaggctga cggcgctggc aatccttgga     96960
     tgacagttcc gcagaaattc ccagtgggca ccgtggtgca ggggaaagtg gaaaagaaag     97020
     aaacatacgg tctgttcgta aacatcgctc cgggtgtgac gggtcttttg cctcgctcta     97080
     aatggcgtga ttccgtggat gccgctcaat acgaaaacaa aaagcgcggg gacgatgtga     97140
     ctgttcaggt ggatcagatc atgtttgaag aaaagaagat ttctttggct ttgcctggtg     97200
     aagctgaaga tcacagctgg aaatcccact ccacaacctc ttccgggttg ggggcgatgg     97260
     cagaggcttt gaagggcctt aacatcaaga agaactagtt gtttcatttt gatattctga     97320
     agttgtcaaa agccctttgg gtctaaaccc aaggggcttt tttttgtggc tactttagtt     97380
     tggaaaacag tttttcatca tttttccggt taatcctcaa taaaactgtt ccacgagccg     97440
     ataagtgtgt cagaagcgaa cccatttgaa cgtctatcgg ggtcaaggaa tcatgaacag     97500
     caatgtcgtg tcttatattg agacaaaaat tcaggaatat gccgccgaac ggtggttgtt     97560
     tcagaacttc aaatttgaag gcctgaagct gcgtccgctg gaacagcgca agtacttcga     97620
     ctttggggtg attgaggtgt gtttgaactc caacggcagt attgatattg ccggggactt     97680
     ctatcgcaac tccatcacac cgaaagaata caactccatc caggacgcct gcgcgatggt     97740
     gtatgatcat cttcgttatg ccgatcagaa ctatcgccgt ctggtgcagg cccctgaaga     97800
     ctggacaaaa aaaagcttct tcagcaagat cttctccggc tttaaaaaag ccggctgatc     97860
     acagattgcg aagccagaaa atcagcgcca tctcggcaaa gtactgatga cggcgctctt     97920
     tcatattcgc cgacttgtaa gggctggtga taaagtcctt caccttgcgg cccttgtatt     97980
     ccagactgac ttcgcagctg tgttcatcct tggggaaaat atgcaagtgc agcccggcag     98040
     ggcttttcac ctcgcgggac tttgaaaaac tccacatttg atccgtcata aatccacgca     98100
     gcaccggcat caggcggttc atcaaaaact gtccggtgac ttcatcaatc acacaaagtg     98160
     agtgaacctg ctttagcttt tcggcaaaga tttccgcggc gtcttcgccg tcgcgggcca     98220
     gggtgcaaaa ctgcagggct tcggtcagac gggcaaaggc gggttccaga ccggcttctt     98280
     cactgcgata gtaagaggct ttcacctcca catagggaag atgcacacgg tacccaatat     98340
     ccacgtggat gcctttcaga gcttcttcca cgatcaaggc cacatcggat tcgcccacgc     98400
     caagagtgtc ccattttcgg gtcaggtaag gatccagttt gcgggcttcg ctttgcagcc     98460
     actctttgat gtttgcaccc caaacggcct cgatctcgcg gggaggtccg ggcaggacaa     98520
     aaactttttt cccgtgtgct tcaagagaaa agccgttggc ggtgccttcg gcatttgcca     98580
     ggatggtggc accttccgga aaaagcactg ttggcgctga atctctttca ccacgtatcc     98640
     gcgtgacgtc aggcggtcgt tgacgtgttg ccagcttttt tcatcgaacg tcagtttttt     98700
     gccggcccag tccgccacca catcccgggt gaagtcatcc gaggtcgggc ccaggccccc     98760
     ggtgataaaa atcaaatcgg ctttggcggc gcaaaactcg atcccctcca gcatcagggg     98820
     gcgttcatcc ggaaccacca ggtgtgcctt ggtggtcatt cccagatctt tgagtttttt     98880
     ggaaatccag gaggcatttt tgtttactat ctgaccgtcg gtcagctcgg ttccaatgcc     98940
     caatacagcg gctttcatat tctgcggtct ccctcgaaga aatttaaggt attccacccc     99000
     cggatttgcg tccagaacca atgccgggcc ccttgttaaa tggcacagat gcgacgcatt     99060
     attgtggtca aaaccttgcc ccgaaggcag tcactacata gattcaccag actgtactgc     99120
     acctttaagg agtcctaata tgtctttcaa ttggaaagaa ttcgatctgt acaatccaac     99180
     ccctgaacac gcaatgttgc gtgaaacttt gaagtctttc actgaggctg aaatcgagcc     99240
     gcaagcgcac gaacatgatc gcagtgaaaa gttcaatctg gagttgttcc gtaaagtggg     99300
     tgagttgggt ctgttgggaa tcaccgttcc tgagcagttc ggcggtgcag ggatggatgc     99360
     cacagcggcg accatcgttc atgaagagtt ttctgccgcg gatccgggtt tctgcctggc     99420
     gtatctggcg cactccatgc tttgcgtgaa caacattgct gtgaacggca gtgatgaaca     99480
     gcgccaccgt attttaccaa agctttgctc tggtgagtgg gtgggctcca tggcgatgtc     99540
     agagcctgct atcggaaccg acgttctggg catgcagacg accgcagtaa aaaaaggtga     99600
     tgaatacatc atcaacggcc gtaagatgtg gatcaccaac ggtaccatcg atgaaaacaa     99660
     cactccttgt gacctggttc tggtctatgc ccgcactggt gaaaaacacg ggcgtgcttt     99720
     gatctccact ttcctggttg aaaaagatca caaaggtttc gctgtcggtc agaagatcaa     99780
     agacaagctg ggcatgcgtg gttccaacac cgcagaactt gtgttccagg actgtcacgt     99840
     tccggcaagt gcactgatcg gccacgaagg tgactccatg ttgcacatga tgcgcaatct     99900
     tgaaatcgag cgcctgacac tggctgcgat gagtttgggt attgcccgtc gttctattga     99960
     aatcatgaac cgttacgcga ccgagcgtga ggctttcggc aaatccttga atcacttcgg    100020
     tcagatgcag cgttatatcg cggattccta tgctgaatac aaagcggctc gtgcgtatgt    100080
     ttacgaaaca gctcgccgta tggatttgaa caaagaaggc aaccgtctgg attctgacgg    100140
     tgtgaaactt gtggcaacca cgatggcgaa aaacgtggca gaccgtgcga ttcaggttct    100200
     gggtggttac ggctacgtgg gcgaatacgt ggtggaaaga ctttggagag acgcgaagtt    100260
     gcttgagatc ggtggcggta ctttggaggc ccaccagaag aacatcactc gcgacctggc    100320
     aaaaaatccg gaagctcttt acaaatagtc cagtctacag aggtcagaat gttcccatat    100380
     gggcccgaac ttgaaatcaa tgccaatctt cgcgtgaact accagctggt gctggagaag    100440
     atcgggcccc tgctgactga tgaacgccgc cagaagatcg aaaaagtggt ggcgcttcgc    100500
     aattttgaca cggccgtggt gcttgagggc atctatgacc gtggcaatat ctccgccgtg    100560
     atgagatctg ccgagggtct tggctttggc aatttccacg tcattgaaac ccaggaaaaa    100620
     ttcaaagaag ccaaccgggt cacccaaggg gctgacaaat gggtcgaagt taaaaaatgg    100680
     aaaaagactg cggactgtgt gaaggctttg aaaaatcagg gttacaaaat ctatgtgact    100740
     catttggatg cgaacgccaa acctctgcat gagattgatt tcagcggtaa gacagccctg    100800
     gtgcttggta acgagcgtga cggtgtgacc cctgaaatga ttgcggccgc agatcaaacg    100860
     atcatcattc ccatgacggg ctttgtgcaa agcttcaata tttccgtggc cggggctctg    100920
     gggctttatc atatttccca ggaccgcttg aaacgccgtg gaaccaacgc gtccctgacg    100980
     gaagaagagc aggggatctt gcgggctcac tattacatga gaacccagga cagcgcagcc    101040
     cagtatctgg aagagatgtt ttcccggggc actcttaaat cctgacttca aacttgtgtc    101100
     gccctttaat ttccaataac cttattggaa agaaagggga ccccgatgaa gaaactgctt    101160
     ttgcttcccg ttctgtttgc ggtcgctgcc tgtgcgcaaa aatccgtaag cctcactccg    101220
     gataaaccag tcagcaccaa aattcctttt tttatgacaa ggcctcagcc gacaactccg    101280
     gtagagctgg tgtttgataa agaccatgca gcgccaaagc ccatgaatta tcgcaagagc    101340
     gattctttgc gcatgtccgg cagtgccacc ttcagcccga aggcgctgaa agaagtcgct    101400
     aagcccgtta aaaagaacaa ggcctctctg tacgtctttg acctgcgcca ggaatcccac    101460
     ggtctgatca atgacatccc ggtgacctgg tacgcggacc gcgactgggc caatgccgat    101520
     ctaaatcatg aagaggccgt tcgccgcgaa cgccgtttgt tgggcgatct gcgtgtcggg    101580
     gataagattg gcaccaccgc cattcaaagc atcgaaactg aagaaagcat gatccgcacc    101640
     ggaggacacc agtatgtgcg tctgacggtg accgatcatg tgcgtccggt ggattctgaa    101700
     gtggatcgtt ttattgaaag cgtgcgtgcg cttccagaaa atgcctgggt gcattttcac    101760
     tgtcgtgccg gcaagggccg tacgacgaca ttcatggttt tgtacgacat gctgaaaaat    101820
     gcgaagactg attcgtttga ggaaatcatc aaacgcaata ccgagctgag taatgactat    101880
     gacgtgctga cggtgccagc cgatgaaaag gactggaagt atccttatca gaaagagcgt    101940
     gcggcattcg ttactgagtt ctataattat gccaaagccc atccaaatgg agagggcatg    102000
     ctttggggtg agtgggtgtt aagatgaagt atttgatgat tgtggctgtg gctctggtgt    102060
     tatcagcctg tgcgaccaag aaaaccaaag acctggattt tgatgatctg ccggctgaaa    102120
     agaagaccgc agcaaagtcg tccaagtcag acaaagcccc caaggctgac gcaagcccgg    102180
     cggaaatggc ccgcaattcc ggaattgtgg tggacccgca ggaactggcg ctgttggatc    102240
     gtatgaccaa ggcggtggag ctttatgtgc acaaagggaa caaaaaggaa ttcaacactc    102300
     tttgcaaaga caagcgcttt gattgtttcg tgaatgacaa attccacccg gctaaaaaga    102360
     agaaaaccgc acgcggaatt cctccctatg ccagcggctc taaaatgggc ctgcaagggg    102420
     aagaacgcat tcagcttcgc tacgagtttt atccttagtt ttttcttaag atgatggact    102480
     tcatcagggg ctcctgatcc gggagctcaa agtccagccc ttgtgccgga gccggcagaa    102540
     tcttgaatga aaaatctttt ttcagtttgt tcaggcgcag gtgcagatcc cctgtcgtcc    102600
     atttctcgta attggtgcag aacaacagca gaccgtcttt ttgcaggcag tacatgcagt    102660
     tgatcagaag ctcatcaaag ttcttgctga tggagaagac cccgtttttg gatctgccga    102720
     aagagggcgg atcacagacg atcataccaa attttctctt gcgacggatg gtgcccttca    102780
     ggaacaggat gcaatcctgc acccagaatt cgtgattctc ggcttcagga tcaaggccat    102840
     tgatggtgaa gttgtgtttg ctccattcga taaagttctg ggacacgtcc acggtgcaga    102900
     cttcacgggc gccagccaaa gctgacacca cactgaatcc gctggtgtaa gagaacaaat    102960
     tcaaaacact gcggccttca gcgtgattct tgacccacag gcggttttca cgctgatcca    103020
     ggaacagtcc cggggacagg ccggtgtcgc tgcgcagatc atagatcacg ccgttttcct    103080
     tggcctgcca gcgtgaagcg gtgttgccga tatgccaaag cacttcggcg ttcgggtctt    103140
     ccccgcgatt cagcatcttt cggacaagaa tctttttgtg atacttcttt gcgatttttt    103200
     caaagcgcaa caaatcctga accgttggat cggattcctt gtaccagtaa acccacagat    103260
     attcgccata ttgatcgatg cggtaagtgt ccagctcgcg atgggcaagg cgcagacact    103320
     catcagtcaa agttgaaaac ttgtacatgc gttcgcggcg ctgaaaggct tctgtcagga    103380
     tttgttcttc cggatcggcc gtgaagtcgt cttcggccca gcctggcaga ggagtttcat    103440
     aacggacttt ttggccattc aactcaaagc ccaacacctg cgagtgcagg cacagacgga    103500
     agtggttggt cccattgtga tcactgtcac ccagaacggc gatgccgttg gcttcagcat    103560
     gcagacggat ctggtgcggt ttacccgtgt ggggcacggc ttcccacaac tggtaaggac    103620
     ccaaagcttt cacccatttg aaactggttt tggaattggg ctcctgggtg tcgcggctga    103680
     cgaagacatt tttttccttc tggatgaagg attcataggt gaactcagtg cgggcgattt    103740
     ttttgtcggt caggaaaagg tatttctttt cgaccttgtg ctgctcaaag gcttgagtca    103800
     gctgggcggc aatttcagag ctggtggcaa agaccaaagc gccggaagtg gctttgtcca    103860
     gacgatgcac ggtgtagagc ttacgatcca gttcttcttc ataaatttcg acacagccgc    103920
     gctgaccata ctcgggcgta tgggtgttca gacctgcgat cttgtcaacg aagatgcagc    103980
     ccgctatttc ggtgtgttga agcttaatta tccgtgtcat ccgactacta taattcggtt    104040
     tttattgtgg gtcactggga gattcgttag aacttatagc tggacctcgc cgctcagaca    104100
     gtcctcgttc gtgttttttt ggcggtggct ccgcagaggc tgttttgcct cactgcggaa    104160
     ctcgcgtcga tgtccagcta taagttctaa cgaatctaac ggaggccttg tttttatgaa    104220
     aaaccgtatt ctagttcttg ctttgatgtt gatgccattt ttggcaggtt gtgggattca    104280
     atctcttcct caagctaaga atgctactga ggctgctttg gctgaggtga acaatcaata    104340
     caaacgtcgg gctgatttga ttccgaatct tgtgaatgtt gttaagggtt atgcgaagca    104400
     tgaagaagct actttgacgg cggtgacaga ggctcgtgcc aaagcgaccg ctatgcagat    104460
     tgatccttcc aaagtgactc ccgagcaact ggcgaaattc cagcaggcgc aaagtggttt    104520
     gtctcaagct ttgggtcgtt tgatggtggt gtcagagcag tatcctcagt tgaaagcgga    104580
     tcagaacttc cgtgatcttc aggctcagct ggaaggcacc gaaaaccgca tcacaattgc    104640
     tcgtcaaaga tacatcgaga ctatcaatgc atttaacaac caagtcagcg ttccgccgac    104700
     aagctggaca aatgcgatca tgtatcactt cgaaaaaatg cctcaatggg acatgactcc    104760
     ggaagaaaaa gcttctgctg aaaaagcacc ggaagtgaag ttctagtttg tcagggaaca    104820
     tgcgtttctt agcatattct tttttcgctt tcttcttggc cctgggtgtt tccgcccggg    104880
     ctgagtttaa ggttcccacg ctgaccggtc ctgtgatgga cgaggtcggt tatctttccc    104940
     gcaacgaccg tcaagagctg atgcagcttc tttatgactt caacaaacgc ggggtcgctc    105000
     aagttcaagt tttgatcgtt cctaccttgg atggcatgcc catcgagatg gcgtccattg    105060
     ctgtcactga caagtggaag ctcggggacg agaaaaaaga caacggggtt ttgttcctga    105120
     ttgcggccaa tgatcgcaaa ctgcgtattg aagtcgggca gggtcttgaa ggcgctattc    105180
     ccgatgtgat cgccagccgg atcattcgtg atcaggtggt gccgttgttc cgcgcccgtc    105240
     aattttctgc cgggatcgtg ctggggacac acgagatctt acgtctggcg gataaagagt    105300
     tcgcagaaca aaacggactg caggaaggtg ttcctgcaaa aagtgaccgt gatggttccg    105360
     gcggcgatat tcctattggt gtgatcatca ttctcttcat cattatttct atcctgggtc    105420
     gctttggtgg cggtcgtgga cgtcatcttc gtggtggcgg ctggggcggt ggctacggtg    105480
     gtggtggggg atggtcttcc ggcgggggtg gcggaggcgg ctggtccggt ggtggcggcg    105540
     gcttcagcgg cgggggctca tccggcagtt ggtaaaccaa gctctcgggg ctgcgtcttg    105600
     gggaaaggct ctttgcctta cccgcttcgg acagtcctcg ctcttggttt tctgtggtgg    105660
     ctgccgctgg gtttttggtg ttcgcttgcg gaacttgcga gtaaggcaaa gagcctttcc    105720
     ccaagtcgca gacgaggcct ggctgacaac ctaggattcg cctttttgct taatgcctag    105780
     ccttgggtgt gttgaagtcg ttttggctgg tgtttggcag cggtaattga ttttttgagg    105840
     gaaatttatg gcttggatta ataaatatct ttctgaagcg gatcttgcgc ggattgaggc    105900
     ttctatttcc aaggtggaag aaaccacttc gggagagatt gttcctgtaa ttgttcgtcg    105960
     ttcttccgcc gtggggcatg tgcctttgac gctgactttg cttttgactc tgtttttggt    106020
     cattgttgag tttccgttca gtgactggtt gtgggtgact ccttgggttt atctgtggcc    106080
     ggtgattgtt gtgatcttct ttggtctttc gcaagtgttg gccaagtcca agtggattca    106140
     gaaagtgttt gttcctgaaa aggacgaact ggattcggtt caccgtcgtg cgcatctgga    106200
     attctatctg aaccgcattc atcgcaccga aggcgggacc ggggttttga tctttgtctc    106260
     tgtgatggaa aagaaagctg tcgttctggc ggatgagggg atctcaaaaa aactgcccaa    106320
     agaacactgg gatgagatct tgggcatgct gggtaaacat ctgcatgagg gcaagtgggc    106380
     ggatggcttt gtggcggcaa ttgaggcttg tggcaaggac ctgcagactc atttcccggt    106440
     catttctggt aaaggcaatg agcttaaaaa tcatctcatc gtcaaggatg tctaagtgtc    106500
     ctgatctggg gcagggcaat taagtccctg caatccttgt cggtgtaatt catatttgag    106560
     aactcgcatt ccgaaaagta ctgtatgcga gtccttgttt tgaacgttct attatctggt    106620
     ttcgcgttga tttccgtggg ttgcaccctg gaggccaaca tcgctgggca aatgctgcct    106680
     tcactgttgc gtcccgacgg tggggagggt gttgttgatg cccctcaaat atctcagaaa    106740
     atttgtgcga atggacccgt gttttctcaa gcggagatgc cgtcgggtga aacgatcttg    106800
     gccggtgact ttactcgcat cggcccctgc agcagtcctt tcttaaaata caatccagtc    106860
     acgggtgcag ttgagtccat cggaccttcc gacgccgccg tcggagaagc tcatgtcatt    106920
     gaggcggatg gggctggagg ttattatgtc ggggggtact ttgaggccaa gaatggatct    106980
     caagccttga ttcatatcaa accggacggg acactttcgg attggaatcc ccaactttcc    107040
     cgtggagctc ttgctgcagg ggtgagtgct ctgaaggttc atgatggagt tctttatgtg    107100
     ggaggagatt ttacggcagc gggcagccct tcgctgagcc ggaccgctct tgccgccttt    107160
     gatatcgcca cgggggattt gttgccttgg gcgccaccgc tgaccacgga cagtttcggg    107220
     gacttgcaca ttcgttcaat cgagattgct tctggatcca tatttatcgc aggggctttt    107280
     ggaactgttg gcgccaatct tcatgtttcc gaaggtgtag ccaagatcaa tttgactgat    107340
     aataatgccg acacttcttt tgccgccacg gggttaagtt ctcaatccgg aaaaatgaaa    107400
     tggcataacg gaaccctggt gcttgtggat ggtggaggac ttgtgatgct gaactccacc    107460
     aacggtgcca acacggggtt tgtcgcggga ctgacggcgg tgccggcttg gggaggcttc    107520
     tcggactatg agctgaaggg cgatgagctt tggattgccg gaatgtttga tgccgtcaat    107580
     ggtcatccca ctcgaaacat agccaagttc gattttagcg gcgcaactcc aacactggac    107640
     acaggctggg cgaccaccta tgaaccggaa ggttgggtgt cacagttaaa agtcactgac    107700
     agccatatct tgtcgttcac aaatggaact gtggggtact ggaataaatc gaacggaact    107760
     cagtacgttc ctgcagtggc cagtccggtg ggcgaaggca cttatttggg ggctctcaat    107820
     gaaggtgaag agttgctgta tgtgcataag tccaaaacac tggggcttcc cgaaaccaga    107880
     tatctggtca tgtatgatcc tgacggagaa gtgatgccct gggctccttc gcccaatgac    107940
     tatgtcaagt ccgtggttgt ccatgaggga aggatttttg tcggtggcag gttcaccaac    108000
     attggcgtaa caccttcggg caaacgttat ctggtagagc tggacaccga cggggaggtc    108060
     acctcctggg atgcggatgc caatgacgaa atctatgata tgcgaagcgt gcagggaagt    108120
     ctgctgattg cgggtgaatt taccagtatt ggcagcgatg gaatgggagc ggcttatctt    108180
     gcaaaactca gcttcgtcga tgcgacaggt gtgccttgga caactcaggt ggacggtcgg    108240
     gtgtttggat tcgatattga aggatctgcc ctggtgttcg gtggcggttt ttcaacggtg    108300
     gatggtcagg ctgtcgaaaa tctggcaaag gtggatctga atacggggag tctgcttggt    108360
     ggaacaccaa cagtcgacag ttgggtcaat ggcgtggctg tcatcgatga aaaagtttat    108420
     ctattcgggc aatttacgga tgtgggtggt gaagcccgct cgcgtctggc ggctttcaat    108480
     ctttcaaatg gttcagtgac cgcttgggcg ccgaatatcg ccgtctgggc ctcccgggcc    108540
     atgcgagaag tgtccggcaa ggtcatcgtg atggcccatt tcaacacgta caatggggtc    108600
     agctacaccg agggcactct ggtgctggat ccggataccg gggccaaagt ggcagatcct    108660
     cgaaatcttt atagttcgac cgtctggctt gaagagtaat gacgccacgt tgcgctggcc    108720
     caaaccttgc gttccgcagg gcttcattga tagtctgagg ccctctatgc agtcgtagtt    108780
     caatggatag agcacttggc ttcgaaccaa ggggttgcag gttcgagtcc tgccgactgc    108840
     accatccttt ttttcttttt cccttttaat actgtttcgg acctggcgcg ggcacaactg    108900
     ccgactgcac ctttcttggc ggatagagtg gaattgattt tgcctgggct tcgttgcatc    108960
     cttttagagc aaggggtgtt gtcatgagtg gcaaaaatgc caaagtggat gctttcattc    109020
     agtcagagaa gaagtggaaa gaggaagttc agctgctgcg gcagattgca ttggacagtg    109080
     gtttgagcga agactttaaa tggagtctgc cttgttatct gcatgaagat aaaaacatcg    109140
     ccatcatcca gaactttaag aactcctgcg cattgatgtt ctttcagggg agtgaactta    109200
     aagattcaaa aaaactgctg aagtcaccgg gtgcaaactc tcagtcggca aaacgctttg    109260
     aattcaccag tgtcgctgac atcacgaaag tgaaggcggc aattcgcgct tacatcaaag    109320
     aagccgtcaa gatttctgaa gccgaagtga aaacccaaaa gaaaccggca aagatgccag    109380
     ccttgcctgc agaattgaaa caggccctgg ataaaaacaa gaaactgaaa gccgcttttg    109440
     gaaagctgac tccgggccgt cagcgcctgt atctgatgca tatcacttca gccaaacaag    109500
     cggccacccg ggtttccaga gtggaaaaat gcattccgcg catcttgcag gggttgggat    109560
     tgaacgacag gccctagcgt cgtttcaggg actggatgat ttcatccagt ttccccaaaa    109620
     agcgggagcg gtctttttta tccatcggtg cgggaccgcc gcgcatttcg cccatatgac    109680
     gaagattctg catcagctcg cgcgtcgcca ccgctgatcc aatgctgtct tcagtgaatt    109740
     cgacaccctt gggacccagc gcacggactt ggcgtttcac gcagcgctcg gccaacagaa    109800
     tatccgcagt caccacgatg tcgccaggcc ctgcctgctc gacaatccag tcatcggcgg    109860
     catcgaaacc ggaagacgcc accaccattt ccactcgctc gttggcgggg atgttgatgt    109920
     acttgttcgc aaccacaaag actttcagct gatagcgttc ggcgacctta tagatctcgt    109980
     ctttgacggg gcagccgtcc gcatcgataa agataatcag cataaagcct ttctggcctt    110040
     agcagcctga accttccatg atgatagtgt acaccttgcc ggtttcacta tcaatcacca    110100
     gcaaagccgc gaattggaag ccgcactgaa cagcgccgac cgggccgact ccgtatttca    110160
     cagttttgat gtggcgaaga agagaaaagg cattttgagc tttcagataa gcttcagaga    110220
     aagccacttt gtcttccgtg gtctgttcgc tgtattcaag gttttgttcc aaaacactga    110280
     ggacgtattc ggaggcccct ttcaggtctg aactgcccca gttggtggaa tcgccctgcc    110340
     aggccgccgc attgtctccc tgccaactgg cttcaaattc ctctgcagac tcgacttcgc    110400
     ccgctgcgag tgcaaattcg cgaaccatgc ctttgacgtc cgtggaaggt tggacctgag    110460
     tcacgcgggt ctcttgggcg atctggctta gttgtgccac agcttgttcg atggtgcggg    110520
     agttatagtc gcttttggca aaactggaag cagacagaag aagggtcagg gtaaacataa    110580
     gcgttttcac ttttgggctc caaagaaagg tttatgaacc tgcttataga gcctgccctg    110640
     atatttgtta aatatataaa aatatagtta atatactata aatgtataaa aactaatcta    110700
     agggtcaaag gggattgcag tatccggaca gatgcacccg gtaattctta tcagaggtga    110760
     agatttcaaa cattccttcc tgatagcctt cgcgatggca agtcagggtc aggcgatagc    110820
     ggcaggaaag ctcggagcgc aattgttcgg ggcagtcgct tgcgacggtg aagccgcccc    110880
     cagaaattgt atgtgaaatg tcacgaagtg cggtggcatt gtaattagtc aaaagcatgt    110940
     ccttcgagcg ttcggcaccc accatcagca tcccaaaatc catgcgcgat tcaacctgcg    111000
     cgctaactgc caggggggaa agcaagacaa agaacaccag cgttttcagg cacttcataa    111060
     gatcctccta aggtgacaat tcattgggcc tgtgcccgga ttttcagtca aacttttggc    111120
     gggaacaggt ggatgaatct gttcacactt tattgatgaa acaggttctg gtcgtgggct    111180
     cgttgaccgc ttcgagggga tttgtaatct gaaggtcacc ccaaggaggt tcccatgaag    111240
     agcgttctgt tcatcaccgc gtttcttttt gtctggctgg cacaggcagc cccggcaccg    111300
     gatcgctgca agaccctgac cgaaacccaa gggggcgtgc agcttcagcg catctggctt    111360
     gagcaggcgg gcatctgcat gttgtctgtt tctcccacgg atgcctacaa ggacatgatc    111420
     tatcgcgact atgtgctgac cgaagatggc atgttcatgg tctttaacgc ttatggtacc    111480
     gatgggcagt tcggagcccg tgactttttc ctgttcccaa gaaagcagac tgtgatcagc    111540
     catcagtggg tgccggaaaa agacgagctg atcatcgagc acgtcaccgg agacaagttc    111600
     gtctttgatg ttaataaagc tgttctgaag tccatttcgg gggctgcgaa agtggtggtt    111660
     gataaagtcg ccaccaataa taaaggcggc gtatccatcg tgggttatca ggggcagatt    111720
     ctggatgtgg gctttgcgct gaatcaggat ccggcgatga tccgcagcgg gaattcggtt    111780
     ctgaccggag cgcaaagaaa ctgttctctg cgcaatctgg atattttcaa ttacatgagt    111840
     gacggcgacg tgatctttaa gttcagaaag gacaccgact ttcagcgtct ggtgtcctct    111900
     gcctgccgtt agaaggaatg catcagctct gtgaacttgc gacggtcacg gagctgggaa    111960
     tccaggtcgt gcagggattt gttgatgaaa cgaacctcaa aggaattgga ttcgggattt    112020
     tcctccagaa cgtcgcgata gatgaattca tgaatcacca gcgcagcctt ttgattttca    112080
     tccaaagagc tccataccaa tgaatcaatg tcatactcct gaatgccaaa acgactttca    112140
     ttggtctgaa caatggcaat cttcagtcgg cagccacgac ccagttccat atcaccctgg    112200
     tcgttggggc cttccaaagc aaaagaggcc ttccagcgga tttgttgagg ccactgcttc    112260
     agccactgcg tgtatttcaa ggctttctgg gaattcaccg gacggatgcg cgcgatcaag    112320
     tcagacactt tggcctggta ggaacgggcc ggggagtact gaacgttgat cccttcttcc    112380
     ttggcttccg ccatttccaa tgcgacggtg ggttggttca ggcagctgac gacgtagccg    112440
     ccgttgcgaa caacatattg agcaaatgcg ctgggcgcgg ccaataaaac gataagagca    112500
     agcagatgtt tcattcggtc tcctttggca cggcgggcag cagttgcatg cccagcgtgt    112560
     aaatttcagt gcattcaccc tgagtcagct ttccgtaaac ctttttccag gccttttcga    112620
     gttctttttt tgcccggtcc aaatttttcg gatttacagc cattgtcagg taaaccattt    112680
     cccttttttc agtgggaacc tgcgggaaaa tgtcagtcga gcgcttcagg gcctctttgt    112740
     gcaatttttg cacgtcaaag ttcgggatgt cgctttcaga agccaggctg cgcacggttt    112800
     tcacataagt ggtggggctg ttcatttcaa ccagtcccag ttgcaaaagc ttgttcatga    112860
     cagtttgcgt gcgttcggaa ggaactccgg tttcagatga aatcagctcc acatcccatt    112920
     cttctgtgtg caaatccatt gccgccagca ccaggaaaaa atccacactg gaaacttcgg    112980
     agaattctga tttgctcaga acgcgttcta tagagtgggt ggcttttttg cgttttttct    113040
     cggagtcata cagggactgg gccttctgtt ggtcttcttc cgtcaggcgc aaacctgcca    113100
     ccagcttgtt gaagttagcc gaagacaccg ggcgcttgtt gttgaaaatc tcggacaagt    113160
     gacccggaga gatctccacc cgctgagcca aagcacgcag tgagaatcgc ggatttgccg    113220
     cacgtctttc ttcaaacttt acatggaaaa acttattcaa cgtcttcatt tggcaaaaac    113280
     acttaccaac tcaaattgga catgtatatg tcaattgcga ggttttcccg agtttaagcc    113340
     tttttgaagg acgaactgtt cgaaatttca tggcgaacac caaaacgaca aaaccggctg    113400
     tggtagccgg ttttgtagga tttacctgac ttgaagacga ctatccgtcc caggcgccgt    113460
     tttccgggct gtcgctgact tgcagagctt tccagacttc ctcgttgtcg aagaattctg    113520
     cctgcttcac gttcagacgt ttttcatcgt ggcagggaac gtaagcgctg atggatcttg    113580
     agatcttttt ggcttttcca ctggctgcct gcgggcgcag aacatcccag taggatttac    113640
     gactgaacag agcattgtcc cggcgtaact gaccattcaa catgtccagg gtgcaggcga    113700
     aagtgttcac cggtgtttta ctgtcgccct tctcgcagga ctttgcatag acctgttcgc    113760
     gccccacatg caactgcatc aggccataca gactgccgtt gggccctttt gctgtggctt    113820
     tcgggttgca ggtgctttcg tagtgggtca tggcattaaa gaccagaacc cagaagttgg    113880
     ccttgtcggt gggcttcatg attttatagg tcgggcatag ctgatagata tccggagagc    113940
     cttctgccaa gtgggagaag ttgccggcca tatattcctt gcggatggca tggccccatt    114000
     caccgatttt ggtgcccgtg gcgtagttgc tacaggccgg tccccatttg tatttgtcat    114060
     tgatatcgtc aatgactgaa gccacgaagg tgagattgtc tttcattctg aggccgttgg    114120
     gtgtttcgac aaagcagtcg gtgcagtgac cggcttcagt gccgctggcc agagccgggg    114180
     agccgtacag gatcgcagcc acaagcaagg tgctgatgca tgatgaaagg accgtcattt    114240
     cgtctccccc tataaatacc gattagactt gaggcgtcat tgcggggcgt tccccattta    114300
     tagccttccc tagagtcatc ggctcttggc tggaccttct atactgaaaa aatgactaaa    114360
     tgttcccata gaggctgaaa acaggacttt ttggggaaca tcccagttcg agacagggca    114420
     aaatcctttg aaaatccaat aggattgaac acaatttatt gaccattttg cccggataag    114480
     cgattcagtg tttctggaat ttgaccgtgg tcatttcagg ggtttatttg ccttaaaagg    114540
     tgatagaatc ctgaggccat ctggagagac aaaaaagaat gagcaacaca aatattatcg    114600
     aagtccgcaa tcttgctgtt gagtttaaaa ccgaagacgg gattgtacag gccgtaaagg    114660
     gcatctcttt caatatccca aaaggtaaaa cagttgggtt ggtgggtgag tccggttccg    114720
     gtaaaagtat cacgtccctg gcgatcatgc gtttgatcgg aaatccaggc cgtgtttcca    114780
     gcggtgaaat tctatttgaa ggccaggacc tgctgaaagt ttctgaaaag aaaatgcgtg    114840
     agatccgtgg tgcacgcatc tccatgatct tccaggaacc aatgacatct ttgaatccgg    114900
     ttctgacggt cgcagatcaa atcactgaaa ccctgatgct tcaccaaaac ctgaacaaac    114960
     agcaggcttt ggacaaagct ttggatcttc taaaacaagt cggcatcccg cacgctgaag    115020
     aacgtctgta cttctatcct cacaaattct ccggcggtca gcgccagcgt atcatgatcg    115080
     cgatggcgat tgcttgtaat ccggatgttc tgatctgtga cgagccaacc accgcgttgg    115140
     acgtgacgat ccaaaaacaa atcctggatc ttctggcaga catccaaaaa agaactcaca    115200
     tgagtctttt gttcatcacc cacgatctgg gtgttgttgc tgacatcgct gatgaagtga    115260
     tcgtgatgaa caaaggtgaa atcgttgagc gtggtgtttc caaagaaatc ttcgacaatc    115320
     caaagcaccc gtacacaaag ggtcttttgg cgtgccgtcc ttctttggat gaaaaccccg    115380
     ttcgtcttcc ggttctttct gacttcatga gtgcagcggg cgaagaaatc acgccaggcg    115440
     cacgtgtgta cactccagcc aaagaaatca tccgtgaaga caaagtcatt cttgaagtga    115500
     atgacctgaa aacccacttc cctcacacag gcggtctgtt gggtcgtgtt cagagctata    115560
     caaaggctgt ggacggcgtc agcttcaaag ttaaaaaagg tcagaccctg ggactggtgg    115620
     gtgaatccgg ttgtggtaaa accactctgg gtcgcacgct gatgcgtttg attgagccga    115680
     cggacggtca gatcatcttc gatggtcagg acatcaccaa gcttgattac ggtcacatgc    115740
     atccgatccg caaaaaaatg cagatcatct tccaggatcc gtatgcttcc ctgaatccgc    115800
     gtatgactat cgggaccatc ctgatggaac caatgcagat tcacaacatc ggtgaaaaca    115860
     acaacgagcg ccgcgaaatt gccgctgaga tgctgaaaaa agtgggcatg agcccggcaa    115920
     tgatgaatcg ttatccgcat gagttctctg gcggtcaaag acagcgtatt tccatcgcgc    115980
     gtgctttgat ggttcgtcct gaattcatcg tgtgtgacga gtccgtgtct gcgttggacg    116040
     tttccatcca ggctcagatt ctgaatttgt tgttggacct tcaggatgaa atgaacctga    116100
     cgtacatctt tatctctcac gatctgtctg tggtgaaatt catctctgac gaagtggcag    116160
     tgatgttcgg tggtaagatc gttgagcaca acacggctca ggcgatctac gatgcccctc    116220
     aacacgacta taccaagaag cttctaagcg cgattccaaa agggatcccg aaagagctga    116280
     cagtttagtt ttttaaaaca tgaaaaagaa aaaggccggt gatgaaccgg ccttgtttat    116340
     ttgttttgtc tgtagtctta tttttttccg taaaggtggg gcaggaagcc cgcgccgata    116400
     acgcctgcat ggttctgagt cttggccact tcaatcgggc attcaaagac cgtcttgctt    116460
     tggcggatca tctttttgta gtgatccttc aggtctttta agtacatgtt acgaatcttg    116520
     atcagaccgc cgctgaggaa gatcttctca aggttgtagc cgatagaaag gttatagcaa    116580
     agaatcgcca atgcccaggc catttccttg aacagcacct ggtacttggc atcgttggcg    116640
     gcaatcagtt cttccacgga atttccagtg aaacccatct cgcgtgcgcg acgaagaagg    116700
     cccgtgccgg aagcaatgcc ttccactgtg cagtggtcga tcttttccgg atttttcatc    116760
     aggcgctggt aatcaacaac gatatggccg tattcagagc ccatgccgtc agactggccc    116820
     ggcaggccgt taaagatcac gccagtgccc acacccgtgc cgatggtgac tatcgcaaag    116880
     gacttcattt tctgtgcgcc accaacccag ccttcagcca aagctgccgc cgtggcatcg    116940
     tgctggaaga acaccggggt cttccaggtt ttgtgaatct ctttggtcag cagatccagg    117000
     atcggaacga tcttccagcc tggatagttg gcaggattca tcagagtgcc ggtttcagca    117060
     ttcaaaggac ctgcgctggc cagaccaatg cccctaaaga cagaggcttt ggtttcgttc    117120
     gggaaacgtt ttttgaaatc cagagcaatg tccgtcatca gttgaatcag gcgcttttgg    117180
     gccttgggtg cggacttctc gcggttcatg tcgaccggaa ccttgatgaa atccagcatt    117240
     tcgccggtat cagaaagcag cgctgctgcc agtttggttc cgcccagatc aagaccgatg    117300
     gtgtaggttt tctttttcat attatttttt aacttgtgcc ttcactaaaa gaaccaagga    117360
     tgaataaggc gccagtgttg cgcgcacttt tccgctgttg ttgacgctaa agcctttagc    117420
     gcaactgcgg gatttcaggc gataacccga atccacgatg ttgcagtatt cgccggcggg    117480
     aagattggtc tggaattctt tggtcaccga ctgaccacca aagttcatgg ccacaaaacc    117540
     aaagcgcgga cgggcaaacg agatcacgtc gcggccgtgg gttgaccagt ttgatacact    117600
     gaaggccttg tcggtctgat tgcggaagtc caccatggca gccacttccg gcagacggtg    117660
     ttcgcaagtc caaggggcgc ggcactggtt ctgttcatcc agaatcggca aggtgcgaag    117720
     gttgtcattc aaaggcggtc cctgatcgaa agaattaaaa tcaaatccgg aatacacctg    117780
     tgggtaacca aacggccacg ccagcataaa gatctgcgcc agacggtaca ggtgctgttc    117840
     agggcttgaa tatttcaaga cggaataatc atttgtgcgt tcgatgtcgt ggttggtgac    117900
     aaagacgatg gaatcaatac tgtttgggaa tccactggca ataaactgca aagcctcggt    117960
     gttcttatct ttgaaagcat accccagacg gtgaggataa tcgtaggccg tcacatcact    118020
     gaacggcgta tattcggcgt attgaacggg gcctgccggg tcatagatga tttcagaata    118080
     gatgtaagcc gatcttttca gacgcttcag gatttgatcc agatcacggg ccgggatgtg    118140
     tttggcggca tcaatgcgga agccagccac acccagatcc agcagacggt ttaagtactc    118200
     ggcctgtttt tcctgcacgt aagtggattc ggttttcagg tccgccagat cgaccagctc    118260
     gcagttttgc agctcgtaca aatcacggaa atcacggatg tcattgttgc cgtttctgcc    118320
     acagtgatgg aaatcctgag gggaataaag acccgggtat tcgtagtgac taaactgcgt    118380
     gccggcagaa cccacacctc cgggaatgcc ggtcatgtgg ttcaagatcg catcggcata    118440
     gacatcgaca ccggcctgac ggcagcggcg gaccatgtcg gcaaattcag cctcagtccc    118500
     tgaacgggat tccagtttat agctgacaac ctgataacgt tcccaccaag ggttgccctg    118560
     ccagtgaatg tgttcgtgag gcggggagac ctgaacggca gaaaatcccg ccgggcccag    118620
     ataggtttca cattcacggg caacatcatt ccaaggccat tcaaacaatt gaacgaagac    118680
     tgtgcgcgga gccgcagctg ctgacaggca agatgccaaa gtcagcaaga acgctgtaaa    118740
     accgagagac aaactgcgga tcatccgatc tccttaaagc ctttgattca ggcccgtttt    118800
     tttatcaaac aggtgggcct ttgtcaggtc gatcttcagg ggcagggtct gcttcatgga    118860
     aaaattatcc atcgaatcca ccaggatgcg tacgttgtta ccggcaagtg ttccgtgaag    118920
     catctgctgg ccgcccaggt tttcggaaat atcaatttgg aagtccccca aagcaacttc    118980
     ttgggttccc aagggcccct gattcaaggc aaaagcatcc gggcggatgc ccagaatctg    119040
     atccgccttg cgtgcttcag gccatgggat cttttccaga accgcgcctt ccaggaagtt    119100
     catttccggt gagccgatga aggtcgcaat aaaggtgttc ttgggacggt gataaatctc    119160
     agacggagtt ccgatctgct caatcacgcc gtctttcaga accgcgatac ggtcccccaa    119220
     ggttgtggct tccatctgat cgtgggtcac atagatcatc gtgcttttcg agttgtgatg    119280
     caggcgtttg atttccagac gcatctggga acgaagatgg gcatccagat tcgacagcgg    119340
     ttcatcaaac aaaatcaccg gagtctgacg gctgagcgca cggcccaaag ccacacgctg    119400
     gcgctgaccg ccggaaagtt ctttcggttt gcgatccaga aggtgtttga tctgcaaaag    119460
     ctcggaaatt tcattcacgc gtttggtgat ttcagccgcc gccagatttt ttagcttcaa    119520
     accaaatccc atattttccg ccacggtcat gtgcgggtac agagcatagg actggaagac    119580
     catggcgatg tcgcggtttt gcggttcgat gtcgttgatc ttttttccgt cgatgctgat    119640
     ggttccggaa tccgcggact caagccccgc cagggttctt aacaaagtcg atttgccgca    119700
     accggaaggt ccgaccagaa ccagaaattc ccccggagcg atgtccagat cgatgccttt    119760
     caagacatcg gcagaaccga aacttttttt gatgttggaa aactgaattt ttgccatatc    119820
     aacccttcac gcttcccatg gtcaggccag aaaccagata tcgggaaata ctgatgaaca    119880
     aaatcaaaac cggaacgctg acgatcaagg cgccagcggc ataaagaccc cattgggtcg    119940
     caagacttgc ctggaacgaa cgaagtccca acggcaatgt gtagagctgt ggatcctgca    120000
     aaaccacggc ggcaatcacg tattcactcc aactgctcat aaagctgaac aaagccgtga    120060
     tcaccagcgc cggagaagac accggcagaa tgatcttata gaagatcatc catttcgagc    120120
     agccatccag caacgccgcc tcttccagct cgcgggggat ggtgtcgtaa taagccttca    120180
     tctgccagat acagaaaggc agcgcggttg aagaataaat caggaacaag ccccagaagc    120240
     tgtcaatcag gcgcagtttc gacaggatga tataaaacgg cagcatcagc atggtcgccg    120300
     ggaacatctg ggtcatcaac agtgaaaata gcatcatgtt gcgcccgcgg aagcggtatc    120360
     ttgccaatgc atacgcactg gtcgatgcca aagccacacc caaaagtgtg gtcgccgcac    120420
     tgaccaccaa agagttgcgc atccagatca ggaagtcggt ggtggcaaac agatccacaa    120480
     agttcttaaa ggaagcattc ggtccgatga tttccaagga ctgtgtctga aaggcgttgt    120540
     cgggacgcaa agacaccgac agcacataca aaatcggata aattgaaaac agtgagaaaa    120600
     gcaaaatgct gatccaggag aaggtctttt taagcattac ttcgtctcct ttttgaattg    120660
     gcttttcagg gatcccagac cccagatcac cagaatcagg aagatgatca cggacacgga    120720
     agccgcatag ccatagcgat acagattgaa ggccgcttta taaacgtagc tgaccagaat    120780
     gtgcgtttga tcacccggtt cccccgagtt actgaccagc cagatcacat tcagattgtt    120840
     aaacgtccag atggagccca gcaaagctgc cggagccatc accggcaaaa gcaacggcca    120900
     tgtgatatga cggaagcgct gccaagcatt ggcgccatcc agtcttgcgg cttcgtacaa    120960
     agagcttgga atggactgca aaccgcccag ggccacgatc atcataaacg ggaagcccag    121020
     ccacacgttg gtcaaaatac acgcagcaaa agccgtcgtc ggctgactga gccactgaac    121080
     cggggacatg tgcaggaact gttgcaggaa gatattgatc ggcccatatt cctgattgaa    121140
     catcgcgcgc caggtaagag cggtgatgta ttgaggcacc gcccacggga tgatcaacaa    121200
     ggcccgccag aatcctttcc ccgcgatcac ttgattgatg atcaccgcca ggaacacacc    121260
     aatagaaacg tggaagacaa tgttcaccac ggtccagatg acggttttca ggaacaggga    121320
     atagaagcgc ggatccgaaa gagctgcgat ataatgatgg aagcccacca gggaccagtc    121380
     ttggaacgtg cgcagactga agttcgaaaa cgaaatcgcg atattataga agaacggata    121440
     gatgatgaca gcaaagatgc cgataaacgc cggcagcatc atgtaatagg caaaacgctg    121500
     gggcccgcgg aatcctttaa agaatgccac tagcgagttt cttgtcagcc agatcaacag    121560
     cacgatgcca atgccgaaaa taactttcaa aacagtggcg cccacgcccg gggtcagaac    121620
     ctcgttcata tcgcggatct gctgttcagc ggtgatttgc gcctgctccg cggcggcttg    121680
     cggttgcaga ctgccggcta gaactttttg atactgaatg cgcagactgt cccagaccgc    121740
     acgcacttcc ggggttaccg gcataggcgt gccgacttcc atgatgtcgg cagaaatttt    121800
     caagagtgga ttgtttttga cgatgtcaga ttcacgcgcc tgcagatttg acggtagaac    121860
     gccgactttc tcagcgaaca gcaattgcac tggcgtcgaa gtcagatact tcaaaagttt    121920
     gacggccgct tcgtaatgag cctcgctttt catgttggcg ttcagggaat aacccttggt    121980
     gcccaccagc ggacttggcc atttgccggt ttcagaaatc attggaatgc gagcgatgcc    122040
     gaaatccacc ttggcttgct gatagtcacc ccacgaccag tcaccgttga ttaacatcgc    122100
     ggctttgttt tctttgaaca aagcattggc ggtttcatag tcgcattctt tcgggatgat    122160
     cttgtcctga tcccgcagct tcagaatgaa ctggaaagtg tctttcaaag cggtggtatt    122220
     caggttcgga gtgacaccgt cggcttttaa gaaggcttcg ccaaaagcgg gaataaacgg    122280
     agcaaagaaa aacggctctg tataattgaa caccagaccc cagcggtcga ttttgccatc    122340
     gccattggtg tccaccgtca tttttttgcc aagctcgatc aattcctgtg aattttttgg    122400
     cggggtggtg atgaacttct tgttatacag aagcatcaga tggtttccga ccgcatcgcc    122460
     gatcatatag tgtttgccgt cgtaaacggg ggcggccagt ggatcaaaat tctggaagta    122520
     atcagagccc aaaacttcgt ccagcgggcg cacgatgccc atggtggcaa agggcccgac    122580
     ctgatcgctg gggccgtaaa ccagctcagg accgctgccg cccatggcgg cagactggaa    122640
     gcttgaacga agctcttcgg tttcacggta agtggcctga acggtgatgc cgggattttc    122700
     tttttcaaat ttttccaggg cttcggccaa gacctgacgg tggccataga tcatctggtg    122760
     ccagatctgg atgcgcacat cctcggcccg ggcggtgagt gaagcgaaaa tcagaaaagg    122820
     aagaatccag aatttcatca gtgaccggct ttctgaatta gaatcacggt gctgcgaccc    122880
     gggatttgaa tgcgtttgtc agaaggggcc agcagaacct gtgacagagt cgcgtcgact    122940
     ttttcatcca gcagcggatg cagttcccag ttctggccta agactcggtg ttcgaagctg    123000
     cgggcttcgc gagcggcgtt gaagaaaatc aaaagttttt ccgaggacga ctgcaggtgc    123060
     atcgcaatca aacccggctc ggtttgtttg tcgttatcga taaaggtcaa agacttctga    123120
     atctcggaca aatcgttgag tttgaacagg ttagaacttt gacggacacg cagcagggct    123180
     ttgaagtact tttctgtgcg ggtgatcagc tcaggcgtga ctttcatgcc gggttcctgc    123240
     aggcgtggtt gccagaaaga ccagtcctcc acgtttttcc acgcgggtgg cagtcctgcg    123300
     ccccagaagt tctgctgacg gctccagtcg atacgattaa agaaatcccc cgaattgtaa    123360
     ctgtcctgat cgccattttt actgcgcaaa agctcagacc cggattcaat aaacggaata    123420
     ccctgactta gcatcggcaa tgccagggcc aactgatgca tgcgctggcg gtcttccgat    123480
     ttactcaaag aagggaaacg tccgttggta tagaacggtg ccttggcctg aacggcatcc    123540
     cacaaagtgt aaccgtcatg ggcggacaca tagctgacag tttcaagcgc ttcggcactg    123600
     gtgccggtcg gcgccccacg atagtgcagt tgtcctgcag tcacgaatga gccccagtgt    123660
     tctttgaatt tgaaatcacg aaggttgccc gcaaggcccg ctttaatcac atcacccaga    123720
     tgcaaaagct tttcgcgctg gccgttgata tcggtcggag tgttgcgatt ggcaggttct    123780
     ttgttgaaat caaaataaag ccccgtcgca aacccctggt cggatttttc agcggaattg    123840
     gtcgtgcctc cacgaacagc gtcgcgcaga cggtcgttga agaatccata gccgctgcca    123900
     taggaattca gcatgtgcag ggactccgct ggatagcggt catagaagga accaaacgcc    123960
     cagccttcgc cgtacagata gattttggat ccatcgatgc cgtcttctct ttccgtcagg    124020
     ccgcgcaatt cggatttgat tttctccatg gtgttgcggg aatggaagga catcaggtca    124080
     aagcggaagg cgtcgatttt ataggtgcgt gcccagtgca gcacactgtc gatcataagc    124140
     ttttccatca tgcgatgttc gctggcggtg tcgttgcagc aggagctttt ttgaatgtca    124200
     ccctcgtcat tcactcggta gtaataaagc ggcacgatct tatcaaagac agagtagggt    124260
     tccagacctg cttcataggt gtgattaaat acaacgtcct gaacaactcg caggttcatc    124320
     ttatttagtg cctgcaccat gttgcgggtt tcataaacgc ggcgtgatcc gttaggatcc    124380
     gtggcataac tgccctcagg ggtcataaag tggaccggat cataacccca gttgaacggg    124440
     tctttggctt tgatgcgacc aagataggct tgcgcttctt gcaggtcgga actttcggaa    124500
     tcgtagtttt cccaagcgtc tttgttttcc ggaaccgaac caaagtcatt gaacggcagc    124560
     aaatgcacgt gggtcatccc ggcgtctgcc aaagattgaa ggtacttcga gctttcggag    124620
     ttggtttgtg cgaaagcttc atagccacca cgatatggga acggcacggt gaaatcagcc    124680
     acgctgaaat cacggatgtg cagttcataa attacgatgt cgttgaaaga acgaagagca    124740
     ggcttatgca aacgatccca gccttgcggc ttcagagagg aatcattcag atttacgatt    124800
     tgggacttgg ctccgtcggc cgtcaggctg aagctgtaag gatctgtgac cgtgtgggtt    124860
     tcaacctgat cgctcagtgg ctgatacgct tccacttggt aaagatagaa atagttgacg    124920
     tattttccgg gaagatccgc gaaccatacg ccttgctggc ggctcatcgg cagaacggct    124980
     gctggattcg tatcttgagc atccttatat agcaacaatt caacattgcg tgcggtgggc    125040
     gcccatagtt ttacgccgac actcgtggaa cgcacatgtg cgcccagatc atcgccgtca    125100
     tagaagtaca tttgatccag aatcccggaa tattgcaaag ccgtggaatc cagaatttgg    125160
     ccatttttat tggatacaaa aagacgcaat ggacgccgga tcagctgatc aatttgcgtg    125220
     gaggaaagat gctgcgtgct caattcaacg tgggaagagt cggtgcgaat cactggcaga    125280
     agaatggagt cctgctggtg cagtgagatg cgttctccga gtgaaaataa aagattttgg    125340
     tgaacacgga agccttgtgg cagacgaaaa acaatgcgcg agttatccac ccactgggcg    125400
     cgggcagggg ctttggcttc agcaatttgt cccagcaaaa gtgtgcaaga aagtacgaag    125460
     ctgcagatca atagtagtga acaaaagcgg aagctcttca aagatttccc ccaaaaagtt    125520
     tgagtcttcg tgcgtaaggt cttttcaggc gcagacttta tgggtatccc tcagcttttt    125580
     caagggaact cgatgaaaac tattacgatt gcgttattgt ttttgattct aagcagcaca    125640
     actcacgctg tggaaacgac tttcacagga tatctgcgtg gcggaagcgg actgaacatg    125700
     cagggtggtc acatgaattg ctttggaaat gcgggaatgc ccggtaattt ccttcgttta    125760
     ggcaatgagt gcgacttcta taccgaattg gccatggtgt tccaccatgt taaacccacc    125820
     gaaacagatc ccgtattttt caaaactcag ttccgcatgg tctatagctc tttaggaacg    125880
     cgtcaatggg aagcctctgc aaaccgcgac acaagccaga ttgaagcgtt tgtgaaggcc    125940
     ggtggtttta ccgaaatccc cggggaattc tgggtcggta aaagatttta tcgtgatgtc    126000
     gatcttcata tctttgactg gtactactac gccgacatga gcggtgtggg tgcggggatc    126060
     gaaggtctgc cgttgggtga agggcgtttt gctttcgctc acttgattca ggctgatgat    126120
     aatttgaatg acaccaatgt cggtcgtccg gttttgaatg cgttggattt gcgctggaca    126180
     gcggtgccgt cattcgctga tcagaagctg aatttctggg gcgtgtatgc atgggccgcg    126240
     ggaagctcca cggacaccga agaatatgtt ccgacgaatg gttattcttt ggcgacacgt    126300
     cttcagggcc ctgtgtgggg tggtaacaat aactttgcca ttttgtacgg aaagggcacg    126360
     atgcgtggat tcaacatcta tgctgacagc acagtgcctg cgacggatga aagccagaac    126420
     cgcgcgtgga cctggagatt tgttgaagac tacacctatg atgtaacaga tcgctgggcg    126480
     ctgatgttcg gtctggcagc agagattgct gacagcggca ctgatgcaga cagcaaaagt    126540
     cagatgcagg ccatcggtgt tcgtccgatt tactttgtat ccgatcgttt ccagtgggcc    126600
     ttcgaagcgg gttattcccg catcaacaat gaatctgaaa aaaccgcggg tggcgactat    126660
     gtcggggatc gtgacctggg tcgcgtgact gcggcagctc agttgtccgt cggaaaaagc    126720
     atgtggggtc gccccgtgat gcgtgcgttt gtgtcccact cgttctggaa tgacgccaac    126780
     caaggcgcaa gcttcatcgg aaaccgtgcc cccgctttca gcgacaagct cagcggcacg    126840
     aacttgggtt atcaattcga agcttggttc taatttttat tttggtacca attccatagg    126900
     tcttggctga actgagctgc gctggtgctg ccgtcgtgaa gtgacttcac tcggcgcaaa    126960
     gccgtggctt ggtctttctg ttggattttc agaatacgga aaagttcagt gacgtttttg    127020
     ccttttccgg ctttcagatc tttgcccaag ttgtcatagt tgattgttgc gaactgctgg    127080
     gcttcaagcg ccatttcatc catggcactg gtgggtgcgt ttgtggccgc cgttgcggat    127140
     gccggagcag ggccgctttt catgatttca gcatcccggg cgtgggtttc ccagttcgga    127200
     acaagggctt cgtcgccttc cggagtggac ggggttggcg tggtggcgca gcctgcggca    127260
     aacaaggcca tgacgacaag tccttttgat ttcttcagca caaaaactcc ttaccctttg    127320
     tttgcaggtt ccggtggcaa cgggatgata tcagtttcgc cggggacttg cgggaaggtc    127380
     aactctctcc attgtttttt ggcctcttcg attttttcct gtgaagagga aacatagttc    127440
     cagtagatat agcgtggctc tgggaacggt tcgcctccaa ggactataac ttgcgtgtct    127500
     tcagtggcgg tgactttcaa ggatgagcct tgttccagga ccacaaagtc gtccggtgga    127560
     atgattttgc cgtcaatatc caggctgcct ttgatgatat agaaagccag ttcctgcgtg    127620
     ccgggatcgt agctgaaggt ttttccctta ttaagcttca catccataaa gaacagcggt    127680
     gaatacacat ccactggtga ctttctgccc agcgcttctc cggcaatcag tgccacgtcg    127740
     gcatcgtcga ctttaaaacg cggaatgctg ctttcagggt gatgtttgaa gctgggttcg    127800
     cggtcttcct ggctcagtgg cagagccacc cagaactgca gcaggtgcag gcggtgcgct    127860
     ttgccgatga cgttttccgg cagtttttca gaatgtgaga tccctttgcc tgcggtcatc    127920
     cagttcacat cccccggagt cagcacctgt ttgtgcccaa ggctgtcgtg gtgaagaact    127980
     tttccctcca gcaggtaact gagggtggac aaaccgatgt gaggatgagg gcgcacgttc    128040
     agcccatcac ctgcggcgaa atcggtggcc gggaaatagt cgaaaaagat gaaggggcct    128100
     accattcgct ttttggagta ggggatcagg cggtggactt gaggccctcc gacagagacc    128160
     agcctcggtg caatttccat cagaatatga ttttgcgtag aactcataac cggacccctt    128220
     ttcttctgcg aaatatcatg ttagcttaaa ccaatttacc aattgaagaa aattattagg    128280
     agtagcatga aaacaaaaaa agaaatcgtc gataactggt tgcctcgcta cacaggcgtg    128340
     ccgctgaatg aattcgggca gtatattctg cttacaaatt tcggtaacta cgtgaaaatg    128400
     ttcgctgaac agttcaacgt gccggtgcgc ggtttggata agccgatgca aagtgccacg    128460
     gctgaaaaca tcaccatcct gaacttcggt atgggcagtg cgttggccgc aacctgcatg    128520
     gatttgcttt cagcaatcaa tcccaaggcc gttttgttcc tgggtaaatg cggtggtatc    128580
     aaaaagaaaa accaactggg tgactttgtt ctgccgatcg cggccatccg cggtgagggc    128640
     accagtaacg aatacctgcc ggcagaaatc ccggctcttc cgtcattccg tctgcaaaaa    128700
     gctgtttcca ccatgatcgc gaaacacagc tgcgattact ggacaggcac ggtatacacc    128760
     accaaccgcc gtgtatggga acatgacgaa cagttcaaag attacctgac taaaacacgc    128820
     gcgatggccg tggatatgga aactgcgacc atctttgtaa ccggttttgt gaatgaaatc    128880
     ccacgtggcg ctttgttgct tgtgtctgac aacccgatga ttccagacgg tgttaagacg    128940
     gaagaaagcg acaagaaggt cacagccaac tttgtagaca agcatttggc tatcggaatt    129000
     gattccttgc gtgaactgcg tgactctggt gagtccgtga agcacatgcg ttgggattga    129060
     tttcagacat attgtccgtt ccatgatttt caaaaacccc tcgggtcgac tagggtcatt    129120
     gcctaggagg cctgcatggg gaagtggctt atacttattc tgacgatctt cgctttatca    129180
     accggggttg caaacgacgg actgccggtg cctttgccgg acgatcccta tcctggtgag    129240
     ccttatcctg taccacctcc agctccaccg aaagatgtcc cttattcgct agggggcggg    129300
     gaaaccggac gcttcggcac cagaactttt gatttctttc cacgctatga cctgaatcgc    129360
     atcaaacgca ttcgattggt ggggctgcgc aacaatctag agattgttga agtgcatatt    129420
     cagtacgcgg attcctccgc tgagcgccgc gagtatcggt tggaaggaga attgaaatcc    129480
     agtggagtgc gtgaagctgc tttggacggg cggccgatct atcgcatatc cgtgaaagcc    129540
     tcgccttcgt acttctggaa aaagcccggt ggattccgag ttgatgtcat cgccgtgaag    129600
     tgagatatgc ctatttatcg agcatgaaat ttagatatga aaatgcaaaa aggtctcggt    129660
     ttgtgggggg cttttctgtg attttcacct tttttcatgc aattaacata ttgtgtcatt    129720
     ccagaagttg cgatataact gggccacttt aaatcaccta gacgttttaa tgcactattg    129780
     gggaggctcg ttttgatcaa tccaggcact aacatgcacg ccgacgaaat cgacacagat    129840
     ttggattctg acctagataa cgaaaaagag gtgaagaaat cggccttcga cgtagatgtc    129900
     gatgaagaac aggaaaccgc tctattggcg agcctgtctg acaaccttct gatggaaggt    129960
     gaagaagatg acctgaacct agatgacgtg gaaaacatcc ttgagcttca agacacgaac    130020
     ttcccgaagt tcactttggc taaaaacaag gcacgtttcc tgagaatggt cagctggtac    130080
     cgtggtaaag aagagtggat cgaagtagct cctctttctg gcgtaaccaa acttttcaag    130140
     acgcaaacga aagaattgga aggcatccgt tcttccaagt tggattatga aatggaactt    130200
     gagactggaa ctttgactcc atctcaaaga tcttaccgcc gcgatgaact taaaatgtgc    130260
     aaggttcagg agaaaatggc agttcacttg atctccaaac ttcaagtgaa aatcaaatcc    130320
     ggccgccgct agttcagcgc cagctgaagc agtaaaaagc aaatcaaacc cagccctcaa    130380
     aagctgggtt ttgtttttcc tggggttttg gtttagagtt taggtcgtag cttttacaga    130440
     aaggttccga ctatgaaaaa gaacaacaag tccgaaaagc acgcgaagcc ctctatcaac    130500
     attggtatcc aggaaaaaga ccgtcagaaa attgctgatg gcctgtcccg gttgttggca    130560
     gactcttaca ctctttacct gaaaacgcac aacttccact ggaatgtcac cggtcctcag    130620
     ttccagactt tgcatgtgat gttcgagggg caatacaccg agctggcaac agccgtggat    130680
     ctgattgctg aacgcatccg ctctttgggt gtggccgctc cgggcacata caaggaattc    130740
     gcgaaactga ccagcatcga agaacctgtg ggtgttcctt ccgcaacaga tatgatcaaa    130800
     caactggtgg aagggcagga ggcggttgtt cgcacggctc gttccatctt cccgttggtt    130860
     gaaaaagctg gcgacgaagt cagcgcggat ttgctgactc aaagaatgca gcttcacgaa    130920
     aaaacggcgt ggatgcttcg aagcatgctg gaataatttt ttggtttcac aaacctaaga    130980
     agaaaaagcc tccgcaaagg aggctttttt atttggatag ctgttgatcc agcagcttgc    131040
     gataaatgcg ctgattcttt tttagagcag cctctaccat ctgataggtc ttttcgtcga    131100
     tgtctttgcg aaaggccaca tgcagattca aagtggtgtc tggcaccaca aagacctgat    131160
     actgatcatc cactctcagt ttgcgcaaaa tgtattctcc gttggaggca gttgggataa    131220
     agatgccatc cagtcttttg gcgcggatct tctgcaggtt gcgctcgatc acattttcac    131280
     cacttaaagg ttcgatcttg attccgtgct ttagaagctc tgtcggagtg aaggaatcct    131340
     tggagtgccc cagagtgcgc ccgcggaagt ccttgagtga ggtcgcccgg gtcagggggg    131400
     agttgcgggg aatgataatc gccgaagatg tcgtgaacaa gggtgttttg gaaaagcgca    131460
     tgtacttttc tcgttcgggt gagggcacca ggaacagggc gacgtccacc ttcttgttct    131520
     gcatgtccca taagacgcgt gcaaacggcg tggccaccca gcgcacttcg gtgttaggca    131580
     gtttcacata gtctttgaag aacgtgatgc ccggaccctc gggttcttca ttcaaagtga    131640
     aaatgtgcgg aggcaggtca tagacattca ctcgcaacac ttccgcaaac gtgaaagatc    131700
     ccgagaaaaa cgtcaatata aagagagcag atagaaactg tggcattcca gaacgtcctt    131760
     aataaacagc cagcactaat ataacaaaga cagtccgaag cgacgagcag attgtggaag    131820
     ctgaatttgc cgataaaacc ggcaagaatt tgggcataaa ttcggaaagg tcggtcaagc    131880
     gggatttttg gaccgacaaa agtccagtgt tttggcctgc ttaaagtgtc tcaaaaaata    131940
     tttgcaactg gccctaaatt ctcagcgtga tacgccgata ggtacaaagt gagtcaaata    132000
     ggctttgtta atgtttcaaa aggggaggac taaatgtcac gtacagttat gatcgtggtg    132060
     agcgatagcc aggaaacaat cgaaaacaca aagaagtact gggagaacca cgatgtgaca    132120
     gttcaagcat attcatctgc acagttcaga gaagggcttg ataacgcatt tttcagacaa    132180
     caactagtag cgggtgttcc ggctttggct tcaggcacaa gcccgatcaa ctctgacgtg    132240
     ggtggtggta acgtaatcca gttcccaacg ccaacagcta cttcatccag cgttcagaaa    132300
     atggaagagc ttgaagctca cgccatcgaa aacgcgatcg tacaatacaa aggcaacctg    132360
     actgaagcgg caaaagcttt gggtatcggt cgcgcgactt tgtatcgtaa agtgaagcaa    132420
     taccacatcg atccttctgc ggctcgcaag aagaaagtgg ctgcttaatt cttccttttg    132480
     aattgaaaag caaagaccgg atgaacaaac atccggtctt tgttattaca ggaccgagat    132540
     gacgcggatc tttgcaattc ttctggcagt ctcctgcgcc tacggggcgt atcatttcac    132600
     tctgcaacgc ggattcgtga atccgtatcc ggcagtgtgt gatcttgtcg cggaaagaat    132660
     ctttctggac gacagcaaaa taaaaaactg gaaaaagacc tgcagtcggc gcagccgtct    132720
     ggtcactccg tattctccga aaaaactgat catcaaggac atgaataatg ccctggcgtt    132780
     gctgaaagtg tcgcacctgg aagtttacga ttcttctgaa gtggccagca tctggcgcgg    132840
     agaaagtctt gaaaccggca ttgaaagccg ttttgtcgac ggggaactgg tcatttataa    132900
     aattcatcct gattctccgg cgcaggaggc gggtttgaaa cccggtgatg tcattcaaag    132960
     catcaatgcc gagcagccca atccctggga ggcgcagacc gagcagggct cgtacctgat    133020
     gcttcgtcag gacaaggaat tttctgtgaa aatcaaacct cgctccatcc agcggtccga    133080
     ggatctgaat cttgaaatca aatccgcgca aaaggcggtg ctggaaattc cgtctttccg    133140
     cgcgactttc tttgaagaag aaaagttgaa aacgctgcaa cagcaaatcg caccgttaag    133200
     caagctggtg gtggacctgc ggggaaaccc cggtgggaac tttgtcgcgg gcctgcgttt    133260
     tctttcgttg ttcatgtgca aggccgaaga agtcgggcgc ttggtgaaac cccgtgcgcc    133320
     ggtgaagaca cctgccgagc ttcccaatga cttgagagat caggaacaac tggccgtgct    133380
     tgataacagc agcgagattt tgttgaagac ttacgacaac ccccagtgct ttaaaggcga    133440
     ggtgcgggtg ctggtcgatg ggaaaagctc ttctgtggct gaaatggtcg cgcaggcttt    133500
     gaaagagttt aaaaaagcac cgttgctggg aagccccagt cgcgggcagt tgctggtcgg    133560
     tgtctggtat cctctggacg aggtcgggcc aggagtgcag atctctatcc ccgaggcgat    133620
     ctacttaagt cacaagcagc atcaaatcga ggggcagggt gtggctttgg atcgggtctt    133680
     gtactacagc ctcccggaaa tgcaggcggg gattgattct tgggtgaaaa aggccctcga    133740
     ctagagtccc ggatgtatgg cgtttgtcgt ctcacagtga gatgatcata ataatacgtc    133800
     aaacatcttt tgtacgtctg ttcaggctct gagcagctag aatgaattgg tgtggtttaa    133860
     aaacggcatg cccttcgcaa gagagatatt acagtcactt gccaaggggt tataaatgag    133920
     gaacgcaaac gtgatcgaat ttccaaaagc acaatcagta agaaaaagac tgcaggacaa    133980
     agcccaggaa caaaaagctg ttcttgttct ttccatcgct tccgtgcttt tgatgacggt    134040
     gttcctgaat cagtggctgg tgcgcggccc ggatcaaaac ctggcgaatg gcggcaaccg    134100
     tggtgtagcg agctttgaac cttccagctt cgccaaagat gtgaagtggg agcatgatct    134160
     ggcaaaaaga atggcaacag aaaaatccac aatggcagca agccttgcag aagcaccgac    134220
     tttgcgtgac gagctggttt ttggttacct tgaaggcaaa tacggcatga aactgtcgca    134280
     aggccgtatt gaaagcctgg agttcattga cgctcaggcg ggtgaacaac cgatggctat    134340
     cgaagacaaa gccggcttcc ttaaaaagta ttctgaagca ttcggtatga actatgccga    134400
     agtgtctgtg gcctccaacg ctgaagggga gcaggtctat agtctgatcg attcctccaa    134460
     gcaaatcatc ggcaaagcgc agttcgttac cgatgatcaa ggtcgcgttc aggcgatcaa    134520
     tttcgcccac taatctcttt agtgtttcct gtttcaggcc gatacgatct gtatggtatt    134580
     tccagatctg tcggctccag aagttaagcc tcatcatcca agatccagta cagtgccggt    134640
     ggcctttgtg gcggaccgat ttattgcact gatactggat tttctgattt tatcacccat    134700
     cgtcagtctg cttgttgcgg gacttgttcg tcagaccaag acattctttc tgttgaatgc    134760
     gaattcggcg gaaggcgtgg tggcggccgg cctcgtggtg ctggccgtgg tctttatcgt    134820
     gacctttctg cagtctgtgt ttttatactt ctggcaggcg actccggggc agatcttcct    134880
     gcagttgcgg gtgattgctt atccggttta tcaaccgcgt ttgtcttacg cccagtgtgt    134940
     gattcgttca ctcagttgga gcttcagttt tgtgctgctg gctttgccgt ttatggagat    135000
     cctcagccac cctctgcgcc gggcgttccc ggatcgtgca gcggacacgc tggtgatcac    135060
     acttaaaaag gttcacgacg acggacctca tccgatcgaa tcgcgtttca tcaattcctg    135120
     gatgcgcatg agtttgcttt tcctgctgct gttcggggtg ctggggtact tcaagaccta    135180
     tcacagtctg atggcgggcg agtatcgcga aaaaggcggc actcaagtcg cggcctgcaa    135240
     agaaatgcgc ggcagtgcgg atcttgaagg tgtggctcgt ttggatgccg ctttgtcttt    135300
     gtatttgctc aatgaaattt ccggtgagtg tctggataaa gaggcggagg tggcgttgtg    135360
     gggagatccg gtcaatgccc aaccgctggc ttatcttgcc aaataccttt tggcggacgg    135420
     tgcggcccag gaacaatact ttagcaaaat ctgtgaagac tcgtcttcgt cgacctgtgc    135480
     gctggcgcgc tacatggcgg aagaggggga ccatgaggat cttgagctgg ccgatggccg    135540
     tctgtggacg actaaattcc tcaagtcaga agagctgttt gcctccaatg actttgccgg    135600
     cagtttgaag gcgatctctg aattgcaaaa gaatccgatt ctgcagtctg gtcttgaaaa    135660
     acgcttcgtt cgttctgtgt gggctttgcg tgatgccgag ctggtcccgc aaagtggcaa    135720
     tggcggccgt atgccggcaa gcgctgctga acaggaaagc tggattgacg acttcaaaga    135780
     acgttacgag gttccatgat catcccttgc ccggaagact ttaaagacta ttccaagtac    135840
     ccgctgacga tcacgctggc ggtgctgaat gtctttattt ttattctgat cttcagcggg    135900
     gtgaactcgg gtctgacttc ctcaccggtg ttgcaaaaag acgggctggt tctgacgggc    135960
     aggttgtact accagtatct gcaaaacatc ccggccgaga ttctttatga aaagccccag    136020
     tgggtgcatc agatgagttc gggcaatacc gaacagatgg ggattctggg ggcctttgca    136080
     ctgagagaca gtcgctttct ggaacaggct gaagccggcg tctatcgcgg tgacgaagtg    136140
     cagatcgctg cctggaaaaa gaacatcact gaattccgca aaaagtatca ggaacaactg    136200
     ctgtatcgct tcgggctgag ttccggggcg aaggggcctc tttcctggct gacttatcag    136260
     ttctctcatt caaattggat gcatctgctt tcgaatctgg gtttcctggt attgctgggg    136320
     gcggcagtcg aagtgatggc tggaagctgg gtgcttttgt ttgtctatat ggtggggggc    136380
     atggccgggg gcctgggctt cctgttgtct gatactcacg gaactgtgcc gatggtgggg    136440
     gcgagtgcct cgatcagtgc gcttttggca ttttattgtg tagccgaaac tcgaatgcga    136500
     gtgaagtttc tatattttgc atcgccgatg ccagggcatt atggcgcgat ttatttgccg    136560
     accctgctga tcataccttt gttcctggtc gtcgatctgg cgaacctgtg ggcgattcct    136620
     gaaggccttg gcggcggcgt tgcttacgcg gcccacctgg gtggcagctt gtttggcacc    136680
     atgctggggc tgatttaccg cgcgaaatcc acaccgattc tgactccatc ctgactctgt    136740
     aatttctata tacccgttga cagaaacgtt accggtgaga cacattaccg tccagaggct    136800
     ggagatcacc cccaacgttg aaatggcgga cccgaatgaa gctaagcaag ctcattaagt    136860
     cagtgattgt tcttacattg ttatcttttg ttggtgtcgc aaatgcggca aaccaatccc    136920
     aagcggtccc atactatggg gaagagttct atcgcgacct tcgcgccgga gtttccggtg    136980
     aggctcttca aaaccgaatc aaatctgtcc tgcagaatta tcatatcgcc gtaaaaggct    137040
     cttatgatct tgtggtgaaa aactgcatac aagggcaagg tcattgctac cgtcacacgg    137100
     cgatcggcta caaagcagcc agagtgttcc tgatggggaa gtactacctg gtgaaagacg    137160
     gcaatcagta tgcggttcgt gacgtgtact gcaactcgga ccgaggccct gaagacttcc    137220
     gcagttctcc gccatctccg ggctccatcc cgaacaacac cgtgatcaac gttgagcaca    137280
     cctggccaca aagccacttc actcgtcgtt tcccggatga tgttcaaaaa tccgatttgc    137340
     accacctgtt cccgacggat tctcaattga atgccattcg cggcaaccat cccttcggtg    137400
     aagtcactaa agacgtgatg gagctgaaat gcccggattc ccgtttcggt atcggcagcg    137460
     ccggttctga cgaggtgttt gagccaccac aaaaccataa agggaatgtg gctcgtgcgt    137520
     tgttctattt ctctatgcgc tatgaccttc cgattgatcc ccaggaagaa aacgttcttc    137580
     gcaagtggaa ccatgaagac ccggtagatc aagacgaaat gaaacgtaat gttgagatct    137640
     tcaagacgca aggaaaccgc aacccgttcg ttgatcaccc agagttggcg gatagacttt    137700
     ttgatttcta aaaaaccgtg caaattgagt tcatcacaaa agccagcggc aacccgctgg    137760
     ctttttgttt ttctaagctt aaaagaagca tctataaaca caaaaaagtt ttaaaaattt    137820
     tgagttttgc ttaaggactt ggcataaaat gggggaaatt gtaggccccg ggcataattc    137880
     ttaaaaaatc tgtaataagt ctcttgcaat cgtgtttttg ttatgctgca atcattttta    137940
     cgggaggggt gataccaagg aaggtactcg gggagcatga tgttctcacc tctattttaa    138000
     ttaaattaag aaaggccact ggaaacagtg gcctttttct tttttccgat aggtctttta    138060
     gaaccgggct gcgcgaacct ggtgcagcat gttcaggctg gtgccagcac cccacggagt    138120
     tcggcaatac aacttgttgg tcgtcgtcaa agcacagaac atggaatttg tggttccaga    138180
     atagttggtg gcgctaagtt tggcgaagct gactcctccg gaaatcactg tcggaggact    138240
     catgtaatcg ctgatccgcc agaagtgcac ggcaccactg gtagtcagcg caatcatttc    138300
     tccgttaccc atgacgactt gctgatagct ggcgccgccg ttcaccgcca cgggcacgtt    138360
     gctgtaaccg ttaccccagc attccagggt ggtgccggtg ataccacaag ctgcagagtt    138420
     ccccagggcc agttgggtgt agacccggcc gccattgatc agtgtcccgg ttgaatccgc    138480
     cgtgctgttg tgacccagtt ttcctaatga gccactgccc cagcagcgca cttggccgtt    138540
     ttccagaata ccgcagaagc gggccgtgct tagttgaatg tcggtatagc gatagcccgg    138600
     atccacgttg atcggggttg tgctaatacc agtacgcata atcgatccgg ccccccagca    138660
     atacacttcg ttatccaagc tgagcgcgca acctgcggtc gccacacttc ggatgatcgg    138720
     cttgaatttt acactggtgg gcaccagagt cggagtggtg gtggtgcccg gaggacagcc    138780
     ggaagccgag gtagaacccc atctatacag attcccggcc gtgttgatcg cgttgatgca    138840
     atagttgtcg gcagtcgcca tcgcttggat ggcaagaccg ccagtatgca ctagatccac    138900
     tttggggttg gtgctgttcg tatcacccag cagcgagttg gtgttgaccc cagtgcagta    138960
     agacgaatca gacaatccca ggcagatgac gcccttgtcg gacatgacct tggcgctgct    139020
     gaagtccacg gacgggtgag ctcttttcag cggatgaatg gtattggagc aatacgcacc    139080
     gccgtcgttg cgaatggcac agacggtgcc ataggccgtc gccatgtcct gataggaaga    139140
     gtatacatcc acggcctcca gcatcggagt cgccgttttc ggaacgtccc cgtagttggt    139200
     gccatcgcca aagcagtaag gcatatcatc gtcggcaata ccgcagatgg aaccgtcgtt    139260
     ggtctgaatg gttttccaga cgatattggt gttcagcaat gtcggcgttg agtaggtgat    139320
     gccgtcctga atactggtgt aaccaccccg gacctgggcg ccccagcatt tcagagcatt    139380
     ggtttcggtg atggcacaga catgggtgtt ggaaccgctg atttgcagat atttcgtcgc    139440
     accatccaca acggtcggtg ttggattgtt aacgctggtg ccattcccca gttggtaaaa    139500
     gtcatttcgg ccccagcact tgatctgctg gtcgtcacgg gtgataccac aaacataagt    139560
     gtaagaggtg acatcgcgat acttcacgcc ggaatcaacc tgggtcagga cattgtaggt    139620
     ggcggtggcg ttgttggcga tttgtttgta cgtgttgttt ccgtagcaat ataaatcatc    139680
     cgccagagaa atcgcgcaga tggtggacga ctgggccgca acgacttttt tgaacttggt    139740
     tacgccatca tcaatataat acggcgtgat cggggagccg gacacatccc agcagcgaac    139800
     acggtcatca gaggtgatac cgcaggccgt gtagtatttc aaatcaatgg acttataagt    139860
     cacgccagag tcaacaccgg ttccactgag tccgcccaca ccaccacagt aaacctggtt    139920
     ggtgtcggtc agggcgcaga aattcatgcg ggttccagtg acctgtttaa agttaagggc    139980
     cggttgggtg atggtaactc cggcggtggt ggccgtcgcc accccccaga cgcgcagttt    140040
     tccgtcatcg gccacggcca agaaggaagg ttgggtatag tcggagccgt gggcgatgct    140100
     caggattttt ttgtaactgc tggtggtgtt cttgatgata aatctttgac gtgcatttgc    140160
     accggcaatg tagtcaggtt gatttgtatg agtgatatag acatccaaat ccttgtcatt    140220
     ggtgtccatc gcgttagtta aagtgtcaaa agtgatttgc gctgacaatt gacctgccgg    140280
     cacctcgatg tatcccaaag caagattgtg atccaccata tagatcgcat cgccgctcag    140340
     attgtaatac acccggacag gtaccgtaga aactgtatcc agggtcacgc cgacagtgac    140400
     ggcagtttga ccttcggtga attttttgct ggcagcgctg aggctggcat acttcagtga    140460
     cgccttcttc caggtgcggg ttgtggccgc ggagtagtcc tgccacaggc cattaagtcc    140520
     attcagtccc accacacaaa gcaccatgtt gtcgccatcg acgttggaat tttgatttac    140580
     gaaaatacca gtggccgaac tgatttcggc actgtagccg gatgcgttcg agcacgccgc    140640
     atccttgcca aatttgtatt tgtaggccgt gacaccaata ccaccgactg tcagggcaag    140700
     attggcctcg ggggattttc cagtgggagc tccaaacacc gtcgccagag gaggctgcgt    140760
     ggaaagtgtg gtggtaaagg caaaggagtc ttggacgacg gagttgaacg tcagattccc    140820
     ggcgatgttg acagtgtcgt cattgtttcc agtcacagtt tgcacggatt gccactgccc    140880
     attggtgcag gacacgctgg tcgcattggg tgctgtgatg ttgatgaccg aaccattcgg    140940
     agagcaggtt ccggtcatgg tgaaagtcgg gccgacatag ccgttggcca ccgggaatga    141000
     aggggtgaca aagcgttgaa tggtgtagga tttcgaagca gaggcttctg ccgtgcctgc    141060
     gagcatcagt tctgccgtaa tattaagagt ggtgttgttg ggaacggtgc ccagcgcaaa    141120
     agacttgctc cacaggtttt gtgctgaaca cgtggtttcg cctgtatagc ttcctgaaat    141180
     tctgatggtg gcccctgcat cagagcaggc ccccgtcaga tccacggaat tgctgatatc    141240
     agccacggtc gccggggtga caatggtgat tgccggggca acatactgaa tgttggcgga    141300
     agtacattct gattcattcc cgaaggcatc gcggaatctc gcacccaatg acagtgtcgg    141360
     accgttgccg gtggccgtga aggtttgggt gggagcaatc gttttccagg tgccgacggt    141420
     ggcacaggtg gagtcttcag tcagattgta ttcccgcatg taggcaggga cattgaaaga    141480
     cacctgcagg tttttcgaac tggttttagt cgccccgttg ttgatccgga tttcttggcg    141540
     gatggaattc ttgggcatcc agtacatcgc aaaaccattg ccggtgtttg cggcatcgga    141600
     agtgaagttg aaagtgaagg ggccggcctg ggtggaagcc atcgcttcca agcctgcggt    141660
     gacaatgctt ccagacgcag agtaaagtgt ctgtccgttc tggcgaaccg tcacaatatc    141720
     tttgtcagcc tctgtgttca ccgcagcggc cagaaggatg tccatcggct gtgttgtatt    141780
     cacggtaaag gtgcagtttt cgttgttggc gtaacccgga ttctgcccaa gcaaagtgct    141840
     gcccacgacg ccgaaaatcg cagttgatga ccccgcggta cagatgttta gaattgtgga    141900
     agtatcaatg atagggatag agtctgtgaa gcactggctg atgattccgc ccgcagtgcg    141960
     gaatctggct gacacgttgt aggcccccgg ggccgcagaa gccagattcc agttgtgcgt    142020
     tgctggggtg cgggcctgcc agttgtcggc tccggtgcaa gagtcattgt taaaaagggt    142080
     gtattctgca aagacctggg gaatatagaa gcgcaaagtc acagcctgag ccactgccag    142140
     tttcatctgc atcggattga tcagaatccc catggcaccg gaatagactt caattttttt    142200
     gacggctgaa agatttccgg cagcgtcttt ggcctgcagg aacagatagc ttttgccgtc    142260
     agggaaagtc atgttgcttt taaggctggt gtaaggttca gcagcgaatg tgaaaagatc    142320
     cgtcgtggat ataaaagaac ggaaggtgca tttgtcattc agactttggc agtcccaact    142380
     gacgaagcct ttatcattta gaataatgtc cggcatgctt aaaagctgcg gcgggtttgt    142440
     gtccttgttt agagtcactt tcacggactt gactgctttg gtttcatcag caagttcagc    142500
     ttgttccacg atcaaatcaa cttcaccttc acccagggaa gccgtgtcca gttgatatgt    142560
     ccaatggcca gtggttgggc acgggaattc ttcattgtca gcagcaccca gcagtaatgt    142620
     cagagagcct tcggccacat cgcactgacc ttcaagagtc agtgcggaag tgttcagctc    142680
     cacatagttg gtatcagggg aagtgagcag tttgaagtct tctttggtca acgcctgaat    142740
     cacggaatcc aaggtacaac ctgctagcaa acttgtaagc aggacaagga aaatccttga    142800
     gatcgatttt attcgacttg gtggtaacgt gccgtaaaag atcatgattt cttatcggta    142860
     tccatagctc ttttgtgagc tttctttctt aagaagtgtt cggctttttt cgccgagaat    142920
     tcatgttaag ccaattgcag ctgactgcac ccggggtggg gagagtgttt taaattgaaa    142980
     cattgttgtg ccgctttggg atctgtaaat aaaaattgat ttaaggctta tcgaggctgc    143040
     gccgaaattc ttttcatgaa aaagattttg ggtatttttg ctgttctctt cgctgttggt    143100
     tgctcaaaac ttggtgaaga tcccagcttg tcggaagagt cgctggaagg tggtcaatgg    143160
     atcgcgtttt gttttggcgg caattccggc tgggaaactc gtaaagcccg ctatgatggc    143220
     acgaactatg tggaaagtgt tgaagtgtca gctgatagct actgcaatca acctgcctat    143280
     agcattgaag aacaggggac atatcttgtt ggagataagt tgagtggagg cttgatgcga    143340
     aaactggatc gaacgttgac cagcattaag atcacaccct tgtcgggttt gggtgtaagc    143400
     aatctgaata gcggctccgt gtgtggcttc actgactgga cgatcaatgt ggctcgtgag    143460
     gtcaccgggc tgtattgcaa tgggtccgtt ccccctgcga atacgactta ctatgacctt    143520
     tatttaattt tcccgctttc gattgatgat ccggaagatc ccattgccaa aggagatttg    143580
     aactttggtt tccgctgggg tggaaatgac ggaagcacgg aagagaccag accggactca    143640
     gtgacggcgc cgaattttaa aaggcatccg ctttaaattg cggatcgtaa cttttcaaca    143700
     gcggcgtgtc ggcgtgggga agacggccgt tgttcatcca tttcaagata tcctgcacca    143760
     acagtacatc catcacatag gcctttgtgt tcaccagtgt tccgcccagg cctttgcgcc    143820
     cccagggtgg gaaaaagacc ggataacatt tcagttcgtt ggaaacaact tcggtaaatt    143880
     ctgcgacggt gatgtccggg gtgttggctg ctgcggcaat caaaaccact tgatcttcat    143940
     tcagggcatc gcagtacagg cgtttgcctt tcgccgcacg ttcttcattg gtcacgcgca    144000
     aggatctttc agactgttca atgaaatcca ggatgaatcg ttcagaggta acttcggctt    144060
     tggcctgaac agccaaagaa agggcaaaaa caaaaagaag aagcgtcttc ataaaggtcc    144120
     ttcgggttgc taggggatgt attcaacggc cctgcagttg cacaggctgg gccagctcag    144180
     ctcgtaaata aggggggatc gctggtgcca gagtgaagtc tttgcccgga gtgttcacgg    144240
     actggtcagg tttaaaaaaa agagcccccg gtttcggccg ggggctcttt gagatgatac    144300
     ttttttttga ggaggactat tcttccgccg gagcaaagcc gcgacgaagt gtgttctcag    144360
     tcacgcacgc tggttccatg tactgtttta agtaatccgg tccaccggtt ttagaaccga    144420
     taccggacat cttgaaccca ccgaatggat gacggtcgac cattgcgccc gtgataccac    144480
     gatttacata aagatttccg acttccagtt cctctttcac acggttgatg ttcgcagggc    144540
     ttctggagaa cacgccaccc gtcaacgcgt actctgtgct gttggcgata tccaacgcct    144600
     gatccaggtt tttcgcgcgg atcacagcca caaccgggcc gaagatttca gcctgagcca    144660
     gcttcgcatc acctggaacg tctccaaaga tcgtcggagg cgcaaagaac ccgccgcccg    144720
     gtacagagcc cttgaacagc agcttgtggt tcttttcagc ttctgcgatc gttccaagga    144780
     tacggtcgta agcttctttg tcgacaaccg gacccatgta agcttttgga ttttcagccg    144840
     ggtggatctc gatggatttc gctgtttcaa ccagacggtc cacgaaacgg tcgtaaactt    144900
     catcaagcac gatcacacgg ctggcagcag aacatttctg accgctgaaa ccgaacgcag    144960
     aatagatcac gccatcaact gcttcatcca gatccgcatc gttgtcgatg atcacggcgt    145020
     tcttaccgcc catttcaatg atacaacgtt tgacgtgctg ctgtcctggt tgaaccaccg    145080
     ctgcgcggtt catgatgtgc aggcccacgg ctttggaacc tgtgaaggcg atcgtggtcg    145140
     tgtacttgtg gttcacgatg tattcgccaa cttcttcacc gtaacccggc aggaagttga    145200
     tcacaccttg tgggaatcca gcttcctgga tcattttcat caagccccag gcaaccactg    145260
     tggattgctc tgcaggtttc atcaccacgg tgttccctgc aacagccgcc gcagtcacca    145320
     tgccggccaa aatcgccaga gggaagttcc aaggagcaat caccgccgtc acaccacggg    145380
     atttgtagat gtagtgagac agctcacctg gcaagccacc cacacgaagt ggtttttgca    145440
     actcacgcat atggcgggca tagtaacggc agaagtcgat ggcttcaccg atgtcaccgt    145500
     cagcttcagc ccatggttta cctacttcaa gcacttgcgt ggcaatcagt ttgaagcggt    145560
     cacgggtcat gatgtcagca agcttgtcca ccagggcagc gcgctgttcg caaggaacgt    145620
     tcttccaggt tttgtaagca gtttgcgccg cttgcatcgc ctgttcagcc tgctcggttg    145680
     ttgccatctg gatcttgccc acgatctgat cggactggga cggattcaca cggtcaaaga    145740
     tcttgccgga ctgaagttcc ttgttgttga tcacaatgtt tacgttcacc ggcaaagaag    145800
     ccttggcttc agccagtgct ttcagcattt tctcacggtc ggcttttacg gcgaaatcca    145860
     aaagtggttc attatagaac ttgcctggtt ttttcggaat aaccggagac gtcggagtca    145920
     aaccttgagc cggatctttc aaaagctccg ccatggattt gttgtcggcg aacttgccac    145980
     gcagccagga ttcgttggac gtgttttcca gaagacggcg taccaggtaa gccatgcccg    146040
     ggatcagttc gcccaccgga gcgtattcac gcatgcggta gcccatgtcc acgattgttt    146100
     ttttgatggg ttctgccatg ccgtaaagca tttggaattc caaagcctct ttcgggatgt    146160
     tcagtttttc tgcgtaaagc atgcacgccg ccaaagttct gacgttgtgg gatgcaaaag    146220
     cagggcggat gaatttgatg ttttccagaa ggtacttcgc gcacaactcg tagttggcgt    146280
     cggattcggc cttgttggtg taaaccggca ccggccatcc acgctgttcc gcttcgatgg    146340
     tttcgtaatc ccagtaggca cctttcacca gacgaaccca gaacggagtg ccgcgttttt    146400
     gcgcgaactc tgtcagggat ttgacgtctt cgaaggaatc gcgcaggtaa gcctgaatca    146460
     cgataccaaa aaacttgtaa tttttgaact caggttcgtt gatcagctct gtgaatactt    146520
     ccagtgtcag gtgtttgaca gagtactgtt ccatatccag attcacgaac acgccttttt    146580
     ccatgcccag acggaacacc gggcgcagac ggtctttcag gatttttttg gattcatccc    146640
     aggctgcatc tttgatctgg gaataaagcg ccgtcatttt cacggacacg tttactttcg    146700
     gcaaagcacc ttcatggtcg cggtcgatct gcggaacttc gtcccatttt tcagcatctt    146760
     tcgccagcca ggtcacaagc tccatgtact tgttgctgta gtcttgcgct tctttttcag    146820
     aaagtgtcgc ttcacccaaa atgtcgacag tgaaggtcat tttgtttttg cgggcttttt    146880
     tcaaaaccgg caatgcttca tccgggcttt cgccagtgat gaacatcttt gccataccca    146940
     taacgttctt tttgatcgca cccgccatca ggcccggagc caaagaaccc aaaccaagtc    147000
     ccacattgaa caccggaggc agggtgccgc cgtcttcaga gaagtattct ttcaagtggc    147060
     gcgcgacttc atcacccgag ttgatggagg gaagcacgtc cacgaaacgg aacatgttgg    147120
     ttttgaattt ttcgtttttc atgctccatt ccatgatgga gccataccag aagtctttgg    147180
     agaaaatgga agccttggac tggctttcca tgcgtttcag aatctcttca ccacgggaga    147240
     caatttgcga ctgaatgtcg ttcatatgct tttacctcta cagaagggcc gcatattctc    147300
     acggggatat aaaaattcaa gcgattagtg ttccgggaat aggggtggaa acaggggatt    147360
     gacgcgaatg gctagcgagc cagccattgg tgtttcattt tacccacgat ttcggcttcc    147420
     agagcgtcgc cgcggcgaat agggccgact ccggccggag tgccggtcaa aagcaggtcg    147480
     ccgggttcaa ccgggaagtg ctggcgcacg aattcgatca ggttttccag agaaaaaatc    147540
     atctggttgg tgttccccat ctggcgggtt tcaccgttga tttttagaat aatttcaagg    147600
     ttcttcagct cttccagatc gtccaccggg aagaacgcag aaaggggagt ggcgcccttg    147660
     aagcttttag ccagcgtcca gggatgacct ttggatttca actggttttg tttgtcccgg    147720
     tcagtcagat ccagggcgat gcaggcttcg tcaatttgca ggttttcatc aaactgcagc    147780
     gccagttcca cctcgtggtg aacctctttc atccaggctg gaacaaccag ttctttggcg    147840
     gccaaagtgg cggtgcttcc ggctttcaaa aagatcatcg gttcggtcgg aacctcgtta    147900
     cccaattctt ttgcgtgttc agcgtaattg cggccgacag cccagatatt gcgaatcata    147960
     gttgaatcct ttttagttcg atgaactcaa aaacaccgtc ggaattcaca tgaaaaccaa    148020
     cgtgctggca gggactccag tgggaaaact cagcgtcaga aagatcttta tcagcagggg    148080
     ccacccccat ggcttcaacc acccagtcat agtgggagca catgaaaatt gtcgcctcac    148140
     ttttggtggc ggcattttcc agcagcttgc tgatgcgttt acgaaaatca ctcagggttt    148200
     catcgccttt ttgttctagc agcgcgtcct gggtgatcag gggcagaccc agatgctggg    148260
     acaggggacg gaaggtgctg tgggtgcgct ttttaggaga cacccaaagc tctgttggtc    148320
     gcggcaattc ctctttaagc accttatcga gcagtttgga ggcttgagca tgtccctcgg    148380
     ccgtgagatc ggggtctccg gaaaaatcca tggctttctg ggcgtgtcta aagacgtaga    148440
     tcttcattgc ggcgggctct cttctgcttg aaattagggt cttgctttgt tagggtcatt    148500
     tttccataaa gtccgggagt ttgtcatgag taaagaacga gttcatcgct ttgtatccaa    148560
     agatctgact gtgcgtattg ccgcagtgaa tgcgactgaa gtcgttcgac acatgcaggg    148620
     tctgcaaaac acttatccct tggccacggt ggctgtggga cgcagtatgg tcggcgcact    148680
     tttgatggcg gctcagctta aggatgatca aatggtcggc ctgcttttcc gtggtaacgg    148740
     cccgttggga agtgtctacg ccgaagcctc ctacaacgga cacgtgcgtg gttacaccgc    148800
     caacccacaa taccagccag ccaattatga caacggcttg tctttgaaag acgccatcgg    148860
     catcggtttg ttgagtgtgg ctcgacatca gccattccag aaacaaccgt tccaaggaac    148920
     tgttgaattg gtcagtggtg aaatcgggca ggacatcgcc cactatctgc accagtccca    148980
     ccagatccgt tccttggttt cgttgggcgt ttacctggac acgtacggca aagttcgttc    149040
     tgccggcggc gtactgattg aagtcatgcc cggcgtggac gaagccgtcg tggaaagaat    149100
     ccagaaaaac tacgaagaca aaaaaccaaa catctcacaa atgcttttgg acggcgcgac    149160
     cgcagaacaa ttggtggctc cgttcatgga tggcatcccg tttgaagaaa tcgaacacaa    149220
     acccgaagtt gaatacttct gcccatgcac caaagaccgc gtgatgcgcg ctttggagct    149280
     tttgacggtg gaagatttcg aagacatgat ccaaaaagcc gaaccagtcc acgtgacttg    149340
     tcaggtttgt ggtcgtcctt acgaagtttc cattcctgag gttcaggagc ttaaagacaa    149400
     acttcacaaa gagtctctgc actaggtttt cgggtgcgcg ccggcttgga gtccagcaag    149460
     gactttcccg gcgctgcggg agacacggca tcctgcctcg tcgcttccgc ctgacggcgg    149520
     agggccatcc aggccccgcg aaggtctccc ttcggccggc aaagcccttg ctggcctcca    149580
     atccggtgtc atcgacatct gcacagcctc tgtgtaaagc ttttctttaa gatcaagatc    149640
     atccaaagaa ataaagacag cgcagggaat accaaacctg acaatcaacg tccgcgcgag    149700
     ataaacgaca tcgcgcgcgt gcgcagtcgt ctcctctaat ttctttttaa gtcatttcgt    149760
     tcgaagacgg attggggaag tcaccgggat ttaccgaccg cagtcggcct tcgcggggcc    149820
     tggacggccc tcccaccgca ggtgggaagc gacgaggcac gacgccgtgc cgacggagtg    149880
     tcgggaaagc ccggtgactt ccccaatccc cccttgttca aaccaaatcc cgatttcaaa    149940
     aaaggaatta gaagagcgaa tctccccagt ctatgagggt ggagttgatc cagcctactt    150000
     tttcttgggc tgtgatgcgg cggcctttgc tgatgtaatc taaggcctct ttgcgcatgt    150060
     ccagggcggt cgggccgtgc aagatcaaga cgccgctttc ggtgtcgtgg atgaagcttc    150120
     ggcggttcat gttgacgctg ctgatgaaac tcaacttttt gtcgatcacc aggattttgg    150180
     aatgcatgat cgaattgggt tgggtccatt caaagatttc tacgtttttc aaatggcggt    150240
     tgatgccttg tttgttcacg tcttcggcga tcttcggggt gccgtcgccg gcaaggtgaa    150300
     tacgggtgat gatttttact tttactttgc gttgaacggc gcggtccaag gccgcactga    150360
     ttgccacgga tgggcggaag tacggggtcg tcaagagcag ttcagactgg gcggaatcaa    150420
     tcatgtcgat atagaacttt tccagctgat agccgtcaaa gtagggcatc gaagtgatgt    150480
     gacgaaccag cggagtcgca tagggcagtg agcgcaggcg catgacctga tctgctgtgg    150540
     cttcttttgg cacgttgatg tttgtggatc ggtggcgttg ggtttccggg tcacgcatcc    150600
     agaaggacag catctgggcc atgacggatt ttacgaaggc ataaccacgg atttcgattt    150660
     cgaaatcgtc atagtacaca taagcttctt cgccatcgcc atagttcttc aggtactggt    150720
     aagccttata aaagggtgta tcgctgaaga tataagagtc gcggatattg cggcccccgg    150780
     tgatcaggaa gctgtctttg gtgttggtgc tggaatgacc aataatcagt ttcgtgtgat    150840
     tcacccggtg gaacttgtca aaccagccgc cgttgttttc atcggacagc acgtatttgt    150900
     agtactgcac tttgatattc ggaagaccct gttgcaaacg gtccagaatt gccttgtctt    150960
     ttttagtcat ggtgacttcc gggacaagaa tacgaatctg tgttccttgc tgaccgtgat    151020
     agcgaagagc actggacagc accatgccat aaaaatccgc cgagaagttc aaagaagaaa    151080
     cccagatgat gtcaaacttc ggagctttgg aaaaatccag ctcggccagt ggattctttt    151140
     tgttgaagtc cctgcggctt agcggtgagc ccgtcagcgc caggatcttt tgattgatcg    151200
     acacgtaagg gtcacgcaga ttcaccagtt tgtcgaaggt ctgcgggcag gtcgtatagt    151260
     tgaagtcctg cttccagaag aacgcggtca cgtcgttgcc gaagtttccg tccggacggg    151320
     cgcagatgtc gatttggttt gtcaatttga tccattcctg ggacacgcgg cccagatcca    151380
     ccagctgcag accgttggtc catgttttgg atttttccgg gtcatagaag gacagccggc    151440
     agtaattcac tcgcggagtg aaacggacac ggattttctg gccgttttcc tgattgtagt    151500
     accagttgaa ttcataggcg cggctttgct gttcgcttga aaagaaccag ctgcccgggt    151560
     gaatgatgtc tccatcgcat tcaagacggc ctttcaggta cttctttcgt gtgttatctt    151620
     tttcttcacg gaaaacggat cccggaaccg gaatatcatt ttccaggcgc aagacatagg    151680
     tttcataaaa catatgttca atcgggaagg agccctgttg ggagccgaat ttgaagtcat    151740
     ccattgaacg gattctaagc acttcttctt tttcaaacag gcgggggcgg aatgtggcct    151800
     caaaccacgg acccagaccc gaccattcac gcaagtaaag cttcgaggac agctggttga    151860
     tctcagcgtt gcgctctttc agcaaggctt caacataggg ccagttttca tgggcatgat    151920
     cgaggtcttt tcgaaatttt gcgttttcct gtcctttttg gaatagctcc tgattgtact    151980
     tccagtcttt gttccaataa cgggaaagtt cgacgtcgat ttcctgaatg cggttggcgc    152040
     gttcatcgtc atacatcaca gagctcggtg cgcgctgcgg gcccgtgcat gaagtcagta    152100
     atgtgatggc cagtaaaagg cctcccaaat gcttgttcat cagatactaa aacggctgct    152160
     ctgagggaaa agttaacgat tttccttaag aaatttccaa aaattaacat caccctgttt    152220
     cgtcgcctga acaatcttta gacacctctt tgggggtctt ggttgagggc agggcggacc    152280
     gggctttgct tgtgtttaag gtatggaaaa cacaagatct tcgtctcaaa atgagatccc    152340
     cgtgaaatgg ctgtcggtct ttgcgatcgt aagtctggtg gtcgccgtac ttagcttcgg    152400
     ctacgaagtt caccgcgccc aggattctgt tcgtcagtac gtcgggattt gggaagacga    152460
     tattgcccgc gccaaacttt tccagggcga cccaacattg caaaataaaa ttctgaaaca    152520
     gcttaaagaa gtccacacgg ccgtagtaaa aagcgaagtt cagaaccctg aatccctgca    152580
     gtgcctgatt tccacggaag tgccaatcac cctgaactct ttgccagccg gaaaaatggc    152640
     ggtgtgcttc ggtccgtccg agttggcggt caaagctctg acttcaccgg tgtttatgtt    152700
     gggtgtggta ttgggtttga ttttgttggg gttcggctat cgccgtgaat ttttggcgcg    152760
     tctgcacgaa caaaagctgg aatctgaact ggcccgcaat aaagagattt cggaaatctc    152820
     gcgccaggtg gcgcatgata tccgcggacc gttgatggcc ctgacaactt taagccagct    152880
     gtcccatgat atgagcacgg aaaagaaaga actgtttgat cacgccgtgg cccgcatcaa    152940
     aggtatcgcc gaagatctgc tggccaaggg ccgcaaacaa aatgcggagt ccagtgcgcc    153000
     ggcagttaaa acatcacagc aggatctgac gaacttgatg gactccttgt tgaaagaata    153060
     tcgtttctct catcccgcag tgaatttcac ctggcacaaa cacattcatt ctgatgtggt    153120
     gaaggtgaat ctggaatcag taaaaatcca gcgtgtggtc agtaatcttt tgaacaacgc    153180
     tctggaggct ttgccggaat cagaggctgc tattaatctg actttgatgg agcgccagga    153240
     tcattggctg ctgcagatca tggacaatgg cagtggcatc cccgaggaca ttttgccaaa    153300
     gctggcccaa gaaggcgtga gctacggcaa agacaatggc aatgggctgg gtctgtacga    153360
     tgccaagaaa accctggaat cagtaggcgg cgacctgcag attcgctccc gtgtcggtgt    153420
     cgggactcag gtgatcctgc gattccccaa gtctgctgag gcggtgcttg accgcgcggt    153480
     ggcgactcat catccttaat ccatgtaccg cacatggaag tatctcgtag taaaaaatga    153540
     acaggacctg aaaaaccggg atcgcttgca aaagctggca aggcatcgcg gtcttccggg    153600
     ctttgtgatg atttttgtat tttccacctg tgccctgatc agtctgggct tggcggggtt    153660
     ctttgcggcg atggcctata cccataaact tcccatgtgg tcttcggtgg ggagtgctct    153720
     ggcgatgctg cttttgaccg ggacctttgt gtttggtgcc cgcgtatttc tgcgcgaacg    153780
     gcagatggat gttttaagaa aaattttacg tcatccggat cgtggaagct tcgtcaccgg    153840
     caagttgacc tcttttaatt atgtggcggg tgacagtcgc aagttttcgc gctatttcgt    153900
     cgaaggcgaa gccgaaggcc ccgaaggtca gcccctgttt gtcggggaat tctttgatgc    153960
     ggatatttgg cccttcacaa cggaagaaga tgatcgtcag attcaaaaag gcgatgactg    154020
     gtacgacctg aaggggaagc gcaggacatt gcctgttcct gcctatttca tctgtgaagc    154080
     aaaggatccg aaaatcgggg tgctggtggg gattgatcag tcgctgctga acgatgccct    154140
     gaaacgcagt gaaaagaaga ccgtttagtt gtcgatctca attcccagaa cattttcgat    154200
     ggtcttttcg taaatgtctt ttttcttggc tttggctggg actgtctcgc ggcggcgttc    154260
     actgccagcc gttgccggga aggccgcaaa cagatctcgc tccttgccat cagcgctgat    154320
     ttcgaattta aactcacggt ctttgcaaat cgcaatcaaa gcagcgctgc cactgaaggt    154380
     tttcgccgcg gtgatttgca gttcgctgat attcagggtc gtgatcttga ttttcagatc    154440
     ctgctcgcgc gggttttcaa tgttttcaat ggcacacggg aaagtcagca acgtcggatt    154500
     ctgatgactt gcaaacacct gagcagggaa ggctggttcc tgcggggttg taccggtgaa    154560
     tttcatttca ctgaccacca gaccccaggg gttttccagg ctgcgttcgg tggtgttcag    154620
     acggatctgg gtggtggcga acagctggtt cttttgagtg tcttcagtga tctgaagttg    154680
     caagagggct ttgtaactgc catcagaaag aagcttcaga ctgatcagcc gtccgatctg    154740
     ggacatgttt ttctgctgca ctttttcgcg caggcggctg acttcgcgga tgcgttcttc    154800
     acccagtttg ggtgccatca aaaatgccag cgaggtttgc gactgccaaa agttgttgga    154860
     gtcatagtta aagaaacgtt ccagatactg gcgcaaaaag gtcatgcgct ccatttcgcc    154920
     catctggatg ttttgcaggg actctttccc ggcatcaatg gtcacggcga ccacacgggg    154980
     attgttctta agctgccagt acaggtaagt gacgaccgaa gcccaaatca ccgaagctgc    155040
     cagcaggacc gacaaaaccc gggttttcat tattcacctt tttccaaagg caggatttcg    155100
     atcatctgat cgcggtgata ttttttgttc gggccttcat cgacccactg gtcgattttg    155160
     taaagtttga ttttggcttt gccgctttgg aagtattttt tgtccgcttt gccggtggtt    155220
     tctttcagca aagtggccgg accattctgg aagaagtcca attgtgcctt catcttttca    155280
     gtttccaggc gcatcagttc catgtctctt tcgtcgttat aatagtagtt ggcagccacg    155340
     gcagaaacga cacccaaaat gccaccccag taaagggcat gcagttcagg acgttcatct    155400
     tccggggcgg tggcagcacc aatcgcagca cccacaccga taccgattcc ggtggtcgcc    155460
     aggcggcttt tttggttggt ggcacaggca gacatcagca ggcagaatcc aagaagcaaa    155520
     cacattgatt tcatgtaacc aatgttaagt ttaaaaccgg gatcaggcaa actctacttc    155580
     atgagatgtt tgtaaagagg caggtacatg tcgtcttcgg gagtaaactg cagatcctca    155640
     cggcggggac tttcgttgaa ggtcaccgga gcattaaaga tcagggccag cggacagcgc    155700
     tcagccgctt cacccatcat taaaactgcc gagacagcca gactgtcggc gagattgatc    155760
     ttggtcatct tcagttcacg gccaaagatg tccttttctc ccaccatgtt gcgaactgga    155820
     tcaaagcctg caaaggacag ggcgatgccg gtcacaccat tgcgcaaagg actggtgtgg    155880
     gaatccgtca cgatgatgcc caggtttttt agtcctgtgc gcttgcaaag ggactggcgc    155940
     agtttttccg cagaaagata cggatcttgc gggtacagga tatagtcgcc gttttcagaa    156000
     ttggattcat caatcccggc cgcaggcaac agcagacctt ctttgatcgt caaggacacg    156060
     ccatgaccga tttcacccag gtagtgatca gcctcgcggc ggatcaggtc ttttttgtcg    156120
     atgctgttta atggaaccag gcggttttcc gccaaagaga taatcttgga agtgatggca    156180
     agaaggacgc cttcctgcca ttgggatttt tcgacatgag ccaggatgaa ctccgccagg    156240
     tcctcacctt gacggaaaat ctctgtgcgg atcggggaga tcatcagtgg cttcatctta    156300
     gtggcccagg cgctggatga tagcgtcggt gaaggacacc gtcgtgcctt taccacccag    156360
     atccccagtt cttgcgttga cgtcagaaag tgcggcaatc aaagccttca tgattgcatc    156420
     ggctttggca ttttcgccca cgtgctgaag catcatcact gcagattgaa gaagtgctgt    156480
     tggattggct ttgttctggc ccgcgatatc cggtgcagaa ccgtgaaccg cttcaaagat    156540
     cgcgtgattg gcaccaatgt tggcgccagg aaccacaccc agaccgccca ccagacccgc    156600
     gcacaggtcc gacagaatgt cgccgtaaag gttttcagtc acgatcacat caaactgctg    156660
     aggcttggtc accagctgca tgcaggcgtt atccacgatc acatctttgg ttgtgatttc    156720
     cggatactgc cagcccactt cctgcgccac tttaaggaac agaccgtcag aaagtttcat    156780
     gatgttggct ttgtgcacga tagccatacg aggtttgccg gttttctgag ccagatcata    156840
     agcataacgg gcaatgcgct cagatccttt gcgtgtgatg cgcttgatgc tttctgcagt    156900
     gtcttcatcg accatgcgct caatacccgc gtaaaggtct tcggtgtttt cacgcacgat    156960
     ggtcaggtcc acatccgagc aaacgcactg aacaccaggc aaagaacgaa ccgggcgcac    157020
     gttggcataa agatcgaact tttgtctcat ggtcacgttg atggacttgt ggcctccgcc    157080
     gacgggagtg gtcgttgggc ctttgattgc cagcttggtt ttgttgatgg aatcaatggt    157140
     ggtctgaggc agcaattcgc ccagggaatt cagagccact tcgccggcct ggtgctcttc    157200
     atattcaaat ggagcatgga cgtgtttaag aacgcgaacg acctgagcca taatctcagg    157260
     gccgatacca tcaccgggaa tcactgtcag tttcatcatg ggggaccttt ctggttgaaa    157320
     ggttttttct tatcaaagat gcggtctttt tccaagggtt gaacgtcgcg cgcgcggctg    157380
     gcgggaggag cttttcttca gctcaccacc agggaaggaa ggatgtggga tgtgttatgt    157440
     ggaccgctaa ggtttccccg attggggtgg ggtccgattg tctctatttg agacatgcat    157500
     cccactaaag caatcagcgg gccagtttga atgggatcct tttgcaccac actttgcggc    157560
     gaaggggtgt ttaaagcttt tacagggaaa acatcctatg aaatcaaaca cttagagtga    157620
     ttttaagggc ctgtcgctaa acctgacggc ttttccttgg cgttggccgg ttttaaggcc    157680
     gcttctgggg gctgttaagt tgttaagtaa aaccagtggt ttagggggat ttttcggtcg    157740
     ggggcgaggt ggccctttcc ttgtaatagt tcaaggcaga ggaggtcgct ctcatgtgga    157800
     agtggcttgg gaccgcattg gtcctatcaa tagcattaat cgttcaagcc tgcgctccga    157860
     aatcccagga agactgtggt ttcgtgcaaa acgtgtatgg cgagcgtatc tcctggaaaa    157920
     gtgatgctcc agtgacgatg caactgcatt cctctattcc ggattccatg gtgcctgcga    157980
     tcctgcgtgc ggcagaaacc tgggagcgca cagccggacg taagctgatc aatatcattc    158040
     aatatccacg ttatagcgga ccgattgttc cccataaaga cgggcagaac atcatctatt    158100
     tgatggatac ctgggaaagc aaccgagctt cggaacaggg ccggaccagt gtttattgga    158160
     tcggggacct tatcaaggaa gccgacatcc gtttgaacgc gtatgacttt aatttctatt    158220
     ggaataacca gcgcctgacg accgccgtga atccggcgcg gaaaacatcc ggagaggtca    158280
     atattgaagc tttggtgctt catgaaatgg ggcatgtgct gggcctgaaa cacaaggacg    158340
     gcgcgggttc cgtgatggcg acctatttgt ccagtggtga cgatcgggtg aacctggctg    158400
     aggtggattc ttcagccctg cagtgcgagt actagcgccc agcagtgtaa aatgtccatg    158460
     taagtttatt taagttgttg gaattgaaag aagctaacta gactttgatt tcgcgcctga    158520
     aaacgcaggc gaaggagagc aagatgagag tgatcacatt ggataaaaac gcacaagttg    158580
     aaactgttgt gacggagtct gttgttgagt ccttctctct tgttacgcat aagtcttacc    158640
     atgaaatggc cgacatgccg gttgtggaag tggatgcgtt ggctcagttg cacgcaaatc    158700
     ttgaaatgct tcaagatctt caatctcgtc ttacatttgt gatgcgtgaa gttcgttatt    158760
     tgatgaaggt ctaaacggaa catctttccc tccaccgggg gcagaaaatt ttcgtactgc    158820
     gtacttctgt atgatgacag attaaacaaa ttccgattaa atctcggata tgaaacaaca    158880
     tcctgaagaa tttcaagcgt acttccagac tcatttcaac aaatggggcc taaccaaaac    158940
     tgaaagtgaa gtgggtggtt tgattcttct tggcttgagt ctgcgcgaaa tcgcggacag    159000
     acgaggcacc tctgaaacga caactcgtca acaagccctg agtctttata agaaagcctc    159060
     agtggaagga cgccatcagt tgtcggctta tttcctggaa aatcttctgg cggcgcaaac    159120
     gagcgctaag cctttcgttc aaagcggttc gggagccctt tagggatgtg atagacgacc    159180
     cagtcgccat cgcgctgacg ggtcatgccc tctgtgatga ccggcttgtc gaaagcaaac    159240
     tcttcccgga atgtctggaa gtttgcgctg ctgacacttt tgccgtcttc ttcaatcttg    159300
     tctttgaaag atcgctgacc ggacacggtc gcacgatcat tctgaatcgt cactttcacg    159360
     gaatcctttt catgctctgg cacgtaggcg cgtagaatat aaaaatcagg attctctttc    159420
     atctggctgc cacggtcttc gaccttgtag aacgggtcag cctcttttgt ggcgtatttt    159480
     ccggcggcct tgacgaagtc ttttcgcgtc tcagccagtt cgcgcacata gcgtttcttc    159540
     tgaatgttca aagattcgcg gttggcgtcc tctgttttca tgtaagtgct ctggaagcgg    159600
     tcgttctggt tgtccagcgc gttttcgtaa gcgactttct gatgctgcag acgggaagag    159660
     tactgtttgt tcagatttcc ttcgcgggat tcccactggg tctgctgctg atcatagcgt    159720
     ttggcaaaat cattgtcctg gcgagccagt tgtttttgct gcttttcgtt ttcctgtacc    159780
     agaacctttt caccgcgctc acgcagttca ccgtattctt tttcattgcg ggtgcgcacg    159840
     cgctcttgca cgttgcgacc gcgctcgact tcatttttca ggctggcatc gttctgagtg    159900
     cgctgctgtt ccaggcggcg atcgctgaat tcattcaact gggacatgtc cttgttgtat    159960
     ttttctttgg cgcccttgat gtcgtcagca cttttggtgc ggaggtattc cacgcgttcg    160020
     gaagcgtctt tttcaatgct ggccactttt tgacgggaat cagtctgggc gcgggcgatc    160080
     tgctcggtgc gtttttcgcg ggtggaggtc agtttgtcgt cataagtttg tgccagagct    160140
     tgagtgcggg agttgtattt ttccgtcaga cgctgacgat cctcaatggc ttcggccgcg    160200
     gcttgctgct gattcttgcg aatgtgattg atcgcggctt cattctgttc ctgaaggccg    160260
     gcctttttgt cgtggtaata gtctttaaga tcagaaagct gggcttcatt ctctttcacg    160320
     agctgctttt ttttgcgcgc gtgatcggct tgaagttcac tcaaatccgc ttgctgggct    160380
     tttctcgtgg aattgtcaat tgacgacatg aaaccagtgt atcaaatcga cacacaggtt    160440
     ttaaggagcc ggggcgggct cggccggaat ctggcctttc gggttggggc agtggggttg    160500
     aaaatcaccg gtgcgcccat agcagcgcca ggtgtcgatg tatgtgacct cttcatcggc    160560
     ggcgacggga tagtaatagc ggtattgaac gtgatccaag gtgctttcaa ccagacggaa    160620
     gtcctgtgtc tgtgctgcct gaggatcggc ggactttttt gtgatcttca gaacaaagac    160680
     ccggtactcg gcctgagcaa aggccggcag cagaacaaat aagaaagccg ataagaagat    160740
     ccgatatttc acagttcttc ctatcggctt tgcggtggga atcttgaaag acaccaaatc    160800
     cgacctcttc agaatagcac tctgtcggca catcgcatta aataaccgca gtgatgtcga    160860
     attaatactc taagctttag acgaaatatc gaagatccca aattggctga agcaagtcgg    160920
     ggaaagtgtg caaactttaa acgaaaaaac gggaattatg agttcccgtt ttcgttagtg    160980
     tgcgtgttcg tggttggcgc ggaccgtgtt ttccacgatg tggaagtagg ccctgaccag    161040
     catctgatag gattcctgat ccagagcctg caaataggcc attttttcga agtaggtttt    161100
     tttggcaatc agctctgtca tgacatcctg gaccttcttc atcttatcaa agctgtagaa    161160
     gtccttatcg tcgctcactt ccttaaggac cgtggcgatc gacttgttgt caaaaagaac    161220
     atgaacaccc atggcggaat gagacagcaa agcttccatt cgttccagac ttgtttcttc    161280
     tatgttgacc aagagcgcct cctgctgacg tcttaagttg aatggtgagg aatattgtcc    161340
     acagttgcaa gaccaaaagt acttctatga caggggccgt cgtgagtgtc ttttttctag    161400
     ttgttggctg aagggattgt ctcaataatg aaaaggtgaa ggatacgaaa cgaatggcga    161460
     aaacaaagac ccgcgcaaag aagaaaccaa gcacctcctc tgaaaaagaa ctcatcttgg    161520
     tggatgaggc tgctggactg atttttgaga atgaaaaaga cctttttggc tatttccaaa    161580
     gcgccatcga caagctggaa gaagagtata ttgctctgcg ttcggctgag gatttcactg    161640
     acgaagagca aattgaacgc gagcattatt tggagtccac actggacgaa ccagatgaag    161700
     tttggatgga tgacaagact ttcgaggatt ttgccatcta ccacttcatt aaaagtttcg    161760
     aagaaggcgt tgatgccttc aaatatgtcg ctgtggctta tgtgtccagt gaagacgaat    161820
     atccatcatt cgtgttcatc catttcccat ccaaagacag ccgcgtttgg cagaactatc    161880
     agcgcggtga aatggtttac gataaaacct ttgaagaggt ttccgcagga tcagtagaag    161940
     gggatgcgat gggcgaaggg gatcctttgg ccatgggcct ttatcaggcg atgctaaaag    162000
     tccgtgggga aaaagacatc ccacaggaaa aattcaaaga ctacgccgac cttcgtgaag    162060
     agaccatcga aagcgctgat gaaatctggc gcaagaacga tctggatgga aacatcctgg    162120
     tcagcttcat ccgcgagttc ccggatcacg aaaccaccaa ggatctgatc tatatcgcgg    162180
     tcactcagga agacgaagac tccaacgtgc attcgttgtt gttctcattc ccaacgaccg    162240
     acaagacgct ggcagatcgc taccgccaag gcgaaaactt acaggccgaa gaagtcagcc    162300
     aggaatccgc ccactgacgg tcggtgaaaa aggcccatct gactgcgttg tcggcggggc    162360
     ttctcgcttc gacgtgcagg agcacgcctg cgctgcgagg acccacctcc gccttgcatc    162420
     tgaacctttt tgaccaaccg ttaaaattgc cggttttaaa aatgaaaaaa gccactctgg    162480
     gggaagagtg gcttttttgc gtttgggggt tgggacttat tagaagcagt agttgttcgc    162540
     catggactgg aactgggaag tagagaactg accagacttg ccatagaaag ggtgcagctt    162600
     ctgcaggaca ccggcgcggg tagagccgtt gtcgttagcg tagtctgctg ggtttgcagc    162660
     aaacagtggc aacagaccgt caaccgtgtt gatcgctttg ttggtggatg catcgtagtt    162720
     ggagatcttc agtgcatcgt attcaccatt tggatctttc agatcaacca ggatgttgac    162780
     gttgttgaag aaagtctgtg gatctgtgta acccatgccg gaagcaacag tcacaacatc    162840
     agaccatttc aaagtcgtct tccagccagt caggtattga ccgttcgccg ggttcatcaa    162900
     agcgaagttc aaagcggaag tgtccaggtt ggtgtaaccg gatgggtttg ccagccattt    162960
     ccacaaagag atataagaac cgccggtttt gaaagtcgct ggaagtgaag tcaggcgcag    163020
     gtaaacgtat tccatacgaa catagttgct ggaatcaacg aagaccttca ttttgccggt    163080
     gatgtcgttg ccagaggcct gattgcaata agccagagct ttagaagatg cagaaccaat    163140
     gtctgttact ggtgtgcggc tggaagaatc ggtagagcct gctacctgct ggctggatcc    163200
     gcaagctgtc aacatggaca gtgcaccgag tgtcagaaga gttgtgaaga tttgtttcgc    163260
     atttttcata aagcccccta atgccaatct ataaagcaac agcggtgcca taggtcagac    163320
     tgagacaaaa taaaaaacca cctgatttca ggtggttgca aattccatca ttctcggact    163380
     gatacgttcc cagagtgaaa cgtcaaactt ctaagagggt gccgcgcaac gcgtgtcact    163440
     ttgcgcgcag gtttctcatt ctagtgcagt gtcacggtga tgtggccgga gatattcaaa    163500
     ccctcaatcg tcatagaacc catggaaggt ccgttgcccg ctcgaatggc tccgatgtga    163560
     atgcgatcaa aatgagacgg aagctgagtg gtcgaaatgg ttttgccatc cttgatcacc    163620
     gtcatctgca atgagccata tttttctccc acaactgtga tgttttccag agtgataccg    163680
     aaagctttgc tgaccgcctg aaggtggttc atgacttcaa ccccggtcat gggttgaccg    163740
     gaaacccgcc ttacttcgaa cataaagagc aggctgctgg ccaaatcagc ggagccgtag    163800
     acgttcgaca tctcgtcgtc tgtcagaggt tgaagtttgg cgtgggaagg aacagtgcca    163860
     agcagaagac cagcgatcaa aaggaacaag agggctttca taaaaactcc ttgattgtga    163920
     atggagaagt tctaacgaaa ggccgcaaaa aataaaagag cgccagtttc gtcactggcg    163980
     cgtttaagtt tgaaatctca ttgtttgttt atggtggatt aaacttaaga cagactgaaa    164040
     aatcttctaa gcaggctcgc cgttcccatc gtctctgccg aacacggggc cgtaagaacc    164100
     tgaatgaacg cgttcccacc actggccgtt ttgccgcagg tctttgaagt cgctgaagcg    164160
     gtattcatag cgttcaaaac gcaggaatcg tggcgaggtt cccttgaagg gatccttgct    164220
     gaacaaggtc atcacatccg gggattgttc aaacacgcgg gttgcgaggt tttgcagcca    164280
     catgttttcg ttgaagttct ctagcgctgc gaaccacatc tgccagtcca tgcgtggttg    164340
     gtggggagca cacaccgggg gcgctttttt taggccgccg ggtttgaact ggaattcata    164400
     atcttcccag ttcagtccat cgttgcttcc ttgcagaacc acttccgggc gggttttggt    164460
     catcactgcg aacaacccat aaggattgtt gatgcggaac gggtaaaaga agcgcatgta    164520
     cggcaacatg aaatttaatt tcgtgctgtt ttcagaaagt gttttcaaaa tccaaaatag    164580
     ggacgagggt accagaatca atgccggtat cagcatcact ggggtgggca atgtggtggc    164640
     ttcaacccag ttgattttga atccccaggc ggaatccggc agcacggcca ggcaaaggcc    164700
     gatggtcagc aaattaaaga agccatagtt gccagtcagg atgatcagga actgcaaact    164760
     taaaagcaat gccaccgcaa tgacttgggt cttcccaggc accagcatca aaaacggaca    164820
     aaccagttcg ataaagaaca tgatcactgt gctgactttc tggaaccagc gaggcatctt    164880
     gtgtgcaaag tacgccaacg gggtcggcag tggctgagtc cagtaatgat aggtcagggc    164940
     cgtcagatct ttccagctgc cgtctttatg cgtgagtttt acaacgccag acaagaacat    165000
     cagtttgaac aataagaaaa tcaccagtcc cagcatgatc ggatgcagat tgtgcgccgc    165060
     cagaggaatc cattcccact gccagggggc gaagaacaat cccaaaaagc ccagctcaag    165120
     aagcaagctg tcccactgat aacttaaaaa gatctgcccg cagctgacaa aagaaaggta    165180
     gcagatgaaa cacgtcaaaa acataaagct ttgggaaaaa cccaggaatg ccaacgatga    165240
     agcggtcatg ccgataaagc agaacagctt caatgtcaga tcgcccgaag aaaaccagaa    165300
     caggctcgga acatgataaa agcgttcggc tttcagttcc ttgtccaaaa gatttaaaag    165360
     atgatcaatc gacaaaatgc cttgagatcc ataaaggccc aacacctgtg gcagcaaaga    165420
     caaaaaggcg acaaagtaag ccagcgccag tgtctttgaa atgatccagc ttgcgatgtt    165480
     gtagtcttca attaacatat tcattctttc tgtcgctgat ttccggcacg cttttctgaa    165540
     atcaatagca agtccaaggt gcttcctttt agtctgatcc cgggtcgcat atatcaatca    165600
     taacccagga gaatatatga aagcattcgt tctatctctc tttgccgtgg tggccttgtc    165660
     aagtgccacg tcttttgctg ctgaggaagt ggtcaatctt caggaaattc aagaaaactt    165720
     cgtggtagag cctgtttttg aggccaatcg tcttagttgc ccgtccgaca tgatgcccat    165780
     tgcgaagtac tgctggaaca ccggccgggg ctgttttgtg aagtgtggcg tggtctgtca    165840
     tccgaaacgt gaaactccgc cgccagttcc agaacctcac tttgttgaat aaataaaaaa    165900
     agcgcgcctt gcaagggcgc gcttgatttg ctctgtcgaa gttggagggc tcatcagcta    165960
     ggatcgagtg acgacccggt tgacgagaac cagaatcacc gcgccaccaa tgccgatggc    166020
     gatgccttcc cagctgaagg cgttgtactt gggccaatga aacactcgtg gtgtcaggaa    166080
     attccccagg aaagatcctg caagtcccaa taaaatggtg cgaatccagc ccatgttttc    166140
     gctgccgggg atgatgatct tggcaaccac gcccaccccc agtcccagca gggaccaaag    166200
     cacaaacaga ttaaaccaag ggtgattcaa aaccatattc acgtatgtca taaaggtcct    166260
     tatgcttcgc cgatttcaac ccacgtgatg ccgtcgccgc caccttctgg tgacccagcc    166320
     ttccattttt ttacgtagat ggaacgggac aggtacgtgc gcacagcttt cttcaaggct    166380
     tccgtgccat ggccgtggat gatcttaata cgatcttcgc gggcctgagc ggctttgtcc    166440
     aatgtcaatt ccagttcctg caaggcatct tcgactgtgc gaccgcgcag atccaaagtg    166500
     cgatcatcgt cagccaaagc cacggtgatg ttggaactct gacggatcag ctgagacgtt    166560
     ggattggacg gtttccccgc aggttttaaa atagtccatg gcagctgcag gcgcaccgag    166620
     cctgacaaaa tcatgacatc acccttggag ttcggcgtgc tttggatgat gccgtcttga    166680
     ttcagggtcg gcacatacac tttggatccc ggtgggaact tcttgccaaa ctcttcggcg    166740
     gtttccggag cccccggctg tgtgatcggt tttgctttca cgatctctgg cagtttgtat    166800
     ttgatctcct gcaaagcggt gtgacgtttg aaggtctcat cggctttggc gtgagcaatg    166860
     gcttcttcca ctttgcgctc ggcttttttc accgtgcgct gcagccattc gtccttgtcc    166920
     ttgttgaatt gctcaagcat gccttcatac ttgcgcttca tctcggtggc cttcttggtt    166980
     tcttttttca ggtggtcctg caaaagattg atatccgcct tcagttgctc gatctgttca    167040
     agaccttcca gacgcgcacg tgtggccggg gccagcacat ccaaagcgcg ctgaacgatg    167100
     ctttgagcaa cacccacgcg tttggccgtc tgaatcgcca tggaatcccc ggggataccc    167160
     gccaggaact gatacgtcgg gcggccggtt ttcgggtcgt attccaagct tccgttatag    167220
     acacggcttt gttcgtccca gccggatttt aacgggccca agtgggacgt gatcacggca    167280
     aagacgtcgt tgttcgagaa ctcttcgata aaggcacggc ccagggcact gccttcttcc    167340
     gggtcggtgg atccgcagat ctcatcgatc agaatcagat tgtcgcggcc tttgacggat    167400
     gcggctttgc ctagaatctt caagtgtgcc gcgaacgtgg aaagctcttc gtccacgctt    167460
     tgcgcatcac caatgccgat cagaacattt ttaaagaacg gcagtttcga agtttcgctg    167520
     gcgcaaatcg gcagaccaca gcgggccatc tgtgcggcca gaccgatgga tttcagaagc    167580
     acggttttac caccggcatt gggaccactt aaaagcaaaa tacttttgtg tccttccagc    167640
     agcacggtgt tggcgacgac ttttttgccg gacaattgca gcaggggatg gcgaacctcg    167700
     atcagctcca tgctgtcatc agaaaactcg atcgggtggg cctccacctg attggcaaac    167760
     tgggcttgag caaaacgcac gtcggcgtct ttcatcagca cttgcgagct ttcaatgtcc    167820
     aaagacttgg aagacagata acgggaaagc tcggtcaaaa gtctttcgat ctcgtcttca    167880
     atttccacct cgatctggcg caggcggttg ttggacggga tgactttttc cggttcaatg    167940
     aacacggtct gtttggtttg ggaagatcca tggatcacac ccggcagatg gtgctgcata    168000
     ccgcttcgaa ccggcaagac ccagcggccg tcacgggtgg tgacgtactt gtcttgcagg    168060
     acgttttcca tctgatgatc tttcaccaga cggtctaaag tgctttgcac ttcacgcgcc    168120
     agacgctctt tttcacggaa aagacggaac agggtttcac tggcgtccga ccggatgtca    168180
     ccacttgggg tcaggatctg gtcaatcgcg gagaccggtt cttcggcctt catcaggctt    168240
     tggtgaatgc gctgggccca gtcgttttgc accgggtgca gggcttcttt caaagccaaa    168300
     gcttcaagac agaagcttct gacatctttc atttccaaag ttttcaggac cgcatttttt    168360
     ttcaggcgca gaatccaggt cgaataaaga tccagactgg tcatgaacgg gcggacgcct    168420
     tggtttaaga cttccgtggc gttgttgatt tcctgaaagc ttgcgtgcgc ctcttgcgga    168480
     gttttcaaag gctccgtttg catgatagct tcacgaccca tgtcactggt ggcgtgggct    168540
     ttgatttttt ctagaatttc tatccagtca agaacgacga gatcttgcat tgagggctcc    168600
     tcggccaatc actgctccca gcacaagcaa aattacaatc cagtcccaat gaccccattg    168660
     gacaaagaaa gtaaggggag cgtttttaag atactttatc acgaactgtc cgctccattc    168720
     ttcatggagt ggtgattttt gtagaacgtc accgtttgcc aaaacagcgg tgctgacccc    168780
     ggtgttggtt gagcgcacta aaggacggcg cacttcaatg gcacgggcca gagtcatgta    168840
     caaatgttgc tgtggttcaa aggtttttcc aaaccacgag tcgttggtca cgttcaccag    168900
     aatgtcggcg cctttttcag caagaccgcg ggtgaaggac gggtaaagac cttcatagca    168960
     gatctgacca ccccaacgaa ctgaaccttg cggagtgtcc cacttcatca cttccggccc    169020
     gtggccgcgg ccgaagtttg aaacaaacgg caaaagtttc agcaagaacg ggaattgttc    169080
     gctcaatggc aggtattcgc caaacgccag aagttctgtc ttgcggtaag gtttatccaa    169140
     gttgttaccc agtggatcca ccaggaaaag ggcgttgtaa gtggaggtgt cctgcttttc    169200
     atcggccttg ggatctttgg aataagcccc ggtgatcaac gggcggctca gcggctgcaa    169260
     acctgaaatc aggatctgtg cgtgtttgcg gtccaaaaga tgctgatcca gataatcggg    169320
     gaaggccgtt tccggccaga tcaggatgtc ggtctgcggg tacttttgca tagcagcaaa    169380
     agacagatcc aggaatttgc gggtgatgac ttcctgataa gcgcggccct gttcggcata    169440
     gatcttttcc agattgccga tattggcctg aaccacggtg gccttggttt cgccgtcaaa    169500
     cttgttccag gctttgccgt gccagaagcc ccagcccacc aaagcagcaa aagtcagcgc    169560
     cagcaatgac aggtgactta aggctttttt gacaaagctt tgtttcagcc acacgtaacc    169620
     catccaggcg ttgaaaagca acaccaccgc ggaaagcccg tggaagccga ccagatccgc    169680
     caggtgatac atcggaatct tcgaccagat cagagtgtaa ccaagatgcc actcaaaaat    169740
     caccggccag gttcgttcca aaagggcatg caaaagagcg atcgtaaaca gagtctgccc    169800
     accggaaagc ttgaatctca ggcgcagcca ggttcccgcc gccacggcca ctgggatata    169860
     caaatgcata aacgcacaaa aaagcagcag cgccagatag gacacggccc acggaagctg    169920
     accgaattca tgcgcggtgt aggcgatcca gtgaaaacca atcaaggtca gaatgaactg    169980
     tgtgacccat ccggcccaga aagatttctt caccgacgag gattcttccg tcacgtaaat    170040
     ccacagaggc gtgtagcaga agatcagcgc ccaaggagga aacggaatgt aacttgtgcc    170100
     gacgagaatt ccggagagaa tcgcccaacg aaaatcgtag gctttatgct tgaaaaattg    170160
     aaaccatctc ttcatcatgg tattagtaac ataaagagtg agtgagtcca cgtgaaattg    170220
     aagatcagat gcccatcatg cgcgaaattg tacgaggttg aaagtgacga catccagacg    170280
     gagtcgccgc tgtttcagtg catttcctgc gagggtcgtt tcagtttcga atatcctcct    170340
     caagatccgg cgaatgtgat ctgttttgca gtttcacttg aggctgaaga ggcgtcactt    170400
     gccgaatccg ctccagaatt ggagaaaagc gagcttgttc ttgctgctaa gcgacaagaa    170460
     gatcatgcta ttgagccggg tgctcaagag atgaagggct gcccgaagtg tggggctttg    170520
     aacggtcgtc gtgcgaaaga gtgttactct tgccacgtga tctttgaaaa gctggaaggt    170580
     ctgccaaagg acccttccct gaaagctcag ccaagccttg tgcgcaagtg gaagaacctg    170640
     gttgaaaact tcgacaatga atccctgcat gacgagttca tccgttcttg ccatgaactg    170700
     gatgctttgc gttttgctat tttgaagtac gaagacctaa aaaccgcgca aggcggtgat    170760
     ccacaatgtg atcagatgat cgcgcgtatc aactctttga tgatggtggg attgagccaa    170820
     aaacctacgg ccaaagatca ggcgatgaag ccgaagtgga acaagtacat gtactggggt    170880
     ccgtttggcc tgagcgcgct gttgatcctg ctgggcatga tcaacctggg tcaccgcaac    170940
     ctgatcgggg tgggcgtggc gctagcgtgt atggcggcgg gtttgatcgt catgatcaaa    171000
     ggcaagattt cagcctctga cttcttagac tgaaaccgtt gaaaaaggcc catctgactt    171060
     cgttggcggg cctttcgctt ctcttcgacg tgcttgaagc acgcctccgt ttcgcgaaaa    171120
     accctccgcc tcgcatctga acctttttga acggtttttg ttataaagat cgttttacaa    171180
     acaatagttg ttttcgttga agtagcggcg gcacagtgat gttccgtttt ggcagtctga    171240
     tggcgtgttg gaagtgtagg atcctgtgcg ggagcagttt ttggtgccgc cgtctttgat    171300
     ctcggccacg aattcgccag aagctgtgac tttgccgttg gatgtgattt tgtatctgac    171360
     agtgtttgtg cctggatcca gaagcgggcg ttgcagcaag gtggcgatcc acaggttgat    171420
     ggatttcttg ctttggcctt tggcgctgtc gtaatcaaca gttttggttc tttgtgatcc    171480
     gtcctggtgc agagctgtca gcgtaaccga gtcaccttta atgcccgccg ggccgacgaa    171540
     atagtcgtat tctcccgctg tcagaatttc ttcgcggcag atgaaagagc cgtgggatgg    171600
     accgcctggg ttgttcccga agcagtggac gacgattcgt ccttgagcaa gaacagctgt    171660
     tttttgattt ccgtttttga agccgacttc ggcgtgggca gacagactta gcaagaaaat    171720
     gaatactgaa attaccgatt tcataaagtt ccccctgtgc aatcaagtct ggcacgatcc    171780
     agacttgaat tgcaaggcag gagcgacttt tacggcacag ggcaaagatt gtctttttgg    171840
     cagtggatga ttctgtcgcg caactgggtc atttcatcca agttgtgctc aagctctaca    171900
     tcaaagccca cagcttttcc gcctttttgc gatacagaga tgaattcacg cacatactgg    171960
     aatttgtcgt aagcgtactt ttccccggtg gaggtgttga tgaactccaa aggagcgccc    172020
     gaccccaggt gggtcaggaa gcgtttgcgc tgttgtttgg ctttggtcag gccgtttttc    172080
     aggttgctgt aacattttac ttcgcccacc atcgcaactt tctgagtgtt gtgatccatc    172140
     aaaaccatgt ccagttcgcc cacggtgcga cctttcaggt tgtaggcaat gcccacgatc    172200
     acttcatatt ggggagcagg gtatttttcc gaaaattcag cacgcgcgac ttcctcgcac    172260
     acggctcctg gatcacgata atgacgggct tgattgcgga ttttttcgaa agttccatcc    172320
     aggtctgcaa aggcagagac tgaggaaaga agaagaacag ctaaaacaac aaatttattc    172380
     atggaatgcc cccgaatggc ggggagtgtg ccacaacgag ggggcttttc ccagcaacgc    172440
     aaggcccctg ggaaaaagcg ataggcctgt caagattcta gacagccgta aggagggctg    172500
     gattgtattt aattcttttt attgccgttc taagatcaac gcactccgcc ctcgtagcga    172560
     gggcggagtg cgttagttga gcagttcgtt tcgacctgtt ttttaaacag atgtggaggc    172620
     ttgtattaga agccttcgtt ctcttgtttt gtgccgagct tgctcgggcg aactttggtg    172680
     cccatggcat cgatcagaga ccggccaaag tgactcattt ctttggcggt ggcatcaaca    172740
     ccgtcttcgg cggcgcggga attcttatca ttaggatccc cgctgaagct tttcatattg    172800
     gcggtgttca ccgcgatcac gcccgtcgca cccacgccct gatccaggat ggtcagtgct    172860
     ttatacagat tcaactgacg ggatgtgcgg gtcttggaag ccagttgtga ctgggcatcg    172920
     cccgtagcca ggatgtattt tttcacgtca ctggcagaga aagactgttt gtgcgccatc    172980
     accaaagcag ctgcacctgt cacaaatgcg gtggcttgcg aggtgccggt catataaccg    173040
     taagagttcc ccggcaggca ggacagaatg ttctggccgg gagctgcgat atccacagtc    173100
     tcgacaccat aattggacga agccaagact tgcgtgctgg ggtcgattgc cgtgactgag    173160
     atgatgttgc tcagtttata atcggccggg taatagtgat gctgatccga gttggatctt    173220
     tcattccccg cagcagcgac aaaaaggatt cccttttttt cggcttcggc gatggcatcg    173280
     tgttcttcct gtgaaaactc agtcccacca ccggaatagt tgatgatgtg cgcgcccatt    173340
     ttcactgcat agcgaatgga agccacggtg tttttcaagt tgtccgtgcc cggaactttc    173400
     gggtcatagt attttagaat catcaggctg acttccggag caatcccggt gatgcctttg    173460
     ccgtttccgg cctctgcgcc gatgatgccg gcgatatgag tgccgtgtcc gtggttgtca    173520
     tccagttttg gattgttgga aacaaagttc cagccataga cgtcatccac aaaaccattg    173580
     ccgtcatcgt caatgccgtt ggtggctttg tcgcggccca tggaatcttt gccggtttca    173640
     cccgggttgc gccaaaggtt tcccgccaag tcttcgtgtt tgatgtcgat acccgtgtcg    173700
     atcacggcaa tcacgatgtc acgactgcct ttggtgacgg accatgcgcg agccgcatcg    173760
     gattttttca aaccccaggc ctggctgatg gcgggatcgt tgaaaagcgc actcggttca    173820
     tcaatgacct tgtcagtctg agaggtgatg aaggattttt ccagagcgcg tgtgctgtct    173880
     tttttggagc tttgagagcg ggaaggggaa tgttcttctg tggagtacag gtatagaccc    173940
     agtcccccaa agaacaccaa accggtacag ccagctgcaa taatcatctt gcgagaaaac    174000
     atgaggtatg cccctttcgc cacaaacact tatcggaatt taaagggcca gcataagcat    174060
     gaaagggttt gatctcattt tgagacggtc gggccagtgt gggcatacat tatatagata    174120
     ttgccggaat ggtttaaact aaagcctgga ggcccctaac cgaagagaag aacatgaaaa    174180
     agtttagaat gtttctgacc ttcagcgctt tgttcctgat ctcttgcaat cagactgtgg    174240
     gatcaggtga gctggatttg ggaagcttga gcgaagacgc tatcttccac aatcaatccg    174300
     aaaccggaac ttcctccggt agcgaatttc attacgttaa actggacctg aaggccaacg    174360
     gggacttcga acaaaccgaa gctttgtttg accaggccgg gtctggaacc aattgcgttc    174420
     ttaaaggcac ttgggccata gagccgggca ccgtggattc ggaagttggc aacgagctgg    174480
     tcgtcacggt gacagagctg aatggcggcg ctgtggcgct ggaaaagcga tacgacctgc    174540
     gtgagctgag ttatcagagc ctgaaataca aatggaacga aaattccgac ctgttggatc    174600
     tgaccaacac catgtatgca gactatcccg aatacacggc agcccaagcc ggtcttgtgg    174660
     ccgacacctt ctgtaatcgc tagttttgaa gagtgatcat taaaataaaa aaaagccacc    174720
     ttgtcgggtg gctttttttg tttgagttta tctggaaagc ttcagcagtt cttccgggaa    174780
     cagcgagcct ttgtcctgat gaagcagtct ttgataaaag acgtagtttc gcatcgtcag    174840
     tttgatataa gaccgggtct cttcgtaagg aacctcttca ataaactcca cggaatcatc    174900
     gcggtagcgg gttttcagcc atccgcggat ggcgctgtcg ttggcattgt aaccggacac    174960
     tgccaaaatg tactgatcct tatacttgcg catcagattc ttcaattcaa aggcccccag    175020
     cgggacgttg atttcaggct tgtacaggtc aagagcctcg ccataaggca gaccgttttg    175080
     tttggctagc tgctttgcca cgctgggcag aagctgcatc aaaccgaagg cgtccacagg    175140
     gctgcgtgct tccggattga aggcggattc ctggcggatg attgagaaaa taaactcctg    175200
     cgggatgccg ctttttttgg aagctgcggc aatgatgtcg ccgtaagcct gcgggaacag    175260
     cagatccgga tggtcattca atagacgatc cttcacctga ggctccagcg ccccaatcgc    175320
     cgagaatagc ggcaggtaaa ggccggaccg ggcataacct gaagaaaccg caagccaggt    175380
     cttttcagca gtgacattgc gttttttcag atcatcgaca gcgatgttca gaatcttttc    175440
     cgcgaacggt ttttcattca cggcaatcag ccattcggtg gtcatgcgag tttgcacatc    175500
     cagttcttca atcgagaaca gacttaatcc ctgcagctcg ttcacgtcca ctttcagggg    175560
     cgggaactcc cagcccagtt cgcggtaagc caacacgcca tagtaaccca gcggatcttc    175620
     tttgatcaga gtttgcagtt cgacttgggc ttcgggggct tgatccagct tcttcagagt    175680
     gcgagccagc cagaaacggg cgcgcgcctt atcggaagaa tccttcacca gatccttcat    175740
     ctgctcaagg ctgcttttcg cctcgggcca ttgggaaagc ttgtagtagt tccaggattt    175800
     cagccacgcg atcttgtcgc gcaaacctgc aaagctgaca ggctgctgat agctggcttc    175860
     gaaatattcc aaagcctttt tgaaatcacc cttttcttcg tcgatacgac ccaggatgaa    175920
     ataaacttca tccatcgggt aggacccacg aagcagacgg tgagtttcat tcaatacttt    175980
     caccgcacgc gacgtttggt cttccgtcca caaagttttt gcaaacagaa cctgagaatc    176040
     atggaaacgg gcaatcgaac ggcggtcttt tttgtttttc tggaattgtt tcttagacca    176100
     gttcacaaca tcggccgtcg cattgatgta ttctgtgcga cgctgagcca ctttgtaagt    176160
     ctgacggatg tttttcaagg cctggaactg ttcatccgcc gtggcttcct tggctgccag    176220
     aattttcttg taagtcgcca gagcctgatc aaattcacgg tggaaacgat agtccgaggc    176280
     cacagcactg aggtctttgt aagccggaag cgggttcagg cgcggagagt ttttgtaaag    176340
     ctgggtctga atgctttgaa tgtcctcttt caactcgagc ttctgcgcga tcaaaagggc    176400
     tttcatatag tattcttctt ttttcttttt attggattca gcgcgggctt tttcaatgta    176460
     agccggcagg tcgtcctgaa gctcttcaga agccaaagcc tctttcagct tgatgtcgat    176520
     gtaaagttcg cggtaccacg gcgccacgtt tgcaggcagc tctgccaggg tgttgatgcg    176580
     ttcacaggac tcgtaggcac gcagcaacgc cagatcatgc agcgggaact ccgggatcag    176640
     ggaaaggcgg gtgaagcctg cgcaggcctc ttggggctgc ttttcttttt tggccatgga    176700
     aacggtgtag gtcttccacc acagaatgtt attttcgtta gagccgactt ccagtttttc    176760
     cagctcagaa attggagcag atctccactt tgccataaag tttggcaatg gcggagtcag    176820
     gcgcttgtcg atacgggaat caaaacgcga ggtggtcgcg caaccaagaa tcacagagaa    176880
     gaatgtcagg gctagtacta tacgaggcat accaacaagg gtatgcccat tcagaggaag    176940
     aaacaacccc gcagggcgga aagccattct aaagtaggct ttccgctgca cgcggtcttg    177000
     caggtcgcct tagaagcgac cgcgctgaag agcttcgata cgaacttcca gaggagggtg    177060
     agtcatgaac aatttggcga ttccaccttt gtcgcggttg gaaatcatca aagtcgcagt    177120
     ctgaccttct tccggtggaa ttggcagatc atacacggaa cgcagctttt gcaaagctgc    177180
     gaccatgctg tcgcgggaag aatacttcgc gccgccagca tccgcacgga attcgcgctg    177240
     acgagagaag tagttcacca cgatagaacc cagcattgtg aaggcgatgt cgcccaggat    177300
     cgtcacggca aagcgaacga tctcgcggta tttttcatcc acgttggcag ccacaaggcc    177360
     cgccagaata cgagagaaga acatcgcaaa ggcattcacg ataccctgga tcagagtcat    177420
     ggtcaccatg tcaccgttgg cgatgtgggc cacttcgtgc gccagaacgc cgtcgacttc    177480
     tttttcattc attctctgca aaagtccggt ggaaaccgca accagagagt tctttttgga    177540
     aggacctgtc gcaaaagcgt tgatgtccac ggattcgtag ataccaacct ctggcatttt    177600
     agggagctga gcgcgtcttg cgaactcatg aactttgttt accaagttgc gaagttccgg    177660
     atttggattg ttggcgtcga tgattttcac gccatggaac atcttcgcca tccacttgga    177720
     catgaacagg gagatgaacg cgccacccat accccaaacg gcacagaaag ccatcaggaa    177780
     cggaatgtaa gagttaagtc ccgccatgcc caggaagcgg ctgacgatag accaaacaat    177840
     cccgatcgtg acgatcacaa ggacgttcgt taatacaaat agaccaatac gtttcaaaaa    177900
     tgccatttat gcactccttc tagagtcacc attaataatg ataactctaa aaggaatgtc    177960
     aatgccatca cgttgtgaca ggttgttttt gatttttttg accgcttccg ccagtggggg    178020
     tggtgctaaa atggaacttg agcaaatcct tttcgagttc aacacttacg cgtccaccgt    178080
     caacaagacg gccgaaaaga agttcgtcca ccaaggcttt cttcaggttt tcgtccacgc    178140
     aacgagccaa aggacgcgct ccgtaaacct tgtcatagcc ctttttcatt agccacttaa    178200
     tcacatcttg agaaacgttc agttccactt ttttctcaag caaagtcatt ttcagctcgt    178260
     ccacaaattt ctgagtgata cggatgacca tatcttcaga aagatcgcgg aaggccacca    178320
     cggcatccag gcggttgatg aattctggcg caaacgcttt tttgatcgca tccatggaca    178380
     aagacccacg gttttcatcg atcaaaccaa tggtgccgcg ggatgtttca agggcgccgg    178440
     cgttggaagt catcaccaga accacgttct tgaagtcagc cacgcgacca ttgctgtcgg    178500
     tcaaacgacc cgcatccatc acttgcaaca aaatattggt gatgtccggg tgcgcttttt    178560
     caatttcgtc cagcaacaaa acacaataag gatgtttgtt cacggcttcc gtcaacaagc    178620
     caccttcttc ataccccacg tatcccggag gcgcgccgac catacgggcg acggcgtgct    178680
     tttccatgta ctcactcata tcaaagcgtt caaagtgaac acccatgatc gtcgctagct    178740
     gtcggcagac ttccgtttta ccgacacccg tagggccggt gaacaggaag cttccgatag    178800
     gtttgttcgg acggcccagg ccgctgcgcg cgtacttgat gttcgcgacc aggcggtcga    178860
     tggcttcgtc ctgaccaaag ataagggctt tgagtttctt atccagatca cgcagctgcg    178920
     ttttttcact ggaagaaatg cttgccaccg gaaggccggt cattttggca atgacttctt    178980
     cgatttctgg gacgccaatt ttgatgtctt ccgcattttc atatttcaag cggaagtaag    179040
     caccggcttc gtccagaacg tcgatggctt tgtccggaag cagttttccg tgaatgtgct    179100
     tctgggaaag ttccacagag gcttgaatgg cttcatccga gtaagagacc tggtggaact    179160
     cttcatagga tttacgcaag cctttcagga ttttcacgca gtcttctttg gacggttcgt    179220
     ggatgtcgat tttttggaat cgacgattca gcgcgcggtc tttttcaaag tactggcggt    179280
     attccgtgtg ggtggtggag ccaatacagc tgatatcccc gctggccaag gcgggcttca    179340
     aaagattcga agcatccatc gaacccccac tggtcgcacc ggcacccaca atcgtgtgga    179400
     tttcatcgat gaacaagatg gcgttcggat gtttttcgat ctctttgacg acggctttca    179460
     ggcgtccttc aaagtcaccg cggaacttgg tgcccgcaag caggccgccc agatctaaag    179520
     agtaaataac ggcatttttc agtttttcag gaacctggtt ttgcacgatt ttttgcgcca    179580
     aaccttccgc gatcgcggtt ttacccacgc cgggttcgcc gatcaaaagc ggattgtttt    179640
     tggtgcgacg gcaaagcact tgaatggttc tttcaatgac gtcttcccgg ccaatcaggg    179700
     ggtctaattt tccctgtttg gcgcgttcgt tcaagttgac gcagaaactt tcaagcgggg    179760
     agccgcgggt ttcatccatg ccctcggctt ggtattcggc cgatcttggt gcggaggccg    179820
     acgggatgtc gtgatcttta ccgtctttgg tgatcccgtg agagataaag ttgatgatgt    179880
     caaactgggt caatccttgg cgagccaggg caaaggcggc gtgggaatct tgttcataga    179940
     acaaagacac caacaggctt ccttcagaaa tctgattgcg tccggcgctt ttcatctgaa    180000
     ttgccgcacg ctgaatcagt cgatggcagg cgagggtgaa ctcaggggtc caggattcaa    180060
     agcctccata ggatcccaat tgttcatcgg tgatttgcgg aataccgacc ttcaggtgat    180120
     cgcgcagatc ctgttttagt ttctgcacat tgactgcaca ggcttccaga atttccacca    180180
     tcacggggga ttcggacagg atgaggagta tgtgctccag agtcacaaat tcgtgtcggt    180240
     tgcgtttggc gagttccgtg gcttcggcga gcttgcgctc aagttctcgg ctcatcatgc    180300
     ttcctcctcc agtgtgctct ttagggggta ctgattgagt tgcgcgaatt ggttgacctg    180360
     catcaccttc atctcggcaa tctcaaggct gaagacccct gcgacacctg cacccttctt    180420
     atgaacatct aacattattt cagtggcttg ctcttctgtt ttcgcaaaaa agcgacgcaa    180480
     tacaaggacg acaaagtcca tgggcgtgta gtcatcgttg agtaggatca ccttgtacat    180540
     cttcggagtg tctagttttg ggacaagctg gacgcccgct tccccctcgg gagatgcaaa    180600
     aggatagttg ctgttgctgt cttttttatt gttacccatg tgtttattct accttatgac    180660
     tcaatttgag cactctttcg tgtctggcaa gtctagcaga gtgaaaaaag ctggttatag    180720
     gtcgagagtg ctacgtgtcc cttacataat aaacatgaaa caaattactc agtcttattc    180780
     gagacaggac cttgatttca ccattcgaat ttgacacact tatgtgggta aacagttagt    180840
     aaaagaacca tggaggtctt taaatgtttt cagttagcag aaaatctcaa agcggtttct    180900
     cgcttgtaga gttgatggtc gttgttgcga tcatcggtgt tttggcgtct atcgccgttc    180960
     cagcaatcaa caaatacttg gcgaaagctc gtcagtccga agctaagaca aacttgtctt    181020
     ctttgtacac gtcagagaaa gctttctatg cagagtacac tgcataccat acaatgtttg    181080
     gtgctatcgg ttactctcca gaaggtaaat tgagatacaa cgttggattc aatgcgccgg    181140
     gtgctccaga ggcgggtgct accaacggtt ataacaatcc accgacagcg gctccgggga    181200
     atacgcgcaa tacggctgca tattgcggta ctactggtgt tattggtgct gcgggttgta    181260
     ctgtgctagc gggtgcaact aatgccgtgg tgccaggttt gcctgcaaca ttgctgaatg    181320
     gtacccaatt ccgtgcggca gcaattgctg ttattcatac tgctatgcct gcaggtgacg    181380
     tttggacgat tgatcagaat aaagatcttc gtaatccgac gccaggtatc ccataggttt    181440
     ttcatggata gtgtgttaac taatctaaca catctgcaaa aaacaaaaat cccaagcgtt    181500
     ttgcttggga tttttgcgtt gttgatggtg tgttctacgg ttaactacaa cttttctagt    181560
     cctactgcgc atcagcgtca gttgatagct cctcctccga tggttgagca cttgagtttt    181620
     ggttatcagg aagcaatcgc taatattctc tggatcaggg cggttcagga ctttgattat    181680
     tgtgatcgag aaattgctga tagagtctgc ctgaataatt cgtggcttta taaaatgcta    181740
     gatgcaatta ccaatctttc gccacatttt cgtattccct atgcagctgg tgctttagcc    181800
     ttaactgtaa ttatcactga tattgacggt gcgacaaaga tcttcgacaa aggcgtcaaa    181860
     gcgttcccaa atgactggcc gattctgtat cgtgccgcct atcactatat gtacgaagtt    181920
     aaagacaaca aacgtgccgc cgaactgttg attcaagcag gcaagaatgg cgcgccacca    181980
     tgggtgttca ccttggcagg ccgtttgtat tcagacgcgg gcaatctaga gcttgcagag    182040
     tccgtccttc aagacatgat caacaccgaa caagatccgg ttctgatcaa gcgccttcaa    182100
     gacaaaattc aatcaatgaa acagaaatag aggtttccgt tgttcaggaa gtgggatgga    182160
     aattgtcttt gcgtgcccaa tgagtctgca tataaaataa actcattggt ggtctatgca    182220
     gtatgtgttt ctgggcaaac aagctaaacg cggaaccacg gtcatctatg atttgatcct    182280
     gaaccgcgat gctatggggc gcattgacgg caaaacccag gtgatgaacg cggtcaccga    182340
     caattacgtt tatacctttg atagcaccgg tcgcttgact caaactaata agaactctgc    182400
     gacagttgcc acttacagct atgacagcaa tagcaaccgc aacggcggaa ccatcggagc    182460
     acagccaacc acagctactt acgacgacca ggaccgcctg ctgacctata acaccttgtc    182520
     gttcacctac aacgcaaacg gtgacttgct gactaaaacc aatagcgtca caagtacgac    182580
     gacccaatac gtttacgacg tgttcggcaa tctgactcaa gtgaccctgc catcgggggc    182640
     cgtgatcacc tacgagatcg atgccttgaa ccgcagaact gggaagctcg taaacggagt    182700
     cgtgcagaaa cgctggatct atatggatca gtacagaatc gcagccgaac tgaacgcggc    182760
     ggggactatt acaaagcgtt tcatctatgc ttcaaaagga aatattcctg attacatgat    182820
     cgcatccgga gtgaaataca gaatcatttc cgatcacctc ggttcaccac gtctggtggt    182880
     caaacaatcc gatggcacag taatccaaag aatggaccac gatgaatacg gccgagtgat    182940
     cgcagacacc aacccaggtt atctgccgtt tggtttcgct gggggattgt acgaccatca    183000
     gacgagccta gtaagatttg gagcccgtga ctacgattca gaagttggac gttggacctc    183060
     gaaggatccg attctgttta aaggtggaga tagtaatctc tatggatatg ttttaaatga    183120
     tccggtaaac ttcgttgatc caaatggcct gatggtaatt tcgatttctt ggggaagttc    183180
     cttttttgct tccaactcac ctggaagtgc gaccgggaaa tcggggtcac tgtcctcggg    183240
     tatagcgttc gatactagtt caggcaagtt ctttaccttc catacaagtg gtcatggaac    183300
     agatgcgata ggacttgttg ctggtaccgg agtttctctt ggtatatcct cgggaggtat    183360
     cgatgagttt tttggaaagg ctccggtatc ttctgctgcg gtaggggcaa tattcggggg    183420
     ggcggggttt tcgtactcaa gctcagcctc tgggcctggg gtttcttttg atttgatagg    183480
     gccagggctt ggagccggtg gcggagttca ggaggttata acatgtccgg gatttgcgca    183540
     gtgaggttag gatttggagt tttctagtca gttattattg gggcttggct tcttaattgg    183600
     gcttgcagtg tttgtgcatt atatttttcg tctgacgcct tgttacccca aggcgatgga    183660
     aaaaaggtat ttgtgcatcc actactcgtt agtgacttta tttattggtt atatattgat    183720
     tctgggtatt ttcggaaaaa tctttggagt ttctttttga tttgtaaaga ataagatccg    183780
     cttcctagcg gctgcaaaaa atgtagcagc tttttatttc gaggctcttt gtttaaatta    183840
     gagctagtca gtgataagcc ccgtgcaatt taaggtagct ctaaaagagc cttcttagaa    183900
     accgcctttt caatcgccga cagccgactt tcagtcgaag gtttgctcat gattcgcgta    183960
     gaaacttctg tggttctgct taggccgctt ccaaagacac cttaaactta attccagccc    184020
     tttgaagctg atcctgcaag gacaagctga tgaaaacctt cggtggatag cctagctttt    184080
     ttgcaaaact cagagcgcgt tccggtgaaa cgaacttatg acctcgttca agctgcgaaa    184140
     gatgagcatt agtgatgcca agttttttgg ccatttcggc ctgagtcatt tcgtcagaaa    184200
     ggcgaatggc ttgaagggta gctccaaaac ttacaggctc accaatgatt ttatctagaa    184260
     atttaattgc atcacttttt ttagtactca tgtttattta cctccaggac ttccaggaat    184320
     tccacagcgc catcagcacg caaagtataa atggcccgat aagccttgtt cagtcgaatc    184380
     gatcgttgtc caacacggga tcctttaaga ggttcatcat gcagggcagg gcttttgcga    184440
     gcttccgcca atcccacttt ctctatactc agcacccaaa gtctaaactt tacgacaata    184500
     tgctttggaa ctttcaacaa gtctgccttg gctttcttgc taaggcgtac ctcgtgaatc    184560
     acgcttcctc caatttaacc aatttagtta agttattcaa gaccacttga aaatcttccc    184620
     aatcagcaaa agaaatgcga acccaagtcc aaattcccgg caaataagcc ctgtactcaa    184680
     gccgcctaac ggacaccaca tctagacgcc ccgcgcaccc gaaaaactcc cttcagggcg    184740
     cttggcgcgg agcttagccc ttgcgcaagt tccgcagccg agcccctgtc cccctgcgcc    184800
     agccacccca aacaagaacg agcgaggact gtccgaagcg aaagggctaa gctccgcgcc    184860
     aagggcccgt ctgccgagga agttttttcg aggaagcctt gacgggcgtg gttttgacac    184920
     cctattttgt catattcatc acgaaaaata gcgcacaacg ttaggttcca taaactatgg    184980
     ctggcaaaag agattactac gaaattctgg gcgtcgaaaa aggcgctgat caggacacca    185040
     tcaaaaaagc ttatcgcaaa ctggcgatgc agttccatcc ggacaaaaac cccggcaaca    185100
     aagaggccga ggaaaagttc aaggaagccg caggggctta tgaagttctg agcgacgcac    185160
     aaaaacgcgc gcagtacgat cgctttggcc atgacgcttt cacccgtggt ggtggcggtg    185220
     gtggcttcac ggatgcagaa gacatcttct cgcacttcgg ggacatcttt ggcgacttct    185280
     ttggtggcgg catgggcggc cagcaaagac agcgcagaaa ccgcaatgaa ccgcgccgcg    185340
     gctccgattt gcgctatgtg accgagatca cgttgaaaga cgttatcacc ggcattgaaa    185400
     aagaaatcga atttgatacc gacaaaaact gtgacgagtg caaaggcacc ggtgcagaaa    185460
     aaggctcgca agtcagcact tgcggcacgt gcggaggctc aggccaggtc gtgcgccagc    185520
     agggcttctt cgcgatggct tcgacatgcc caacctgtca tggccagggc acagtgatca    185580
     aaaatccgtg caagccgtgc aaaggcaaag gccgtgtggc tgaacaccgc aagatccgtc    185640
     tgaacatccc ggcaggggtg gacacgggca cacgtctgcg tgtggcgacg gagggtgagg    185700
     gtggatatat gggtggtcct ccgggcgacc tgtatgttga aatccgcgtg aaacaacaca    185760
     acaacttcga acgtcgcaac gaagatcttt tcgccgagct gtcactgcct tacgtgcaga    185820
     tgcttctggg cgcagaaatc gaagtgccga ccgtcacagg caaagccaag ctggaagttc    185880
     ctaaaggcac tcaccacgga gacaacgtga agcttgttgg tgagggtttg ccttctctta    185940
     gaggcaaccg ccgcggtgat atctacttca ctgtgaacgt gcagttccca gagaaattac    186000
     ataaagacga agagaagctt ttgcgagaaa ttgctaaggc acgcggtctg aatgtgacct    186060
     cggaaggtgg cttcttcggc aagaagaaat aggatcccac aaaaaattgc ggccccggcg    186120
     cagaagggtt acgccagggc ctagaggggt cttgtttttg ttttgtttta agagaggagc    186180
     gaggtcacat catgccttca gctgcctcat aacacgagtt aaaaccctgt aagatattga    186240
     aattattcat taaataattg tcataaaaaa gtgagcccac cagcttgacg aaatcacggg    186300
     cggacacaca tttaaattgc tgaaaacagc taattttaag gagatttagg tatgggtaaa    186360
     attattggta tcgacttagg aacgacgaac tcatgcgtcg cgattatgga aggcggcgag    186420
     cctaaagttc tcgtgaacga agagggcgct cgtaccactc cttcagttgt cgcttacacc    186480
     aaagacggtg accgcttggt tggccaaatt gccaaacgtc aggctgtaac caatccagag    186540
     aacacgatct attctgcgaa acgtttcatc ggccgcagat ttgaagagat tcaagaagag    186600
     atcaaattgg ttccttacac tgttgttgcc aaaggcaatg actgtgcgtt caaggttcag    186660
     ggcaaaaccg cttctcctga agagatcggt gccgctgttc ttgcgaaact gaaaaaagtg    186720
     gcagaagact atttgggtga accggttaca gaagcggttg tcaccgttcc agcttacttc    186780
     aacgatgcgc aaagacaggc gacaaaagat gccggtcgta tcgcgggtct ggaagtaaaa    186840
     cgtatcatca atgagccgac agcggcggca ttggcatacg gtatggataa aaagaaagac    186900
     gaaaaaatcg ttatctacga tttcggtggt ggtacgttcg acgtttccat ccttgaagtg    186960
     ggtgacggtg ttgttgaagt tcgcgcaacc aatggtgaca ctcacctggg tggtgacaac    187020
     ttcgatacag tgatccttga gtggctgatc actgagttca aaaaagatca ggctattgat    187080
     cttaagaacg acaaaatggc tttgcagcgt ctgaaagagg cggctgaaaa agcgaagatc    187140
     gaactttctt ccgctcagga aacagaaatc aatcttccgt tcatcacggc ggaccagtcc    187200
     ggtcctaagc acttgcagac tcgtctgtct cgcgcgaagt ttgaccagat gactgaagat    187260
     cttgtgaaac gctccatgga gccttgccgt aaagctttgg ccgattccgg tttgaaagct    187320
     tctgaaatcg acgaggttgt cctggtgggt ggttccactc gtatccctgc gatccagaaa    187380
     gccgttaaag acttcttcgg taaagagcca aaccgctctg tgaatccgga tgaagttgtg    187440
     gcgatcggtg ccgcagttca gggtggcgtt cttgcgggtg acgtgaaaga cgttcttctg    187500
     ctggacgtga ctccactaag cctgggtatt gaaaccctgg gtggcgtgat gacgactttg    187560
     atcgaaagaa acacggcgat tccttccaag aaatcccagg tgttctcgac agctgctgac    187620
     aatcaacctg ctgtggacat tcacgtcctt cagggtgagc gtaaaatggc tggcgacaac    187680
     aaaactctgg gccgtttcga actggtaggc atcccaccag ctccacgtgg tgttccgcaa    187740
     gttgaagtta ccttcgacat cgacgccaac ggtatcctgc acgtatcagc gaaagacatg    187800
     tcttccggca agtctcagca gatcaagatc acggctcagt caggtatgtc tgaggacgag    187860
     atcaaacgtg cggtcgcgga cgctgaaggt cacgcagagg aagataaacg caaagccgag    187920
     gcggcaacac aaagaaacaa cctcgacaac ctggtttatc agactgaaaa actgatcaag    187980
     gattccggtg ctcagttgcc agaatctgaa gtgaagtctg cgaacgaagc ggttgctgaa    188040
     gccaagaaga tccttgaaaa caaatctgcc tctggcgatg agttgaaagg ggccttcgaa    188100
     agacttcaga acctgacgca caaactgact tccgagcttt acaaaaagca aggggctcag    188160
     ccaggtgctg aaggtcaaca agctgatgcg gctgaaggcg gcgaagcttc tgcaaacaaa    188220
     ggcggcgacg acgtgatcga cgctgactac aaagacgtaa actaatcagg gatcattcct    188280
     gaaactaaaa gccgggttgg aaacagcccg gcttttttta tgtccaaaac ccggttttgt    188340
     gatttaatac cagtatggaa ttcaaagatc tgttttctca agccgtctca aaaaacttcc    188400
     gccgcgggga cgtggtgtat cgtgcgggtg aaacacccca gaatatttat tttgtcgaat    188460
     caggcctggt gggcctgggg ttgtggggag aatccggcaa ggatcatctg gtgcgcttgt    188520
     ttcgcgaggg ccagatcttt gggcaccgca gtctgtttgc caatgaaccg tatcatgcca    188580
     ccgccaccgt gattgatgac agtgtccttc gggtcatgaa taaaaacgaa atgcgccagc    188640
     agatgaaagg caactgtgac ctcgcggaaa agcttttgga gactttggcg attgaactgc    188700
     gccgggctga agccaaacaa ttgatcttga gtgaaaaaga cgccccggcg cgtattgccg    188760
     aagcggtggt gtatttaaaa gaacttcacc cggaatactc ctggacccgg caagagatcg    188820
     ccgatttctg cgggaccacc acacccaccg tgatccgcac tctggcccgc ttcgtggaag    188880
     acgggctgat agagcagcgc gggcgggaaa tcatcatcct ggataaaaag aacctactgg    188940
     cgcaggggta attttaaata ccgtgtgcca ttttcctccg ccgccggcag ctggcccgcg    189000
     cggatattca cctgaatgct tggtagaagc agtttggggg ccgccagcgt ggcatcacgc    189060
     tcttggcgaa acttcacaaa gtcttccttg ctggtgtgac ccttcagttg gatgttctgg    189120
     ttcttttcct cattgacggt ggtttgatac atcaaagcgc ggccgttggg ttgatagtca    189180
     tgacccacaa aaatccgggt gttttccgga agggaataaa tttttccagt gaccgagtcg    189240
     taaagatttt cagcacttcc cgccgggaag tcgcagcggc ccgtgccgga atcaggcata    189300
     aacagcgcat ccccggtaaa gatcgcatcc tcaatcagat aagacgcgca cgcaggcgtg    189360
     tggcccggag tgaacaaggt tttgattttc agcgatcccg cctgcaggac ttcgccttct    189420
     tttagcagga tgtcaaagtc agagcccgag gtgttcaggt cattcatatt gaagaccttc    189480
     ttgaacacct tttgcacttc ggtgatgcgt tcgccgatgg cgaccttgat gtccgggaag    189540
     aagtttttaa aaagctgaga gctggacagg tgatccgcat gggcatgggt ttccatgaca    189600
     tagtgaggat gcagtttcat ctcttttaca aacgccacca cggggtccat ggactttgta    189660
     gaaagttttc cagacgctgg atcgtaatcc caaaccgggt caatcaccac ggcatcccgt    189720
     gtgtcctggt catagaccac ataggtcagg gtggaagtga cgctgtcaaa gaagtgctga    189780
     atttgcagtt tcatggaata cctcctgctg aaagcctgtc tcaggtttct ggctatggtt    189840
     cattatagaa caaaggcctg ccctgagtta tgtcctcgga cataagaaaa ggtttttctt    189900
     tatgttcccg ggcataacac ccagaccgag gatagcctta ggatgaagtc ctgtgaagcc    189960
     aaataagcga ggactgctat gcgtgaaata agctgtgaac aactgaaaga aagaatgaac    190020
     gaattccgtc tggtggatgt gcgcaccccc gaagaataca ccggggagct ggggcatatt    190080
     gcgggcaccg agctgcgccc gctcggccct gaactgctgg attttttgaa aaccctgaac    190140
     ccgtccgaga atattgtctt tgtttgtcgg agtggggcaa gatcagggca gacgacactt    190200
     ctcagtgaag agatgggatt caccagcacc tacaacatgg tgggcggaat gttacgctgg    190260
     aatgaaatgg gatatgcagt gactaaagga gcaggaaaat gatgaacagt attttgatgg    190320
     cgttggcggg tggggctttg attggtcttg cggcctcgtt gatgttgatt ttaaacggtc    190380
     gggtcacggg tatcagtggc atcgtgaatg gatttatcgg cgatgttcgc aaggatctgt    190440
     ggcgaggtgc ctttatcctg gggctattga tcggcggact ggtgttggga gctttgcaac    190500
     cagatatgtt cgtgaacacc tcgggccgat ccgtgggcgt ggtgctgatt gccggtttga    190560
     tcgtggggtt tggcacggtg atgggcagtg gttgcaccag tggccatggc gtttgcggaa    190620
     tagcgcgctt ttctgtgcgc tcgctggtgg ccaccgcgac gttcatgatt ttgggaatgc    190680
     tgacggcaac actctttaag gcactggtgg gaggctgata tgaataaaac atccatgaaa    190740
     caaaccgcgg ccgcttttgt ggtgggcttg atctttgcga ttgggctggg agtttccggc    190800
     atgactcagc cccagaaggt cattggtttt ctgcagctgg gtgagggctg ggatccgtca    190860
     cttatgtttg tcatgatcgg agccatcccg gttcatatgc tgagttaccg ttggatgaaa    190920
     gggcatcgca cacctttgtt ggacactcag tggcacgtgc cggcgtccaa ggaagtcacc    190980
     cggcccctgg tggtcggaag tgctttgttc ggtttgggct ggggcttggg cggattttgc    191040
     ccgggtccgg cgctgacgtc tgctggagcc ggtcaggaga tggcaatcta ttttgtgatc    191100
     gcgatgcttg cgggaatggg gctgtatcgc ctgtacgccc gctttactgt gaaagggtga    191160
     ggtgtttttt atggaactgt tgggttattt aggtgccagt ctggtcggag tgtcgttagg    191220
     tcttctgggc ggaggcggtg cgattctggc ggttccgttg tttgtatact tcttttcact    191280
     gccaccatct ttggccacga cttattcgtt gttcgtggtg ggggtgtcga gcctgatcgg    191340
     ctttgcccgg aattttcgtc agggacaggt ggatgtcaaa gccggtgttt attttgcggt    191400
     gccttctttt gtcggtgtgc tcttggtgcg tcgctggctg ctgcccgcca ttccagatca    191460
     gtgggtttgg gggccggttt tgtttaacaa agaagttgtg attttaagtt cctttgccgt    191520
     ggtcatggtg atggccgctt tggcgatgtt gttgccaaga gcttcttcgg cgcaggggcc    191580
     ggtggctccc gctgcgtttg ctttgaaagc cttgggtgtc ggggccgtga caggctttgt    191640
     gggggctggt ggtggctttc tgattgtgcc ttcgttggtg cgcatgtcgg ggcttcgcat    191700
     gaaggtggct gtgggcactt ctttgggggt gattgctgcc aattcaatgt tggggttctt    191760
     tggtgatctt tgggcccgca caccgatgga cttcgttttg cttttgaagg ttggtgcgct    191820
     ggccgtggcg ggaatttttg ttggttccta ctggtcgcag cacacttctg aggcgcgttt    191880
     aaagccggcc ttcgggatat tcgtattgct tctgggcgga cttattattg tgcaacaggc    191940
     gcttaattaa cacttttaaa tactttcctg ggcgttaacg tttgacctca ttctcagttg    192000
     atttacgatt gagaatgagg tgactatgca caaagaactt tatcccgtga attccgaggt    192060
     ggcgaaaaaa gcctggattg atgaagccaa atacaaagcc atgtatgagc gctccattca    192120
     agacaacgaa gccttttggg ccgagcaagc cgagcgcctg gactggatca aaaagtggga    192180
     taaggtcaaa gaagtcagtt tcaagaaacc cgttagcatc aaatggtact tgggtggaaa    192240
     aatgaatgtg tcctacaatt gcgtggaccg tcatttaaaa acccgcggcg acaaaacagc    192300
     cctgctgtgg gaagccgaca atccatccac accttcacgc aaaatcactt acaaagaact    192360
     gcatctggaa gtgtgccgct tcgccaatgt cctgaaaaaa atgggcgtga aaaaaggcga    192420
     tgtggtgacg atctatatgc cgatgattcc ggatacagcc gtggcgatgc tggcctgtgc    192480
     gcgcatcggg gcggttcatt cggtggtgtt tgccggtttt tctccggatt ccatctcaga    192540
     tcgtattttg gacgggcagt gccggtttgt gatcaccggt gatgccggct tccgcggcag    192600
     caaagtggtg gcgttaaaag aaaatatcga taaagcactt gtgaaaactc cggacgtgca    192660
     aaaagttctg gtggtgaaat atgcgggcac gacggtggac atgaagccgg gccgtgatct    192720
     ttggtatcac gaagaagtca aaaccgtcag cgaccagtgt gaaccagaac ccatggacgc    192780
     ggaagatcct ttgtttattc tttacacttc cggttccaca ggaaaaccca aaggggtgat    192840
     gcacaccacg gggggatatc tggtgtatgc cagcatgacc caccagtatg tctttgatta    192900
     tcacgaagat gatatctact ggtgttctgc tgacgtgggt tgggtgaccg gccatagcta    192960
     tatcgtgtat ggcccgctgg cgaatggggc gacaagtttg ttctttgaag gggtgccgaa    193020
     ctatccaact ccaagccgtt tctgggaagt ggtcgacaaa cacaaagtca caatattcta    193080
     tacctcacca acggcgattc gttctttgat gcgcgaaggg gacgcggcgg tgaaaaccac    193140
     ctcgcgaaaa accctgcgcc tgctggggtc cgtcggggag ccgatcaatc cggaagcctg    193200
     ggcatggtat cacgatgtgg tcggtgaagg acgctgcccg gttgtcgata catggtggca    193260
     gacagaaacc ggtggcattc tgatcacgcc actgccgggg gcgattgcgc aaaagccggg    193320
     gtctgcaact ttaccgttct ttggggtgca accgaaactt ttgaccaacg aaggacaaga    193380
     gatccatgga ccgggcgaag gggtgctggt gattgcggat tcctggccgg gccagatgcg    193440
     cacggtgtat cgcaatcacg aacgttttga agacacgtat ttctcgaact atcccgggta    193500
     ctatttcaca ggcgacggct gtcgtcgcga tcaggacggg tattactgga tcacgggacg    193560
     ggtggatgac gtgatcaacg tttccggtca ccgcctgggg acggctgaaa ttgaatcagc    193620
     gcttgtggcc catcacaaag tggctgaagc cgccgtggtt ggatatccac atgatatcaa    193680
     agggcagggg atttatgcct ttgtcacctt gaagtccggt gaaacggcca gtgaagagct    193740
     gcgtaaagag ctgattcaga ccgtgcgtaa agagatcggg ccgattgcga ctccggatct    193800
     gattcagtgg gctccacgtc tgccgaagac ccgttctggc aagattatgc gccgaatcct    193860
     gcgtaaaatc gccgagaacc acccggatca actgggggat acgacaacct tgtcagagcc    193920
     tgcggtggtc caagaactgg tggacaatcg catgaaccgg tgatagcttg cgcgtcatga    193980
     acacacgtat gatgaccctg attttgatgg tgcttgttgc ggctttcagc cgtttgatcc    194040
     ctcatccttg gaacttcacc gcgattggtg cgatggcttt gtttggtggg gcttacttcc    194100
     catccaaaaa acaatctttg ttgatcccgc tggcagcgct gtttatcagc gatctggcgt    194160
     tgggtttcca taacaccatg ttgtttgtct acctgggttt cactttggtg gtgatgctgg    194220
     ggtgggcttt gcgcgatcaa agaagcgttt tcaaagtggg cacttccgct ttggtgacaa    194280
     gctctgtgtt cttcctgatc tccaactttg gtgtttgggc gatgggcaca atgtatgctc    194340
     cgaccttcaa cggtctggtg cagtgtctgg ttgcgggcat cccgttcttt gacaaccaga    194400
     tctacggaga cttgttcttc tctggtttgt tgttcggtgg ctatgaagcc atcaaaaaat    194460
     acgcgccaga attcgtcggc gctcctgtaa aataagactg tgaaactggg gctgcatcgt    194520
     ccggttctgg acggtaaagt gaacttcccg ttgtgtctgg ccccgatggt gggcctgact    194580
     cacgtggctt tgcgcgaagt catgcgcgat tatcttccgg ccgaggctta caccatctgg    194640
     ccgaccgaga tgttgaattc ccgccgtatt cctggcgaaa atcttgaaaa aacccctgaa    194700
     accatgcgcg ccgcttatga gccgggcttg gtgccacaga tccttggtaa cgaagaagat    194760
     gccattgctg aaagcgtgaa acgcctggtg gagtggggcg ctgaagccat cgacatcaac    194820
     atgggctgcc cggtgcaaaa agcgctgaag cacaattatg gtgtggcgtt gatgggggac    194880
     ccggcctatg ccgccgaagt ggtgcgcatg accgtcaaaa attccaccgt gcctgtcagt    194940
     gtgaagttgc gcgctgtcgg cagcacgaaa gagttcgacg aacttttgac gttcgtgtcg    195000
     ggtcttcgtc agtcgggcgc cgcctgggtg tgtctgcatc cgcgaacagc ggcgcaaaaa    195060
     cgccgtggta atgctgattg ggagcagatc aaacaacttc ataaagcggt cgatttcccg    195120
     gtcatcggca atggcgacgt acaaacctat gacgacgcca tcaacatgct gaaagaaacc    195180
     ggttgtgaca tggcgatggc gggtcgtggt cttgccgcgc gcccgtggat gatgtggcaa    195240
     ctgggtgaag agctgggttt tgcgcccccc gcaggtaaag aaggtcagaa agcccctcgc    195300
     acttcggaag aagagggcgc cgagtacggc aaatgtttgt tgcgattgat tgatcgctgt    195360
     cgtttttatt tcggggaaga tctggctatg cgcaaagtgc gcttctatgt tcgcaccaca    195420
     agtgtgtggc tgccgtttgg aaacactctg gtgggtgttt gtgcgaaggc tcgcaccatt    195480
     gatgaaatga tcgagggtgt gacgaaattc tttgaaggcc ccgtggagat gagtctgcgc    195540
     acggagcttc gacaataatc ctactcttgc agcaggggca tcagtttgcc ttcttcgtcc    195600
     aaggctttca aatccgtata gccgccgatc aatttgccgt tgatcatgat gatcggcaca    195660
     gttctccagc cggtttcggt tttgattctt tcaatttctt caggtttatc ggtcagatcc    195720
     accacgtcat agtcgatgcc tcggtcatcc atgaggtgca tcgcgcgatc gcagtaagga    195780
     caagggattt tcttgtagat taatactttt gccataattc tttttgacat aggtaggtgg    195840
     gggagacaag gtttcatcta agatgaactg cctgctctgc cattctcctc attctgcgcc    195900
     cttcaaagtg gataaaaagc cagcccgcag ctattttcat tgcgcagagt gtgatttgat    195960
     ctttatggac cccgcagagc gtcttgggcc gcaggaagaa aaacagcgct atgatgaaca    196020
     cgaaaatcac agcagccctg ggtatctggc gttcttcgaa ccccttatca acagcattga    196080
     agaacacttc aaagctgcgg gtgtcatggg ttcgtcactg acgtcattgg atttcggttg    196140
     tggtccgacg gcgctgcttt cacagctttt gaatctgcgt ggatttaaaa ctcacgatta    196200
     tgatttgtac tatcgtccga atcaggatga gttgcgcaaa acctatcatc tggtgaccag    196260
     cacggaagtg tgggagcact tgtataatcc tcgtaccgaa atcgaacgca ttctgcgcct    196320
     tttgaagccg gggggattgc tgggagtgat gacttccgct cacagaggtg aagcggtttt    196380
     ccatgactgg cactatcgcc gggatacgac tcatgtcgta tttttctcag agcagaccat    196440
     gaagtggatc gctcagacgt ataaaatgca gttgataaaa agccgaagcc cgtactggat    196500
     tttccagaaa ttgttctagc cttaacgggt gataccaaac ttgccgactc aaaatgagaa    196560
     ttttttgatc ggcttttgac caagacccca tattccgaaa agacaggtga ggaatatgag    196620
     ttgggtcttc acataattgt catcatctta acaatagtct gggctggtcc gggaaaagcc    196680
     gcacccgagg tggctttggc gatggcttgc attcagcagt cccactgttc tgatcaggta    196740
     aagaaactgc agacccaatt gcagtggaac tgcgaacttg aagtcaaatc ccaaaactgc    196800
     gccaaacttt cagaagagca tccggactgg gcgccactga tgcgcaagtg cgatctggct    196860
     tcgcaatgcc aggagcaaaa agaatacgca cagaaaaaag cgctggcctg tttgcgggga    196920
     tataaaaacg cgatggtcga tctgggaatc tctttgaaag acatgaccgt ttcgctggcg    196980
     ggtcttgtcg aggacagttg ggagtccctc aagaagaaca accgtgaacg ggcggcgttc    197040
     ctcaagcaat gcaacacctc gttgtcctgc aaaaaagatc tggtgaaaga cgatcatcgc    197100
     tacaacaaac tttctgatga agaaatcaac aaactgcctg cgtcgttttt gtatgtgcag    197160
     gctcaggata tgaaagctta caggtcgtcg ctggagcgcg tgcgccccaa gccttatgtg    197220
     ccgattgccg agcgcgctcg tgacgacacc gcaatgacct ctgatcagaa tcagaagctt    197280
     gaaaacctga tgaacatcgc cggttccaaa attaaagaac agtatggccg ctacatgtgc    197340
     tacaacgctt tggcccggga agagctggag tgttacgcca tcggcacgat cgttgatccg    197400
     acactgctgg caggctactt cgtaaaaggg gctcgagccg ccacagccgc gggccgaatg    197460
     atcaaggctg aaaaagagat tcaggctgga actgaagtag cggttggggc ggggaaggtt    197520
     tcccgcagtg aacttaccgg ccgttacata agctattctc cgaccagtgt agagcagaac    197580
     accgcttgga ttgcccgtgc tgaaaaaggt gcggatacca acgtgacatt cctggatgtg    197640
     gaaaacagcc agatgaaata tctgaatgac attttaaagg acaaaaacct tgtgacgggg    197700
     ttgacgaatt atcacaagga attgttgttt gataatatca aggcactgga agctgctaac    197760
     ccggggctgg tcattgataa gtactctgat ttcaagtcct cgcgttttgc tttttcaggc    197820
     aaagtcccca aggacattga agagcagttg gaaaaggttt ttgacaaaac caatgctgaa    197880
     ttcaacaaaa agctgaaaga gtcaggcgcc ctgaagcccg acaccaaaac agaagactgg    197940
     ttccgcgctg gcattggcaa ttcggctgat gaggccaata tggcggcccg ctactcccgt    198000
     cagttggaca agaacgaagt tcagagcttc cgcaaggatg gtttgaagac cacgatgcaa    198060
     cagaaaatca attcccttga aaagcaacgc caagagctgc gcacggaagt cgctggcacc    198120
     ggcatggtgg atggaaagac tttcgatcag gacgtgtttg atatcgtccg taaaggcaaa    198180
     ggggatacgg cccaggtgca gcaggccttg aaaaaccgct atgctttaag tgacatttca    198240
     accggcaccg tcaaaaaatt gcagtcttat gtgactgcga cagatgagtt ttcaccgggg    198300
     atttatatcg ccaagcggga gattgcccat ctgaatgcag cagatcaggg tggtttgtcg    198360
     gtggacatta tcgggctggg ttcagcgaac ttaaaaggca cggctgaagc gttggcttct    198420
     tcttccaacg tgaaccgggc cctggagacc actcgggcgg cagaaaaagc cgtcaccaaa    198480
     aaattcaatg accagaaaaa gcagtttgag gatgttttga ccaaagccgt cccgtcaggg    198540
     aagttgaagt ctttgtgttc aggggatgac tgcgtggccg tggcggtgaa gcctttaaat    198600
     caggctgaaa agcaggacat cttaaagggt ctggctaaca ccgactactc gggaacctac    198660
     cgactggcct tcattccgga tggtgtgcgg aatgtatcgg cccgcaacgc tttggccaat    198720
     catggagagt cggttgaaaa aatcctgcgc caatccttgg gggcaaggat ggagccacgc    198780
     aaacttaaag gcctgacttt cggtgtggac atgcggactc agaatttaaa cgagggcagt    198840
     gtcaaattgc tgatgggtga agccaaaggc gtgacgctga catccagcga acgcaaacaa    198900
     attcaggaag ccttcaaaga agccatccaa aaattcaaca cctccacctc cgccaactac    198960
     aacgccctcc cataaaaagg tgcctggttg ttttatctgg ctacagtgca gaatcttgtt    199020
     cgaaatacat ttatcctgcc ccctcagact gagctatcgt aaaggcctga ggccttgatg    199080
     aaaaaaatga cagtgttgtt cttccttgct gttaatatgt tttgcccatt ggcatgggcc    199140
     gaggacatca catggatccg ttgggatgat ccgcccattt ttatttttag cggcccattt    199200
     aaagggcggg ggctgctgga taacgtagag agtgaacttc gtcggaagct tccccagtac    199260
     acccacaaga ccatcgaggg cacggtcccc cgggttttga aagaggccga agccaaagct    199320
     ccggtgtgta atgcgggctg gctggatacg ccggagtggt ccaagctgtt ttatttttca    199380
     aggccggtct ttgtgattcc tgccaatggg attcttctgc caaaaagtcg gctggtggag    199440
     gtcagaaatc tggcgcccta ttcattgcaa aagttcctgg atgataaaaa agactggaag    199500
     ctcggggtgg gaagacttta cggcgttggt attgatgatg tgctgattaa gaacaactat    199560
     cagaaaaacc cgcaggttat caccatcgcg accagccttc gtgtgcacaa aatgcttcat    199620
     tccaatcgga ttcagtacac cttgggatat ccctttgaag cggtctatta caacaaactg    199680
     ctggatggga agaacaacga ggtcgtgcat atcccggtga ctgaaaatgc agcccgtgtg    199740
     gaggtcgtgg tggcttgtcc taaaactccg tggggagcca aagtcatcgc ggatatcgat    199800
     caggttttgc aaaacagagc actgctggaa aaatttgaaa aaggggtgga ccgctggctc    199860
     agcattgagg accaggaaaa actcgctccg gcccgtaaag aattttatcg aaagaactat    199920
     ccttcgctca agtgatcgac accgcacaag gcgtgcagtt tggctttgaa ctctgttggt    199980
     tttttaagaa ccttgatttc atcaaagatc gccttggctt cctgattttt cagggacagg    200040
     gctttgagcc attgtttgga gcgggacacg gcaaagtagt cgttgatgta caaagtgctg    200100
     gattcaaaga actgcggcag cagggggcgg gcgcgttccc agctcatgtc ttccacgggc    200160
     tgttgattca ggctttgttt gatctggcta aagatgaacg gattgctcat gactccgcgg    200220
     ccgatcatat agtcttcgca ctgggtgact tccacgcagc ggttgaagtc cgccacattc    200280
     cagatttcac cgttggcgat aagctttatt ttggtctttt ctttgatctt cgggatccag    200340
     tcccagtaag ccggtggttt ataaccatca gttttggtgc ggcagtgaac cgtcagccag    200400
     gtggcattgg cttcttccac ggcctgggcg atttccagac acttggtcgg atcgtcaaag    200460
     cccagacgga ttttcgccgt cactggaaca tccgcgggaa cagccttgcg aacagtgtcg    200520
     acaatgttaa acacgcgatc gcaggatttc aaaaggctcg cgccgccatc atgacgattc    200580
     acggtttttg ccgggcagcc gaaattaaga tccacaccta gggcgcccag tttcactgcg    200640
     cgctgggcat tcaaagccaa aggttcggcc tggcctccca aaagctgcac aaacaccggc    200700
     gtgccccagc gggtgcgcga tccggttttc agttcggggc agtttttata gaaaacactt    200760
     tccggatgca gacggtcggt gacacgcaaa aattcggtca cgcactgatc aatgccgccc    200820
     agacgcgtga gagtatcacg catcacccag tcgacaacgc cttccatcgg agccagaaac    200880
     agtttcattc ctaagcgccg cccagtttgg tcagaatatc aaaatgcttt ttttcaacag    200940
     gctgaatgga aaggcgggag cctttttgca aaaccagcat gtcagccagt tttgcgttgt    201000
     cgcgcagctc aggcagactg atatagtttt taaagtgcgc cacatattcc acctgcacac    201060
     agaaccagat tggtttttct ttggtggctt tcgggtcaaa atattcagat tttttatcga    201120
     actgctcttt gtccggctcg gccaccttgc tgatacgagc aatgccagcc actcctggag    201180
     gagtggcgtt ggagtgatag aacagcactt cgtcgccgac ttgcatgtct ttcatcatga    201240
     agttgcgcgc ctgatagttg cgcacaccgg tccaccaggt cgttttgtct ttcttcagtt    201300
     gatccaaaga aaagacatcc ggttctgatt tcatcagcca gtacttcatt tggttttctc    201360
     cgctttgatt tttccggatt tgaagaacca ttcgcccgct tgtttgcgga acaggctgac    201420
     ttcgtgatgg atgaagtctt catcatcgac gttgtagtag gctttgaact cgacggtgcc    201480
     tttggtgccc ttttcttcgg cgtgaataat ctcaagcttc aggaacttcg cacgttccgc    201540
     ccactcacgg ttggcctctt cgtcgatttg atccaaagtc tgaggatctg tcgtatcctg    201600
     caggtactcc atttgattct tggcaaaagc gctgtaacga gcgcgcatca aggcttcggc    201660
     cgtcggcgcc aaagctttac cagagtgata aacaccacaa cattcagaat aatttttctc    201720
     agaaccacaa ggacatttca tagcccgcga aactaccaga attcccccta aaaggtacct    201780
     gcttactttt tccgaagcat tgcgttattt ggcttgtggg ggtgcccttc cagagggggg    201840
     ctgctatcgt tttggggtga ggtgaaatga tggcgaagtg ggctttgatt actggggcaa    201900
     gttcgggaat tggctgggca acggccgagg cgctggcagc gcaaggattt gatattttcg    201960
     tgactggcag acgctatgaa aaactgcaag agctggaaaa agccatcaaa gcccgtcatc    202020
     ccaagactca ggtgaagctg gcttgttttg acgtgtccga ccgtttcgag gtcagtgaat    202080
     tcgtcaaagc tcacaagact gaaatttctg aggtggaaat tctggtcaac aacgcaggcc    202140
     tggctcgtgg agttgaaaaa atgcaggacg cctctttgga tgattgggag gtcatgatcg    202200
     acaccaacat caaaggcctg ttgttcatga cccgcgccgt ggtggaacac atggtgaaaa    202260
     agaattccgg tcatattata aatttaggct cggtggcggg tcgctggact tatccaggcg    202320
     gtggagttta ctgcgctacc aagtttgctg tgcgtgcatt gtctgaagga ctgcgcatgg    202380
     atttgctggg caccaaggtg cgtgtcacca acattgaacc gggcatggtg aacacggaat    202440
     tttccgtggt tcgcctgggg gatcaggcca aggccgacaa ggtctatgaa ggcatgactc    202500
     cgctgtcggc tcaggatatc gccgagacgg tcgcttggtg cgcagccaga ccggcccatg    202560
     tgaacattca agaactcgtg atttatccca cagatcaggc ccatgtcggc caggtcgctc    202620
     gcaaaggagt gtagtgatgg cagagggcgg attcagaatc gaaaaagaca ccatgggtga    202680
     agtgaaagtt cccgcagaca agttctgggg agcacagacc caaaggtcca cagaaaactt    202740
     ccgcatcggg ggcgatcgtt tcccgcgcga gatgatccgg gccttgggtg tcttgaagaa    202800
     gtccgccgct atcaccaacg aaaaactggg tctgcttgat ccgaaaaaag cctcggtcat    202860
     cgtgaaagcc gccgatgaag tgatcgtcgg caaactcgac gcccatttcc cgctggtggt    202920
     gtggcagacg ggttcaggca cacagaccaa catgaatgcc aacgaagtta tcgccaatcg    202980
     tgcgatggac atgatgggca tcaaacttcc cagcaaggaa gttcatccca atgatgatgt    203040
     gaacaagggc cagtcttcga atgacacttt ccccaccgcc atgcacattg ctgtgggcga    203100
     gcagattcat catcgcctga ttccgatgct ggaaaagctg cacaaagctc tggaaaacaa    203160
     acagaaagaa tttaaagaca tcgtgaaaat cggtcgcacc catttgatgg atgcaacccc    203220
     cctgaccctg gggcaggagt tttccggtta cagcacccag gtgaaacact ccatccagcg    203280
     cgtgaaaaac accttgccgc atctgtacga gctggcattg ggcgggacgg cggtgggaac    203340
     gggtttgaac acgcatccga aatttgcggt tgaagccgct gcggaaatcg ctcgcgagac    203400
     ggggattgcc tttgtttcgg ctgaaaacaa gtttgaagcc ctggcggccc atgacgcttt    203460
     ggtggaagtc agcggggcgc tgaactcggt cgcggtgtcc ctgatgaaaa ttgcgaacga    203520
     catccgcctg ctgggttccg gcccgcgctg cgggatcggg gagcttcatt tgcccgaaaa    203580
     tgaaccggga agctccatca tgccgggcaa agtgaatccc acccagagcg aggctatgac    203640
     catggtctgt gcccaggtga tgggaaatca cgtggccgcc acaattggcg gggcgacggg    203700
     gcattttgag ctgaacgtgt ttaagcccgt gattgtgttc aatgttctga attccgtgcg    203760
     cctgttggcg gacgcggcag aatccttcac cgatcactgt gtggtgggca ttgaagccaa    203820
     ccgtaaacag attcagaagc atctggagca gtctttgatg ctggtgacgg cactgaatcc    203880
     tcacattggc tatgacaacg cagccaaaat tgccaaaact gcccataaaa acggcacaac    203940
     actgcgcgaa gaagccatca atcttggact gctctctggc gaagaatttg ataagatagt    204000
     aaaaccggaa aacatggtcg gccccagccg atagagcgtg agctgaagct cggctccagc    204060
     cagcgggcgc ataagctgaa gctcggctct agccggcaga gctgaagcgc cggcaggcgc    204120
     gcaagctgaa gcagcaacag aatttggaga aatatgaacc cactattggc aaaagcggac    204180
     tggatgaatc gtgacgacat cagaccctat gtgtttgttc gtcccgaaaa tcagatcgct    204240
     cagccgggtt ctgtgcatcg caatgactgg ttcactcagt ctcccgtctt caaaaaccct    204300
     ctggatgtga aagaactggc gtttgccgat cgtatttact ctttggaaga gcgggccttc    204360
     gggccgtcaa acatggccat gcctcgctgg gtcttttatg actgcgcggt gatgccaggg    204420
     tttgtggcgg gctttgcggc tcgtccttcg gccctttcta aggcggcgcg tgaggcgctg    204480
     gaccccaaaa agttcccggc cagcctttct ccgatcaaat cctccggggt tctaaaagag    204540
     gttgagtccc tggatgacat ggactggata cccttgtccc tgtttatcat catcccgacg    204600
     atgcataagg gcgagtgggt ggcgcacaat ctgtgctctg tgaactcact gttgccgaaa    204660
     gaggagcagt tttacggtct gggtttcttg tccaaggcct ttggtctttg gtacgccaac    204720
     gtggagcaat gctccgggat gacccagtgg gggagtccgg ctttgaagct gcactcgcat    204780
     tatggtcatt tagaggtaat tggggcttac gctccggtgc attctcatgc taaaactatt    204840
     acttaccgcg tacaggtaaa tacccagtgc tgggaaaagt tctttaacaa ggaaccggat    204900
     ctggcctttc tggaaaacta cggaccgacg ggcacgttca tcgatccgaa acaggaagtg    204960
     agtatgttga acttccagca gcgcattgag cgcggagagg gccctttcta cctgagtgca    205020
     ggggagattg cccaaaagaa gctcgacgaa caattgatga tttatagttt gaaacaacaa    205080
     tactagatag gaagatatac atgtccatga ataccctgcc accggtcgcg aagtcttttt    205140
     ttgcgttctg taaaaaatgt gatgccgaca gataccacgt tgtcctggct cacacttcgg    205200
     cgacttccgc aaagatcaag tgcgagatct gcggttctca aaagacgtat tctcttccta    205260
     aagctcagac taaaaccggc aagcctttga caggtgcagc ggcgaaaaaa cgtgagcaga    205320
     ccatgagctc ccgcaagtcc agccaccgca atgaatacga catgctgatg tcgaacgacg    205380
     gcgcggcgac ggcgacttac agcatgaagg gcaagttcga aaagaacacc aagctgcaac    205440
     atcctaagtt cggcctgggc ttcatcaagg acgctatgac tgataaaatt gaagttgtgt    205500
     tcgaagacga agttcgtact ttgatccata accgtcagta attttttata gaatcgaaaa    205560
     ttaatggatt ggtttaaggg gcttaacccc gaacaacaaa aggccgtgaa gcacaacttc    205620
     gggcctttgt tgattttggc gggtgccggt tcaggcaaaa cgacggttct ggtttccagg    205680
     acaggacgac tgatttcaga gcgtgtggca caggctcagg aaatctgcgt gcttactttt    205740
     accaacaaag ccgcgcgcga gttgaaacat cgcgtgggtg caaagctggg aagctccggc    205800
     tcgggcatgt gggcggggac cttccactcg ttcggattgc agattttgcg ccgattccac    205860
     aagcatgcgg ggctttcccc gtatttcggc attgttgatc aaagtgactg taatgccatc    205920
     gtcaaagatc tgatcaaaga catcaaaaac tcgggcaaag acaagttcga tgccgacaag    205980
     atcctgaaca tgatcaatga ccgtcgcacg ggcatggccc cgcagacgga agcctttgac    206040
     gaatatcacg agatggtgga agtcctgact ccgaaattca ccaaacgcct ggagcatctg    206100
     ggggttgtgg atttcgaggg gcttttgatc aagcctatta cgttgtttaa agaaaatcct    206160
     gaaatcctgg aaaaagtgca gggcatgttc acgcaagtga tggtcgatga gttccaggac    206220
     accaatcgtc tgcagatgga tctgatcgcg cagatcgtga aaagccacaa caacatcgcg    206280
     gtggtggggg acgacgatca gtcgatttac ggctggcgtg gggcggaagt gaagaacatc    206340
     ctgaacttcc cccaggaatt cacaccgtgt gaagtgatca agcttgagcg caactatcgt    206400
     tcttccgctg aaattctggc ggtggcgaat gcggcgattt ccaagaataa aaaccgtcac    206460
     ggcaagatcc tgcgtccgca ggttgcggaa gacaccggtc agttgccgga attgtttatt    206520
     ttggatcgtg aagaggacga atgtgaattc gtcgtcactg agattttgaa tttccaaaga    206580
     cagggttatt cctacaagga catggccgtg ctttatcgtt ccaatacgca aggaggcttg    206640
     attgagtcct cgttgcgtcg tgcgaacgtg ccctatcata tctcaggggg cacttcgatc    206700
     tttgaccgtc gcgagatcaa ggacctgatg gcttatctga agcaggcttt ggctccgaat    206760
     gaagtgtccc ttcgccgtat catcaatgtg ccttcgcgcg ggattggtga cacttccatc    206820
     gagaaattga gtgaatttgc actgaaaaaa cgcatcaact tcgtcgatgc ctgccgtttc    206880
     tggcaggaag cgggagtgca ggacaaagcc ggcgccgcca ttgatgattt gatgatgttc    206940
     attgaaaatc ttccgaaaaa catcctcgat ttccaggtgg gttcttcgcc aggggcgaag    207000
     atggttcaga ttttccagga cattggttac cgcgaatacg tttatggaac ggccgcggac    207060
     cccaccagtg ccgaaaaaaa atggatggtc gtcgagattc tgggacgcat cctggattca    207120
     ttcctgggcc gtcgttctta tgacgttgaa aacatcaaat ccttcgtgga ttgcatgctt    207180
     ttgcgggatg atctgtccga agaggaactg gaaaacaaag ttcagctgat gaccttgcac    207240
     gcctccaagg gcctggagtt cccggtggtg attttggcgg gccttgaaga agaccttctg    207300
     ccgcacaaga atctgggatc tgacatcgat gaagaacgtc gtttgtttta tgtgggcgtg    207360
     acccgcgcaa aaaagcgtct ggtgatgtcg cgctgtcagc agcgcaagaa gaacggcgcg    207420
     gttcgtccgg tggcgccttc acgattcctg ctggagcttc ctaaagagct ttacacagaa    207480
     ttccctctgg gagctcgacc tgtggtcggg caagaacgcg aggatttagt ggcaagtttc    207540
     ctgtcgaagc tggacagtaa gctgggaacg ggcaagaagt agcgattttc tctcgagatc    207600
     cgaatctatt ttgatctgaa gcctgagcaa ccatcacttt cgtgaatgag tgctaaggct    207660
     atgtccggga agtgccgatc aaaaaactgt taaaaagttt ttttcgagag gattccatga    207720
     aacgtcccgt gcccacccaa gctgaaagcc ctttcgggtt tgatgagttc tttttttcaa    207780
     caaccgacaa acgtggcgtt atccgttatg gaaatgatgt ctttgttcgt gtcagcgttt    207840
     atcccaaaga atccatgttg ggtgctccgc acagtctgat ccgccatcct gacatgcctc    207900
     gtgccgtgtt taaggaattc tggagctttc tgaatcaggg gaaagccgtc ggagcatacg    207960
     ttaagaatct ggccgggaac ggcagttatt attgggtgta tgcgttcgcc tttccgattg    208020
     gcgatgggta tttgtctgtt cgattcaagc cctcttcaga gttgttttca gttgtgcagg    208080
     gtctttataa agaggtcctg gcttacgagc agcaggaaca cagtctggaa gagtcccatc    208140
     agcacttgct gctgaagatc caagaggccg ggttccctga ctatgaaagc tttatgatga    208200
     aggctgtcat ggaggagctg aaggcccggg ctgcccaggt gctggcctct gaatccagat    208260
     cgtccggagc caccggtgcc agtcagatca ctgcggtcac aaattccacc acacgcaagc    208320
     tgaatgatgt ttttgataag ctgcgggact ttcaaggggc caatcaaagt cttgaaagtg    208380
     ctatgggtcg tctggatcag ggctttcagc agctgaagtt tatttccatc aatatgaaaa    208440
     tcgcggctgc caaatttggc gagatggcgg caagtctggg tgtggtttcc cacgaatttt    208500
     cagtgttgtc gggcactatt gaaaagcacc tgggcggtct ttccgggttt gttgaggaat    208560
     tgtctagtgt gattcaaaag tgtgtcttgc gtgcagcggc cctgaatgtg cagatgctga    208620
     tggtggactt ttttgttcgc gaatccatcg ccaagctggc aacttcagaa aacgctttcg    208680
     acgagatgct gcagaatcag aaggcctttt ccgatctttt tgcccagtat tgccaaaatc    208740
     tcgataaaga gttttccgag ctgaaaaaaa gcctgtccgc gatttcctat gagatgctgg    208800
     aagtggccaa gtttgtgacc ggacttgaag tggttcgtca gatgggggcg attgagtcgg    208860
     cgcgaacaac tgagattaga aacagtttca cgcactatct ggaagcaatg gatgatttta    208920
     ttcagttgct gcgcgaaagt accggtgaaa tcggccgggg tgtgacttcc ctggcctcaa    208980
     attccgaatt cattgtgtct tccattcgca atatttcagg aaatgtggat cagatctttg    209040
     ctcttgcttc ctcgcaagag cagcagaaag ccggctaatc agcctttcat ggcttccttg    209100
     aattctggcg gcagcggggc ttcaaaagag tgtttatagc cattgatcat cacggtcatg    209160
     cgcgctgcgt gcaggaacat gcgtttggtt tggtaaatat tcgccatgcg ctcgttgtac    209220
     ttggggtcac cataacgagt gtcacccacg atggcatgcc ggatcagggc cgtgtgtttg    209280
     cggatctgat gctggcgtcc ggtgatcagg cgcacttcca ccaaagaaaa atacttattg    209340
     gcttcaagga ctttgtaaag cgtccgggcc tcgacgcggt cttttaaaag cccctgcgga    209400
     tttttgcgtc cttcagcttt gtcggaaata ggtgtgttcc attcctgcca atcggtgctg    209460
     acaggaagtt cgcctcgcaa aagtgcgtaa taagtttttt caactttgtg ttcttgaaac    209520
     tgcccggaaa gattggcggc ggtttcggca tccagtccca ccagcaaaag gccactggtt    209580
     tccttgtcca gacgatgtac ggggtgaatg tcctgatagg ttcccggtgt cagttgcttt    209640
     tttagaagtg tgcgcacatc gggtgggtca ttgtgaacag aaacgcccga aggtttgttg    209700
     atcaccagcc agtgtttgga tttttcgaca atgggtattt ggatcggtgc ggacgggcgg    209760
     ctcatgggat ctccttcagg attttctgca cctcttccgg gggcagatcc tgagtggtca    209820
     atggactttc aaacagggct ctttctttac gggagatcgc caatgaatgc acggaaatta    209880
     aaacaatcag gttgaacagg aatccgcccc agctcaggaa caggaaaaaa gttcccataa    209940
     gcaggatgtt cttttcataa gctttcaggt tctgctcttc agcaccctcg ttgaagggct    210000
     cgacatccga gcgggactcg cgccagtaaa gtccgacttt ttgcaggttg ttttgcagct    210060
     gtcggtacgc aggggctttg acctttttcc ggtgtatcca caaatgcagt ccggtgacgg    210120
     aagccgaggg aatccaaccg atgacatagg cggcggcaag ttcgggtgcc atagaggtcc    210180
     tttcaggagc ttttccagct tattcccttg gttgattctt agcaagccag agcccggggg    210240
     tttgaggcag caaagggttg cggggcaaaa tacatcaagg gggtgtctat gaatccgaat    210300
     atcaatgaat tcctggattt tctggaaaaa gaggatgaca cggattatgg cgacttcaag    210360
     cgtgaggtgg acctgcatct gatgcaactg gcagagtccc tgcgcccctt aagtaatgaa    210420
     caagtcctgc aattacgccg catgcgcgag caattactct ggtcttacaa ggacgatatc    210480
     gaagaaatgc gctcgttgtt gaaacaagag gtcagccacc ttgaagagtt tggcccccga    210540
     taagttggtg cgctgcgtgt ttccaagctt aaaaccccct tgtaggcttg aaggactgac    210600
     ggaggtcctt catgtccact ttggcgcaac aggagttttg cattactctc agcgatttgg    210660
     cctcgttcat ggagattcct ccaaatcaaa tcaaggccaa ggctgaaaaa actttgcagc    210720
     gaaagatcaa atccccgtgg ctgcttcccg aagaagcccg tcaattgttg ctggctgaag    210780
     gttacaagta tccccacaag gtgatttcta tccaaatgct taaaggtggg gtggccaaga    210840
     ccacgtccgt cctgaacatg gggctgcgag ccgccatgta cggcgcacgc gtgctatttg    210900
     tggacttgga tcagcaggct aatttgagtt tcgctttggg tgtcgaggac gagtcccttc    210960
     cagtctgggt ggacatcgtc gaaaaaaaga aaagcatcga tgaatgtgtg cgttttatcg    211020
     aaccgcacgt ggatttgatt ccgtccagtc tgaacaattc ggttttggac cgggtgttgc    211080
     tgaactccaa ccgcaactgg tctttggcgg tgaaaacccc gctggaaaaa atcaaacacc    211140
     gttatgacct gattctgatc gacacagctc cagccctgag cgccacgaac accgctgtga    211200
     ccgtggcttc cgacgaggtg attttgccag tgaacccgga caagttcgcc tttatgggcc    211260
     tgcaaaagaa cctgagcgaa ctggaagaca tccgcagcga cttcagtctg gagttctcgc    211320
     gtaaagttct ctttaccaaa ttcgatggac gtgagaagtt cagtcatgag cttttacaaa    211380
     agtgcataga gtcttttgag gactcgctga tgaagggcta tattcgaact tcagcagagg    211440
     tgaaaaacac cgtgcgctcc ggcaagagtc tttatgccgg aaagtctccg atcaaagccg    211500
     actatgattt tgtaacccgt gaaatgttgg gatttgttta aaaggaagta aacatgccag    211560
     agatcaagca ttacgacgca aagaaaaagc atcatcatcc aaaaaaacgc cgtcctcatc    211620
     acgaggcgca ggcggaaatc gacgaagcca ctgagatccg cggtgacgcc gaagaaatca    211680
     tcgatgaggc ccacgccaca gggggcgaag ctaaagccac gatgaaggag gcaaaggcca    211740
     caatggaggc cgctgatgaa atcaacacgg aagcgcaaaa cgaaggcgta aaggccgaac    211800
     aaacactgcg tgacgctcat gagatggaat ccgaaggtgc tccggctttt tctgaagaca    211860
     cgaccgattc tgacattcat cacagcgagg agaaggttca cctggagttt tatggcagtg    211920
     aaatgatccg ccagaaagcc ccgaaagtga tggaaatcgc agacacggtt gctgacgagt    211980
     ggaagaaaga cgggcagttt gaaggcttgc ctgtgggaaa tccgatcgcg caaatggcgg    212040
     cagccaaagc tttgcgcaca gccaaggatg ttgataagaa gctggaagaa aaaggtgtct    212100
     atgccatggc taaaatgggc atcgatctta tcaaatcaaa aatcgaaaaa agaaatcact    212160
     agatagatgt ccaaaagaga acaacgcatc cgcgaaattc tgaaccagtc cctggctccg    212220
     ttggagctgg gggtggaaaa cgaaagccac atgcactccg tcccggccaa tagcgagacg    212280
     cattttaaag tgctggtggt gtctgaagcc ttcgaaggaa aatctcgcat cgaccgtcaa    212340
     cgcatggtca acgatctgtt gaagtccgaa cttcaatcag gcctgcacgc tctaacacaa    212400
     aaagctctga ctccgacaga gtggcaagct caaaaagaca ccttaaactt cgtcagtccg    212460
     gaatgcctgg gcgggagcaa acacgatcgt cggtcctagg gcgcgggttt tggctggggc    212520
     ttggggctgt ctgaaatcag gatgagtttc acttctttct ttttgttgga ctgagggaag    212580
     ttgatttttg cggaagtgcg aatcgttgag atgaagtttg gattgttttt agcggtgcat    212640
     ttcgagatgt cgagagtgac ttcagagaag gacatatagt ccgaggcttc ttttgcgctg    212700
     atgactttcg cgcaagtgag tgcattgatg ttttcatcga ttttttcacc gccacaaccg    212760
     atattcgaag gcactttata ttccgccgtc cactgctgta aagccgggcc ctgaggcagg    212820
     ccataacatc caataatcgg cgcacgctcg acaaagaacg catcagattc agttccatcc    212880
     gactgaatat gttgcacgac gagcgcaact cgatcattgc catccaccgt cgcatgaact    212940
     gttgaaccaa gaatcgaaat ccctaaaagc attcccgcag caaaacgcat atatagtacc    213000
     tttgttcgtt gaaaataaat tggagccagt attgatcaat accaggttga ttgcggcgaa    213060
     atttattcag atttgcgtga aaacaaggcg ggcgattact cgtcgaattg attaagcttg    213120
     gacttcagct cacccagaag gcgtttgact tcctgcagct gctcttcgtc aggggacacc    213180
     ttgttggcag cttcttctgt cagggtttcc caggtgttca gggcgtgctt taggtcggag    213240
     ttcaggttgc cgaacaggga ttttttggac gacggctcac gcttctccgg tttttccggg    213300
     gaattcggcg tgtcagtatt cgaattttgc tgccgctcta ggttgccgcc actcattaaa    213360
     tgcttatttc tgtccgtaat ttaagctcag tgcttatttt ttgtgccgga aaaccggctt    213420
     tctatcagaa gcgcatcctg cgctaggggc gatagtgtga taaatggaac tccatttgac    213480
     aagcgttttc gggctggtaa attacttcgt ttatagacga agtcagggcc gaatccggtc    213540
     tttttaggag tgtgacgtca tgtctcaaga gattatctac acaatgaagg gcgtaagtaa    213600
     agtatatcct ccacaaagat atgtgttgaa ggatatttat ctttcttact tctatggcgc    213660
     caagattggt gttttgggtc tgaatggctc tggtaaatcc actttgctca gaattatggc    213720
     aggcgtggac aaggacttcc tgggggaagc tttcccttcc aagacaatga aagtcggcta    213780
     tttcgagcaa gagcctcact tggatgaagc actgacagtg aaagaaaata tcttcgctgg    213840
     catgggcgaa ctgccgaaag tgatgaaaga atacaacgcg atcaacgaca agttctcgga    213900
     cccggatctg gatccggacg agatgaacaa gctgatcgaa aaacagggtg cacttcagga    213960
     aaaactggaa gccctgggtg cctgggacgt cgatcaaaag atcgaaatcg tgatggacgc    214020
     tcttcgctgt ccagatggtg atctgccggt gacaaacctg tccggaggtg aaaaacgccg    214080
     tgtggctttg gcccgtttga tcatgtctga accagatatt ttgcttttgg acgagccgac    214140
     gaatcacctg gatgccgaat cggtggcgtg gcttgagcaa tatctttcca agttcccggg    214200
     aactgttatc gcggtcacgc acgatcgtta tttccttgat aacgtggctg gctggatcct    214260
     tgaattggat cgcggtgaag gtattccttg gaaagggaac tatacttcct ggctggaaca    214320
     aaaagacaag cgtcaggcga acgaagccaa agatcaggct cgcaaggccc gcacgctgga    214380
     aaaagagttg gattggatcc gtcagggcgc caaagctcgc caggcgaaat ccaaagctcg    214440
     tatttctaac tatgaaaacc tgttgaaaga ggcttctccg gaaaaaatcc aggagatgtc    214500
     catctacatc ccgccaggac ctcgtctggg cgatatcgtg gtggaagcgc ataacatcac    214560
     caaagcctac aaccacaaag ttcttttgga tgacgtgagt ttcacaattc caaaaggggc    214620
     gatcgtgggt gtgatcggtc cgaatggcgt gggtaaatcc acgttgttcc gcatgatcac    214680
     aggcaaagag cagcctgatt ccggaacatt caaggtcggc gagacagtca aaatcgccta    214740
     cgttgaccag acccgtgaaa ctctggatcc gaacaagtcc atctacgagg aattgtccgg    214800
     tggcgctgat gtgatccagt tgggcacgcg tgaaatcaat gcgcgtcaat atgtttcctg    214860
     gttcaacttc tcgggttctg accagcagaa aaaagtcggt cagttgtccg gtggtgaacg    214920
     caaccgcgtg aatatggcaa aaatcttgaa gcagggtgcg aacttgttgc ttctggatga    214980
     accgacgaat gatctggacg tcaacaccat gcgtgcgctg gaagaggcgc tgctggagtt    215040
     cggtggatct gccgtggtta tctcgcacga tcgttggttc ctggatcgcg tgtgcacgca    215100
     catcatggcc tttgaaggtg attccaagat tgaattctat cctggaaact tcaccgaata    215160
     cgaagaagac cgtaaacgtc gtctgggcga aaatgcggga ccaaaacgca ttcgcttcaa    215220
     aatggtgtaa tgaaaaacca gtgggtgaga gcagggttat tcctgctctt tctttttgtg    215280
     gcttcacgat gggtcccacc gcatccggtg gacccctggg gacttttccg tcctcagaaa    215340
     attcttttta tgtttttcgc cctgtcagcc cttcaggtgg tgggcaaggc tttttcaatt    215400
     tggatcggcc ggaaagccgg cgtcattctg accggttttt tgggtggttt gctttccagt    215460
     acagcgacca ccgtcacgtt ggccaaagaa agtcacgaac ccgtaggatc gcagactctg    215520
     cgtctggcgg ccctgcaaag tgcgattttg gcgatgctgg ttcaggccgc ggtgctaatc    215580
     agagctggag gaattgcagc ttttgagttg gtggggctgc attttgcgat tttgtcgctg    215640
     atcactcttt ctttgattgg attgttatgg cggcgcaaac cgcaatcaca tccggtgatt    215700
     gcggggaccg aaagaatact cgatatccga tcttcattaa aactcacggt gttcattgtg    215760
     ctgattctgt cggcttccaa acttgtgcaa gagtgggcgg gcagtcaggg gttgatgatt    215820
     ctgacttttg tgatctcgct gtttgaggtg catggatctt tgatttcgac ctctcagctg    215880
     cttgcggcgg gaaaagtcga tggctttcaa tatgagcgac ttgtggaagc ctctttgatg    215940
     gcaagttacg tttcaaagtt tgcgctggtt gcgacgatat caagttcggg gtttcgcaaa    216000
     aaggccttaa tgaccttggc ccctgggatg ttgtttatac tgttgcatct taccagcagg    216060
     tgaaatttgt attgtttatg cggccgaaca tatgctccac acgccagttt gaaacggcgg    216120
     ggtcatagtg aagggtcgca aagacttgtc ccattccaat agccaattct gtacctgcag    216180
     agtttttcaa agacacctgc catccactcc actccagatg aatagctcca tttgaacccg    216240
     tggtatggaa aataacctta taggggccac cccagctagt tgcgatagag tcgaatttga    216300
     ctccggcatc agggccggca ttgcaacccg tgacactgtc ttgcaggata gggccgccag    216360
     ccacccactg gtgcatttca ccctggtggg ccagaacata ggcattggtc cacggcatgg    216420
     aggccgtgac tccacccgag ttgcgaaccg ccgaaataat tccgtagttg ggttgtttaa    216480
     tcccgccgtt aacatccatt tttgcagtcg gagcgccgac accaacaccg acgttgccgt    216540
     tttgatcgat gacgaccttt tctgtggacc cggttgcacc gttgttggtg gtgttgaaga    216600
     tgatttttgc cccgccggcc gacgccgtat gtgcctcggt ggcaacgaag ttgatagagg    216660
     catttccgcc ggattggtat tgggtcccgt tgtaagcaaa cgcagtaaga ctggtgaggg    216720
     attgtccgct ggtgacggct gtcggagcgg cgagagttcc ggcactttga tagccggaga    216780
     atgtggccat ttcgatggtg ctagaaacga gtgcggatat gcggccgcct acgtcggtgc    216840
     cttcgccaac ggcctgaatg cccgcgcgat tcgggtgtac tgctgatgac ggcacacgcg    216900
     ttgccacctg caaaggcacg gcgggagcag gggtgccgat ccctacaagt cctgagccgg    216960
     ttattctcat gcgttctgaa tctgttcctg ccgcggctgt atagaagcgc aagtttccgt    217020
     tcacggctgt ggcaaagtct gtttcagccg aagaagaaat gcgtgcgcta taggcgtgtg    217080
     cggtattatc ccaaccgcgg aacgccaaag ttccgatagt gtcgttggcc aaaaggggat    217140
     tgcgggtggt cgttgtgccg cgggaacgcg tcaggctgat ttgcggaagg gctgtttcgg    217200
     aattcacacc ttccagatag atgtcgtccc catagtctgt tccgtccccc acgatatgca    217260
     gacggcgggt cggcgaagtg gtgccgacac caatcatccc gtcactggcc agacgcagtt    217320
     tttcagttcc gttcacgctg aagcccagta tgttggtgcc cgggaacatt ccggatgtgc    217380
     tgtatccgcc aaaggaatat gtgggatttg ccgccgtgaa cgaacctccc cccagccgca    217440
     tcaatggtcc aaaggaacca ttcagggtca atgaggtgga gctgagatcc atggccagat    217500
     ttccgcccga agtgaacttc ataattccac cgttgttgga aatcccggtg ttcgggctgt    217560
     ttgtgaaagt caaagaaggt gaattccaag cgccatcggc aaggtaaacc ttacctgcgc    217620
     ccgtgatgtt gtaagttgcc atgttcaaat gggttgtggc cgtgtgattc cccagattgt    217680
     cgcccgtagc cggcagcaat gccgccggaa cttttccgga gccatccagt tctaccaaat    217740
     tcccggcaga ggtgccgaag tttttcgccg ctgcggttcc cagaccggaa acctgcgtgc    217800
     tgctgatggc aatgtccgca catgagaatg tgtcggtgat cgaactccag ttcagggttt    217860
     tgttggctgt tgcgcaggct gctggcattt gcgcattgcc agtgaccgtc gaacgaagct    217920
     ggccgaagcc aaagtactga gtgtcccact ttgtattgtc gtaaaccaga acctgtccca    217980
     ccagtggagt cgtcgcggcc acggctgtgc cttggatttt ttcaactttg gtgttgctga    218040
     ggcccgcggt cgaagtcaca tcgccagcga cattcggaag atcggttgcc gtcgcattgg    218100
     acgccgctgt cacaagaccc ttggcgctga cggtaacgcg gttgtaagtt ccggccgtga    218160
     cacccgaatc gttgagtgaa atcgccgggg tcgttccacc cgagcttgcc agcggtgccg    218220
     tggccgtgac atctgtcacg gtgcctccgc tggtcgtgac ggtggtccaa gacagttttc    218280
     ctgtgccgtc agtctttagc aactgaccat tggtgccgtc agccgcaggc agttcatagc    218340
     tgctgtttcc ggaaagagca ggggccttca gctccacata gtttgctcca ttgtacaggc    218400
     gcactccact ggaggtctga atcaggccgc tggtgttgat ggcggtggaa cccccgatgg    218460
     tgccggaggt gatcgcactg ccagaaactt ttccggcagt ggatatcgtc gcaagtttgc    218520
     tgtctgcaat ggccgcggcg gctgagatgt cttcattcaa aatggttcca ttcagaattt    218580
     tacccgtggt cacggcatcg tcctgaattt tggcggttgc gaccgtatta tcgttcaaag    218640
     tgactgtggc cgccggactg ccagacgagg acaccgcccc cgtcaaagaa gtgatagctc    218700
     ccgccgtgcc ggagttgtca tctgccgggg cccagttggt cccgtcaaat ttcaaaactt    218760
     ttccagacgc caagccggta ttcacaaccg gggttccttt gaggcgatcc acagaagtgg    218820
     cgctttgtgt gccagacaca tcccccgtca gattgccagt gaagcccgca gagctgcctg    218880
     ggatgtttcc ggaaacatta gcgccagtca ccacgggcgc tgtgcactcg aaggttccag    218940
     ccggggcaat atggcgaagg taggtgccag caccacaaac cggcaaagag gctttgtcca    219000
     caaagtcgct ggcgacattg gatcccaatt tcaaggcgct ttgcgccaac ttggcgtgac    219060
     cagcataggg gacagagcgg atttcattgt ccggggtgat cagcttccag cccgtgccgt    219120
     cgtggaattg cacacgcaaa agacgtttgt cgtcggcaac tggagtgtag gagcccccgc    219180
     cttcacaggg aatggcgacg gaattgtcaa agctgtccag cagtttaaaa cccgcagcag    219240
     cagggtagtt tttggttccg gtaccaatgg gtacgtcaaa gacgccggag gagttgcgca    219300
     tatcgatggc gccggaggtt tcacggtaaa gcacgcaggt gccgctcgga ttggtgatcg    219360
     agaactcgaa ttggacgccg ttgacttcaa gagcctcgcc ttgagagttc tttatacgtc    219420
     cctgataggt gagtgaaccc ggcgtggcca gagcccacga cgaaagaaaa agaactgtga    219480
     ttcccgttac gtactgtttt cccatgggat acttatcggc agatcgtcag cctcaattca    219540
     gtaattttgg gcaattcttt gcaaggcgag gggttgttga gtcctgttat gagacactta    219600
     caaaacagac ttggccaaag gcattttcag aaccacgcgg gttccactcg gagcagaaga    219660
     gctggtttcc tcgctggaaa agatctcaat cgtcccatcc atcatctgca ggtattcgcg    219720
     caccagaggc atgccatagc ccgtgccttt ttcgccctga gtgccgggac gggtggtctg    219780
     ggaattcagg ttgaagatgt tggccaggat ctctttcgga ataccaatcc catagtcgcg    219840
     gatctcgata atcacttcgc tgtctgtagg ataggcccgc aggtcaatgc gctcgccggg    219900
     gtgagagaac ttgatggcgt tgttgataag gttctgcagc acgacgttgc tcaggatggt    219960
     cttttcaccg ttgatcggca tgcggtcgcg ggaaatatcc agctgcatct tgatgccttt    220020
     ttgctgggcc gtggcgacgg tgttttcgta gacttcgttt aaaaccatgg tcaggttcag    220080
     cggtttcagg ggcatggagg ctttgccgtc tttcacggac ttcagatgtc gcacctgcgc    220140
     cagcaggttg acgatgtcat ccacggcgcg ttcgatcttg tccagttctt gggcgccgga    220200
     cgggttttcc tcccggtcct ctttggcttt caccaggttg taggtcatcg aagacagagt    220260
     gttggcaatg tcatggatca ggacccgcag gaggttttcc acatcgaggt ttttctcctc    220320
     gaggttcttc atcaggctct tttccccgcg gatgtagtag tgggtgttaa aggccgagaa    220380
     caacaaaaag acgacgacat taaagagctt ttcgcggttg tagtccccgt agtcggcaat    220440
     gacgttaggg ccgaacccct gcgagcgggc gtaccagaag aaccacaaga tcgtaaagac    220500
     gatcagatag ccgccaatgg ccccgggaac gccgaccagg ataccgcaga ccagaggaat    220560
     ggccgtcagc caaaagatgc ccggagcctc gataccaccc gaaagataaa gcagataggc    220620
     caggatcaaa gaggacatcg tgcccataat gcaggcagag atcagatagt ttttaaggag    220680
     tcgcaggcac agtggcggca caatcagcag caccacccag atcgggatca gggctgagtt    220740
     atagtcgggg accttatact gcaagttgaa ttttactata tagacaagcg aaacggcgag    220800
     ggtcagaaaa tagatgacct tgaagtaggt cagtcttttt ttgtaggcat cctctgatgt    220860
     aaaagtcagg tctcgcatgg tgcttctatt cctggttgct tccattatgc aatatcggcg    220920
     acgaaacaaa aggcctgagg gtatttcagc aatgtaatct tgtttagctg aaatttgttt    220980
     gttctagagt gagacaagcg ggcgcaaggt ctcgtagtgt gctttcagct ctacgaactg    221040
     cggggcgttt ccaccatggt cgggatgcag aatcatggcg gcttggcgga aggctttttt    221100
     caattcactt gcggtaaagc cggctggaag gtcaaagatc cagctcttca aaaactcgta    221160
     agcctgctgc tgagacgggg aaaagttatg agctttgcgc tgtggacgaa ctttgggggc    221220
     cggatattgt ccacgtgggg agttgaattc tttgcgcccc acttgcccga tcaggaaggc    221280
     aaggtgggag gggtcggcat tcaaaaggct ttcttcggag gcgttcacga agggttcaga    221340
     acccattttc tctctgagaa tttgcttgaa gcttgcctga aaactcatgt ctttcttatc    221400
     ggtagaaagg ggggatggct cagtccagaa ggtgttttcc ctgtgaaaaa cggacttttt    221460
     tagaggggaa aagggggctt tccatagggg aaaaagctgt tttcagaggg gggagggggt    221520
     ggttttagag gggaaaacgg ggtcttttcc gcttcctgtg cgaaaaaaaa atgatttccc    221580
     ctgcattttt ctttagacaa acgactggac ttggatacac actaagctca ttcgagataa    221640
     acaagactaa aaacctaacg gaggaatttc gaatggcaaa agcaaaagct acaaaaaaag    221700
     ctactactaa gaaagcagct cctaaaaaag ctgtagcaaa aaaagcagct ccaaaagcag    221760
     ctaaaaaagc ggctccaaaa gcagcagcta aaaaagcagc agctccaaaa aaagcagcag    221820
     ctcctaaaaa agcaaaaact gctcgtaaac caaacgcagc tttcatgaaa gcgttgactc    221880
     catctgcagc tttggcagca gttgttggtg cttctccact tccacgtact gaagttgtta    221940
     aaaaactttg ggcttacatc aagaagaaca accttcaaga cactaagaac aaaagaaaca    222000
     tcaatgctga tgcaaaactg aaagaagttt tcggcggcaa aactcaagtt tctatgttcg    222060
     acatgactaa actagtttct aaacacctta agtagtaggt cgtttaaaac ggggaaaaaa    222120
     gcctaggtaa aacctaggct ttttttttgc cttcgtttcg gggctggtga aaaaggccca    222180
     tctcctgcgt tgtcggcggg tcttctcgct ccgacgtacc atgggtacgc ctccgctgcg    222240
     aggacccacc tccgccttgt atatggacct ttttgaccag cccctcgtcc cgtttggggg    222300
     tgggcttccg ctgcgcggga tcgcagttga tgggctcgac tttgtcgtcg cgggtatggc    222360
     ttccgctttg cgggttcgct tttggctggg ctttcgccgt cgccttggtg ggggtggttt    222420
     attagctcga ttttagaggg gaaacggcgg cttttatcta aggtggactt ggattttccc    222480
     tgttgggagt tggggttttg gtctgttcaa gggtgggggg ctgtgctata ccatcctcta    222540
     tgggaattaa gccgctttct ttggaagaaa tcaaaaagat gactgttgcc tgccgtattg    222600
     cagccgacac gctcacttac ctggataaat atatcaaaat tggtatgacc acgaacgaga    222660
     tcgatcagct ttgcttcgat tttatggcga ccaaaggtgc caagtccgca tgtctggggt    222720
     atcacggcta tcctaagtac acttgtactt ctatcaatga agttgtctgc catggcgttc    222780
     ctgatgacaa gaccatcttg aaagacgggg acattatcaa tgtcgacgtg actgcttgga    222840
     ttgatggttt ctttggggac acgtccaaga tgtacatgat cggtaacgtt tctgaagaag    222900
     ccaaggacct ggtggaaacc gcccgtatgg ctcgtgatat cggtatcgaa gcgattcgac    222960
     cgaacggtta taccggggac atcggtttcg aaacgaacaa gcttgtgacc cgcaaggggt    223020
     atgtggccgt gaaagagatc ggtgggcacg gtgtgggccg caagttccac gaagagccgt    223080
     ttgttccgtc ctatggcaaa aagggcaagg gcgagcgcct ggtgccgttc cactgtatca    223140
     ccgtcgaacc gatggtgaat caagggactg acgaaatcat cgaattcgac attccaggaa    223200
     gcagcattaa gtactatcat actgcagata gtctactgtc cgcacaattt gaacatacag    223260
     ttcttgtgac ggatactgga tatgaaatct taactttacc ataattttta aaaacctaag    223320
     acaaggactt caatcaaatg tcattgacta cgacgaacgg aaaaaccgct atgaagaaaa    223380
     atgctaaaat gaaagctcct acagcaacta aaactgctgc taaaactcca gttgttgact    223440
     accgagtcag caaagaagca atggaaaacc cagaggtttt cgcaaagctt gctaaatggg    223500
     gtcgtgaaga aatcaagatt gctgaaactg aaatgccagg tttgatggct cttcgtaaag    223560
     agtacaaaaa acagcagcct ttgaaaggcg ctcgtatcgc tggttgcctt cacatgacta    223620
     tccagacagc ggttctgatc gaaacgctag ttgagctggg tgcggaaatc cgctggtctt    223680
     cttgcaacat cttctccact caggatcacg ccgcagcggc tatcgcggca gcgggcattc    223740
     cggtatttgc atggaaaggt ctgactgagc aggaattcaa ctggtgtatc gaacaaacta    223800
     tcgtgggttg gggcaaagaa ggcttcaaca tgatcctgga cgacggtggt gatttgacga    223860
     acatgatgca cgagcctcgt ttcgccaaag aaatgaagaa aatcatcggt atctctgaag    223920
     agacaaccac cggtgtccac aacctggaag tccttgtaaa acagggtaaa ctgaaagttc    223980
     cagcgatcaa catcaatgac tctgttacca aatccaagtt cgacaatctg tacggttgcc    224040
     gcgaatcttt ggctgacggt atcaaacgtg caacggacgt gatggttgcc ggtaagatct    224100
     gcgttgttgc gggttacggc gatgtgggta aaggttctgc gcactctttg cgtggactgg    224160
     gcgcccgcgt tcttgtgact gaaatcgatc caatctgcgc gcttcaggcg gcaatggaag    224220
     gtttcgaagt gacaacgatg gaagatgcag ctccattggg tgacatcttc gtaacagcga    224280
     ctggctgctg cgacatcatc actgacaagc acttcatgaa aatgaaaaac aacgcgatcg    224340
     tgtgcaacat cggtcacttc gatatcgaaa tcgacatggc ttggttgaac aagaattcca    224400
     aaatgcgtga agtgaagcca caagtggaca tccacacttt gaaaaacggc aaacaagtca    224460
     tcatcctggc taaaggccgt ttggtgaatc tgggttgtgc tacgggccac ccaagcttcg    224520
     ttatgtccaa ctccttcacc aatcaggtgt tggcgcaaat ggaacttttc aacaaccgtg    224580
     acaagtacca ggacatcgct gtttaccgct tgcctaagca tttggacgaa aaagtggcgg    224640
     cattgcactt ggataaattg ggcgtgaagt tgactaaact ttcttccaaa caagccaagt    224700
     acctgcacat gagtcctcaa ggcccgttca agcctgagca ctaccgttac taatcaaccc    224760
     gcaagggaag aggggctgca gagagcgtga aactctcgga cagtcctcgc gcaagggagc    224820
     cttcgtggct cccttttttt ttgccgttgg acgatcttct ttattattgc acttgtgact    224880
     ggcgctgtgg aactcggttt cacgctctct gcagcccctc ttcccttgct ggtgatcagc    224940
     ttgcttgtgc tgtgcttttt gagtctacgg tgcggtattg ttggtgactt tttctgtttt    225000
     tgatttgttc tgttaaggac tttaggggcg ggttttgtaa tcaagattat ttcacacctt    225060
     tagtgcttag gtttctttgg ggtcgacccg ataaatttgg ccatcgctgg ggaatgcgat    225120
     ggcttttgtc gggggagaat aatgaacgta cgcagtttaa actttaaagt gtctgtgatt    225180
     gttgggatcc tagttgtttg ttcggcattg attgcggtca tgagctggcg aagtcttggc    225240
     gagttgaatt cgactttgac tcgcatcacg aatgtcactg tgcctcgaat tgatcgggat    225300
     cacatgatga aagagatctt ccttacccag gttatcaatg aaagaaactt tgcactgaat    225360
     cctgcggggg gaccggcgcg ggaggcggct cgtaagtaca tttcggaacg ccacaaagag    225420
     atggcggaag tgctggaaga gcgcaaagcc ctggcggatg aagcgggggt gaaaaggatc    225480
     gcggccttcg aagccgttta taaagagtgg acggatctta acactcaggt gaccgagctc    225540
     tttgacaaag gtcaggacaa agaagcactg aatattcttg tcaccaaggg gcgcgatgtc    225600
     cgtgtgcggg ggacggaaat cgtggatacc atggtcaaga gcaataacga gcgcatgcag    225660
     gctgatcaga agtctgccga ggcctctttt gcgcgttcgc gtgacctgtt gctgggcaca    225720
     gtcgtggggg ctctgctttt cggtatcgct tgtgctttcc tggttcttag gtctcttagt    225780
     gcgggtatca accgtgttat ttcagagctg actgacaatt ccactcaggt gtcgggggct    225840
     tcccagcaga tctcggtttc ttccgaacag ctggcggagg cttcttctga acaggcggct    225900
     tctttggaag agaccgtggc aacactggag gaactgactt ccatgatcaa gatcaatgcc    225960
     gataatgccc gtgaggcggc ccgtctttcc ggagagacca gtcaggtggc cagccgcggt    226020
     gatcaagaga ttcattcttt gatggattcc atgcaggcga tttcccagga ctccaagcgc    226080
     attgaagaaa ttattaatgt gattgacgac attgccttcc agacgaactt gctggcgctg    226140
     aatgcggcgg tggaagccgc gcgtgcgggc gagcaaggaa aaggttttgc ggttgtggcg    226200
     gaggcggttc gtaatctggc tcagcgcagt tcatcagcag caaaggatat cacggagctt    226260
     atcaaaggca gcgttgagaa aattgaccga ggtgcccatc aggctcagca aagtgggaga    226320
     gtgctgggtg aaattgtgca atcagcccag aaggtgtcca gtctgaatgc tgaaattgcc    226380
     agcgccagtg aagagcaatc caacggcgtc aatcaaatca gcaaagccat gaatcaattg    226440
     gatcaagtga cacaagtcaa cgccgcgacc tcggaagaag ccgccgccgc ttcgcaagag    226500
     ctgtccgccc aggcccagca gttggataaa gtcgtggatc ttttgaccta caccatcaag    226560
     ggcgtgcgcc gggaaatcgc agccgccgcc agcggtgcgc agtcaaaagc caaaaccatt    226620
     gacatcaagt cagcccgaag gcacccggcc ccaaaggtgg ccccccacaa agtttcgtca    226680
     gtaaaaagtg actccatgga tgactggggc aaagtaggaa ccaccgacgg cttctaaaag    226740
     gtgccttaaa aggtgcctgg tgacttttta catctacgcc gcagcatgaa cggtgtaggc    226800
     attgttatct gtcttcaccg tgatagggtt ctaagatatt caggaggact tatgaaggtt    226860
     cttggtttta tcttagccct tttcgtcgcg gcatccgcat tcggtcgtct ttcggacggc    226920
     aaagccacat tcgtcgtgaa agacggaaag atcgtcggca ccattcaaaa aggttttcat    226980
     ttcaataagg aagctcccgc ggcttttgcc atgaagggcg tagagatcgc gcctcttgtt    227040
     aaagaggaat ctcagctggt ttttgctatg ccgacaaaag aaaacgaagc ctttgagctt    227100
     ggcttctatg tctgcgacga caaaaaaacc gtgtgcgaag aacacaagat cacttacgtg    227160
     atttccggcg ggaagctaaa gcctgcaagc gaagtcaaaa aagccgaggt tgcaaagccg    227220
     gaagtgaaag ccaccacggg caaagttcac aagaatagcc atggttttat cgaaaacgat    227280
     ctggaagctg ccaaagtttt ggcggcaaag tccaaaaaaa atctgctggt tgattacggg    227340
     gccccttggt gtccggcctg tgttcgtctt gaaacggaag tctttggcac caaggctttt    227400
     aaaaacgtca cgaaggattt tatcctggtc gctttgaatg cagacatgag cgccaataaa    227460
     ccgttcggaa aacagtacaa tattaaagcg attccaacag tgttgatctt gaaacctgat    227520
     ggcaccgaac tttatcgcgc cttggatttt gcaccggcgg atgtttacgc caaacgcatc    227580
     aaagacgcga aaaagaacct tcagtcgact gcggatcttg aaaagctggc acaagccggt    227640
     gatcaaaaag ccatcgaggc tttggctgtc aaagcttaca atgccctcga tatggaaacg    227700
     gccgtgaagt ggtatcgtca gattgattcc aaatccgatc gttttgcctc tgcagaaacg    227760
     cagtgggctt ctcagcaggc ccgtgcggaa aaaaagtcgg aagaatatct ggccatcctg    227820
     aaaaagtggg ccgaccttaa accgcagagt ttcaccagcg tcacggccac caacgaatgg    227880
     gcggaattcc tgaaaagtga aaagaaggat ctgccggcgg atttgaaaga gcgcctgaaa    227940
     gccaacagcg agtttttgga aaaactgacc aagtcgaaag ccgacaccgt caaatgggtg    228000
     gagtcctggg aggtcagtcc gatggctccg gtggaaaggg ccgaggcgct ttccatgtgg    228060
     aaggtgtccg ccgaggccct ggggcaaaaa gaagaggtcg tcaggattca acaggagctg    228120
     cagaatgaag tgcgttcgtt gaagctttct gagaatcgtc cgggggaggt gatggcaacg    228180
     ctgttttact tccgtcaggc ggggcttccg gaacttgagg aatcgtggct gttgaaactt    228240
     gaaaaggcga atcctcacag ctatgtcccg cacatgaagc ttgcaagcta ctatgtgcgc    228300
     aacaaggcct atgaaaaagc cctgccccag gcaaagcttg cagtggagct gggagaagac    228360
     ctgcgtcttc acaacttgaa gaccctggca gagattcaga aagagctgaa acaaaaagat    228420
     gaagccaaaa agaccatcga gatcgctttg gctcatcccc aagtgaaaga agagcgcttc    228480
     aaggatgttc taaaatccct ggagcagatg aaaaaagatc tttagtcctt taaaaggaaa    228540
     gtggccttac ccaggctttt tccgtttgcg aaaatctcaa cgacatggga gcccggataa    228600
     agcacccgtg tcgtcaccgg gcggaaggag tgcttctttg tgaagtccag ccgctctttg    228660
     gctttcagct ctttgtttgc aagcttaaac accttggccg agttcgtgcc gttggccttt    228720
     ttataatgaa tcgcatagtc caccacgacc gtggcattct tgggacttga aagaccgaag    228780
     gacatttcaa ggtggccccc ggttttaaca gtctttggtt ttaacgtcag atcgtgcagt    228840
     tttaccgtgg catcggtgtg atagcccaaa agcttcaaag cctcggcatt accggccttc    228900
     acctgggtgc gcagggcgtg gcgggtgatc cagtcgattt ttgttttgtg ttcctggggg    228960
     gcttctttct gccagcgctt cagggttttg atcaccacat ccgggtgtgt tttggtgatg    229020
     tcattcaggt gattggcgac ggatttgcgc acgtaaagtt cttcgtcgta tttcagttct    229080
     tccaaaagct tcaacgtcgg tgccgggtcc ttgataaatt cccgcagcag ttcaccccaa    229140
     ggcagacggg gccgagagcc ttcagaaacc cagcggcgca cgtggtggct tttatcctga    229200
     gtccaggcca tcagctgttt cagcgtttct tcctggcggt gaatcagaaa cgggcgcacg    229260
     gcccattcgg ccgtgaattt ttgcgtcaaa gtgtgcaaac ctttcatgga ttcatcgaaa    229320
     ttctccagtc cataggtttg cacaaattca gtgaaggccc acaggtcgaa acctgataga    229380
     ggttccacgc ccggttttgg tttgttgaca gccttcagca ggatgttgag ggctttggta    229440
     tagtcttgcg gaagatgtga ctgcaatcga ccgcggatca gctgcacacg gggtttcatc    229500
     tcaagggccg aaagctcgcg gctgagcttt agaaagcttt tactgtcaaa gtctgcgtgg    229560
     tggtattgca gatgttcagc cattcggcgc accagcgcct cgttgatcca gtttttgaag    229620
     gccgattcgt tttcagcggt ttttttctgc ggcataaggc agcctttccg tctgatccga    229680
     agttatttgg tcggatcaaa ccacagcttc ttattgtcga agggaacact agttggcaac    229740
     agcggatttt caattctgaa cagttttctt ttcttaagat tcaggtccgc gatgactttg    229800
     ccataggccc tgttaaacat ccggtcaaac tcgccatttt gaatcagcag ctccaggccg    229860
     tcttgggcgc ggcgggcgag cttttttccc tcttccgtct ggtggaacca gaaataggtc    229920
     ggcaggggat aatacagtaa aatattttct tcaatcatca actggggcag ccgctctttg    229980
     cgggcgttga attcttccag aacttcggtg actccgcggg ggaaggcggt ggtgtgggca    230040
     ctgaatacaa gattctcaaa gatgcggtcg taatagacct cttccagcac acgaaagcct    230100
     gcgctttcca gaatcgcatt gtcaccccag ccttcgccct ggcgcatggg tatttttttg    230160
     agctgttcca ggttcgagat tttatcgaaa gtggctttgt cttttttatt gatcagcagc    230220
     acgcggtagg aaatcaggct tttgtcgatg gggatgcgca cggtttccag ttggcgctca    230280
     cgtttgatgg aagtctcgcg gatcatgacg gtgagctttt ttgagttcga caaaagttcc    230340
     cgcatctgac ggtcttcagt catgcgcacg ctgggtttta aaacataagg gccgtatttg    230400
     tccttggtgg cctccagcgc ggccttcagc aaatcccagt gatagttgta acggcgatct    230460
     atttcagact ctggtggatg aaaaatgtaa accatctcag cgcccaggcc agccagggga    230520
     agaaacagac atagcaaaaa catcagactt ttgcgcatca ttcagctcct ggtcttgaaa    230580
     gtaggggcct ttgattttcg agtcaaaaga aatgaacatg cgtccggcgc tgcaagatcc    230640
     gctgtggacg catgtttgct ctatttcgtg aaatgcattt tgtcggtgta gtgacgcagt    230700
     tcctggatgc tttcgcggat gtcttccagg gcgcggtgtt tattggcctt ctggtaaacg    230760
     tatttgaact tattgttgat gatcactttc caggaagaca catccaccat ccgatagtgc    230820
     aggcgtccgg caaattccgg catgtacttg ttgatgaaaa gacggtcctg catgatcgaa    230880
     ttgccggcaa gaacaggttt atccttggga tccgggaaat gctttttaac catatccaca    230940
     agcttggctt cgacctggtc gggatccatt ccgttaggca ccttagcggt caagccggat    231000
     tttttgtggt gctcggtatt ccaggcgtcc atgctgtcca gatatttctg gggctgtttc    231060
     accacggttt cgaaagtttc gagttctttg aagtttagat ccgtgacgat ggccgccact    231120
     tcgatgatca cttccttctc gacatcaaga ccggtcatct ccatgtcgat ccaaaagagc    231180
     ttgttcatga gagttcctat tctagggcgc cacgcgcccg gatactctct atgatgaggg    231240
     atttgcgtgg gggagacaag gcctttaggc cttcttttgc tccatcccag tttttaaggc    231300
     gcgttccacc gtggaaatga gcgagttttc atcccagggc ttgtcaataa aggcatagac    231360
     gcccaatctt tgagcttcca gcaccatgtc cttctgccca tagccggtgt gtatgatgaa    231420
     cgggatctga aggccgtttt cacgcatcca cttcagaact tccaggccgg attttttagg    231480
     catcttttca tcagaaagaa cggcgtcgaa ctgccgggtt tttagcaggt caatgccttc    231540
     gatgccattg ttggcccgat gaatttccga ggtgctgcct tctaggatgg ccgagaggac    231600
     ttccagcagt tcgaattcgt catcgatgat aagcaggcgc cctttggagg tttcggaaat    231660
     tgtgttgatc attggatcat tatgccggaa aagtgcagta aggtcatcgc actctatcgt    231720
     caattttttt taatcgaacc ccctgagcag gggattcgat gactccacaa tcttacttgg    231780
     attttgaaga gttgatgatc ttgtattctc cggctttgga aatcgccgcc tgaatctgat    231840
     cttgagaaat cgttgaaccg gctttaggtg agacaatcac tttaccgaca gtaacatcac    231900
     atttttccag gccatccatt ttgcacacct gtgctttgat ggattttgca caggatccgc    231960
     agtgcatgcc ttcaacctca taggtgatgg tttcagccag ggccgtttgg gacagtagca    232020
     gggcagttac agccaaaagt ttcttcattt tggggtctcc ttgatggtgc aaagacatta    232080
     tacccatcaa aaccggcggg ctagggcttt atttgcccaa aaagagggca taggacacca    232140
     tgatattaag tttttttaaa aataatgttg tcaggggtgt ccgacttggc tataaaagat    232200
     tctccgaaac gccactgggg tggtagttaa gttggttata acgtccgcct gtcacgcgga    232260
     aggccgcggg ttcgagtccc gtccaccccg ccattttttc caaaaagtgg ctaaaattac    232320
     cgaagcaaag tcttcggttt ttttatgccc aaaaatcaat caacatacgt gctgccgtac    232380
     tttttaaaca aggccttcat ttttcccgaa cttttgattt catcgattgc tttgtctact    232440
     tccttcttcg tgattcgccc tttgcgactg attgagcaga caatggggta gtctgtaaga    232500
     aaaagtgctt cgcggttttt tgcaatactg ggattttcaa gacggaaata atcgaaaaaa    232560
     atttgatctg tgacgacgta ctggatacgg ccattgagca gtttttttag atttccttct    232620
     tcggatagac tgtcttcgcg tagaattttg ccagatgcaa agtaaggatc gagcttgggg    232680
     tagacatact gaagcatcgt tccgattgtt ttgccttgca tatcgcttat ttttttgggc    232740
     atcggtgtcg ggccaataat aacttctttt ttgttaaaaa gaacttcgga gaaatctaat    232800
     tttttaactc cgtcatccca gattttgctt gtatagcaga ggacatccat ttgacctgtc    232860
     agcatgtatc tgttgagtcg ataacgagtc acgacactga agtttgcggt acgtcccata    232920
     gcctctgcca aagcactgac atagtcgacg ataaggccgt ccacttttcc ttttttttca    232980
     atcaaaagag gtggtgccag tccagcagga attgcggcgc gaagttcagt ctccgttttt    233040
     gcctgcgctg aatgtgccag gataaaaaaa gataggaagt acagcagctt cgttttcata    233100
     ctccaagttt attagagagt tgagatgtcg caaggtttaa tttgaatgat gcaatatctt    233160
     ttttgtttag acagttgatt gcgataaaca acaggatgtt gttgtcacaa tggccaaaat    233220
     caggtgatat taaaagccaa atgacttgga tccgggatac actgcaagag ctttgagcta    233280
     agaactgata cttagaagca gaaggaaatc aaatatggac gcccattacg gaaaagtgat    233340
     gcaagctaga aatcaaattc aaggaaccgg aagcaaattg tattttgctt attcgggggt    233400
     tttggatcgc caggctttcg aggtttgggc ggaagagcat agctaccagt ttttcgtact    233460
     gcccgagggg ctggtggctg aagcaaaagg tgtcgatttg gtttttgatt ttccttcgcg    233520
     ttggtggggt gggcgtgttg ccgggttggt cgccaaagaa ggctcgtctg tctttggaag    233580
     gttatttgaa attccggaaa aagaatggcc cattattcag cataaagaag gtgtcgtgac    233640
     tgggatgtca gttgagacga ctctgcgtgt ttccgtcgac gggcaagagt ttgaagcgac    233700
     ggcctttgtg acgtcaccga gtcgtcgcag tcttgatggt cctgtcagtg aacgttatct    233760
     cgaggcattg gtaagaggag cccgggcttc gggtttgcca gaggcgtatg tggcctcatt    233820
     gccagctaaa gctcgagaca acccttaata cccgcgtctc actttgcaac agaagctccg    233880
     tatttcaatt taagacataa caaatttgga gggcgccttt tggcgccttc gacagttctt    233940
     gccgtgtata aacaagcttt attgcagttg atgctggaat gactctcgca gtgtaaatgg    234000
     gcagaggtgc cctatgaaaa gagtcttgtt ggcaactgtc ttaattttga acttctccgt    234060
     tttccacgcc cacgcgaacc tgctgccttt cactcaggat gttaacgtcg gtgagaactc    234120
     cgtcgcggtt tcaaaaatta agtttagcaa acgcgctgac gccggttcat tctgtcacac    234180
     tctgggcaaa caacttggct tgaatatgaa actggcggac cttgaagagg ttatacaagt    234240
     tgcggcattc ggcaaacccc aagtggacag tgtgatggtg cagattaaaa agaaagatgg    234300
     ctctgttgat acagctatcg tcgcctggga caacaagaaa aagatcaaaa tcgacaaaga    234360
     gaatccagcg aacgttgata ctcatctcgt acttagaatt cgtggcggcg acggcgtcgt    234420
     tagggaaaca accctcaaag aactgaaaga gttaggggcc gtcgactatc aggatcgacc    234480
     tattgataag cttccggcct tttgcgttca cgatattaaa aaacaatagc cgggctattt    234540
     acagtgcgcc tttgagctaa gaacaagcgc ccgcgcttgt tcttctgtgc tggcggtgcc    234600
     aattgagcag gtatccgccc catccaatcg aactgcatac accacttcca cacccgacat    234660
     tccatcttca gtggcttcag acaggcgata gataaagcca atccactgca atgatccgct    234720
     gccgtcttcc gaagaattcg ttttacggta catccattcc acttcagttg acgccacgtc    234780
     atggaaggaa tacgggttgt taagggcaat ctgctgccca ccgtaagcca gctccggatg    234840
     atagcgtagg tcgccgccgg tgatattcag ttgatacccg ccaaagccct tgcattcggc    234900
     atcatagaaa tcaatcgggg actgttgggt tgccgcgctg acttcaatgc actccgtggt    234960
     tagattggta aatacgctgc caacggtgac ttgctggcct gtctcggcga aggccgtcag    235020
     agctgtcgtt gaaataattg ctattgaaga aagaagctgt ttcatcggtt gttcctttac    235080
     ggttgctgag ttcctgatga actgtttatt gcgcctaata agaaaatacg agccgaactt    235140
     aaggctcctg ctgagtgaca gcaacatttt gtgtgcacac atcagacctt caagggggct    235200
     ttttatttgt cttcctgtag tggtgtcgtt acaattcctc gaaattagac ctgtcttttg    235260
     taaaggactg atatggacac gcctcaggat tccgagatcg cagaaagaga agtacgtcgc    235320
     aaaacccttt gggtgatagg attgaccttc atattgccgg tactgatcac tttgtgcggc    235380
     atctattacg tcgtgtccac tgggaaatag ttctgttaaa tcctccgacc gagcttttgg    235440
     tgtgaacaca acaacgacga tgtccgtaaa tggccagtat tttaagttga aatatcttag    235500
     cctgccttgg atcaaccagg aggttttatg gatttcaaag gaaagaatgt ttttatcacc    235560
     ggagccaacc gcgggatcgg tgccgcttta gtaggggcct gcctcaatcg gggagtcgcc    235620
     aaggtttacg ctgccgccag agataaaaac aaattaccga aaaacgatga cccgcgtgtc    235680
     gttcccgttc aactggatat caccaaccgg gagcaaataa acgaagccgt gtctgccgcc    235740
     gccgacgtgc agatcctgat caacaatgcc ggcactcttc atgccggaag ttttttggaa    235800
     gggaataggg acggcttcct ccgtgacatg caggtaaact atttctcgac gatggatgtg    235860
     atgacggcct tcgttcctgt gcttaagcgc aactgcgacg gtcgtatcgt gaatatcgtg    235920
     tcgatagcca agttcgtgaa ctttcccttt atcgcgggat attcggcttc caaagcggca    235980
     ctttattcga tgactcaggc ggctcgaatc gaacttagtc cgtactgtat tgccgttcat    236040
     gctgtgaatc cgggtgccat cgatacggac atgaataaag gtgccgagat ggacatgacc    236100
     tctccggtcg aggttgcaga cagtatcttg gcccacgtcg aaaaagagat tttggatatt    236160
     gttccggaca agataggtca ggcgatgttc aaagtgtggc aggagtctcc agtggggttg    236220
     gagaacctgg ctaaagatat gtattttaaa aagccggtcc cctgaacttc ttataggcag    236280
     aaagtctctg aacaatctgc tgacttgagg ggtgctaata ggtcgacgca ggattcaggg    236340
     ggatcggggt tcctattcac cttcgatcag tgccgatggc agagttactc agaatagagc    236400
     aatgtgtaac ctttcagctt gcactccaga tccagagcga aggcctcttg aaaccagcca    236460
     ctgtggaacg aaccattgtt gatataaagg taaacatcct gatgaaaagg cccgatttgt    236520
     ccttgggctc ctttgcggat ttcgccagcg agcagagtgc ccgccagtac gggagaagac    236580
     gggaagtcgc ttcggctgcc ataggtggct gcgatctcag ttgtttcgtg atcgcaggcg    236640
     gctgaagccg ctgttgaaag caccatcgtc gtcattgcaa gcaggattct tgaatatttc    236700
     attcttttac ctttgctggt tttgccgcct caggatttac cctcgcttct ggtggagctc    236760
     aagtcagaat tttgtctgga gatgggaata tataaggagt acacggtctt atctgtgagt    236820
     ttacatcgta ttttgagtct atgtctcgag ccacacttat taaattccga taagtcagat    236880
     atgtttggaa cgtactcgct gaaatcactt cttgttttat ctgtatttct ctcgggctgc    236940
     agtctgtctg tcgacttagc ccccggttcc tcaaattctt ccccggaaac ctcacccaca    237000
     gatcctgtgc agcaggccca aggtaaagtc tgttttgatg gggtgattcg cacagtcctt    237060
     gagtctggcg gtgttcgcta ctatgggggc gattttagca aagcgggtcc ctgcggcagc    237120
     gggatcgtcc ggatggactc tgatgacaga aatcaaccgg tcactttacc ggtctcagcc    237180
     aaagagatcc atgcattggc gcaggattcg acgggacgtt attacgttgt catgacaccg    237240
     ggagccctgg gggagatgac ccttaaaaga ttcagcgcca agtgggagct ggacacctca    237300
     tttcaggcac cgacattcta ctatcccact tcacttcttg aaagtaagct ccccttcgcc    237360
     tggctgaaga tcaatcaaag ttcagtggtt ctggctggca ccttcactta ctcgaagtca    237420
     gaagaagaag tgggcggtgg cgaaatgctc ctggccctgg aagacgccca aaacgtggcg    237480
     attcttaaca aggaaagcgg ggccttgctt cctgccagtt cggtcggaga aggtctggat    237540
     ctgagacgtg tggatgatgt ggtctttgtt ggtaacagag tcgttctggc gggcaacagc    237600
     agtgaacacg gatccgtggt tgttgatgtt gattacgtcg atcaaagtgt cttcactgat    237660
     ctgactggat ttgaagatag ggtcacattg cttcaggatg gcagcggtca ggcactgctt    237720
     tataatatgg gttcagaatc ttcagagctg tattcagtgg cgggaggaaa tctgattcct    237780
     cgtgcctttg atatttctgc ctgcggagtt atgggttctc ccacggtgaa ggcctctgga    237840
     gatacgcttt atttgctggc cctggtagat tttgaagccg ggggcgtaaa tttttgttct    237900
     tacaatttgt ccacgaatca aatcacaaaa gtgcaagcct gggatgtggg acgtcttcca    237960
     ccaagcgggc gtttcctttg gggagtcagt gaggatcatg ttgtcctttc actgggtgac    238020
     cggtttgcgg aattcaagcg cagcgatctt tccgaaacat attttcagga aaagctggag    238080
     gtctcggcct tcgcctctgt ggaaggcggc ttctttgccc tgggaacatc aggcggagtg    238140
     gcgggcaccg gaacgtcggc ggggatctat gcgcagtcta taagtacggg agctgaggtt    238200
     gatctttcag tagctctgca gttgtcggat gagaacgctg atggcgtcag tgttcgtggc    238260
     cttgcggttc ataataataa actgtatgtg ggtgggatct ttgatgaggt caatggcgag    238320
     cagcgcgagg gcctggtgat cctggatatt gaagatgact attctccggt tgcactgccg    238380
     ttgcccgttt caggacagat ctctgggatg agcctttatg ggaataaact ttatatggca    238440
     ggctatggcc ttgtcgtggg cgagcctgga gaggaagagg tcggcgagct gggtgccatg    238500
     tctgtcgacg gcgccagcaa attggtggca ctggacttga acacgggctt gcttgatggg    238560
     ggcctgtcca atcagatcta tgctgatatt ggtgatgcgg atgtctattc gctgctggtt    238620
     aatcagtccg gaatctttat cgggggctat ttcgagattg gcgtcgagga cgactggtat    238680
     tgggactttg tggtgttgga tcattcaggt gctgtgatcg gaacaccgtt gccggcagag    238740
     ccagggaatt acgaacgggt gaccggcatc gtggagctca atgggaaggt ctactttggg    238800
     gtcggtgact atacgacaga caaagccact tatgccgagc taaagtcaga catgaccttc    238860
     gagaccagat tgtttagtga tgtggccgac agcaagatcg aatccctttt tgtgtacgat    238920
     ggaaagcttc atggtgtgct taaagaagat gagctgccgg tggttcatcg aatcaatgac    238980
     gatggctcaa ttgccgagtc ggataagatc tcggtggggg gactgccagc caatgtgcct    239040
     atgtaacagt ctcttcgagc tcgctacgtg gtagctattg aataaatgac ctctacgcaa    239100
     gtgtctccgt gctgacggat gttcttgatc ttaaaagccg tgtctgtatg gcgtgcaaat    239160
     agttttttgc cttcatttaa gaagaccgcc acagtttgaa tgtgcatctc gttcaacagc    239220
     ccctggtcgt aaaattgtcc ggccagatca ccaccaccca cgacccagat gttttttcca    239280
     ttcgctaatt tctgcatttc tttgtggtgg ctggcgacat ccccttgaac aaaacggatg    239340
     tcggcaccgg ggaagggctt aagattttga tgggtgaaaa caaagcaagg gactttataa    239400
     ggccattcct cggcatgctg ttgcatccac ttgtacgttg atgtgcccat ggccagggcg    239460
     cccaccgtat ttacaaaagt gtcgatgaaa ctaatgtccg tggggccgtt tttgaagagc    239520
     cattccagag agtcgttggg atcagcaata tacccatcca agctggccgc cgtgaaataa    239580
     atggtcttca tcaggtcctc cgtctccaga cttggatgat atccatagtt tcgatgcagc    239640
     ggcaagtttt gttatggatt gataacatcc agaatctggt tgctgccgtt gatcttaagt    239700
     ttcaacggaa cgcggctttc ctgagattcc gtcaataagt gcagtttggc ttcagggaag    239760
     ctcatcaaat ttttgatgat caaaagcttt ggcagaccaa cgagcttgac catggcttcg    239820
     ttttccatgg cttcgatgtg ttcaaccact cccgtgacat acagttgcga tgccgcaccg    239880
     gtgctgacag tggcgtttgc ctgtgacgtc acaacattga aagctacaaa tagactcgcg    239940
     attaaaagaa attttgccat aattaccgtc ctaatccttt gacttgagat aaaattaatt    240000
     gattgtgtcc gtaaacgtct tccacaaaac ggataacacc gtccgagttc atttgggaag    240060
     ttacaggtac taaataaacc ggcatcggtt ctttcaggtc cacacgggtt tctttatcaa    240120
     ccaattgacc ttctttaacc acgaagtttt caatctgcgg ccgggaccat tgcgttcctg    240180
     caagcagata ttcggccaga tccagcggtt tttccaggcg cacacatccc gaactgcgca    240240
     ggcgctgggc ttcgccgaac aagtcgcgct gattggtgtc gtgcagatag atggcataag    240300
     gattcgtcat cataaacttc acaacgccca gggcattatt gtagctcggt ttctgcctga    240360
     tatagaagtt cacgctcgag gacttgatcg acttccagtc aatgctggtc gggtcgatgg    240420
     ttcggctaaa gtcagcagtg tacacttcaa atctgttatc agtgaaatac ttgcgaatgc    240480
     ccttggtgtc gagcttcttc agaatttcaa ctttatcgtt caggaacacc gtgggtggaa    240540
     ttgtccatgt cgggttcatc accaaatagg tgatgcgatc ccgaagcgtg ggcgtcttgc    240600
     gttccgcagt gccgttgatc gccttaaagc tcatcgagat gttgttcttt ttatccgtca    240660
     tcatgaagtg ggaaaacgcc gtattcacga aaatatgacg gtcttcaaga ttctgcggga    240720
     accagcgcag ttgctccata tccgcttgca gttgactgag tcggtccaac agggaaacgc    240780
     tgaagaacct ccaggtgcgg ccgccgggtg aaatcactcc atccggtttc attttcaagt    240840
     ttagttgaat gtcattgatc gctatcagca tgtcctgatc aaacgtgtcg ttcatgctgt    240900
     cgatgcgata acccaactga cgcaaacgtt ctttcagttt gatgatgacg ggatcttttt    240960
     tacccagtga caacggcttc tttgctgggg tgatgttttc ccacaatccg gtttccagca    241020
     aaggatacag tctttccagc gccattttca gggactgata gacggaaaac tggggggcca    241080
     ttttatcaag ggccagtttt gcatcgctct ggctggtcag gacgacaagg cgaacctgtt    241140
     cggccgtcag gaagtccttt tttttgactt tgatatctga agccaggcct accggattga    241200
     ccgatccgct gtaaacgtca cgcagggcct tcacatagac agccagaatt tggcgccggt    241260
     cgaagtccgc gtccagggtt ccgcgcagga aggactgctc cagttcgtcg ttccaataga    241320
     cggaaggatt cagtccatgc tgccacaccg tcaacagagc ttcgcggatt gaagccgcac    241380
     ttaagctgtc gacagcggtt aaataatcaa tcgcactttg accttgcgtt ggcgccgcag    241440
     aagcataggg gggactttgg gcctttgccg tagaaagccc gcttgccaaa atcaaagacg    241500
     tgatcgcaag aaataaacga acaggttgcg tatccatttc cattcacctc gtggcaccag    241560
     gtaatacaag aactctgcca gtgccgggat ggaactgaat gtgatttaga gactatttga    241620
     gaaatatctt catataaatc tgtcagccgg tgacacttct ggggcctcgc tcagttgctg    241680
     gacagcccgg ggcagccaca agcggcttat agttcttcca agatcccggg gggcgggcac    241740
     gagactcgca agggtgcttt aagcccagca aaggcgcttt atgaaaaaac tgttaatgct    241800
     tctttcactt cttttgatca attgccagga aagtcccgaa agctttcagg gaacaggcat    241860
     ggacatgggg cagggacagg ggattatcgg tgggaccacg gcttcttttc aaagtgatct    241920
     gtcccagatg gttgtcagtg tgcgcactta ttataacacc cgcattgagg ttataaacgg    241980
     gcagaaggtg gaaatgaacg acgtgtttca gtgcacgggg attccactga gcaggcagtt    242040
     gattttgacg gccgcccatt gtttgaagac tccggatggg tatttacgca cggtcgaatt    242100
     taaaaccaaa gccggagagc atctggctta tgcagaagac acgttcgtgg tgccagaaca    242160
     gtacaaagcc ggaaatcagg attatgattt tgggattttg aagttaaaaa agcagttatc    242220
     tgaggacata attatcacgc ccttgatgga tcattctatc ggggatctgc gctctgttct    242280
     ggcggcaggg tatgggcgca ccaatggtgt ttggtctgac attaaaggtg atggcggcaa    242340
     caccctgcgt tcggttcaat tgacggtgtc cgctttcgca aagaacgaaa accgtttccg    242400
     tgtgcaacag tctcaaggca aaggtttttg tcagggggac tccggtggcc ccgcctttgc    242460
     ccgaattcaa ggacgaacct atgtggtggg gatcgcctca aaaacaacac gatcgtcaga    242520
     gtccgccacg gtcgacactg aacgctgcac cgatgagggt atttatatca gcgttcagaa    242580
     gcaatttggc atgatcgtgg agctggccaa gtccttggcc actgacgtcc cttagttagg    242640
     ggaatgtcgg ttttttgctg gcgtcccagg caggattgga ttggtgatcg aagagggtgt    242700
     tgttcacgcc cgcaggcagg acccacccac tgatatcctg attgaaggcg tcggtgccga    242760
     agaacatctg ctccataccg gtcagcccag gggtagcaaa gacccaactg gccaggggct    242820
     ggttgaacgc atccgcattt tggaacatgg atgtcatatc cgtgactttg gatgtgtccc    242880
     aggagcttcc agatttagtc agaggctgat tgaaggccag agcccccata aacattctag    242940
     ccatgtcggt gacgttcgca gtattccagt tgctgatgtt ctgattgaag gcaagggcat    243000
     cgctgaacat actgttcatt gtgatcacgc tggaagtgtc ccagtttccg atgggctgat    243060
     tgaaagctgt cgctcccatg aacaaattgc tcatatcctc gatcccgctg gtgttccaat    243120
     gaccgatagg gctgttgaag cttgtggcca tcataaatgc gccgcgcata tcggtcattt    243180
     gagtcaagtc cggagcatct gtcgcagtga cttgcatatt cgcgcagcca gcaaacatca    243240
     gctgcatagt gccccactga atggtgcccc attgttttac gtcgatgact ttcagataat    243300
     caccagcacc agcaaagcgg aaccaaggca tggcaccttt gattttgatg tcatagattc    243360
     cgcccgtcgc gtagttgtgt gaaatagcgg gcatgccggg attccagctt gcagaatcaa    243420
     ccggttcgga actgccgtca ccccagtgaa ccacaaagtt gtatccggac cagccattca    243480
     gtggcagctc catcgagttg gcagcattgc ctttgctggt gtcgatggtc atgatgaaag    243540
     agtttttaat cgtggcactt gttgatgggc cgtatgcggg tgccaaaagg ccatccgcac    243600
     tttccgccgt gtcggcagca atggagatat tcaccgggcc atcccctgta catccgctga    243660
     tggtcaccgt cggagtcatg gtggttccat tcgtcaccac agcggtgcaa ccagctgtgt    243720
     cgggtccgcc cagggtgatg tcggcatctt gaaggtcgac gatcgaggca tcagtgtagg    243780
     tgacggtata aacgaagttt gtcgcaacgg ttccataaga cacggacggg gcactgacat    243840
     tcaatgtcgg tcctgcaggg accggcggag tcccggttgg gggagtttct gaaggcagta    243900
     cgacactggt tgggacgagc tgcaaatcaa acgtgcagcc cgttaaagcc aagaatgcaa    243960
     acagaagcat gatgttccag agtgagacac gtaccgtcgt tatcatgatt aatatttcgg    244020
     tttgctacga agaacccttg aatacatctt ggtaacattc gcgcctttta ccggcgggaa    244080
     tgtggaaatt attaaaaaac gaggggtgct cctttttcgg gagtcccccg gttggggggc    244140
     aaggtgtttt gttaattcaa agcttcggcc tcaatttgga gcatcgtcga tctgctagcc    244200
     tgcatcagag cgttggtcag ctctttcgtc atattctcca gacgatcacg ctctggattg    244260
     cctttgacca tcagtgtgac aaggccccca acgctggcgg cggtcacaac aacaccgatc    244320
     catcttagca tgctgggttt gctggcatca tcattaacga acatgattgc ggtcaggcat    244380
     cccgagatca ccgtgttgat cacgagtgcg ccgccgatcg tggattcgtt gccgttttga    244440
     gtctctagag aaatatagtg actaagacgt tgcagttgca ccagagctgc ttgaagaact    244500
     tccaggcgtt gttccggtgt cagcccggcg gtcgcctctg aaagtgcctg caggtcctcg    244560
     ggggatattt ctgatttacc ggactgcaga agtgtcagag tctggttttt aatcgctttc    244620
     acggccgcgt gtgcctcggg actcagctgc tcttgagagg cgatatttcg aggtgtgttc    244680
     gcttgctggg ttccggcttg aacagactgg gccatcattg cgcctgccag gatcatcaaa    244740
     attgcctttt tcatcttgtc tcctttagtt tgtatttata atttctaagt tttgtttttt    244800
     tatattctca atcagcaaca gagctttttc ggccttttca ctctggccgg ttttctggaa    244860
     ctcgagaagt ttgacctcaa gtccggagat ggtttttatg ttttggtcat aggcagctct    244920
     ggtcattgcc gaggctgaca tccgggcctg attttccatg tatgcagtgg ggtcggtgat    244980
     gacctgatga tgaaagacag tcagccagga aagcagtccc acaaaaatat agctgttcag    245040
     actggagatg atgacgtcag ccccatggcg aacccgggcg ttgatgtaag cctttgtcag    245100
     tggaccgccc tcgggctggg ttaagacttc cataagtaca ccatcgggaa ttttttcggg    245160
     gcggaagaat ttgaagtgcg ggacagaaac gatgaacccg gcggatccca gatactgata    245220
     gctcagataa ttaaggccag cattggcccc cagagaaaac atcagtcgga aatagtgagc    245280
     attgtgtcgc agaagtgtca tcgggtccat tttgatttgg acgcccattt tttccagtgc    245340
     actcttataa tctcggcgct ggatttcaat ggtcagttcg cgtcgatagt ccctgttcag    245400
     atgaagaatg ttaaagaagt cagcggcagc cattttggct ttcacggaaa gactgcggtc    245460
     ccccagaatg tcggccttgg cagcttgata gatttgagtc tcggtaaccc gtgatttgcg    245520
     agaaagcgac tcaaagtgag acgaacgggt gtccaggaaa gcgccaccgc aggccatttg    245580
     cgcggctgca ggcaatgcta tcaggaatat gaaggctgaa acaaccaggc ttcgcattta    245640
     ggacacctct tcattggatg tcaatgcaat cacggaacca aatgccatcc cgtttggttc    245700
     gatctgatga tcttctaacg cagccctaac attttttgtc aatcgggtgt agaggctgtg    245760
     ggcgtggccc gaccggcggg actttcgggt cctttctgtt gacgcttctt tgctcttctc    245820
     agtatatttt acgggaagct gggctcttca tcagctttga atacttcatt cataggatat    245880
     agtaatgaaa aataagaaat ggttcgccgt taagaccctt tatgtaactc gtgctgtggg    245940
     taaatccagc gccaaaggca aacaggcctt tgcggaactg ctggaagagc gtgtggtttt    246000
     gttccaggca gcgaatgcca acgcggcggt gaaagcagct gaaaaagatg ccaaagagta    246060
     cagccagtac acttatacaa actttgaagg ccaggccgtg cgcacagagt acttgaaagc    246120
     ctgtgatgtg tttgaacttt atgaaactct ggaaagcggt gtagagctgt ttgcctccac    246180
     tgaagtgctg acgaaaaagg tttcaagcaa gcagttgatc gcacgcagac ttggtgtctt    246240
     ggaaacaaaa agcaccatca aaatgcgcaa gcgttttatg agcaaagagc tgggttctta    246300
     cgtttagatg ccaaaataaa aaagccccgg gaacggggct tttaatgtcc cacagcgcct    246360
     tcggtgtgct taagttccga gatctggaat ttcgcggaaa gcatcagtga agccagcaca    246420
     aagatggccc cgacatagcc gacagacccg atatggttcg tggaggaaat gctgccaagc    246480
     agggctcctc cgccaatgcc gatattgaaa atgccagagt acagcgacat tgccacatcc    246540
     tgcacatcag gggcttcctt taaaacagcg gactggaata tcaggcacag aagggtcagg    246600
     gctgttcccc agacaaatgc cagcgccatg agccagattt gtgaatgcac ggccagtgtc    246660
     atcaacagca ggcttgagaa aacgatcccg agtgatatcc acagtgcatt tttcggatgt    246720
     ttgtaaataa tcttgctgcc caggatgctg ccgaaaactc cagaagcacc aaacaccaat    246780
     agcaaaacca cgacgaaatc cgttgaaatt ccacccaccg ccagcaggaa cggtttgatg    246840
     tatgtaaacg cggtgaagtg cccggtcacg gtcagagccg tcatcaggta aaccagcacc    246900
     agggattttc gcttgaacaa tgaaggcaca tttttaaacg tggtgatgct ctggcttggt    246960
     aaggagggga gcatgcgata cagaataacg taaatgacga aggccaccag cgcgatcaaa    247020
     gaaaaggcca tgcgccagcc aaagctctgc cccaggaaag tgcccaaagg gatccccagg    247080
     atatttccca gagaggctcc cattgcaatt atcgataaag ctttggctcg tcccccggcc    247140
     gggcccaggc ggatcgccag ggggatcgca atggaccaaa acaccgcatg ggcaaaagcc    247200
     acgatgatcc ggcagaccag cagcatgcca aagcttgccg ccaggcccga ggccaggttt    247260
     gccacgacga acgttcccaa caggatcagc atcagccggc ggcgatccca gtgggagctg    247320
     acgaccgtca ttggcaggga cattgtcgcg acaatccagg catagatggt catcagcagg    247380
     ccggtgaagg cttcgctttt cccaagacct gcagaaatct ctgggagcag acccacagga    247440
     ataaactcgc tggtcacgaa tatgaaactg gccagactga tgctgacagt gggaagccag    247500
     gatttgagag aatttgtgtt catgatgcga accaccccag gggaatgcgc ttcagtatga    247560
     acctgtcggg aaagactgga aaggaaaatt ccggttttga atggaaatct gactgtaact    247620
     tagaaatcca aagggacttt attgaatccc aaaggttttt aaaaaacagt cttgccgctt    247680
     catttcgaca aaatgtgaag tctggcctat ctttgtgtta aacttgttcc gtcagcgcac    247740
     taaacttttc acgggggtgt ttatgaagca ttggattttt gtgatggtgt ttgttttttc    247800
     tgctgcgatt tccgccaaag aaaaagaata tgtaaaacct tctgatgccg agttaaagaa    247860
     aaccctgact ccgatgcagt atcagtgcac gcagcagtcg gcgactgaaa agcctttcga    247920
     caatgcctat tggaataata aaagagaagg catctatgtc gacattgtca gtggcgagcc    247980
     attgttcagt tctactgaca aatatgactc cggcacgggc tggcccagtt ttaccaagcc    248040
     catcgatgac agttctttgg tgacaaagcc tgattatgaa atgtcggtgg aacgcactga    248100
     gctgcgttcc aaaaaggctg actcgcacct gggtcatttg tttgacgatg gccctaagga    248160
     taagggcggc aaacgatact gcatcaattc cgcagccctg aagtttattc cggttgagga    248220
     aatgcaagcc aagggatacg gacagtatct gtcgctgttc ccgaaatata aaaaagaaaa    248280
     gaagaaatag acctattcct gacaggtgat agagatgttt tcagttccat caagtgtcag    248340
     cgttcccgtc caatgacggg ctgtcaccat gtccaaagta agatgggcgc gttgttcaga    248400
     aactttgctt tgccagataa attgcatgga gccgtagtct gcatactgac tgagcagttg    248460
     gtactgattc aaaaaaccca gttcccgtct gaaacgcacg gtttcaagtc catgcgggcc    248520
     caccttaaaa tggatgattt ggttctgatt ttccccatga cagcggaact gataatcgaa    248580
     gtgtgcctgg cttgctgagc ttaaaagcat aaatagaacg aaagagaaaa gtgttttcat    248640
     ggttttacct tcacgggcaa tctaagcgag attgtcagat tgtggaatag ccggggaaaa    248700
     gtttacccgg tattgctggt caagattgct gaggctcagt tttaagccac acgttcggct    248760
     ggtgagaaag tcacggtccg aaacaagtcc cgtgatttga ggccactttt aacacaatat    248820
     gcgtaaaact cttaattcct gaacccactt ctataaactt gtccgggaag cgatgagagc    248880
     aaaggagttc aaatggaaat ctcaccaagt ggaagaaagc aagatgccaa acacaaaggc    248940
     tcaaccccgc attcgaagct gctggtgatt gatcgccagt ttgatgtgcc actggagaag    249000
     ctgtttgccg cctttagcag cgcggaggcc cttaaaagat ggtggtggcc ggagggcatt    249060
     tacgcagatc acattgattg ggagctgcgg gacggcggca agtacttcat caatatgaag    249120
     ggctacgatc agagtgccag cggcatggcc ggttggattg aagaggtggt aaaaaacgaa    249180
     cgcatcgtta tgaccgacca attcgccaat gaaaaaggcg agccgatctc ggccaaagaa    249240
     gccaacatgc caggggaatg gcccgccaaa ggctatatca ccttcgagtt tgaatcccgc    249300
     gggaaggatc gcagtgcttt taggctgtcg caagaaggta tccccaatga attgcaagcg    249360
     gagtgtattc aaggctgggc agagtctttt gaaaaactga agaaatactt ggcggggccg    249420
     gcgcaaggcc actaaggtgg catacatcaa aagtacgatg atctttgccg tttgtatttc    249480
     gttgtcgtaa tcccacgaga agaatgatta agagactgaa aaggtcttgg ggccttggta    249540
     cagaacaggc ctccaggtga tcatcttttc ttaacaacga cccgatcttt attccaatgg    249600
     tgcgatcatg cttttacagc ttccttattt tgtgcgtttt ttttgggttg tcgaaagact    249660
     gccaggcaag caatgtgggc ttgtttccgg gaacgcgcgt gagtgcattt caaagcgtct    249720
     attccggtga aaaaggcaaa tcatttgcgg agtcctcttc tggggtgggc gccggggttt    249780
     ccgtgtatat ggatggtaaa tacctgactc cctattttgg tttcaaagtg ggcagcatgg    249840
     cgggaactca gatgtttctt gataacgcct ccgaagtttc cacctcgttc aactattaca    249900
     gcgccagtgc ggaggcgggg tttcatctgt ttcctattga acgtcgcaag aagggcttta    249960
     atgtttattt ctcgggtggc ggggtgattg gttacaattt tgtggccttg aacaaagagg    250020
     cctctctgga aaacatccct tacagtgatc agtcattttc cacggggtac gtggcgggag    250080
     tgggttcaga gtggattctg aactctgctg acaaaaataa atggaatctc aatgctgaag    250140
     ttctatttaa gaatgaaagc agcactttat tcaaccagcg atacgatcta agctgcatgg    250200
     ttttttccct cggtctgggg tggtagtcct attttcacat ttgcgtaata caatgtcgga    250260
     cgtcgtttcg ataaaatgcc agcacatgct tttaggcaac tacagccttt attgttcgag    250320
     attttccatt cgacgattca gaatctcatt tcaggctaaa gtctaaatca agctatccaa    250380
     aaacatagag agaaaggaat ctcaatggaa cgttattggt ctcaacgaat agttgcttcg    250440
     gttctgacgc tgcagtttgc agctgttgcg catgcggatg tgcaaatccc tgcctacacc    250500
     aacggggcgg aattgtttaa tgaagctcag aacaaaccgc catttgaagg tgttggtcgc    250560
     attggcgatg ttacccgtca ggcgggtgga ggtttgtaca ggctggatct ggtcaagcct    250620
     cttccgctga caagtctgaa ggcaaaacca agtgccggac gggtcaagat tgtgacggtg    250680
     acactggtga ccgacaaagg ggaccgtatc ccggtgaagg cgtataacaa tgtggttgtc    250740
     gccagcacgg atcagcctct ggcctcagag cttttgaaca ctccagcccc gatttcagtg    250800
     gtcgaagtgc aggctgaagc catgggtggg aaagcggctc tggacatcaa tgccatctct    250860
     aacagcgaga ttcccaaatt gaatctgcgt ggagaagaag tggcctgcaa aaagaacatc    250920
     gatgcgacct tgaaggagca tctggacgtg gtgcaggtgt gggctggtcg tgctgaagtc    250980
     agtgcgccag gctccattca ggaaaaatat gccacgaaag agttcaaccg ctatgtgaac    251040
     gagtttatct cggtcctgaa ggctgacaaa gcggcttttg cctccactga atacacggtg    251100
     acattgctga atttctttgc ggaaagacac aatacggccc gtgcggaaag tgccgctgat    251160
     gtggcttata aaaatatggc gatggaaacc ttcaatgcat ttctgctggc tctgcaaagt    251220
     gatcaaactt gctacaatat cggcagcgag ggcatgatca agattgcgac agacttccag    251280
     aaacgtcttg aaggcaataa accggacagc cgtgccagaa agttgtacga agtttttgtt    251340
     gtcggaatcg gcaagctgat cccgacacaa taccgtaaag agctggcggc caaaaatctg    251400
     actttccgtc aggcagacaa tgaaggtcat aagtattata aactggtcac caccagcaag    251460
     ccagacaact tcctgaaggc cactcatcag gacatgagtg cttcagctta tgccgtggcg    251520
     gagcaggctt tgaatcgtga agtgaaaacc atgaccagcg accagcgcta cgagctgatc    251580
     gttgagtatc aggcgaaata caacgatgct gcaaactatc ctgctgagat catgatgaag    251640
     tacctcatca ttctgtctga aagtggcact ttgttccgta tctatcgtta ggatttcatg    251700
     gcaaaaggcc cgtcgcaagg acgggccttt cttatttcat catatccccg acgcagagtc    251760
     ctcgccggtt gtgacatgag gatcagtcgc catcacccgg gaaagccggg tggttttttc    251820
     attgttaact cctaagtgcg ctaaattcga gctgagccag accgtgacgg attcccgacg    251880
     ggccgacagg gggctttccg ccattctggt gtccttccag agcgaaatag gctatagtca    251940
     gccctcgctt tatccgggag cccgtatgaa tacctttgct gattttgagc tgttgccttc    252000
     tcttttgaaa accctgaaga ctttgaagat ttccaaaccc acggacattc aaaaacaggc    252060
     cattcctttg atcatgagcc atcaggccgt ggtcggagtc tctgaaacgg gtagcggcaa    252120
     aacgttggcg tatgtgctgc caattttgaa ttatctgaag tctttggaag aatccggaga    252180
     cccggtgaaa gaggaaaacg cacctcgcgc ggtggttatg gtgccgtccc gggagttggg    252240
     cgagcaagtg gccaaggtct ttaaatccat gactcacgat acaagactgc gggttcgtcc    252300
     ggctctgggc gggatgagcc ttgaacaggc ccgtcgcaac acctccgggg cctttgaagt    252360
     tctgctggca acaccgggcc gtctggtgca gatgctgaac aaggacctga tcagtctgcg    252420
     tgatgtgcgg tttttgattt tcgatgaagc cgatcaaatg ttggatcagg gttttttgcc    252480
     tgacaccaat cgtatcgtcg actgctgccc agaggatgtg aatctggcgc tgttttcagc    252540
     cacagtttcc aaaaccgtgg aaaagctgat gaatgatttg ttcgccaagg ccgaagtcat    252600
     tcgtagtaaa aacagcggga aggtggtttc cactttaaaa accaaaaacc tgacggtcga    252660
     agatggcaaa cgctggccgc tgtttgaaaa agtactggcg cagaaagtgg acggtggcac    252720
     catcgtcttt gccaacaccc gtgaacagtg tgacaagatc gccaaggaat tgacggacaa    252780
     gggccacgct tgtgtggtct atcgcggaga aatggataaa aacgagcgcc gaacgaatct    252840
     gaagaaattc cgtgacggcc aggtgggcct gttggtggcc accgatctgg cgggtcgggg    252900
     gctggacgtg tccaatatcg cacgcgtgat caactatcac ttgccgaaag aaatggaaaa    252960
     ctatctgcac cgggcggggc gcacggcgcg ggccggtcgt ccggggttgg tggtgaatct    253020
     ggtcaccgag cgtgacagcc gtctgattgc ggctttggag ggtaataagc ctccttcatt    253080
     ggaaaaaaag acccagcacc aggggaaacc tcgggttgcc tccaaaacgc gattcactga    253140
     cgccaaagga aaggccggat acgcaaaatc catgggagta aaaaagcgct aactgcgcct    253200
     tagcttatgc agggcagcag gagggctttc gggcctaacc agagccagtt aagaccctcc    253260
     cagacttgac agaaatcagg tcgaggagtg tactggtacg ctatgagcaa gcccaataaa    253320
     acacctgtag atgcacccaa tttcctgaaa caaatcatcg aaaaagacct ggagactggc    253380
     aaagtcaaag gcgaagtggt cacgcgcttc ccgccagagc cgaacggata cctgcacttg    253440
     ggtcacgcca agtcgatctg tttgaatttt ggtctggctc aggaatacca gggtcgctgc    253500
     catctgcgtt ttgacgacac caatcctgaa acggaagaaa ccgaatacgt tgaatccatc    253560
     caggaagacg tcaagtggct gggctatgac tggggccaac acctgtatta cgcgtctgat    253620
     tacttcgagc agatctatca gtgggctgaa cagctgatta aagacggcaa ggcctatgtg    253680
     gattcccaga atgaagagga agtgcgcaag aaccgcggcg acttcacgac tccgggtaag    253740
     gattcccctt accgcaatcg tactgttgaa gaaaatctgg atttgttccg tcgcatgcgt    253800
     gccggtgagt tcgatgaagg tcagcatatt ctgcgtgcga aaatcgacat gcagtctccg    253860
     aacatgaaca tgcgtgaccc gttgttgtac cgtatccgca aggcgcatca ccaccgtact    253920
     ggtgacaagt ggtgcatcta tccgatgtac gattatgctc accccttgtc tgatgcaatg    253980
     gagcacatca cgcattccat ctgtactttg gaattccagg atcaccgtcc attctatgac    254040
     tggtgtgtgc agaatgttcc ggtgccggca gagcctcatc aatatgagtt tgcacgcatg    254100
     aacatgacgt atctggtgat gagcaagcgc aagcttttgc aactggtaaa agaaaagctg    254160
     gtttctggct gggatgaccc gcgcatgccg actatttccg gtgttcgccg tcgtggttac    254220
     actccggaat ccatccgtcg atttgcaaaa cgcattggtg tggcgaaatc tgaaagcatc    254280
     atcgaatacg acatcctgga aagctgcgtg cgtgagcacc tggatgaaac ggctcatcgt    254340
     gcgatggcgg ttctggatcc aatcaaagtt gtgattgaaa acctgccgga cggtcataaa    254400
     gagctgattg aaacgtctgt gcatccaaaa aacaccgagt tggggaaccg ctctttgccg    254460
     ttcactaaag aagtgtacat tgatgcggcg gacttcatgg aaaatccgcc ggatgattac    254520
     ttccgtctgt ctccgggcaa ggaagttcgt ctgcgcaatg cctatgtgat caagtgcaaa    254580
     gacgtggtca aagatgcttc cggcaaagtg actgaattgc gctgtgaata tgatcctgtg    254640
     actttgggcg gtaagccgac tgccgatggc cgcaaagtaa aaggtatcgt ccactgggtt    254700
     tcggcaacgg attgtgtgga tgcggaagtg cgtgtgtacg ggcgtctgtt caaagtggcg    254760
     gatccggaaa atgtaccgga cggtcaggat ttcaaagtga acctgaatcc ggactctttg    254820
     aaggtgatca agaacgcgaa gctggaaaaa ggtttgaagg atgcgaaact tgaaaaccgt    254880
     taccagtttg aacgtgtggg ttacttctgc ctggacagta aggactccaa gccaggggcg    254940
     ttggtgttca accgggttgt cgagctgcca tcaagtcact aagaaattga aaattcaaac    255000
     gacgaaggca gccccgagct gcctttgttt tataggtggt cgctatgttg tttgctgaaa    255060
     gtgtttataa gacccgtcag gggaaagtgg ccgacgcctg gaaaggcctg ttaggtcccc    255120
     aggatctggt cctgattcac agtggtgagg ccgtgcaaaa gccgggtggc ctggatcaga    255180
     cgtatgattt tctgcctcat ccctcctatt tctggctgac cggacaccgc cgtgatgaag    255240
     gtgtcatggc ttattctgtg agcgaaggct ggattgaaca tcaacgtcca ctcagtcccg    255300
     tggacatcgt ctgggagggc gctgaaggaa attttgaatg cgaacacact ctggtggatc    255360
     tgcaaaagaa gttgcagggc ggggcgtaca agcgcgtgtt ccacctggga cagacatcag    255420
     aaaagtcatt tgaagccgaa acccgcgaac tgtcgatcaa gctggatcag gttcgtcgtt    255480
     gcaaagattc acacgaagtt cagttgattc gtcagatcgc tgcgatggcc aacaaaggtt    255540
     atcaggcgtt gcaaaatgca ttaagaccgg gaatcaccga gcgtgaactg caattgcatt    255600
     atgaaaacgc cgtgttgatg gcgggcgctg acaagatgcc ttacggttcg attgtgggca    255660
     gtggcgaaaa cgcggcaatc ttgcacgcgg ttccgaccaa aaagaaagtt gtttctggcg    255720
     aattggtgct ggttgatgcc ggtgctgata ttgaagacta ttgtgtcgat atcacccgcg    255780
     tattcgctgt ggatggtaag ttcaccgggc agcaaaagga tgtttatgac ctggttcatg    255840
     acgcttataa agcctctgtg gccctgtgcc gcccggggac tcagtggcgt gatgttcata    255900
     tgaaatccgc ccgcgtgatt gctgaaggtt tgcagcagtg gggcatttgg aaaagctccg    255960
     tggatgcggc tttggaatcc ggcgcgattt ccgtattcta tccgcatggc gtgggtcacc    256020
     tggtgggctt gaaagtgcgt gacaccggca atccggaaaa cgtgaatcca caacgctatt    256080
     acggagctcg tctgcgtgtg gatctggagt taaaagaaaa ttacctgatc acggttgagc    256140
     cgggctgcta tttcgcccgt gcgtttattg aagacaatga cctccgcgaa aaatacaagg    256200
     accacattca gtggtccgag gctgaaaagt ggaagtcctt tggcggggtt cgtctggaag    256260
     atgacatcct gatcacaaaa ggtgaggcag agagtcttac caacgttgtt ctcaagtaaa    256320
     attacaacga ggtctcctgg ccggctttaa gccaggagga ccacttctgt gaatcatagt    256380
     ctaaatctgg gacactttca tgggcctcca ttgacgtgtc aaaaccattg gccttttcgt    256440
     caccttcgcg cgaagaggga tgctcacgca tctcggcttc cacagtccac tttggacgtg    256500
     tcagtatgat tgccaagatg aaacccacaa caatcagcac gatatatcgt ttgcgcattg    256560
     gtcccccttc tcccacagga gtttgagaca atgcaagacc gtgccgaacc cttcggcaaa    256620
     aataagcggc aaagagcttc taaagtttag acaatcgcca gtcgctagac agcgggactg    256680
     caattgcttg attccactct gaaaatgtca gggcgcgatg atttgagtgt ctaccagctg    256740
     aacatgacga gttcctgggc tgcccagcac cagtgtcgtg ggagtggtca tcccattggt    256800
     tttttcatcg ccttgttttt ttacgatggg ccgattcttc ttaggttttg cgttcattct    256860
     tcaattcacc ctatacagat aaacgttcaa aagtgaggtc aatcaaagct gagaccttaa    256920
     cgggaacagt gttgttaggc ataaagagtg tcgatggccg atacaattgg caagcgaaat    256980
     gttccgtggg ctagtaaaaa ggaattttgc tcagatacat atttgtttag ttcgatgacg    257040
     ggaggatcat tgttcgcacg aacttacaag gaggaattgt ggaaacagac gcaactatga    257100
     gcgtagggaa gaaactggtt gagctgtgta agaagggcga caacatgaag gccattgaag    257160
     atctttattc gcctgatatt gaaagccacg aggcgatgga gatgcctggc atgcctgcaa    257220
     aaatgcgcgg cctggaggcg attcgcagga aaaacaagga ctttgacgaa caaatggaaa    257280
     tgcacgggat tgaagtggaa ggtccatttc ccttcggaga tcgctttgcc gttcactata    257340
     aaatggacgc caccgagaaa aaaaccaata agcggattaa aatggaagag gtcgcactgt    257400
     atacagtccg agacggaaaa atcatcaaag aagaattctt ctacacgatg tgagtttatt    257460
     catattttca aaaaagctaa ctgagtatct tcagtgttcc tgattaagtt tgcgaaatca    257520
     tcaagacgtc cccaaggtga gagctggtgg attcaactct ggatttatag aatcagtttg    257580
     tgaacacact ggctctttcc tttttcatgg ctctgcttct gacttcttgg gtcagtcagg    257640
     cccgcacgta caacgtcgcc attttatact ggagcatgaa gattcccggt caggtggcca    257700
     tgcgacaggg gttcgaagaa gaggtggcag cgtataacaa ggccaatgaa gaaaaccaaa    257760
     ttaaattaac tccttatgtg gcgggtgaag gccgtgatgg tttgctcaga caaatagagc    257820
     agttggatca ggcggtaaag tccaaacccg atgctatcgt gatacagccg gcggatatca    257880
     caatcctgag tcgaggggtt caggaggcca acagtaagaa catcccggtc tttgcttatg    257940
     accagtacat catcaaagcc aaactgacct ctttcatcag cagcgacaac tatcaggcgg    258000
     ggtgggacaa tggtctttat atcgacagtc agtttccgcc ggaaaaagtt ttaagaatcg    258060
     tgccttttga atatttccgt gtgtcggcga cggtggagcg catggatggt ttcttcgacg    258120
     cccttcgcag ccgcaaccgc aagttcactg ttcttggtca tttcgaggcg gtggaacccg    258180
     tgggcggttt gaaagccgct caggattatc tgaaaaaatt caaacgtggc agtgtggatg    258240
     tgatcttcac caacaatgac ggcggaggcc tgatcattgt caaaaccctt tgggatgccg    258300
     gccataagaa gctgattcat gcgacggtgg atggggaccc ggcctccatt gaaaacatca    258360
     agagcaaaac actgacggtg attgactcag cacaattctg tggtgagctg ggacgggaaa    258420
     cggcgcgcac ggtggttcaa ttcttcaaga atggaaaagt ggagcctgtg aaattcattc    258480
     cgacattccc ggtcacactg gagtccctga aattctatcc aggctggatg gggcggccca    258540
     cggaaaaagt tcgattccag tccttgcggg acatccatat caaagaggcc aaagccgacg    258600
     gcaagcccaa gcgcggagcc atcatcaaag tgggactgac tccctcttgc ccctatttgt    258660
     gtgaaatggg tccggcgggc tggtctggct atttgtacga cattcttgaa agtgccgcca    258720
     aagaaagtga tttcaaattg gagatcgtca gcctgcccag tgaaaaactg ctgccggctc    258780
     tgcaaaagca gcaggttcac tttgtgataa gccccatatc caaggttcgt tatactcctg    258840
     atctgcgggt cgtcggcccg aaactgggaa tgagtcttgc cggcgccctg ttcacccccg    258900
     gtgtaaagct gcaactggtg gattcagatt cattggcgga caaacgcatt gtttttgccc    258960
     agttggccca tgaaaacctc atgcagctgc cgccgtcaga ctttaaccgt tcgttgaaaa    259020
     tctccggccg cgagatcggg gaccgcatga ccaaactgat cgccgaaaga cgggtggacc    259080
     tggctttggg ggactacaat gttcttcgct ataatatgtt gcgccggcaa ctgctcagct    259140
     ttgaaattca accgacctct ttggccggct acaacgcgct tgtgctggtg ggacatccta    259200
     aagatccaga gtacggcgag ctgccgttga tcctgaacaa gtggttcgat actcaccgcg    259260
     cgtcaggcaa gctggaaaag attctaaaaa aatacaatct tgaggactgg aacatctttg    259320
     ctttgtagca gtttttcgac atatgatttt catgggaaat ggagtttcta tgaaaacatt    259380
     gggattgtct ttgttcttga tggcaagttc ttcctgggct ttgccgtcct atcaggtgcc    259440
     ggaaatgcag gtgcgtgcgc actatcgcaa cacattcaac ttgccgcctc tgacttatct    259500
     gagcaacacc tcgccttcca ttaataacca cggtgatgtg acctttaagt tgatggccgt    259560
     ggatggcact cccaatcagg ccgtgtggta caaaggcaag agtgatagca aatggcaaat    259620
     tgtctttgtg gcccccgaag atcgttatgt gtcagatccg tctgtgaatg accgcgggga    259680
     aatcacttac agcccttata ccgaagtgat gagtgatggt ctgttcgtgt tcgataccaa    259740
     atctggaaca accatcgaaa agctggcagg tccggcccat aaaatagttt ttatggcgta    259800
     tgttcaaact ttgaatgacg gcacctcggt gttccgaggc atggggacag attttgaccg    259860
     tggcttctat gaagtgaacg gcggtcttaa aaccattgcg atggaaggtc agagaaactt    259920
     tggcactcct tccgcttatc tgtttaagcc ggccgtgaat gataaaaagc actgggcctt    259980
     caaggttcgg gtgggtgagc gtggtgaaat cggcaatgaa caatcagacc agatcctgct    260040
     ggtgaagcca acaccacagg gatatgacaa gatcatcgtg gctcaggaca acaaaggcga    260100
     cgtgaattct ccgttcaccg gatttggtaa cggtgtgtcc atggctcaaa acggcctggt    260160
     ggcctttgtt ggtcacgata agaacaacag gaagtccctg gtgctctggg aaaacggcag    260220
     catgacaacg ctggttcgtg aagggcaggg cggaatttct gaaattgaga tgttctctcc    260280
     gaaagtgaac tccagtgggg tggtggcatt ccgtgcgaaa aatgaaaaag gcctgcgtgg    260340
     gatttatgtg gcctccaagg acggcgtcaa gcgtctgatc ggcgagggcg acagcatccc    260400
     gacagatctg gggccggggc aaatcctgca aaagcaagac ttcccgggct ttgccggtga    260460
     tattgatatc aatgaaaaga atgagttggt ctttgcctgt gtggtggcca ccaccgacaa    260520
     tcagatcacc ggagatgccg tttaccgcat ttcgccagcg ggtctttagc gcgcacattc    260580
     ccgcagcaag ctggcgcagc ggtccagaat ggtggcgcgg attttatcgc gctgctctcg    260640
     gaactcgggg tgctggctgg tttgcacgat tttataaagg ctgatagttc taaccagatc    260700
     tatcagcctt tgtttttccg gtccccgtga cagcggaaac ttcgggatct cgcggttcag    260760
     ggacacggct ttttcgacag cttccgtcca gtcaatttca gtctgggtca aatagatggt    260820
     cggcacaatg ccggtctttt tgatggcctg ctcttcactt ttcaactggg tgttcagcca    260880
     gcgcagctcg ttgacgatag cgttgaattc ggcatcgtgc ttttttccaa acagactgaa    260940
     gacggttttt ctccatgccg cacagaaatc atcaaaatca atgttctcgg ctttttcaaa    261000
     gaatggcggg tgcgtgatgt agtgcagggt tctgcttaag acatccgttg aaatcaccgc    261060
     gctgtctgtt ttgtgcccca ggcgcatcag attgtgggcc cagctgacga tgttcatgac    261120
     ggaatggctg ttgaccagcc cgctgcgaaa attcagatga aagccttcgt acacggccat    261180
     gctcatgggg cgattcagca gttgatccat gtgggatttg cggcgttcgc tgcgggctat    261240
     ggcaaagaag ctctccagac ggtccgaaaa cttttcaaag gattcgttcc acaggccttc    261300
     gtgctggcag gttttataaa gttgaaaggc tttggcagga gtcggctcag cctcttccag    261360
     cagggcattg attttttgtt ccagcaaacg tgggaatgaa tgccaaagtt ccttgatcat    261420
     ggaccaaaga atagcacgtc tctgacagag attctgattt cctttttttg tcgaaataat    261480
     tgacgattcc cctctgaaaa aacatccaat gccagttcgc aaattggtgc ggcgatcttt    261540
     gccgcgcttg aaacggggat ttagtataat agagcctgaa caaggaggtt gctctatgtt    261600
     gttttcgaaa ccttttaaaa cggtttgtgc gctttccatg gcggcattta tttctcaggc    261660
     accggcagtg gcctttgccg aagtcaaccg catgcttccc accacgaccc tcatcgaaga    261720
     gttgaacagg gaagaggcca cctctcaggt gcaggaattc ctaagccgcg acgatgtgca    261780
     ggcggccttg attcagcgtg gactttctcc tgcggaagcc tctgatcgtc ttgccagtct    261840
     ttcagtggct gagctcaatg acctgtctaa acaggtccaa gaagccaaag ccggaggcga    261900
     cattttggtg accattctaa ttgtggtcct gatcatcttc ctgattaagc gaatctaaga    261960
     tgaagtttat ccgccaaata acaggtatag ttttggtgac tgcgggttgt gccagcacaa    262020
     ctccgcaggt ggactcgttg aatctgcgct cggtgatccc gcaagaaaca gaaatatccg    262080
     gagtgccgtt cattgaacaa agtgaaggtc actgtggccc ggccaccttg accatggctt    262140
     tgcattgggc gggaaacagc gtgcctttgt cgacggtgac ctcgcaggtt tatacgccgg    262200
     gaatgaaggg cagtctgcag acagacatga tcagcggagc ccgccgtcag ggcatgatgg    262260
     cggtgccggt cacaggggtg cagaatctgc tgcgggaagt gcggggtgga catcccgtca    262320
     tcgtctttga aaatctcgca gtgagctggc ttccgcagtg gcactatgcc attgtctatg    262380
     gttttgatcc cgtcagggaa gaagtgattc tgcactcagg cccggaggcg ggaaagcgct    262440
     gggacatccg caagtttgaa cgctcgtgga agctgggtga ctactggggg ctggtggtgc    262500
     taccggctgg acaactgtca gtcaccgcct cggaacgtgc ccatgtgacc gcggccgcgg    262560
     cgttggaggc attgggaaaa aattcagaag ctgaaacggc ctatcagagc attcttgctc    262620
     gctggccgca aagtctggcc gcctatgtgg gcctgggaaa tatccactat tcacgaaagc    262680
     agtattccct ggccatcaac aatttacaga aagccaccca tttacagccc gagtcagcag    262740
     tggcttggta taatttgaca atggctcagg ctgctctggg gcatacttcc gaggcccgaa    262800
     aaagtgccaa agaggctttg cgttgggcgg cgccagagtc aaaaaaactt tatgcgcaga    262860
     atcttcgttc ttttcttgat ggtccgtgat tgttgacagc ctttccgggc ggcgatgacg    262920
     gtttccgtaa gctcttttac cattgttggg gggagctttg atgccaacag aacaggaaca    262980
     gaacaaccag ctttggcgac gctataaaac tatctttgaa tcaaagttag tcggcatcct    263040
     ttccacggac atgaacggtc agatcctcga tgcgaacgat tgctttctgg agatggttgg    263100
     ttacagccgc gaagatctga atgagggaag gctgaattgg aagacattga cccatcccaa    263160
     ttaccttgaa caaagccggc aggtcgcaga gattctgaaa accaaaggct ctgttccggt    263220
     ttttgaaaag gaatacattc acaagaaggg acatctggtt ccggtgcgcc tgggcctgac    263280
     catgtttgag gatggaaccg ttatcactct ggttcaggat atcacccggc aaaaggacat    263340
     cgaaaggaag ctggaagagg ctaaatccct gttagaagaa agagtggcgg aacgcacgcg    263400
     gcaactggtg gaatcagaat cctttctgat ggcgatattt gaaaatatgc cgaccatggt    263460
     ttttgttaaa gatgcccggg acctgcgctt cgtccgtttt aacaaagcgg gcgaaaatct    263520
     gctggggatt ccacgcagtc agttgatcgg gaaaaatgac tatgatctgt ttccgaagga    263580
     acaggcggat tttttcacca ccaaggatcg ggatgtatta aaagaatcaa aaatcgtcga    263640
     tattcccgaa gagcagatca acacggcccg gggtgttcgc tacttgcaca cccgcaaaat    263700
     tccggtcttt gacaaggaag gccgtcctca gtatttgctg ggcgtttctg aagacatcac    263760
     ggaactgaaa gaggcggaaa agcagcgggc tgttctggtc aaagagcaga tcgcccgcag    263820
     ttcagcagag ttgcgcgctc agcaaatggg ttttctgtcg gacttgacct ttgcgatgac    263880
     ccagtctttt gatttggata acattctaaa agcgtttacg gaaaaatcca tcccgaccct    263940
     ggccgacatc tgcattgttg acttgatgga cgaagaggga ctggagattt cccacaccca    264000
     ggtggccgcg aaaacagatg aagacagaca gttcattcaa agctggcggg aacggtttcc    264060
     tctgcgctgg gatgccccgt atggtgcggc cgaggtgata cgctcgcgca aaacagagat    264120
     catcaacgga gtggatctgg atcagttttt gaaatccacc ttcgggcccg aggccgccat    264180
     gacccaacgg cctattcacg cagaagcatt catgacggtg ccgattttgt tgcgggatga    264240
     aaaacccctg gggaccatca gtctgatcac aacgtcaccc ggaaggcact tttcgcctct    264300
     ggatcagagc atggccgagg aagtcggccg ccgtctggcg gtgttgattg aaaactcgcg    264360
     tctttattac cgggctcaag aagccagtcg tgccaagacg gcctttttgg ccaatgtcag    264420
     tcacgaaatt cgcaccccgt tgggggccat gctgggattt gctgaaatcc tgaaagagga    264480
     tgaaagtctg cgggaagaac agaaagaggc ggtggagacg gtcctgcgca acggccagca    264540
     gttgttgcat atcgtggacg agattctgga tatttccaaa gtggaatccg aacgcattca    264600
     aattgaaagc attgtctttg atctgccgga tcttttacat gacgtgattc atcttttgcg    264660
     tggtcgggcc gaggaaaagg gcattgagct tagactgcgt ctggggccgt tgcccaaaaa    264720
     gattcagtcc gatccaacgc gactgcgcca gatcctgatc aatgttattg gtaatgccat    264780
     caagttcacc gattccggat ttgttgaaat ggaggcccgg tcccataatg gcaaacgtcg    264840
     cgacgggcgc cagcgcatcg agtttttggt cacggacacc ggcatcggga tttcttcaga    264900
     acagcggaac aatctgtttc agcctttttc ccaggcggac agttcgacca cacggcgctt    264960
     tggcggcacg gggttgggac tgtttctgtc ccgaaagctg gcaaggttgc tgggtggtga    265020
     cgtgattttg aacaccagtt cggcgggaat tggcagcagt tttttgattt caattttagg    265080
     cagggaagtc actgactccc agatccgcga cttagggaaa aagaatgata agtccgcgga    265140
     agtgtcctcc agacaggttg aaagtattct ggtggtggat gatgccatgg ataatcgcga    265200
     gctcttccga cgatttattg ttcgggccgg tattccggaa gaacgcatcg agacggctga    265260
     gaatggtgcc gaagccgtgc gtaaggcctt ggacagatcc tatagtgtga ttctgatgga    265320
     cattcagatg cccgagatgg atggctttca ggcactgaag aaactgcgca cccagggata    265380
     tcgcgggccc atcgtggcgc tcacggccca tgcgatgaaa ggggaccgcg aaaaatgtct    265440
     ggcagccggg tttgatgggt atttacaaaa accgctggat cgggtcgagc tcaagcgggt    265500
     tttgaatctg gatttttcaa gtcagcagcc cggaccgcgt gatgccgaac tttagttcaa    265560
     tggcccttgc acccgggaca ggatatcgtt tagcagattc atatccacgg gtttgcttaa    265620
     gtagccgtca aagccgtgct ccatggattt cttctggcct tcaacactgg cttgggcggt    265680
     cagtgccaca atcgggcgag tgtagccatt ggtgcgcagt tgggtggtgg ctttatagcc    265740
     gtccatcacc ggcattttga tatccattaa aatgacatca aaggggcggg ccatggcttt    265800
     atagactgcc tgttctccgt tttcggccgt gtcgacatcg gcgccttgct tttgcagata    265860
     gcggttcatc agcaggcgca ggtcctcgga atcatccacc accagcacac gtcggtcttt    265920
     cagaaaacct gtttctttcg cgatcttcac tcggtccagg gcctggtttt tttgtttgga    265980
     gggagtgaca agtctcagtt tgtgaaccgg tccgacattc agggaaagtt caaaggagct    266040
     gcccttgcca agttcagaag acaccaggcg cagccggcca ttcatcattc gcgccagacg    266100
     ctcggataga gccagcccca atcccgaacc ctgcacccgc tgaacttccg cgctttcacc    266160
     gcgcacaaag ggctggaaca gatttttttg agtggcgtcg tccatgccca taccggtgtc    266220
     ggtcacacag atggtgagat gtccggtgtt gtccgtgtca gaataaaagc ccacgcgcac    266280
     ggtgatggtg ccctcgtgag tgaacttcac ggcattggac aaaagattga tcagcacctg    266340
     acggaagcgc actgaatctg attcaatgat ttctgggatc tgggattcat agtaaatttg    266400
     gatgtcatgt ttttgatctt ccagcgccga acgaatgaca cttaaagagt cttccagctc    266460
     tcgggccgga ttcatcgggg ctttctggat gtacaaacga ttggtttcga ttttggaaag    266520
     atccagcagg tcattcacca gcgaggccat gaagttcccc tggcgatgaa tggattgcac    266580
     gtcccggcgg ctttggtcat ccagatgggg actgcgcaac agggtgtcgg caaatcccag    266640
     gatcgccgcc agaggagtgc ggatttcatg gctggcattg gccagcagca cggatttggc    266700
     attgttggcg gcttcgtgca gatcacgttc ccggcgcaac agttcttcat tgcgcttggt    266760
     ggtgatgtcc caggcgatcc cggtggcccg gtaaggcacg ttgtccgggt tgcgatagaa    266820
     acggcccttc aaagccacgt ggcgggctga accaaaactg tcagtgaaaa tcgcttcggt    266880
     atcgagctcc aaagtggcgc tgcgattttc tttcagcaga gttttcagct gttcggtgcc    266940
     cagggggaaa agggctgcgt tgccttcgca gtgaaggctg tcagtcgtca tgtcccaatc    267000
     ccaggtcaag gcatcggaag aagccatgga catgcgcaga tgctcttcat ttttttgtag    267060
     tttcgtatcc aaagtcagaa gtttgatgat cgcctgattc aggttttttc ccatgacgat    267120
     catcagtccg cagtaaacca tcaccagcat tcccaccagc aggtggtgct gttgtcccga    267180
     tgtcacatag ccaattcccc agcccagcat ggcgggggcc accacacaca tcatcgccac    267240
     ccgtgaagac acgtaggtga tcatcgcccc agcggacatc gaacacacca acagggctgt    267300
     cagaatttgt tgaatggtgg atccataagg tgcgaccaaa cccacggcgg cccagcaaag    267360
     gccggaaatc aacagcaacc cacacatggt tcgatgccag aagtgggttt catccacatg    267420
     gcgtaatgtg ggtttcacac gcttccagcg atatagcatg gacagacgga tcaggacgga    267480
     cgtgaacagc acggacaccc aggtgagtga aaaagcctgc gagacattgt tccatgagat    267540
     atacaaaaaa gcggcggcat tggcgaagat aacaatcacg ccattgatgc tttggcgata    267600
     gataagatcg atttttcgaa ccgccagatc caaagattcg taattggagt tgttcgaagt    267660
     gagggaggga agatccgttt tgttcgccat ttggctgcga tactacaagg acggtgtttt    267720
     ttaggcaaat tgcatcggct tcatgttggc ggcttccagg aaaaaagctc atggatttga    267780
     ttccatttgt cgcaggcggg agcctcaatg accactctct gaccgttcca cggactttcc    267840
     atttcgatct tggtcgcctt caaacacagc cctttgatgt ttaaagtgtc cctgaagaag    267900
     cgattgtggt gagaatcacc atgttcgatg tctcccagca gtgggtgagc gattcggtca    267960
     aaatgacgac ggatctgatg ccagcgtccg gtcacagggt gagcctgcac cagagaataa    268020
     cgagaagtcg gatatttttt acctactgca tagggaagtt ccacctgtgc aagactgcgg    268080
     aacaccgttt gggcctcaac aatgctttgt ccttcatcaa cttccagagg caaatcaatg    268140
     ctgccggatg caggcacaaa tccccggacc acggcatgat aggttttgtg catgcggcgt    268200
     tcagcaaaca agaaattaag ctcgcgcgca tcctggcggc tcattgcaaa cagaacaatg    268260
     ccgctggtcg gtgcatccag acggtgcact ggaaagacgt cttttcggaa catcttgcgc    268320
     agatgccaca gacaaatacg ttctttcgga acaggatagg gcgatagctc gggcggatgc    268380
     acgaagaagc ctgacggctt gtcgatcgca aaaaagtttt catcctgata gatgattttt    268440
     aaaggacttt cgctgctcat gccggatctt tcagataaaa ccttgtgaat tcagagttca    268500
     gaatttcttc tccgcgggtg atggtcaggg agccttcctg caccatcagg ctgaaacgaa    268560
     attcccgcga actttcttca cccaaagtcg tcagaaattt gtcatccagc tgatagattt    268620
     caatcttttc gggctggtgt acattttctt tttcgcagtc gcgcagaatc tgagaagcgt    268680
     ctttgtacgt gtagattttg acggcttgcg aggcctttga ggctttgtgc agttttttcg    268740
     gactgggatt gccgatttca atccacaaaa gtgttcggcc actggtggca tcgctgtggc    268800
     tgagggctgc ggactcggga tcgcccagtc cttgcgctga aaactgcagg tcttgggaat    268860
     agttgcaggc ataagccaga gcccgtgtca gcatataggg catggattcg gacggatgca    268920
     tcgccagacg gaaatcaagc tgttcataaa tgccgcggtc gatgtcggaa agatcaatcc    268980
     gaaaccggta cagtttggag ggttgtgcca tggggcgtag cataggggtt ttccccagtg    269040
     aaagcgagaa aagattgtcc cgatagcggt ttttttgctt caatgaatcc atgaaaatga    269100
     tgggacatcg cggggctcgg gaccgggcac cagaaaacac tttgcgttct ttcgagtttg    269160
     ctttgcagtc cggcgttgcc gccgtggaat tcgacattca cgaatcccgg gacggggtgt    269220
     gggtggttca ccatgacgac actttggatc gcaccacaac cagcacggga cgggtgggtg    269280
     cctgcacttg ggcggaactt tcccaagtgc gaaccaatga gggggactct ctgccgcgtc    269340
     tggagcaggt gctggaactt tttaaaaggg ccccaaccca gttgcagatt gaagtgaaat    269400
     ccccggggaa tttccgtgcc ctggcggatc tgttggaaaa gaactttccg gcagaaagac    269460
     tgaccgtcat ttcttttaat catcgctggc tgcgtgaatt ccgggatcat tcttcaataa    269520
     aaacaacttg cctgctgttt ggtttgcctt tgaatccggt gcagatcatg gaaagcgcca    269580
     aggcccaggg aatttcgctc agtgtgaact ggattgacca gcagttggtg gctgaatgcc    269640
     atgcggcggg attttcggtc acggcttgga atgccaatga cgaagccact tatcagaaaa    269700
     tgaagcagct gggcgtggac tgtctgggga cagatgttcc atttaccgcc gcgtcgtggg    269760
     tctaagagta gagctttcct tcaattagaa cctgtgctct agtgattctc atacaattta    269820
     tggggatcca atgaccaaga aaaaagcggc caaatccaag tcaccaagaa ctcaagccat    269880
     tcacggcgag tttctttcca aatcctggga gttctctcac catttgattc cgccgatgac    269940
     ggcttcgacg acattccgtc tggaatccct gcaaagaggt gcggaaggtt ttagcacttt    270000
     cggcgcacag aagggcgaag aaaaacccat ctggatctac gaccgtctgg aagagccgac    270060
     aacaaaaatg ctggaagacc aactggccct tcttgaaaaa ggcgagtgtg cggtgacctt    270120
     cggaagcggc atgggcgcaa tcgcctccac tctgatgtca ttgctttctt cgggccagaa    270180
     agtcattgcc cataaaactt tgtacgggtg cacctacagc cttttgacga actggctgcc    270240
     gcgtttgaat atttccacgc atctgatgga tgtgaatgat ttcaaaaatc ttgagctgca    270300
     gctggcggac ccggcagcac gcgtggtgta ctttgaatct gtttccaatc ctattttgga    270360
     aatcgcggat cttcaaaaga tcaccgcgct ggtgaaagct gccaacaaaa aacgcggcaa    270420
     ggacaatcag atctatactg ttgtggataa cactttcgcg actccgtggg cgcttcgtcc    270480
     ggtggaatgg aacgtggact tcgtgatcca aagtttgacg aaaaacatct ctggcttcgg    270540
     tacggaaatg ggcggggccg tgatcgctcc aagaacgcat gaaagcattc tgcgtgtggc    270600
     gcgcaaggat ttcggtgcga ttatccatcc atattcggca tggcacattc tggtgtacgg    270660
     tatttccacc caggccattc gttttgaaca gcagcaggca tcagcctggg cggtggccaa    270720
     gttcctggaa gcgcacccga aagtggccag tgtcacttat ccgggcctga aaagtcatgc    270780
     tcagcacaag ctggcgaaaa aatatctaaa atccccggag ggcaagtttg ctccgggcac    270840
     gatgatttcc ttccaactta aaggtgacat gaaaaagtgt cagaagtttg tcgatgatat    270900
     cgccaagaat tcatactcga tcactctggc cgtcagcttg ggactgacca aaacgttgat    270960
     tgaggttccg ggctttatga ctcactcggc gatcccggat gacaagcgcg gcgacagcgg    271020
     tattgatccg cgcgccatcc gtctgagtat cggtttggag aacgtaaatg acattattga    271080
     ggatctgaaa gaagccctca aaaaaatcta aaattcgcgt ggaggacgct gggattcgtc    271140
     cttcacatcc agtgtatagc tggtggccgt gtcagagatc atgtagctca tctcgggcag    271200
     gccctcagcg acctggcaaa ggccgatttc aaactcggat tcaaattcac aatagatagt    271260
     gcctattttt tcaaacgggg tcacaggatc caactcggcg acgtccgaca gagcatcgcg    271320
     cgtctgctgg atttcttttt ccgtggacag gcttaagttc tgactgacct tgatgtcatt    271380
     caaatccaga taaacggatg ttaaaacata cgggcacgcg ccacgttggc ccgccgttgg    271440
     aacgttcacg gcataactgc cgtcttgctg gcgcagggct ttgatgacca gcgtgcggtc    271500
     gtgtccggcc gggctcatgc ggtcttccgc aaatttgcaa acggaggcat ccagtttttt    271560
     attgaaggtg aaggccggag aataaaaagc cattgccgaa atctgcgttg aaacgggggc    271620
     ttgtccttga atcaagtgcc cctcggtgct gggttgcagc cgtgtttccg ccaacacggt    271680
     ggaggtcaaa agcagggtga acagggcagg cagtacgacg ggcagtttca tgtttcatcc    271740
     tttggcggaa gccttagcgt ttcgtcacaa ccgggaaatg ccaaggccat gccataaaat    271800
     tcggatcttc aggtggaatt agagcccggc tcagggaaaa ttcgccccgc aagtgtgtca    271860
     atttgttgat cacggcggcc tttgcgggca gtgtgaaaaa ataaggtgaa gaaatgatcc    271920
     agcaacgaaa acgcaaaacc aaagaccctt gccctgaatg ttacctgcac cgggatttgt    271980
     gcctttgcag tttgatacct cgcctggaat cccgcacccg attgtgtctg gtaattcacg    272040
     ccaaagaatt aaaacgcacc accaacaccg gtcgtctggc tatcaaggct ttgcttaaca    272100
     gcgagatgcg tgtgcgcggg gacagtcggg aagcactgga tctgtctgat ctgctggtgc    272160
     ccgaataccg caccgttttg ttttttcctg cagaagatgc gcgcgaacta gatgccgaat    272220
     ttatggcgga agacccaagg cctttgcagt tgattgtgcc ggatggaaac tggcggcagg    272280
     ccagcaaggt caacacccgt catccagaaa ttgccgggat tccgcgagtg atgatcagtg    272340
     cacccaacaa atcccagcac catctgcggg cggaaacaac cgaggaaggc atggcaactt    272400
     tgcaggcgat tgcgcaggcc tttatggtgg cggaaggccc cgaagtcggt ggggccttga    272460
     tggatttgta tcaggaaaaa ctaaaaagaa ctctggcggg acggggagtt ctgcccaagc    272520
     cgacttagac gtcggcttcc atgatccagg tgtccgtgtc attgaagagc tgctccagga    272580
     tctcatcctc aaacagatga tcccccttga acaattcaaa caacgacagg gaacggctgg    272640
     tcagctcttg ataagacttc agtttgccga agtattcttc cttgctcatt tccggagcag    272700
     ccagtggctt gtaaacttcc ttttgcccga agatcaaagt gtcatagctg tagctgttga    272760
     acaccagcgc ttctgttgcc gtgaattgcg agttggatcc aaagttcccc gcactcagcg    272820
     gaggtctttg attgaacaga ttcacgatgg tttgtgcgtg tccaatattg gtcttttcac    272880
     ggcagtgctt ccagaacggg gtgtccagtt tcttgttgaa cttatagtgc atgcccacga    272940
     accagcggaa ggtgtcccaa gtcacggcga tttcattgtt gataccggtg atggaaatct    273000
     gatcgtccaa agttttgggc atcaaacggc acaaaacatt gatgctgtga accgcggtct    273060
     ggatggcggt ggattccaaa ggctcgataa atccgtaaga gttccccaaa gaaaacacgt    273120
     ttttcaccca ggcttgagtg tgacgacccg agcggaattc aaccattttg tatttttcaa    273180
     agtgaccgaa gcgggcgcgg gcttcagcca gggcggtttc ttcgtcacag aatttggacg    273240
     agaacacata tccatagtga tcttcggtgc gcatcgggat tttccagcac cagccattgt    273300
     tcatggtgat cacagatgtg tagcagtcga caacgtcttt gttgggcata tcaaaggtca    273360
     gcgcgcggtc ggtgaccaat gtgtccgtga acggcgtgaa ttcggttttt agggcttggc    273420
     ccagaatctt ggagcggaaa cccgagcagt caatatacag gtcataggaa agactgtggc    273480
     cttccttgga ttccaaggac gccacatagc cccgttcatc cagtttcact tcgtgaacct    273540
     cggcatccag aatatcaatg ccgcggcttt tgacttcctt gttcaggaag cggatcaggt    273600
     ttttgttgtc gatatgatag gaaaacggaa tgctggcaag gaaggaagtc aaagtgccat    273660
     ttttgttgcg aatgaccgga attttatttt cattcatcag caccgagggc cagttggaat    273720
     tcttgatgtc gttttcataa taataagact cgtactggtg tccggcaaag aagctgaagt    273780
     tgaatttgta atcacccggg cagccccagt caaaacgaat gccgaatttc aaagtcggct    273840
     cgacttcacg gaagaattct gccgggtcaa tttcaagtcc gcggtgcagg aacggcacga    273900
     tttcggtggt ggtggattca cccactccaa tcacgggtat tttactggat tcaatgacgg    273960
     tgacttcaac ttcagggtga tattttttta gtgccagggc ggcaagatat ccggcggtgc    274020
     cgccgcccag aatgccgatg gttttgatgt ccgtcggcgg gcatttgggg aagttcagat    274080
     agctaaggtc aaaggcattg tcgatatgtt ctgaaagtgt gctcatggtg ggctaatctg    274140
     cccgcgaatt cggtgatttg caacttgaga gatccacggg cccgtccttg tatctttcag    274200
     ctgaaataaa tactgtccaa gaatttgaca cagatcaatt cctaggagtt ttcgcaactg    274260
     tttgatagat tccccagcgg cgattcacgc cgttgtaagg ggagtccctg tgttgaattc    274320
     aaagctgttg ctgtcgtcct tgctgctttt gacccttgtt gcctgtacga aaaatgaaaa    274380
     aacaaacaat gtcgaactga ccggttcaga gacctcgatt attggcggcg aaaaggctga    274440
     tgccaatagt ccggtgacgg cctccacggt ttctttgatt tacaactatc agggcaagcc    274500
     ttactccatc tgcacaggca ctttgatttc aaagaatctg gttttgacgg ccgctcattg    274560
     cctggcggag cttcagggcg cagaaatctt cgttcatctg ggggaggttt tgccgacgga    274620
     agtcgatgaa accaaactct tgcgaatagc ggaatttgaa actcacaaag aatatcatct    274680
     ggtttacaat gaacagggct tcccggtgac gggccgcaat gacgtggccc tgatcaagtt    274740
     attactggat gctccggaag gtgcagtgcc ggtgccggtt ctggatgagt ccgtagagct    274800
     gaaagcagga gagaccttgc tgcttgcggg ctatggactg ttgaatgaaa ttgataatcc    274860
     gattccggca acgggcctga acttggtgcg agtgccgctg gcaaaattgt gggaatccat    274920
     tttggtgacg gatcaaacga atgcaaaagg cgcttgttcg ggtgattccg gcggcccggc    274980
     ttacctggaa acttccaaag gccttgttgt tgtgggcatc actcgtgggc cccacgatct    275040
     ggcgccggac tgtcgtcatt tcggtgaata caccaatgct tccatgttca aaacattcat    275100
     cttggaagag gcggctgcca tgggtgctga cgcccctgtc tttacgaccg agcgtcagta    275160
     aattgtccta aagattcgtc tgcagtgtca aaaacacact gcggacttcc cccgggtaca    275220
     gatagatgtg cccgtattga gtcggggatt ccttccagta tctttcatcc gtcagatttt    275280
     cgacggacag acgcacgacg gttttatcat ctttttttcc aaattcataa gaagctccgg    275340
     catcccagcg agtccatgct gacagcatca gggaattatc ggctgtcacc gcacgttcgc    275400
     cctcatagga cacgcgggag tttacggaca atccttgaac cgcagggatc agatagttca    275460
     catgagcccg caaagtgtgc tctggcagat ttgttggacg ctggtcattg acggcagggt    275520
     tcaaattgct gtccagacgg cgggctttca gccacatcgc ggatgccgcc cattgcagtc    275580
     gtccggtctc tccagtcagc tccgcttcaa tgccctggtg gcggctcaga ccatcaatct    275640
     tatagtccgg tcgttgatct tccacctgag gacgctcgat ctgaaaagcg gcaagattcc    275700
     aagttacggt ttcgccaccg cgaacaccga cttcaacctg tttgctgatc acatcaggta    275760
     cgaattgacc tgggttggta taaccactgc ggtttggggt gacataggtt tctacacctt    275820
     caccatagct gacataggtc atccacgccg ggaactgata agacagcgcc agccacggca    275880
     gtacaaagtt ttcgcgataa tcagtggcgc gggaggcatc cgtacgaacg ctgctgcgat    275940
     gaacatcact gaaacgaagt cccagccacg cgccccaggc acccaatttg actgaatcaa    276000
     aggcaaacag ctcgttcact tcagagtctc tgttggtatt ttcatctgtc agggcagggt    276060
     ccgctggaag tttcgccgtg ccttgcacat ttcccacacc caccgggttg taagcctgtt    276120
     tgtcatagcg ttcgcgggac acgtgcccca gatagccgac gttgatgtcg tgggaaatgg    276180
     accctgtttc cgctttgatc tgcagtgagg tctttacagc ttgggtgctg cggcgttcgt    276240
     tttcacttct gaagtcatac atgtcaaatg tgccgtcaga acaatagcgg tcataattgt    276300
     tttcagcaga acacccaaac ggataagcca gacggtcatc ggtgtgcagt tcttgcgcac    276360
     cggcggcggt gtgccagatc aggttctggt tcaaacggtg agtgtacttc aggcttccgg    276420
     tcagccctgt gaaaaccacc ggttgggacc agctttgatt gttcaagttc aaacgcggat    276480
     cagacactga aggcagagca tttcccaaaa gactgaaggc ggcctgagtc ggctgggact    276540
     ttctggacca ttcgatgtca gactcaagca attgagattc ggaaatgcgc cagctgttgg    276600
     ccaaagccaa gacacttcgt tcgcccttgc tgtcttgcac tgcagggctt aagttttcat    276660
     gggctacgtt caggcgatag ccgaactgtt cagaaccttt caccggccct gcggcatcgg    276720
     ccgcgatcag ccagtcgcca taacttccaa cttccgtttc aagcagcagt tggcgacgcg    276780
     cggtcgggcg tttgacgaca tagttgatca tgcctccagg ggagcttgca ccggtttgca    276840
     ggccactcag gcctttcagc acctcaagac gttctttgtt ttccaaagga atggacgtct    276900
     gggcgttgat tggcagtccc tctcgcagga agttggcgcg attatcaagg gtaaatcctc    276960
     gaatggacat atagtcccag tatcctgaag cgttgtagct gtcggtgacc gaggcttcta    277020
     tcaacgtaat atccgacaga cggtgaatgc ggttttcacg cagggtttta tcgctgattt    277080
     gtgaggtcga cagcggcagg ttctgggctg gaacttccgg gaaaccaaag gcctctaaag    277140
     gttcttgagc ctgatcgtcc tgaatggtga tggtgttgat ctctgaggat gcgttttgtg    277200
     cgtgcagacc ctggctggtc agcagaactg tcatggcagt gaggattgat acgtgctttt    277260
     tcatagcctt cctttggcag gtcggcagga cagaaagggg cctttgggat gagccggatc    277320
     tttctattct tgcttccctg cgcgagcatt atctctatca ggttcaaagg gttattctca    277380
     gtcggtgaat tcaccaacac ccctagcgtc aggtcagcgt tatgattgag gaggccgccc    277440
     aggtcaaatt ctttttggaa acagcggagg tcgggcgtta ttttcataaa ttccgcttat    277500
     ttccacgaag ccatgctaag ctttatatat gaatataaat caaagcctgc tttgcgagtt    277560
     cgtcatcaag ggtttggtct cttataaaaa agaattacgc gggcctttct tgcaggattt    277620
     tcggcagcag tttgccagcc tgagtccaga agaagtggca gaggccttta ttgatgtcac    277680
     ctttctgggg tcggctctga cctttctgca gggggagcag tggaacctga aaaaggatcc    277740
     tgataccagc tccgaaaatt atcttcgttt caccgaacag acctttgcct ccaatctttt    277800
     gtctttgaat tatctgcagg aaaccctgca aaccttgaat gcaaaagaac tgcgccagac    277860
     ggccgagctc tgtgaagagc tggagcgtct gctgttgtcc cacgttcagt cagcgagtca    277920
     ggaacagaaa aaccgctttg tggccagagc cctgcagttg atggaaaatg tctttgctca    277980
     tgaaaacacg ctgtcgttgc agggaaacat ccaggctcgt tccctggcgc tttctttgta    278040
     tcgcactttc gacggtctgg atcagatctt tggtttgaac tatgacgccg acgtgggaat    278100
     gaaaactgac gtgaacggca ctgaaagatt gtatgaaggg gcgggccttg gtgtgcagtc    278160
     ttcgtattca acgttgctga cggctttgcg cgaagtgcag gcgtcacaag gaacacgctt    278220
     cattgatctg ggttccggtt atggacgggt gggcctggtg gtgggtgtgc tcaggccgga    278280
     cattgacttt atcgggtacg agtacgtcaa acaccgcgtg gatatttcca acgaatccac    278340
     ggccaagttc ggtttgcagg atcacgtgca ttttttcacg caggatcttt ctgaaaaaga    278400
     cttccgcatc cccgatgccg aggtctatta catgtttgat ccgttcagca aagacaccta    278460
     tcagcatgtc ttgaatcaat tggtggaagt ttcgcgccgt caaagaattg tcgtggtcac    278520
     caagggcaat gcacgattgt ggctgaagga aatcgccgaa cgcgaaggtt ggttgccagg    278580
     tcaggagttt gacggcggca atctgtcgct gttccgttcg cgcgaatagt tactttacaa    278640
     atttgacctg gaacttttga cctttgatgc ggccgtcacg caacttttgc atggcgccgt    278700
     ccgcgacttt cgcagacacc gccacaaaag agatcttgtc ctgaatttca attttgccca    278760
     catctgccga agtcaaacca cccgcagcgc cggtcaaggc ccccagaata tcgccgggac    278820
     gaagtttatc cttgcggcct cccgagatgg agatggtttt catcggagct tctttcaggg    278880
     ttttattcaa accatactga tttttaaagc ccaatgacgg acgggcgaac ttgccgccag    278940
     tcagctcttc gaactggccc agtttcagag tgtctttagg gtgcgcaatc gtgaccgcaa    279000
     cgccggtttt gccagctcgg ccggtgcgac cgatgcggtg aacatagatt tccggggaaa    279060
     gtggcagatc aaagttaata accagttcca ggttgtcgat gtccaggccc cgggccgcca    279120
     cgtcggtggc caccagaatg cggtgggatc cgttgcggaa catcgccatc acgcgatcac    279180
     gttcacgctg ttccatgtct ccatgcaggc agccgctggc ggcacccagg tcattcaggc    279240
     gttctgcaat ttccgccact gcatttttgg tgttgcagaa gatgatagtg gaatccgaag    279300
     gatgctgctg caaaatacgc atcagcacgt tggttttgtc gttgtcttcg ctgtcataaa    279360
     caagttgttc aatcaggttt tgctcttcat cctcgatgat cacctgctgg gcatggcgct    279420
     ggtatttgcg ggaaagatgt tcgatggatt ccgggaaagt ggcggaaaac agaactgtct    279480
     ggcgggaccc tggcagatca cgcatcacag ttttgatttc atcggcaaaa cccatatcca    279540
     gcattttgtc ggcttcatcg agtactacgg tttttaccgc agaaagatca atgcggttac    279600
     ggccgacaaa gtccgccaga cggcctggtg tgccgacaac gatctgcact ccgttttcca    279660
     aagcgtcagc ctgttcacgt ccggattggc ctccggtcat ggccagaact ttcaatcctg    279720
     gaaggcggcg ccccagtttg cggatctctg tgaccacctg gcttgccagc tcgcgggtcg    279780
     ggcacagaat gagggcttgc aacagcggct gatccagatt gattttgttc aggatgggca    279840
     aagaaaaagc ggcggtcttt ccactgccgg ttttggcctg gccgatgatg tcttttcctg    279900
     ccagcagcag cgggatgctt tcctgttgga tgggggtcag tgtctcaaag cccagctcct    279960
     gaaccacagt cagaagttcc ggggacaggg gaagagtaga aaattcattc tgggacacgg    280020
     gcacacctcg gaaaaaatgg aaaacactta ggtaacaggg ggggctttta aagtcgagcc    280080
     ctgaatgaaa atacgaaaaa atgaccgatc ccagatttag gtatcccgac aggctctttt    280140
     gtggcatcaa ttcgccatgg ttcaaatcgg tcagatcaat aaacttaaag tcgtcaaaac    280200
     aatggaatac ggagtctttc tggatggcgg aagtgacggg gaaatcctgt tgcctgcgcg    280260
     ctatcagccg gaaaaatgtg aagtcggtga cgaactggaa gtttttgtct gctttgactc    280320
     tgaagaccgt ctggtggcca tgacggaaat gccgtttgcg atggtgggaa ctttcggttt    280380
     gctgaaagtg aaatccattg agcgtgtggg ggccttcctg gattggggtt tgccgaagga    280440
     tttgttcctg ccattcagtg aacaaacccg tgatttgaag atcggtcaga acgtgctggt    280500
     gtatctgtat ctggataaca cggatcgaat ttcatcttcc atgcgtctgg agcgtttcat    280560
     cgacaaagaa tccgggaatt acgaagccgg gcagagtgtg gatctgttga tcgcagccaa    280620
     aaccgatctg ggatacaagg ccattatcaa tgggcgtcac tggggcatgc tgtatgcgaa    280680
     cgaagtgttt cagcagcttg agtacggtca gcgcctgaaa ggtttcatca agcaagttcg    280740
     tgacgatggg aaaatcgatt tgcgcctgaa cgaagccggt cacaaagcca cggctgacat    280800
     cggtgagcgc atcatggagt tgttgaaatc caaaggcggc ttcctgccaa tcaccgacaa    280860
     aacagatccg gaagccatct atgatctgtt cggagtcagc aaaaagaagt acaaaatggc    280920
     gctgggtggg ctgtataaaa agcgcctgat cacggtccat gacgacggca tccgcctggc    280980
     agttggccgc taaatggccg ccacggggct tcccaagccc cccgataggt ctagacgtct    281040
     tacatggtgg gattttgccc gcaaaaccca ctttgggcct ttaagtcttt gattttacaa    281100
     tattttgttt gtttttgcgc gccgccgccc caagcccggg tgttcgcagc tttcagcgaa    281160
     ataatgctca tttagcctat tctcatttta attgcttccc cttttccgag aaattcgcta    281220
     gaaattctct agcaagaatt tagtctctgg agagttttcg ggcatagggc ccaagacctc    281280
     ttaagagctt cccaaaagca aatcttagga ggtttatatg ggtaaaaaaa tctacgttgg    281340
     aaatctttct tattctttgg atgatcagtc tttggctgac actttcgctg aattcggaaa    281400
     tgttgaatct gcacgcatcg tgatcgatcg tgaaactggt cgttctaaag gtttcgcttt    281460
     cgttgaaatg tctactgacg acgaagcagc aactgcaatc gctaaattga acggcgttga    281520
     gttgatgggt cgcgcgatga acgtatctga agctaaacca atggctcctc gtgagaaccg    281580
     tggtggcttc ggtggcggtc gcggcggtgg cggcggcggt aaccgtggtg gcggcttcgg    281640
     cggcggcaac cgtggtggtc gtttctaatt taagatttta atcttagtga aaagggcgga    281700
     aagaaatttc cgcccttttt ttatttctga attctgtctt ttctgtcgac gcttcagtca    281760
     gcttacactt tccctgtaat tcaccaattc cacatccacg ctaagttccc gatttcagtc    281820
     acctcagcag ttttgattta ttggctctgt ccttgcttta aaaacctgca ggaggacggc    281880
     atgaccacac tgggtattcg tgtctcattt ttgttcttgt ttgctttggc gctggcggcc    281940
     tgtgggggcg gcggtggttc gggcagagta tcgcctgccg ggggtgattc cagcgaccag    282000
     gaatcctctg gagaaagcaa tggctccgag tgtggaacca tggtggacat ggcctgcgaa    282060
     gtccttgtgg cggtcaacca agagcgcacc agtcgcgggc tgaatgcgca gacggccctg    282120
     ccagcctgtg tggccgaagc ccaggcccat gctgatgaca tggtggcgcg aaatttcttc    282180
     gcccatgaca gtccgacgga aagcacctcg cagcgttttg cacggttcgg tctgtcggga    282240
     agttattggg gggaaaacat cgccgccggg tattcaaccg ccgcccaagt gatggcggga    282300
     tggatgagtt ccaccgggca tcgcagtaac atcttaagtt ccaactttcg caccatgggt    282360
     gtggggatcg ctgccaattc acaaggcatg ctccactggg ttcaatgttt ttcgggtaag    282420
     tccgcgctct aaatctggag ccaaaatttc tggcactctt cttgaattga ttctctcatg    282480
     acttccgtta tgaagtcctc tggtggcaaa cgggccccag tgatattccg gggggaatta    282540
     tgatcacaca cactttgttg gcagcttcat tcacctttgt gtctttggcc gcttcggctg    282600
     cggcagcggg atttgtcgaa actgcgggca acgcctgtga atggactccg ggtcgctatg    282660
     aactcagcga aactgaaggc cgggtgcgca tccccaatgg actttacgta aaaaaagaag    282720
     aaaccagcaa gatcgcccgt ggcagttgca cctttgcgtt gactctgaag gccccggccg    282780
     ggaaaaagat tgtcgtgcgt gacagtcagc agttgatcag tctgcgtgct tatccccagc    282840
     aaacccgtgt gaaagcggaa gtcgaaatct tcaaagccgg cagtcagggc gcgaaacaga    282900
     ccctggaaat cgtggcggcg gaaaaagcgg aaaaaacaac ccagtatgtg gggcagaaag    282960
     acgtcttgct tgaaaccgcc tgtggcggct ctgatatcct gcgcggaaac ttgtcagcga    283020
     ctatcattgg tgaaggcaag ggtcgtgcat ttgctaaaaa tgtgaccctc gacattcagg    283080
     aggtggattg caattaagga ttgcaccacg ggcgtggtgt gatgattttt gtgatctcgt    283140
     tggctcgcat gtaaaggaac tccggaccca ccgccaggcg ggcacgctcg cggcgctggg    283200
     atcttgggga caccgtgcga atctgtccat aacccagacc atcggtcgtg gtcgttccag    283260
     tcataccttt taaactccat ttcacagtct tgccagcgat cggtgttacg tccgattccg    283320
     tcaggattgt cgagatggtg ccttcagaat cccggcacag cagacgaaaa tgcaacacca    283380
     cgaagacttc ctggcggcag ttctgcgaac gggaatagcc atagccggca tcacaggtgt    283440
     tgaatgctcg ttctgtaaag cccagctctt ccggggcacg atccagtccc aaaaaagttt    283500
     gcaaagcgac gtagtcgatt cgggatggcg tcgcaacgtc agctgacacg gacaccggag    283560
     gcggagattc tttctttggt gtggtggtgc atccggtaag agcagcaaca agaactgcaa    283620
     aaatccattt catgaaaatc ccctcgcggt ggtgtataac taagcctagg ttaaatctgg    283680
     taaattacaa ggtattctat tttggtgatt cctcaaaacc gccttaacgt attttgatat    283740
     tttcgcggga ggaattctat gtacaaagcc cttagtaaag ctctggtgct gactcttctt    283800
     ggtgcaagct ctgtatctgc gcagcaggac cctgtagcca ttatcattcg caatgccaag    283860
     ggtgaacagg tgggaaatgc gacgctcaca gatgtgacca acgggatgcg tattcagatg    283920
     gaactgcaaa atcttccgcc gggagaaaaa gccttccaca ttcatgaaaa ggggctttgt    283980
     acggctcctg atttcaagtc agccggaggc cactttaatc cggacaaaaa gaagcatggc    284040
     cacaaggtca aaggcggacc ccacgcagga gatttcagca atattgtcgt gaaagaagat    284100
     gggacggcat cagtggatgt ggttaatcct atgttgaccg tccatgcggg gaaaaattcg    284160
     gtgatctcca atgaggggac ctcgattgtg attcatgcca aagcggatga ttataaatcc    284220
     cagcctgcag gcgatgccgg agatcggatc gcctgtggag aaattaaaac tccgccggag    284280
     tcaaagcctg tgatcaagta attacttggc aaaggcgtaa atcaaacttc cgcccttaag    284340
     catgccgatg actttgtcac gcaggtgatt tgccactgcc gggcaacccc agctgcgccc    284400
     ttgaatgaca ctggattctt ttacatagct ggctccatga atcactacag cgcgggcacg    284460
     ggctttggag tttgtgctgg aaagaccatc cagtttcaaa gacaaaccgt gttttccata    284520
     ataggtctct gctgccagat agtaacccaa ggagctggcg ttggaaccgg agttgttgct    284580
     gaacttttca gcgtagccgt cgtggttggc atcagagcct ttgccgtggg ctgtgtgaat    284640
     cgcagtcact tccccagtgg acatgttgat gataaagaag cgggcctgtg tggaacgttt    284700
     gccgaaatcg atcaaggaca tgtatttttt gttcttgatg cgagactgat ttttgtcgaa    284760
     gtaaagaacg gcttctgcca acgctttgga gttgatcatc ctttttggat ccaggtgatc    284820
     atagtttttc agtacggcgg cactttccat cagggtggtg gtgtcttcca aagcggcggg    284880
     ttcggtttct tcggctgtgg ttttgtctgc ggtgttcgtt tcaggaattg tctgctccat    284940
     ctcagtgtcg tccggaagga cttcggcgga gctgtagtct tggcctgcac aggcggtcat    285000
     ggaaagaaaa gcggccaata ccagggattt tttagagata agattcatcg atcctccgtg    285060
     aaagatgctg tgtgttcttc gacagatgct agctgacacg aggtgttcgt cggaaaaatt    285120
     gttactgcga cataattttt aggaccttgt gcgtggggga atctgcaatg gattcggttt    285180
     tttcaattcc tttgttcagt gaacaaacca aagtaagatt gaaaagtcct gctggggctt    285240
     aagatgcagt aagggagcgg gtttgcggtt ttcatctgct gctgaaagag tagtataggg    285300
     gtatgaactc tggatgaatg aaagttagaa ataactgaaa catcaaagag tccaaagagg    285360
     accgtgaacg ggtcaactgg tttgatccct caccaaaagg agcttgaaca atatagttgt    285420
     ttcttagatg aaaaaaatag agtgtgcttt tgagtgactc tgattctatt caaacaagaa    285480
     caatttgttt ttctccagat cctctgtgcc catgtgtttt acacgtgggc attatttttt    285540
     taagagcctg cctttacaat ggacttcatc acacaaagga gtccttatgc atatctgcgg    285600
     ttggtttgaa attcccgtta aagacatggg ccgtgccatg aagttctatg aacagtcctt    285660
     tgatgtctct ttcactttaa gcgagatggg gccggtaaaa atggccatgt ttcccatgaa    285720
     ggaaaaggag ccgggcgcca cgggggcgct ggtgcagggg gctgaataca agccgtcgca    285780
     tgatggctgt cttttgtatt tcactgtgaa cagcattgaa gacagcttga aaaaaataaa    285840
     agacaaaggc ggcaaaaccc tgagcgaaaa gaaaagcatc ggacaatacg gctttatcgc    285900
     aaccttcgaa gacagcgaag gcaacaaagt ggctttacac gccaaacact gattggtggc    285960
     gtcgcacgcc aaattccacc ttattgaaag ccaagtaaga ctgacgacgg tgacacttgc    286020
     aaatcatgag gggcttcagg tagaagtcct tcatgaaaaa actgatgatt tctgcctttg    286080
     tccttttctt gtccctgaat gcaggggctt ctgtttccaa gcttgtctgt gtgccagggt    286140
     atgagccgat gcgtgctgat gctgtgattg aaattgtctt caatcgcacg atcgatcctc    286200
     ttaagcctgt gattggcagt tacaaccttg gtgcggtttt aaaacttcat gataaaatca    286260
     cagggcagac ttacacgcgt tctgatgttg tgtttgttcc agcgacttcc atggatgacg    286320
     tgaatctgcg cgggggcgcg gcgggcatgg tgcacatccg ggtcagcccg gtgatgaaga    286380
     acggtgcatt catgggccgt tataccggag accttttcgt aaacgatctg gattcccgga    286440
     actactacaa tctgaccggc tcggtacaag agccgggaat tgtttgcgaa acccgctaaa    286500
     agctttttag gcagtcttgt tccgggactg ttccattctg cctccatagt ccttttctat    286560
     tcttgaagag gacgaggagg tccttatgat tcaaactctt aaaaaacaaa tgatggcgac    286620
     tctgattctt gcggggctga caacggctca tacaagcttt gctcaggaaa aatcccatga    286680
     agctttgcgg gaggcattcc gtgcctgtca cgatgaactt ggtattgaac agccagagcc    286740
     tggccaaaga ccgcaggccc ccgatgaaga aacccgaaaa aaaattgata cctgtctgaa    286800
     agaaaagggc tttgaagtct ctaagttcgg gcgtggtggc gggcctggca aaggtcgacc    286860
     tgagcgttcc tcggacggcg gtgtgcaata gtcagattga gatcggaagg gactcttgga    286920
     ttttggtgga ctacactgaa tttcaagagt ccagaggaac tttttaggag ggcttgtgaa    286980
     aacactggat agatgctcac tgcgcgtggg ccaggaatta gtgatcaggg aatcagagcg    287040
     cggagatgat ctgcatcgcg gggatcgttt gcgggttgtc ggatttcaga tgctttcaga    287100
     gaccgtcagt cagaacttcc ggattggaag ttccttttac tgggaggggg aggccgtttt    287160
     tacacgcctg tatgtggcgg aacttaacgg cggcatgtat ctggtgtggc cggaggaaac    287220
     caccaacggc cactttgatg tccaatatct gcgttagttg ccgcagactt catccagggt    287280
     gacctggtat ttttccggat tgaagacgcg acccagtttg cctttaatac cgccagaacc    287340
     gcgtcgctcg atttcacagt cttccacttt cgcgaactgt tctgaaatca tgatgcggtg    287400
     aaggctgata cgcaaagtat tcagagctgt ttgcgccttg attttgttcg tcacggaatt    287460
     tgtcaggcca ttggaagcct caagcacatg caacaggtcc gtcatgccca gcttatagcg    287520
     cagaacttca gcatcataga ctttgacaag attcgcgtgg gccagggctg cggcgttgta    287580
     ctgcttttga gcttccatca atgaacccag ggtcacttca atcaggttgg cctgttcaaa    287640
     ttgcagctct tttttgcgca acttcagctg ttcgatgttc aggttgctga tcttcaagtt    287700
     agggaaataa gcaaacccaa agttcacgga accggagtgt tcaagacttc ccattgcgcc    287760
     gttcatgcgg gatgcgccca atgaatgtcc gcccaggaag ctgaaggcct tgctccattt    287820
     gttgtactga gccgaagtga tcatggcagc catttgacgg ctttccgggg acttttcgtg    287880
     gacctgggtc agcagggact gcggggacca gttttcaacc ggcgaaaccg cgaccgcagc    287940
     gtcctcgaaa acaatttcag ttgtcagggg caatcccagc aattcgcgga tcgcagcttt    288000
     ttcctgaaga accagttcgt caacctggga cagctgaacc aaggccatct gggtctgagc    288060
     ctgggcttgc aggtattctt cttcacggat catacccagc tgagccggca ggcgcagttg    288120
     ttcttcgatg gctttcagat tttcgtactg cagactcaag atgccgcgca gttcgatatc    288180
     ccccagaatc gtcatgtaga tggagtaagc ggaggaatag ccgttcagtt gagcgatata    288240
     gtgggacatg ccctgcgctt taagcaggta ggtgttttct ttcaggtcca tccaattgga    288300
     aggcatcagg aaaggcagca ggaaagaaac ggaattcaaa gcgaaagaag gaccactgga    288360
     aatggcgccg cccagattca cggaaggcag caggtttcca cgcgccacat tgacgcgttc    288420
     tttggcctgg tgaacgttgt tcagggaaat cgcgattcca acgttgcggt ccaggaacag    288480
     gcggcgaaga gtgtcgggat tgattttaac ggtggcattg ttttgagccg tggtttttgg    288540
     cgcggcaaag gcggctgatg acgtgacaag agcggccagc agaagagcag caaatacttt    288600
     catgaatccc tccgaaataa accctgaaag atgtattgcc accccgtttc cttgtcaaac    288660
     ggagtgttat tcggactcca aaataggggg gctcaggcgc tttccagggc cttttgccac    288720
     gctgcccctc ggggaaaagt cgtgagcgtc ccaaagcaac ccaagggctt gaatcaagtt    288780
     gatatggata tctgggaaaa ctttaatgct gcagtgcttg tggtaccatg gaaaaaataa    288840
     agaagccgat ttctaggagt agtacgttgg aagatcagaa gtcgtttcag tatagtttta    288900
     accagaaaaa taaaatgctg gtggtgagtt tctctggtga gatcaacacg cctgtgttgc    288960
     cggccctgga ggcctgccgt caggaactgc tggccaagcg cgaggtcagc tgtgtggtcc    289020
     tgtattttca ggatgttgag accatcagtg cggatgcaat tccgtggctt gcgcaggtgc    289080
     aaagagaaat tcgtctgaag cctgcagaaa tccgcctttg ttctttgcgc gaaaacctgc    289140
     gagagcgtct ggtgcgtatg ggtgtcatcc gggggttgga ggttgctgat gatctgaagt    289200
     cagcactttt gtccttcagt cgcgccagct gacgtgctag tgtgggcgca tgaacaacta    289260
     cagctttaaa aaatatcagc cattaagtct gcgtctttgg cactggttca atgctttggt    289320
     gatcctggga ttgctgggaa cggcattcct gcgaaaaact tttttaagct ggcgcaccaa    289380
     tgccgccctg attgaaagca aaatgctcga ggctggaacc tccatcacgc ctgagctggc    289440
     caaagacatc gccgtcggaa ttcgcacgcc gatgtgggac tggcactatg tgctgggttt    289500
     cactctgggg gggctgttga ttgtgcggct gttggtcggc atttttgccg taaagaaatg    289560
     cccggccgcc catgccgcgc aaagtgcttg gaaccttagt aaggttccgg ccggtcagaa    289620
     aactcacgct ctacattata ccttggtcaa aacgggttat gcgctgtttt atctggtcac    289680
     tgtgttcatg gtggtttcgg gtcttgtcat gtatttcaaa aatgatctgg gacttgcaaa    289740
     agaaaccatt gagccggtta aagaaattca cgaactgatg atgtggttct ttgtggcttt    289800
     tgtatccggg catattcttg gggtggtcat tgctgagaat cgccaggaca aggggcttgt    289860
     gtctgatatg attcacggtg gaaccaaaga ttgatttttg gttccccggc tttccgcgcc    289920
     tgatcttact tgcagactga caggccactg acgatttttt tggtccattt gaatttctgc    289980
     ttgcgcccct gagggcgcag aacttcccag tgggaagacc gactgaacaa ttcacctttg    290040
     ccggcaaact gcatatccag cagatgcaaa ccgcatttca acgagctttc cggtttctcg    290100
     ccatcgccgt ttttacagcc gatctcgggc ccgtgcccat ggcggtggtc gctttcgtaa    290160
     gagccttcct tgccgcgatg aagctgcaac aggcctacgg cggtgccgtt gggacctcgg    290220
     gccgtatgtg gacccgcgcc gcaggtgctt tctcccaggg ccatgacatt catgatggcg    290280
     acaaagacca ctttcttttc ttcggggccc agttgcggga atgccgggca aagactgacc    290340
     agatccgggg tcccgtcaaa taagttcgga tattcgcgtt cgttgaggat gttcatcaca    290400
     tgacgaccca acggaccata gccggaatct gttgcaaagt tgctgcagac ttcggcgacc    290460
     ttgcggtcct tctgtttgtt gtaattgtat cgatagatgt ctttataaga ctggtctccg    290520
     cccaccgtgg tgcgcagggc gcggatttga tccacggagc ggtctccgcg atcctcacac    290580
     cccaggcaga cgccgcgaac gccgtcagag cgcaaagtct tgcgtgtctc tgcaatggcc    290640
     ggcagtccca gcgcaaatat gattagtgcc gttaagaatt gtctcataat gtctccgcaa    290700
     cattgcaaag caagcatgat gccggagtct taaaacgaaa agagcagact ctaagagtct    290760
     gctcttgatc agaaatatca caccgtcgtg acaaaactgc gctgtctcag attgagacag    290820
     gaatattact gctcgcggaa ctggcgcttc ggaccacgga agcgtttgat gcccgggtgg    290880
     tcaccacgac gctctggacg gtcggtctct gcgcgctgag ggcgctcaga gcgctcgctg    290940
     cgctccgcgc gggccggacg gtcgctgctg gcggaagcgc ggtaagaacg ttcggaacgc    291000
     tcggcacgtt cagcacgttc gctgcgctca ggacgctcgg ctctttcagg gcgctcagtt    291060
     ctttctgggc ggtcacggaa agccggtctt tcggttcttt ctgcgcgctg ttcgccaccg    291120
     ctgaattcag cacgggcgcc ttcagagcgg aagccacggg caggggcgct ggcgccacgg    291180
     ccaccaccga atggacggcg ggcacggtaa tcatcacggt catcgcgacg gtcgttgcca    291240
     cggccaccac gggtgaagcg gttgtcgttt ggatcgcgtg gcagaagctc acgcggaaca    291300
     cggtcaccca tgtagtcaag catcagatct ttcttcacga acacgttcgg gaagtaagcg    291360
     gcgataaagc gcgccagcag ttcttctttg gaaagttctt tgaagttgat gtcttcagcc    291420
     tggatcagat cctgaatcag gtcggaagcc agctgcagtt gaactgcttc tggatccatg    291480
     gaagtgactt tgtccattac gtctttgatt ttcaggccag ccacttcgtc agcagaaggg    291540
     atcacacctt tggtcaaaac agctttcgtg ttttgcatca cacggcgaag aagagtcagt    291600
     tgctccgggt tcaccagagt gatcgcagtc cctttttgac cattacggcc ggtacgaccg    291660
     atacggtgaa cataggactc agagtcccaa ggcaatgagt gattcacaac gtgggtcagg    291720
     tctttgatat ccagaccacg ggccgcaacg tctgttgcca cgatcacctt tacctgacgc    291780
     tgtttgaatt tcttcaaagt cgcttcacgt tcctgctggg atttgtcgcc gtgcagggaa    291840
     tctgccggga atccacgttg agtcagaacg tccgcaagtt ctgccacttc cattttcgtc    291900
     tggcagaaga tgatgccata gaattccgga agagtttgca gcaggcggcc gatcacttca    291960
     gttttatagg aatttttaac tgtgtagtaa acctgctcga tagtgtcagc agtgccgccc    292020
     actttgttca cagagacagt ttcaggattt tcaagataag tggaagtcaa acgacgaact    292080
     tcagaagaca tggttgcaga gaacaaccaa gtacggcaag ccgcacgaac agagtcggaa    292140
     tcatccggct gagtcgcgga aaggattgtt tccagagctt ctttgaagcc catggaaagc    292200
     atttcgtccg cttcatccag aaccacagtt ttcacgctct gaagtttgat cattttctgt    292260
     tcaaggaagt ccaccagacg gcccggagtc gccacgacga tgtgagcgcc acgtttgatg    292320
     ccgtcgatct gggtgcggta agaagcgcca ccgtagattg ttactacgcg aacgcctttt    292380
     ttcttaccca gcaaagtcag ctgttctgcc acttgcagag ccagctcacg tgtcgggctc    292440
     aaaacaagag cttgagtgtc tttcacagtg ctgtcgatgt tttcaatcag cgggataccg    292500
     aaggccgcgg ttttaccggt gcctgtggat gccagaccga taaagtcatt ggcaccggcc    292560
     agcagaatcg gcaaagcctg acgctggatg ggggttggag tggtgaaacc catgtctgcc    292620
     atcgcagcca tcacgggtgc actcagtcca aagctttcaa aattatctac ggttgtcagt    292680
     ggagtcatta gagacctttc aggtattgga agtggtctca aataaaaaac accatatgtg    292740
     cattgatacc gcactgcttg cggcagatcc aagcccactt caaaaagatg cgccaagata    292800
     gtcgatcttg gcgcgaaaag ctttatatat ttttaatatt tcccagaata atgaactatt    292860
     tgcacaaggg aagagtcttg acgatagcag cgatgttatt gatttgttgg tactttccgc    292920
     cggatttgat caccgcccaa tacacccctg aacttacgac aatgcgacct ttacttttga    292980
     tttggccggc catgatgccg actccgcagt gcagattgat gtagggatcc aaaatggttt    293040
     tctttggatc ggtgggcgcc agattcttgt ccttttgcca gtcgaatttg caatagcggg    293100
     cccattgcac gtcctgatag gaaagctgca aaagcccttc agagtaaacc ttgcctccgg    293160
     tcacggggtc tgtgcccatc gtggtttcgt gcattcgcga aacgggactg taggcgctct    293220
     catatttggc gatggcgaca aagagctggg cccaggcgtt ggcccgctgg ttgttgtcca    293280
     gggtgttgta tttcgggcag aaggtggtga tgtcatctgc gccgggcagc aggctgctcc    293340
     attcgttcag aatcagctcc tgcaggtatt tggaccactc ggttcgctct ggatacttgg    293400
     tgctttccca ggccagggcc tgcatcttat agccgggctc tggttcaggc tctggagccg    293460
     gcgttggagt gggtgtcacg ccggtgtcgg tatcatcccc gggatcggtg ctgccagggt    293520
     cggtgacccc tgcactttgg ttggaatctt ccagactggt gactggaaat tgactggaat    293580
     ttgcacaacc tgtgaacaga acaacgagtg aaatcaaggc ggcggcgatt gtatagtttt    293640
     taactgcagt gtggttcttt gttgcgatca tgtgtaaccc ccgcagagct accagagcaa    293700
     cgtcgggacc atgtgaggcg ggtctgtatt tggcgaagtc cttgatatct cttggggatt    293760
     tggaccagaa aaatcgcgaa tttgggattt tttgtgtaga ctctgagagg tgctaaaaaa    293820
     gaaggcagat tttcccgaaa ttttttgaag ccttcacagt taaaaaaagt tatacgaagg    293880
     acctatgatt catttatcga acatcaccaa gcagcagggt aacaaagtcc tctatcgcaa    293940
     cggatctttc cagatcaatg ccggagagaa aatcggtctg gtcggcccca acggcgccgg    294000
     taaaaccacc atcttccgca tcatcatggg cgaagagggc atcgacggcg gcactatttc    294060
     caaatcagat cgcactgtga tcggctattt ctcccagaac atcgaagaga tgaaaggcaa    294120
     gtccgctctt gaggaagtga agtccgctgt gggtaacatc ggcgatatgc aagtgcgcat    294180
     gcaggaatgt gaagccaagc tggcggatcc ggatctggat ccggatgaga tgatgaagat    294240
     cctggaggtc tacggtgaac tgcagggtga atttgagcgc ctgggtggtt atgacctgga    294300
     atcccgcgcc gcggaaatcc tgaccggtct tggtatcggc ccggatgatt atcaccgtcc    294360
     cagcgaaagc ttctcgggcg gttggaaaat gcgtattgct ctggcaaaaa tcctggcttt    294420
     gaatccagaa gttctgctga tggatgagcc gacgaatcac ttggacgtgg aatccatcgt    294480
     ctggcttgaa gagtggctgg tgaatttcaa aggcgccatc ctgatgacaa gtcacgatcg    294540
     tgacttcatg aaccgcctgg ttggcaagat cgtcgagatc gccaataaaa ccatcacggt    294600
     ctatggtggc aactatgact tctacgaaaa agagcgcgac atccgcaaag aacagctgat    294660
     cgccgcagcc aaacgccagg aagacatgct ggccaaggaa gaggagttta ttgcccgctt    294720
     tgcggcccgt gcctcccacg cagcgcaagt tcagtcccgt gtgaagaaac ttgaaaaaat    294780
     cgaccgtatt gaaattccgg atgaggaagc tgaaatcaag tttgaatggc cggtgcctcc    294840
     gcgtggcggg gacgaggttg tgaaactaga aggcctttcc aaaatctgga aacgtgatga    294900
     cggcaaagaa aaactggttt tctctggagc aaatgcattg gtgaaacgcc tggaccgtat    294960
     tgcggttgtg ggtgtgaacg gcgcgggtaa atccacgctg ttgaaaatca tcgcgggtca    295020
     cgccgatgcc accgaaggca aaatgacttt gggtgcttcc attaatctgg gttatttctc    295080
     tcagaactct ttggacgttc tggatccgaa aatgacgatc gtggacgaag ttcactctcg    295140
     tattccgaat gctggcatgg gcacggtgcg aagcctgttg ggtgctttca aattctcggg    295200
     cgaagaggcc gagaaaaaga tctcgatcct gtcgggtggt gaaaagtccc gcgtggttct    295260
     ggcctgcatt ctggcgcagc cggtgaattt gctgattctg gatgaaccga cgaatcactt    295320
     ggacatcaag tcccgcgaat tgctgctgga tgcgatcaag aacttcccgg gcactgtgat    295380
     gatcgtatcg cacgatcgtc acttcctgcg cgaagtgacc acaagagtat ttgaagtcga    295440
     taagaaccag attcgcatct acgacggcga ctacgaatac tatcagctta aaaaacaaca    295500
     agagcagatg gcttaatgcc tggacaaacc ctggatctga aaagtttcaa aatcccgctg    295560
     ggaaaacttt ccccgcttga aacttttcgc acgcgccagg gggatgtcct gtcttatcgc    295620
     ctgtaccccg catggtcaga caacctgatt gtcctgtatc acggggtggg cagtgacagc    295680
     cggtacatgt gtgtgctggc caccgccatg gcccaggccg gactgggcac cgtggtgacc    295740
     ccggatctgc gcggtcacgg tgccagcctg aatgcggccg atccgcagtc acagcatcaa    295800
     ttcgaaatcg atcttgaaga gcttatcatc cacatcaaaa tgacccgcgc ggtttcccgc    295860
     gtgatgctgg ccgggcactc gttgggtggc ggttttgtgt tgcgtgtggc agtgtctgat    295920
     attcgcaggc aatttgccag attcctggcg atctcgccgt acctgcctcc cagcctgaat    295980
     gttttccgtg aggactttgg cgggtggatt tcacctgatg gcaacggtgg ttttaaagtt    296040
     aacatgcctg ttgaatttgt ctctggccag gaaaagctga cttacagtgc ggcttatctg    296100
     gccgccgtga ctccgtcgaa aaacatcctg gcggaccttc agaagttgca gccgccggtg    296160
     caggttgtgg tggccgagct ggatgaactt attattccgc agcgccaggt gcagctgttc    296220
     actgacgctg gagcgaacat ccgcgtggtg aaggacttga atcacctcac gattgtctcg    296280
     aaaccggatg tctggctgcc agaaatttca ctttgagtcg tgaaaattac gattgatccc    296340
     ccaggtgggg aatttactct aaaccgcttt agctctatca atgtcctgcc gaaaagttat    296400
     acgaaataac caaaataatt gaacgtaggt ggtggttatg aatacggagc ttggcgcatt    296460
     tgcgctcagg caggtgcttg cctcaacagc agttcttggg ccgatcttaa tcctgatcgg    296520
     actctgctac ttcctcttta accaaagcag aagaagcgtg accttataca taggcacggg    296580
     gttgattctg accgtcatag gagtcacctg tttgtactcc gaacttcgaa gcgaagattc    296640
     gcgggctcac catgaagcag ccatcgaaca ggtcgaagtc atcgcggagg aagctgttcg    296700
     gaagtagctt ctgaattgct tggtccgttt tggcgcgggg atttgctggc gaacttggcc    296760
     agtcccagcg ctacggggga cgccgtccgg gctcagttgt cgttcggccc gccgggccga    296820
     atgcgcgcca tccaggcgcc gacaaagccc ccttcgcgct ggcactgtcc aagctcacca    296880
     gcaaacttgc gttgtcccaa tcaattcaga aacaacttcc gaaaatccca tcacaaagac    296940
     atcggttcca aagggcatcg tcgtgcacct gcgcagttaa gaacacattg atagttatta    297000
     gctatttccg actggaacaa tttggatggg gacttgaggg agcccgacgc agcggtcttt    297060
     gccggcgcct ggatggtgta ccgcggaggc gggatccctc aagaccccag ccaaaccccg    297120
     cgccacccgg caacgaacaa acccacaatc agtgagtttt aatttctgtc caagagtctt    297180
     cgaagagttt gtttttttcg ccttggtctt ggattcgttc cagcttcttt agagtggctt    297240
     catccgggaa cagggcgcgg ttgttttgca gttcttttgg cagggcggct ttggtgtttt    297300
     tcaggaccgg gcctcccaag attgttttta cgcggttgat ctctgcctgt tcgcttagca    297360
     ggaagttgat cagcttgtgg gcggcttcgg ggtgtttggc gcctttgatg atgaccaggt    297420
     tgtcgatggc gaatgttccg ccctcttccg ggatgatgta ttcgattttg ccaggggact    297480
     tgtctgctgc ttgaagggcg tcagaggaat aggtctgggc cgcggcgact tctttgttgt    297540
     tcaggatgtc gatggtgtcg gacgcaaaca tctttacgtt cttttttgct ttcagcaacg    297600
     tggccttggc cttgttgatt tcttccgggt tggtgctgtt cacgctgaag ccgttcattt    297660
     tcagtgcggc acccagggtt tcgcgcacgt catccaaaag ggcgaatttg cctttcagtt    297720
     gcggattttc cagaaggtct ttccagcttt tgatcgggcc tttgtaaagg tcgcgattga    297780
     cggcgatgcc tgcggttgtc caaatgtaag gcaaagagaa cttgttctct ggatcgtagt    297840
     tctgtttcag gaactgagga tcaatcagag ttttgtttga aatctgatct gggttcagtg    297900
     cttccagcag attcatcttg gacatgactt cgaccatata gtccgaaggc acggccacgt    297960
     cgatgcccga agagcccatt tgcaccttgg ccagcaattc ttcattcgag gaatagttgg    298020
     aaatattgat cttgatgccg gtttctttct cgaactgagc ctgcagttcc ggagagatat    298080
     aattgcccca gatggacagg ttgacttctt tggcttcaga aacttcagca gacttctttg    298140
     tacatcccgc cagcagccca caaagagcca ggccgaccat caatattctc gacatttttt    298200
     tatttccttc ttattgttag aagcatgttg gaacttctga atatcggcaa gagtttttcc    298260
     agtcaaacgg ccctgaaggg aatcaacctt tccattgggg aaggggagtt cttttccctg    298320
     ttgggtccca gcggctgtgg aaaaacaaca cttcttcgca tcattgccgg tcttgaaagt    298380
     gccacttccg gtcaaattct gctggatggt cagcgcgtgg atcatcttcc tgctcaaaaa    298440
     cgtcccttta acatggtctt tcagcgctat gctctttttc cgcacatgac ggtgggggaa    298500
     aatatcgcct atggtctgcg cctgaagggg ttggggaaag accagatcga ggccaaggtg    298560
     gcagaagtcc tggccttggt ggatatgggc gagttccggg accgcaagcc tgaaactttg    298620
     tccggcggtc agtcgcagcg tgtggctgtg gcccgcgcct tggtgaatga accccgtgtg    298680
     cttttgctgg atgagccttt gtcggcgctg gattaccgca tgcgtgagca catgcaaaaa    298740
     gagctgcgcg ctttgcaaca aaagctgggt ctgacattta tctgtgtgac tcacgatcag    298800
     gaagaagctc tggcgctgtc agatcgtatc ggtatcatga gtcgcggggt tttggaacag    298860
     gtcagctctc cgcgtgagat ttatgagaat ccggaaacga tcttcgcctc tcagtttgta    298920
     gaatccacca gtctgctgcg tggtgagttg gtggaggtca gtcaggatct ggccaccatc    298980
     cgtctgggag atggcagcct tatcaaaggt aaaatcaatg tcccaccgga tcagatccgc    299040
     ctggggatga gcattgaagc ctacgtccgt cgcgccatgg tctttggcga gcgtgaaaag    299100
     tgaaattacg agatctgttc cttctgccgg tgggattgtg gtttgtggtc tttgtcctgc    299160
     tgccacttat tatcgtcgct gtggtgagtt ttgccacgcg gggaacctat ggtggtgtgg    299220
     agtggtcgtg gacccttgcc aactatgtac gggctttttc gccgacctat ctgggaattt    299280
     ttgctgaaag tttcaagctg gctttgatca ccaccggggt ctgtctggtt ctgggcgttc    299340
     tggtgtcctg ggccatggcg acggcatcca cgcgtttgcg tcagctttat ctgatggctg    299400
     tggtgctgcc gtttttgacc aatctggtga ttcgtatcta tgccatccgg ctttttgttg    299460
     gtgccgacgg tccgctgcag gcggggttga cattattggg agttcccttt gattccttcg    299520
     cgctgacgca gaacaagtgg ctggtgcttt acggaatggt cacgacttat ctgccattca    299580
     tggtgctgcc gttgtacggg gcttttgaaa agtttgattt ttccttggtg gaagcggctc    299640
     aggatctggg cgccgggatc tggaagattc ttttcacagt gattttaccc aaccttaaga    299700
     aagctctgtg ggcgggggct ttgctggtgt tcattccttc tttgggtgaa tacgtgatac    299760
     cggatcttct ggggggcgct aaaaacatgc tttatggaaa tctgatcacc gaacagtttt    299820
     tgaaagcccg cgactggccc tttggggcgg cattgtcggt gctgatgatg ctgcttttgc    299880
     tggtgatggc gctggtgttc agaatgtggg aggcgcgccg tgcccgtggt tgaacgaagc    299940
     cgtcctcagg cgcccatgtt tgcgaaagtc gttctgtgga taacactgct tttgctgcac    300000
     actccgattc tggtgatgat tctgggcgct ttgattgaaa agaaaccgga ttcctggagc    300060
     tggacactgc gctggttctc cgaagtcgtg aatgatcagg ccctgatgga cgccttgaaa    300120
     aacagtctgc tggtgggtgt agcggcaagt ctgctttcaa ccgtgattgg caccagtgca    300180
     gctgtggggt tgcaccgttc ggccggcggc tggcgttggg cggtcgaggg gttgtccgtg    300240
     gtttcgctgg ttttccctga gattgttttt gccttgtcgc tgttgtcgtt gtttttcatt    300300
     ttacagtttg agctgggtct gatgactgtg gtgatttccc acgtcagctt cagcatctcc    300360
     tatgtgatga tcacggtcgg ggcccggctg gcgacgctgg atcgcagttt tgaggatgcc    300420
     gcccgggatc tgggggcttc agagtggcag acctatcgtt cggtggtgct gccattgctg    300480
     gggccttcga tcgtcggtgg tggggcgtta agttttctgc tttcctttga tgatttcctg    300540
     atcacgtact ttgtgaatgg cgtggggcag gacacgctgc cagtcaaact ttacacggcg    300600
     atgaagctgg gggtcagccc caaactcaat gcgctttcca gtctgatgtt tgttatgact    300660
     ttgctggcgc tgattttctt cttccgttct tccgcgttcc gtgttttctt tgaagcgcgg    300720
     gggaagcatg aatccaaatc agaaaaagaa aatccttagc tgggcttttt atgactgggc    300780
     caacagtggt tatgccacga cggtcatggc tgcatttttc ccggtctttc tgaagcaata    300840
     ttggagcgtc ggcactgacg ctgtcgtgac cacggcccgc ctgggcgtca ctatttccgt    300900
     ttcaagtctg gctattgcct tgatgagccc cactttgggc gttatcgcgg acatgaaggg    300960
     ctacaagaag ctcttttgca tgctcttcac tttgattggt gttgtgggct gtgcgtggat    301020
     ggggttcatt ccgcaagggg actgggtcag tgctctgtgg gcttatggta tcacactggc    301080
     ggcgtttaat gcggccagtg ttttttatga ttcgcttctt ccttacgtgg cggaacacaa    301140
     gtacatggac tttgcttcgt cgctgggata ctcgctgggg tatctgggcg gcggggtgct    301200
     gttgctgctg aatgtgctga tggcgcttta tcctcttagt tttgggatcc cggatgcgac    301260
     tgtggccacc aaactttcgt tcatgattgt ttcggtgtgg tggctggcgt tttcccttcc    301320
     gctgatgaag aacgtgcctg aaccggaagc ggaaagatcc gtgaaaggcc ttggaacctt    301380
     gacgctggaa agcctgcgca cactgaaagg cactctgaaa gccctgatga aggaacgcaa    301440
     cctgtttatg ttcatggtgg cttactggct ttacatcgac ggcgtctaca ccgtgatgac    301500
     catggcggtg gattacggaa tttcgatcgg ttttgaatcc aaggatttga ttgctgccct    301560
     tttgatcacg cagtttattg gattcccttg tgcttatttc ttcgggactt tgaccaaacg    301620
     ctggggggcg aagatgccca ttctggtttg tatcgtggtg tatggggtga ccgtgattgc    301680
     cgccacccag atgaagacgg cgacgcattt ctatttgctg gcgacggtga taggactggt    301740
     gcagggtggg gtgcaatcgc tcagccgttc catgtttggc cgtatgatcc ccaaagaggc    301800
     cagtggagag tattttggtt tgtttaacct tgtgggccgt tttgcctcga tcctgggtcc    301860
     actgctggtg gctgcggggg cgatgcttag cggaagttca cggtggggca tggtgggatt    301920
     gttgatccta ttcgtttctg gcggtattct gctggcgatg gtgaaagagc ctcgcgaagc    301980
     ctaatccttt ttaccgaggc cccaaaaagg ggtggacttt gacgggggtt cgctggataa    302040
     ccctccgata tgacttacaa tccccgtgat cactacttca gaaaagcaaa gcaggaaaac    302100
     tttgcggctc gttccgtctt caaacttgaa gagatcgacc agaaatttaa aatgttcaag    302160
     cccggccagg tggtgcttga tctgggggct tctccgggat cctggtcgca gtatgcttcc    302220
     aagatggctg gtgaaaaggg ccgtgtcctg ggcgtggatc tgagcccggt caccgtgaag    302280
     ttgaagaacg cggttttcat tcaggccgat cttcgtgatt tgaatctgga agacatcttc    302340
     aaagaacatg gcttcgtacc tccgtttgac atcgtgatgt cagacatggc accaaagacc    302400
     accggcattc gcatgaccga tcaggccaga tccatggaac tttgtgaact ggctctggat    302460
     gtcgctcgtc gtttcctgaa aaaagacggg catttcgtgt gcaagctctt ccacagtgat    302520
     gacttcggaa agcttcgtga tgagatgaaa aagaccttcg ccaaagtgga ggcggtgaag    302580
     ccggattcca cccgcaagat ttccaaagaa atcttcctcg taggccttag taaaaaatga    302640
     ttcagatcgt atttgagaat actcacttta tcatctgtga caaacccgcg ggtgtgcttt    302700
     ccacacccag ccgctttgaa gaggatgacg cccgtctgtg tctgggcaca gccctgcaga    302760
     aggaaaaagg ttttcaaatc ttccccgtga accgtctgga tttcgaggtg tcagggctgg    302820
     ttgtctatgc caaaaccgca gaagcccatc gtaaagccaa tgcctggttt gaacacaaga    302880
     ccgtcaaaaa gacttatcgc gctttgacca ccgggcagag ctatgcgcac atcccggcca    302940
     acgtgcccaa tgaaaaactg aaactcacac ctgaagtggg gaacaccttc gagtggcgct    303000
     gtcggctgtt gcgcggaaag cgccgggcgt atgaaagccc tcagggcaag gaatgcctga    303060
     ctgtcgcggt tttccggggc atgcagggcg attatcaggt ctgggatctg aatcctgtca    303120
     ctggacgttc gcaccaattg cgttttgatt taagtcgtca tggttttccg atagtgggcg    303180
     ataaacttta tggatcaact gtggagcttg cagacaatcg catcgctctt cgctcataca    303240
     gaattgactt tgcgaacgca aatggagcct cagctctagg cttgccggag tttctcgaga    303300
     tctcatcact gtaggttctg tttggctttg caaaatgtca tgtatggcaa tgcatataaa    303360
     aatcgtttgc acgatctcag cgaatagttc ttaattgttt tcatgagtaa tacttattcc    303420
     gagtacaggt ccgaggtggg tgaagtcatg gactatatcc gccatatctt caaagccctt    303480
     cgtgtttctt ccagtcagtt tgagaaagat ctaggtttga gtgccgcaca gatttttgtg    303540
     atgaagaaac tcaaagaaga gccagggctt tcgatcaatg acctggcttt gcggaccacc    303600
     acccaccaaa gctccgtttc tgtggtggtc aaaaagctcg aagagcaagg tcttgtatcc    303660
     cgcatgatct cgaaagaaga ctcccgcaaa gtggttgtat cgctcactcc ctccggtctg    303720
     gaaaaactca gcgaaatccc ccgcacagtt caagaacaca tgatcgaaac tcttcagaat    303780
     atgccgccgg aaaaaaccgc atcgctggct gaattgatgc gtgaatttgt caccgaagcg    303840
     ggaatcgtgg agtcagtgcc cgcgcccatg tttggcgagg acagcggtcg ttagatttcc    303900
     cttttgatct gatccagata agttctgatg aaggcgacac gatgttcgcc ttcttttttt    303960
     gctgtcggtg tgttcaggtg ttccaccagt ttgaacagtt tcgaaaagaa atgatcaatg    304020
     ccgtaacttt tgtcatccag ctctcgggat tcggcccagg ggtcttcctc ggcatagaag    304080
     gggcggctca tctgtgtgga cacggcaaag cagcgggcga tgccaatggc gcccaggctg    304140
     tccaggcggt cggcatcctg gatgatgcgg gcctcgaggg tttcaggttt gatacccgca    304200
     ctatagctgt gcgcctctat ggcgtggcgg atgtcttcga agaattcttc cggatagttc    304260
     actgacttca ggtattcaat cgtcgcttca gctgacaatt tcgaagcata gggccggcgg    304320
     ggatcattct ttgggacatt gataaagtca tgaaagaagg ccgcaggcat gacgacttcc    304380
     cagcgggcct tttccgcctg gcacagctgc ttggcggtgt tcaccacgcg catgatatga    304440
     agatagtcat gcgccgggtc cgagctcggg taaagaaccc gggccttgtt gctgaacatg    304500
     tggtaccagt gcttttcctg aaatgcgctc atggcttcaa tttaagctag ggttcgatga    304560
     ctctcaccat gggaccggtg agtttgtcaa aatacgctgt taaaggctga tccgagaagc    304620
     catcgacatg atcgaaggtc acatagccat atccttggtt gccccatttc gggccccacg    304680
     agttcttaaa cataaacact ttttgttcgt cgtcatagcc aacgatcagg acggcatggc    304740
     caccacagct gattttgcca ctgtcacagt cggcgttgat ctgcgggctg aaagtgaagg    304800
     tgcctttttg atcgttgatg tgggacaggg acactttcaa ggtcacaacc acgggacgct    304860
     tggcatccag ttcctgcatg aaaatttcgg accacggctt gcgcacccac atctgtgtga    304920
     ggattttcgt gcgcaggctg cgatagtcga cactggaaac cttttgttgg cgcagatcaa    304980
     agaagctggt ttgttccggg gtgaagggct tagtgaaatc caggctgctt tcctgataag    305040
     gaagatcctt ttcctgatag aatctgctgc cgtttgagaa attcaaaagc aactgatagg    305100
     tgttgccgaa ctccacttcg gggcgccacg gagaaagcac cttgtgccgg aagatttcgt    305160
     actcttccga aatatcataa tcctggccgt tgaaggattt gatggtggat tcaatcaatg    305220
     ctgacacagc aaaataggca caagtatcgc ggctcttttg atctttaact tcggtttgga    305280
     gagggcgaag gtccacctgt ttggccaggg ccatttccaa gaagaacgag cacaacaggc    305340
     ccacagccag aataagacgg gtcagcagca acttcacaaa acactccact gtttaaaaag    305400
     cattcaatct ttaaagacaa agcaagctcc ttgccacctg aaatgcttca ccatgcaggt    305460
     ggggcgggga cgggggcttg gatcgagtaa aaacaacagg attcgcttct ctttagacag    305520
     gggtttcggg gctgaatcag atgcggcttt gtccctgctt ttactggtat gggagccaaa    305580
     ataggttgaa tattttcacg gtcaatatca tgctgttccg aactcaattt tgaacgtatg    305640
     ggcagtgagt atgtaccgtc tttttctttt tttgtgtgtt tttactttgg cagtgggggc    305700
     gcgtggcgaa aagatcgtct tcgcctctta tgatgacatt cctccgaaaa tttaccggga    305760
     aggggccgag ctgaaaggca cctatattga aatcatccgt gaagtctgca aacgcatgaa    305820
     ggtcgagccg gtctttgaaa cctatccatg gccgcgggcc gtgatgatgg ctgaaaccgg    305880
     caaggtcgat gccctgtttc cgccatttga aacagaagag cgcaggaagg tgttccactt    305940
     cccaaatgaa cccgtcagtc agacacgcaa tctggctttt gccctgaaaa aaaggaaagt    306000
     cagggtcaaa ggattggagg acttcaaagg tctgacggtg ggggtgaatg atcgttattc    306060
     ctatgggccc tcctttgatg agttcaaaaa acagctgcgc ctggatcaca gcacgacaca    306120
     ggaaatgctg gtcaaaaagc tcaaagctga caatatcaag cgggtcgatg tggttgtggc    306180
     ctcggaagaa gctttttggt tcttggccaa gcgcttggga tataaggacg aatttgagca    306240
     ggtgtttgtg gtttcagaaa atccgtctta cgttgtgttt tccaaagccg cgggcaaaga    306300
     tcgcgcgcaa ctggcagagc gttttaacac cacccttttg cagttgaaaa aagagggcgt    306360
     gacaaaaaag atcttcgacc gatatctgaa gtgattcagt ccggctctgg catgttgatc    306420
     agattgtttt tccagggggc gggttcccac aattcaatgc gcagtccttg cgggtcatga    306480
     atccacgcaa acgatccaaa atcgttttca accacctgtt cttcaatttg aatccctttg    306540
     tcagccagct cattcagcag cactttaaga ccgtccacgc gaaaccgcag gtccgatgtt    306600
     ttagcggaag gcgtaaagtc ccgcgtgtcg atatcacggg tgctgtcagt gatatgactt    306660
     cctaatgtgg aacgatgcca gtccgaaatt cgctgttttt gaaattcatg tgccatggag    306720
     ttattctggc caaagggacg cagacccgca atattggcga gcctggctgt gcaatcatgc    306780
     aggtactagc ggctggcggg ctggcgcaaa gacttgcacc agtccggatg gcttttggtg    306840
     ccgccatcat aggcataggc caggttgttc tttagcagga tgtccgccaa agatctgccg    306900
     tcaaccatga cgtccgccag aatgcggaag tatttgtcgc gctgaacatt gtgcagttcg    306960
     acgttcttgg cgcttttcag ggtgctggcc acaaggttgc gggcaatgcg cccggcttcc    307020
     ttttcacatt tgtttttcgt tttcacttca ggagtgtcga tgccggacac acgcacgctg    307080
     atttttttac cgataagcgc cgggacgttg ggaatattca cagtcaaggt gtcaccgtca    307140
     taattcttca gcacctccac acagcggaag gtcttttcat catgttcaca agaggctttg    307200
     atggtcgcga cctcgcgggc ttgaagacgt tcagagcagg cggtgatcat caggggcagc    307260
     agcagaatca atgcaggttt caacatacgc ccagtgtagc gtcatttggt gactgcgagc    307320
     aactattcca gattcagtcc cgcctgaagg tttgaaatgc gagtctggga acggattttc    307380
     tttgaaagct ggcggtcctt gatgccactt ttcaccaggg catttttaat ttcctgcggt    307440
     gccagggttt cccaagggcg gttcagcatc aaagaggcgg ccaggccact gacccaggcg    307500
     gtggcctggg aggtgccgct catgtatccg tactttccac cgggaagggc ggaaaacaca    307560
     ttctttcccg gagcagcgat gtccaccgag cccgtgccga agttgctcga ggccaacagg    307620
     cgcctttgtg aatccatggc ggccacggaa atgatgttgt tcagtttgta tcccgcgggg    307680
     taatagccca ccaggtcggt gttgcgccct tcgttgccgg cggcagcgac aaatagaatg    307740
     ccctgttcct gggcgtcgcg aatggctgcc tcttccatgg ggcttctttc gtcgccaccg    307800
     ccggaatagt tgataatatc cgctttcatc tttgtggcat aacgaatggc cttcacagta    307860
     ttcataaggt tgtcgtttgc cggaatcgac ggatcatagt acttcaaaat catgaacttc    307920
     acgcgcgacg aacgggtgcg ctgctggatg atgcccgcca cgtgggtccc gtgaccgtgg    307980
     ttgtcggtca ggtcattgtt gttggaaaca aagttccatc catggaggtc atcggcatat    308040
     ccattgccat catcatcttt catattgtct ttttcgcggg ggttcaccca caggttgtcg    308100
     cgaagcagtg gatggttcac atccacgccg gtgtcgatga tcgcgaccac aatatccttt    308160
     tctgaattct cttgagagta tgaattcatc gaggccccca gaactgtagt gattaaaaac    308220
     agaattgctt tcatgctgaa gtgctaaagc aagcatgaag ccaacacggg gagtgggttg    308280
     aatgtatctg aaccggaaat tcactgcggg tgttcagaaa tctctgaaca taaaaaaagc    308340
     ccgaacgatt gttcaggctt ttgtagtcac catagttcta tagacaactg tctaaaagtt    308400
     ggacagtgcc tcaggccaca cgtttgatct gggaaccctt ggacacagtg tatttgttgc    308460
     gtcccgtctg cttggattcg tacagcgctt catcagcgcg cttatataag gcgtccgctt    308520
     tttcgcccgg catcacttcg gcgataccca gggacacggt gaagcggatt tcaaactttt    308580
     cgtgaacaaa gacttctttg cggatgcggt tcatggcttc ttcggccatg cgcacagctg    308640
     cctgggcatc acagcctggc aagatcaccg cgaactcttc accgcccagg cgggcaatga    308700
     aatcctcttc gcgagagaag ctttcctgga tcaggcgcac gcattcctgc aggacaaagt    308760
     cgccaatgtc atgtccataa gagtcattga tcttcttgaa gaagtcgatg tccatgataa    308820
     tcaaggtcat cggatctttg tcgatttcat gcaactgcag gtaacggcgg atttgctcgt    308880
     catagcttct gcggttgtga gccccggtca gatggtcttt tctcatggtg gtgttggcct    308940
     ccataagctg ttttttgacc gtggtcagat tctttttgat cgcctccata cgtttggagc    309000
     ggcgttcgtt gtgggtgctt tgatgcttca gatagaagtt gatgaactcg cgggatttgg    309060
     cccgcaggtc ttcgatagag ttggactcca cggcctcacg cagttgttcc aggctctggt    309120
     tgatgtcgcc gctggcggaa gcctcggcgt cgacctcttc gctgagatga tcggcgaatt    309180
     cccagatgat gcgtttgaaa tcatcaaagg tgttttgcac atagctgtat tcatcaatgc    309240
     gatagctgga aataaactga cgtatttcaa acagcacacg ctcggtgtcg gcatgatcct    309300
     gcttcactaa tgatttagag aagttatcca gcttgttgcg cactttgcgc accgaatggt    309360
     tttggatttc aaaaaggtgt ttgttcatga cgtcgaggat aaagagcagt gtcgcacgct    309420
     cttcgctcat ggcaggaaca tccttggctt tttcagtgcc actgttcgag ccccagtcca    309480
     tgtcaaactg atcaactagt tttttcaccc actgtttcaa gtcagcctcc tggccacgga    309540
     tacaacactt tattatcgga cttattgggc tttgtttgaa gatggttggg gtgatttttg    309600
     cgggggctgt ttcaccttga gacactgaga aatacattta attctattta cattgcaact    309660
     gtgttgcttt ttagcatttt cgtcgaggtc ctgctccagc ctgaagcgga aaattactat    309720
     gatatgccca ttcaaaggag tgtctgatgg gaaccagtgc tgaattgaaa ggaccgaatt    309780
     tatccaaggg agtggatctc agcgagctgc gtgaagataa aagtctgctg ggctatgtcg    309840
     gggaagagcc ggtgattctg gttcgccatg atgaagagta ctttgccatc ggtgcgacct    309900
     gttcacacta tggcggtcct ctggctgatg gactggtggt cggagaaact gtgcactgtc    309960
     catggcacca tgcctgtttt gatctgcgca cgggggaggc attgaaggct ccggctttga    310020
     atcctgtttc ggcctacaat gtggaagtgc gcggaagcaa ggtctttgtc accagcaaaa    310080
     aagaaagcac ggtgcggccg cgggagtgga gtgaatcgca gaggtacgtc atcgtgggtt    310140
     ccggagctgc ggggaccgcc gcggcaatca tgctgcgcaa acagggtttt atcggttcca    310200
     tcactattgt cagcgaagac aagtcgttgc cttatgaccg tccgaatctg tcgaaggact    310260
     atctggcggg gaatatcccg gaagactggg tgcctttgga gaccgaggaa ttctatcaga    310320
     ctcacaaaat tcactttgaa ctttcaacga aggcggaaaa ggtcgatgct cacaggcgca    310380
     gtgtgttcct gtcgaatgga aaaactttgc gctatgaccg actgttgctg gcgacaggtg    310440
     gggaaccgat ccacccgccg attccgggca tcaagcagga tcacgtgttt tatctgcgca    310500
     ccctgcagga ctgccagcgc attatcggtc gcacatcctg ggcgcaaaaa gtggtgattg    310560
     tgggggccgg atttatcggc cttgaggtgg cggcagccct tcgccagcgc aatctggaag    310620
     tgcatgtggt ggcaccggaa gagatgccct tgttgaaagt tgtcggcgtc catgttggaa    310680
     gtgtgctgca caaactgcat gaagaacacg gggtgatctt ccatctgggg cacacgatca    310740
     aagaaatccg tcagcgcagt gttctgctgg atgacgggca cagtgtggac tgtgactttg    310800
     tgatagtggg cacgggaatt caccctaaca ctcaattggc tgaacaggcg ggttgctggg    310860
     tcgaaaatgg ggtgctggtg aatgaatatc ttgaaaccag tgtgcctggc atttttgcgg    310920
     cgggggacat tgccagatgg ccagaccctc acagtcagcg ctccatccgg gtggaacact    310980
     gggaggtcgc cgaacgccaa gggcaaacgg cggcattgaa catgatgggg gaccggataa    311040
     agttccagga tgtgccgttc ttctggacac agcactatga tttgagcttg ggatacgtcg    311100
     gacactcaga tcgctttgat agaatggatg tgatggggga tcttaacagc agagatttcg    311160
     ctgtggccta ttatgaagat caaaaagtgg ctgcagtact gacgctgggc cgtgatcggg    311220
     aaagcctttt ggtcgaagag gcgatcggcc agtacgatga gaagaagatc cacgagatct    311280
     tccatcaaca cgaacgtgat catcatccct aaagcagaaa cccccggaaa gatccggggg    311340
     tgtttgattg actagtgtgc agtggcggac ggggaacgaa gttcgtggaa gtcgatttct    311400
     aaagaaatct cagccttgag cactttggaa accgggcagt tgaccttggc atcctgggcg    311460
     atggtttcaa aaagtttccg gtcaatgccc ggaaccagcg cacgcagctt cagtttggaa    311520
     gactgaataa caaagccgtc gccagatttt tccaaggtca cagttgcaga gacatccaat    311580
     gactccgcat tgaatccttt tttagcaagg gctccggaaa gagccatagc gaaacaccca    311640
     gagtgagccg cgccaatcag ttcctcgggg ttggttccca tgccattttc aaagcggtcg    311700
     gaaaatgaat agggaagatt tttaagagcg ccactttccg tagacagttc gccgctgcca    311760
     ttttgaagat ttccctgcca gtgagctgaa cctttgcgtt gcattgcaac ctcctttgtt    311820
     cgtggaaagc ataagatgtt gaatcggctt tcgcctagca ctccgacaaa atgcattttt    311880
     gcgaatgcta ggtgacagaa ggatgcctgc cgcgcatagt gagtctatga acaaaacaaa    311940
     aatagcaaaa attgcgtttc cgatagcggc acttttgtgc tttttccctt ttgtctcttc    312000
     agcggccgcc ctggttctgg gaatcgtatt agccgtggcc ctggggaacc catatgtcga    312060
     caaaacccgc agctacactc atcatctgct aagtctttct gtgatcggcc tgggggccgg    312120
     gatggatttg atggtggtgg gtcgagtggg tttgcaaggc atcggttaca ccgtggtggg    312180
     catatcgttc actctgctgc tgggaatgtt gatcgggcgt atgcttaaga tcgaacggga    312240
     tacttctaca ttgatcacag tgggcactgc gatctgtggt ggcagtgcca ttgcggcggt    312300
     ggctcctaca atccgcgcca aatctcatga agtgtcggtg gctttgggaa cagtgtttat    312360
     gttgaacgcc tgtgctctgg tgatttttcc ttggattgga catctgctaa atctgacaca    312420
     aacccagttc ggcctttgga gtgcgctggc aattcacgac acaagttcgg tggtgggctc    312480
     cacactgcaa tacggtcctg aatctttgca ggtgggaaca acagttaaac ttgcgcgcgc    312540
     attgtggatt gttccggtga ccttcctgat tggtttgttc tatttccgcg gtcaaaaagt    312600
     ggagggcgga gccggcaaag caaagaagcc atggttcatt ctgggctttt tgattgcagc    312660
     ggctttggtg acttggattc cggaacttcg cccggtgggc catgtggttg aaaccgtggc    312720
     aaagcgcgcc ttggtggtga ccttattcct gattggtgcc aatctcacga aagaaaccct    312780
     gaaaagtgtc ggcatcaaac cctttctgca aggagtgggt ttgtggatcg tggtggcgtc    312840
     ctgcacactg ggtgcgattc tgattggttg gattcactaa aacaaaaagg cgctggtgac    312900
     agcgcctttt ttatttttcc gtcagggctt tcgaccactg accagattga tgacaaagct    312960
     gataatggcc aaggccagga agacgaacag cagaattcgc ccgatctcca ccgacatccc    313020
     cgctacgccg ctggcaccga agatgtaggc aacaatcgca atgataaaga aagctatcgc    313080
     ggctctaagc ataagagctc ctttcagttg gggcgggagg agagtgcggg tgcagatagt    313140
     agtcttcaaa gttgtcccgc gagctgttca tctgcgacgg atacgggacg gtttcgcgct    313200
     gatggcgctt ggatgctctt tgcatctcgt ccagctccca gatggggcac agttcctgga    313260
     tatgtttttc agactgatcc aatggctcct gcatgattcc tcccacgtat gtggtggtct    313320
     ataggatcgg tgcagaatat ttgaaaggct aagattttaa aggaaatgtt ttagaaaaca    313380
     aaaagatcgt gcggaacggg cgccccccga gggaaatcag agcgacgccc gaccgtcttg    313440
     ttacttacag aaggataatt ttttgaccat gccagagatc tcggagatct tctgatattt    313500
     gccaccgctt tttagcacag cccagtacgc gccggagcct actgtgatca gacctttgtt    313560
     tttgatctgt ttggccatga tgccgactcc gcaataaaga tttttgtagg gatccagaat    313620
     tgttttgcgt ggatctttgg cggccaggtt tttgtctttg ctccagtcaa actcacacca    313680
     gcgcgcccac tgcacatcct gataagacag ttgcagcaga ccctccgaat aaaccggatt    313740
     gccagtcaca ggatcggtgc ccatggtggt ttcatgcatg cgtgaagtcg ggctgtaagc    313800
     gctttcgtat ttcgccatgg ccgagaacag ggccgcccac acgttggccc gctgatcgtt    313860
     gtccaaagaa ttgtagcgag ggcagaactt gctcatgtca tctgcgccac ccaaaagagt    313920
     gttccagtca tccaggatga tcttgtgcaa atattctgac cactgtctgc gctcaggatt    313980
     tgtggaagtt tcccaggaca gggcctctat tttgtagctg ttgtcgggga cggagggtgc    314040
     ggacggctct gtcggattgg agggttccgt cggagtttgt tcaccggtgt ccggtgttcc    314100
     tgcgctgccg ttgccatctt cgatggtgct ggccagatct ttcagggaag tagaggaagg    314160
     ggagcaacct gccgccaaca aaaatgcaat agcaatggca gcgaaagaaa cagctttcgt    314220
     tagatgctta gggttcgtca aaagacctcc aaagtgtcgg gggctcctgc ttgaagaacg    314280
     tgcgaacggt gccgggtaaa ctgttatggg ttcaaaatca tgtcaccggt gtaagacaaa    314340
     gctgtacttt caaaatacaa gaaggccttt gaagtatgtt aactttcaca ctgaaacata    314400
     aaatttcagg acgatggaag tggaaatgca gaccgaggtc tggtggctga tggccgggga    314460
     tgcggaaaaa gacgagctga agaaaatgct ggaataaaaa aagccaggtt catcaacctg    314520
     gctttttttt gttttagaac ttagtcgttg cactgagcga agctgaagtc ggtgtcttcc    314580
     aggcggtcca tccaccagtc aacacaacca ccagaatcat attggctgca tttaatctcg    314640
     gaagtggaca gtgcgccatc gatgcaagtg cgcgtgcggg ccgtgctgtt gcatgtgtag    314700
     ttagggccga tttgttttgt cggttcggcg ctgtaataca tacgaacagt tttgccgtta    314760
     gggatgatca atccatccgc agaaacgcag ttgtgagcct gagccgtcgc agaaacgccc    314820
     aaagccaggg ccaagataag tgctttcatg ttatctcctt atggttttac agagccggga    314880
     ctataaccaa tttgttccac gaaagttgtc aggagattgt cagggaatgg ttggggctgt    314940
     cttttttttg tgcaactcgg acagaaatgg gggcctttct agtgcgaata aatttctgac    315000
     aaagcagaat ccagattttt gaacagcagg ttcaaggctt cttcgtaagc cttggtgata    315060
     tccgtgccca ttttgaagcc gaacgggtgt ttggtttcaa agcaactgga agcttcggcc    315120
     ttggccttgg ctttgttggg aatagtcagg acaccagaaa ctttcacgca gccttctttg    315180
     aactggccag tctgatagtc ttcaattgtt aacagcaaag aattagcccc cggcgttttc    315240
     acggccaccc cttggcgttc caacgcctcg gcaaccgcac ggcggacttc cgaacgcagt    315300
     tcatcactct gagctttcac ttcatctttg cgggcatcca ccacgctgat ggtcacttct    315360
     tttttcggaa ggtcgcgcaa cggtgcttga atgttttgag agttgatagt gggaacatca    315420
     cgaatgcttt gccccttcat cgcgcaagag gaaagaagtg acaaagccac caacaccaga    315480
     agttgtttca tatccaccat ccttgaaaag aaaaaggggg acttgagatc ccccttttaa    315540
     gtttatggat gttggcgaaa atttcaaact aaaattaatt ttcgtcgctg aacgtggctg    315600
     gaatcagctg ggactggttg tcctcaagca gaacgtcacg aaccgagcga ttctgaggag    315660
     cgtacaggat caggtcgcca gcgccgtaac ctttgatcag gttcacggtt gtgctgcttt    315720
     gagcctccag ttcgatcact tccggaatct gggtgtaggc ctgagcattc gtattcacag    315780
     aaaccttttc ccattgagag ctgtgctcgc ccagatagtc gtcatattcg atggcgccgt    315840
     tgtcaccgtg ggtcgtagag accttcaggc tgatttcgcc agtttctgca aaggaaagca    315900
     tggaaatatc agcttcgatg attgctagcg tggagttgtc aaagacaccc atgccacgca    315960
     tgtccaaaac cgccccgctg tagtcttctt tggccttgct tggatccgtg acaaagtctt    316020
     tttcatactg acgacgcatt tcacgggcct gattgccatc cagaagaagg ctgacaaact    316080
     catccccagt catgcctgga aggtccgaag cgggcagtcc cgccagctcc tgatccgcca    316140
     acccgtcacc gttggaatca atttgcacgt tcacttcaca acgctgccaa gtggtcatgc    316200
     cttcataaag cttcaaagcc acttgcagca cgcggccttt gtcagactca ttcacacgat    316260
     aacccgcaga ctgaaggtca cagttacggt tgtgaaccag gtcctgcttc ggagatttct    316320
     tacggccgtc agcacccaaa aggttgaaca ggtaagcttc acccggattc acgctgtcat    316380
     ttttcagaac cacttccgcc agactgccag cgctgtctgc tttggaagac gagtgaacca    316440
     caacaggaga cgccgagatt ttggaaatct tgcgagtcac tgctaaagcc ggcagttgtg    316500
     ccaaagtttt gtcctgggcc ttgaaggtca ggaagccatc cagctcgtct gttgagtttt    316560
     gcatcaaaga gctgttgatt tttcccttaa ccagaacagt tttggattcg cctgctgcca    316620
     aagtcacagt tgctgccgtg atttgcaggg cctcagagcc ggaccattga gctgtcaaag    316680
     tcacagtctc gtcgctgatg tttttgacaa cgatttcttt ggccagggtc ttttgttttt    316740
     caacgtcagt aataccaaaa gagatcacag acggaaccgt cacaattttg gcattcaaag    316800
     attcagccac ctgaacacgg ccggccccct gacggctgac ggagtaaacc tttttgtctg    316860
     ctgcgtggat caccttgccg tgcgccagca agactgattt cagctctgcc ggtgaaagtg    316920
     tgttgtactt ttgcttcagc aacgccatca cacccgcaat gtggggactg gccatgctgg    316980
     ttccggtcat tgttgcgcct ttttcaccag caccgctggc ggcagagata atgttcgttc    317040
     ccggagccga gatttcaggc ttgatgatgc cgtcttcaga acggggaccg cgggaagagg    317100
     acggggagat cgtgtccgcc atccacggtt tttcaatctg agccgtggtt ttaaggttgg    317160
     cttcaaccgg gccttgtgcc aaggcggcct tgatgcgttt tgcagaggtc agatcaatca    317220
     tgattcctgg gatgtcaaat ttcccgtcgc ctcccataac gatcggagcc ccttcggcat    317280
     tgttggcaac aacaacaccg atagcgccgt tgtcctgggc cacttgaatt ttaaccgaga    317340
     agttcacttc accacggtcg atgaaggcga tttttccaag caggcgggct ttggtcgcct    317400
     catccaaagg tttggcagcg gtgccgatat agaccagctc cgctttcaga tcagtcacat    317460
     cagccaaagg tttggtgatg gcaccctctg tggcttccac gatcagcgcc tcaccattaa    317520
     cagcaaattc tgccgccggg aaaagcacgt tctggttcat gttgtcgatg ctgttggcga    317580
     cagaaattgc gtcatcagaa acagaagggg cacccacgat gtatggcagg tccccgctgt    317640
     tacccgcggc cgccacaaca acagttccgc cacgcaccag atttttgatc gcgtggttgt    317700
     acatgatatg aggattgccg taaccgctgc ccaaagacag attcacaacg tccagttgtt    317760
     tttggaaagt cagatcccct gttgggtcgg cagcatattc aagggccgcg atcacgacct    317820
     catcactggt ggagcctttg gcaccgaaaa ccttgatggc ataaagatcc gcatccggag    317880
     ccacaccatc ataagtgttt acaccatcac ccacgcccgc cacggtgccg gccacatgcg    317940
     ttccgtgcgt ggcttcatcc aatggattgg catcgggaac cggaatgcgc ttcaaagggt    318000
     ttggggcgcc tgaattgtac tcagagccca cgatgtcgat accgcccaca acttttttgt    318060
     tcgggaagga ggggtgagtt tcgtttgggt tgaccgcttt ataggcttct tccgtgcctt    318120
     caccacccag cattttatga gtgtagtcga cacctgtgtc gatcacgccc acgcgcatgc    318180
     cctggccacg gatgttctgg gcataagccg cctcagagcc gatgaatttc acggaggtgt    318240
     ttttgccaac caggcccttc aggttgattt catcttcaga agggcgggcg aaagaaccgg    318300
     ctttttcaga aagagtgatg ttgggaacag ccttgatttt gtcatagacg ttggcgggag    318360
     cccagaccgc gaaaccgttt agcaccagtt tgtagcgaat aagaactttg atgtcagaag    318420
     agatcttttt aagttcttcg atcgtggctt cctgctcagc ttgaattgcg gcaagaagtc    318480
     ttttgtcgat gaccagtttg ccgtcttttc tttgggctgt ttcaagcaat gccggattgg    318540
     aaagtttgac tataaagatg tacggatctt caacagtggg gcggttgctg taaagtcctt    318600
     ccagaaagtc tgaattgaag atctgatcct tcggagcttg agccgagggg ctgcaggcag    318660
     tgaacagcaa agctgaaatc aacagggatg aaaaaaatct tggtggtgtg ttcgttttaa    318720
     acgttctcat ttacgccctt tgctctcagg ttgcatttca gtgccatacc gacactgaaa    318780
     aacgggtttg ggtcattcca gtggggaata ttccaagatc cgtgccggaa aaaatgccac    318840
     cagtttcggc actttttgta gtgctttagg gggcttagcg caagcttatt gtggggattt    318900
     gagggctcat tgctgacgcc tcatagtcct gaaaacaacc ttccgtttgc ggtcgagaaa    318960
     tggatgggat cctgaggccc ggacttgagc cccccaaaga tcttttttac gatgaggact    319020
     tcatgaggag attttatgat gaagtgctct gttgtcgtcg gtttgttttc attgatcgtg    319080
     tctgccacgg cgtccgccgc ggtggaaatc ccggttcagg cccgcttctt tgcgggaatg    319140
     acgggtgtga agcttgatga actgaatgac agtctggaag ctcaatccat gaaaaaaatt    319200
     gaaggcgtca cacagttggg tctggaaatt acctatcctg tgatgaaata tctggatgtg    319260
     ggcgctcgtt atgccaagaa gctcgctgac agtgaagaaa atccggccga ccctaatacc    319320
     gactattctg ccaaaattga tcaggatgcg ttcctgctga ttgcacgtgt ccccattgtt    319380
     cgtgaggact tctatcgcgt cgatgccttt gctggtgttg gcggcaccaa tacgaaagtc    319440
     acgatgaaga ctctggcaca aaacggtgac tacaccaaga gtgtcggaga gagctggtat    319500
     gcatcccctt acgctgcggc gggagtctct ttggctttgg gttacaagcg attctatttt    319560
     gtatttgaag gcgctattga gcacaacaag gtggatgacc tgaagcgctc cggttcggtc    319620
     agcaccagtg tgaactctct ggatctgtcg ggttcttact ttacggtggg gatcatgttt    319680
     gacgggattc ccggaactgt cggtcgctaa gatcgaaaaa caaaaggcct gcattgcgca    319740
     ggcctttttt atttagaaca cagctaagtt cgtgcccagg aagatttcac cttcaccctc    319800
     ggccggttcc actttctgaa tatagcggaa gccaaagtcg attggcagga agcggaagat    319860
     cacagattgt gcgatcaact ctgcaccata actgttcagg ttggcgttgt tgttgccaag    319920
     gatgactttg gtgtgatcca tgtacagatt tccataaaga cgtttgaaat agatccacgc    319980
     ccccaggttg tagtccggat aagacagcgg gaacatgtac tcgaagctgc cctttacaaa    320040
     acgatctgcc ggcaggtaat caaagccacg ggaatagatg taacccaccg gattgaatgc    320100
     cggagtcggg aagatgtaat tgccggtgcc ttcgcggttc tcctgtccat tcccagtcag    320160
     acgaatgcca ttattagcaa ggaagcctgg caggtacaga cgaacctgtc cgtaagttcg    320220
     gtaagaaccc ggagcttctt cgttggacac tccatccacg tcttcataga acgcctgaac    320280
     gtcgaccccc agcggaggca gaatcgcacg gtgctgcgcg gatttggtgt aagagaacaa    320340
     aaggcccact ttttgatccg cgtaagtgga agcttgagat cccggcacag acaccttgtc    320400
     cagtcggaag ctttccgttt ttaaaagctt cgcagagtaa tcaacctgca ggtatccgtt    320460
     gtacaggtgg tgtttaaagg catacggcaa ggccacgccc aaaccgtaag agccctcgcg    320520
     ccaggtcagt tcctgcgtgt tcagattcac atcggcagca cggttgcgga tgtcgcccag    320580
     aatgctgaag accggccagt accgtttaaa gtcgatcttg acggaagtaa atggggtgtt    320640
     ttcctcgcca tcagaaccga ccgtgatggc ggaaccgaaa tcgcgaagat agttgtccgt    320700
     gatcaccgtc aaagccaagc cgcgaccgcc aaagaagctc caggtgtgcg gagtgaaacc    320760
     ccgcgcatca aacatcccat agtctgattc ggtgtatttg gcagaatccg ccgtgtagaa    320820
     ggtttcctgg ccgctcagtg gtaccggctg gaacttgttg taattatcac tggggttgtc    320880
     gcccagatag ttgaagtcaa ccagttggga agccggcagg gccgcgcatg agctcaactc    320940
     cgctttcttg gtacgggctc cgtagggggt ttcttcggtg taaaccaggc ttgttccatc    321000
     aaaggttgga gcgtaagcag aaattttgct ctgggtgcat tgcctgaatt cacccagggt    321060
     gtttccgtgg aagatttcgt tggcgccttt gtactgtgcc tcgaacagaa tttcttggtt    321120
     tgagtttgtc tgcagccaga agatattgtt gcgggaaaac ggcaaaagca ccttatattg    321180
     atccgaaccg aagcgcgcct gaatcaaggc cttgtgtccg gtgttgttgg aagccacggc    321240
     gataatttca tccccgttca gcgaagcggc ctccatcaga tcaaggtctt taagggacag    321300
     agtgcgcagg ttctttccat caaaaccaat ttcttgaatg tcccaggtca tcttgtcatt    321360
     gaactccgct gccagaatgg atttaccgct ggcgctgaat ttcggattgt aaaggcggcg    321420
     tcctgaagtg atgtaggact tcgatccacc ggtcagatcc accagaacaa gatttgccga    321480
     gccctcaaat ccatagcgcg ggtgaggcac ataatccgtg tacacagcat gggtgccgga    321540
     atagtcaatg cggcttaagt cttctgaata cggcacttcg gcgatttttt cttcaccctg    321600
     tgctgtggat ttgtagatgg ccgggaccgt attgaggtca aacttcacat agtacagact    321660
     gttattggaa accttgggat tgaatcttac cgtgtagtcg gttttgggag cgtcggtgaa    321720
     ggcgtctttc ttccatgcct cgcgcagttc gttgaaagtc tcatagtaga agctctggaa    321780
     ctcaacgccg gtcagttccc tgaacgcgga ttccagacgg aacgggtggg gaccgcgggt    321840
     gattttgtcg gtcagttttt cccagaaatc atcaccatat ttttgatacg cgcgggaaat    321900
     cagcacgtaa ccgtaaacat actgattcac caaagcgtca cgataggtcc cattcacaaa    321960
     ttgatcgtaa gtcggggttt cgccccccag caaaatacct ttaagacgcg tcaggaaacg    322020
     cggggaccgg ccccggccac catccgtgta ttttgtttcg gcatagacgg catcaccttc    322080
     cgccatccat ggttttttag agatcacatc ggccagattc agccccagat ccccgaagag    322140
     gtaatcgaaa tagcgaaccg tgtttttatt gaagtcatcc atctgctgta cgtgacggta    322200
     ttcgtggatg gaaagaatct gcagccattc cagagatccc accatggggc tgtaggcacc    322260
     ggcattgaac cactctgtgc ggcggggagc gcgagctaca aaaccattgg gaagagccac    322320
     ctcattgcgg ataataaggg tgattttctt cggtttgctg attccatagc tcaggcccac    322380
     aacggcggcg ttgtgtttga tgagattcgc cacatacacc gctttgggac ggaaggcttc    322440
     aggatagatg actttaacgt attcgttttc aatcgtcttc cactgacggg gcgggctttg    322500
     tgagttgtcg attacttcgg attgagacat ggctatggtc ggcgccaaaa ggccggccat    322560
     taaggacaaa agtagtttct tcatgaggat cctctgttta gtaaacccct aaaatttagg    322620
     agaaacgcag agggttaatc aagcagtgat ttggtttagt tagggaaagg ccccatggaa    322680
     accggcgcca gacggaacgg ctttctgttt gttcccagct cgctgttcgt gtcgataccc    322740
     gaacagtacc agtttgtgcc aattttaccg caaataccat aagcgccacg aacttccaga    322800
     tcagtcacag tgccgatggc gttaagagtc gtcaaagccg tcggagaaaa atggtattca    322860
     ttcgtctgat agtcattcaa gccgtgttgg tcatagcgat taaagcccca gcaataggcg    322920
     gcgccgttgt tgatcgcgca gtggttggtg taaccgctga tcagtcgggt cacgttggtg    322980
     aagcttccaa tatcaacagg tgtcttttgg ttggtgttgg ttccatttcc tgttatttgc    323040
     ccccaacact tgatggacgt tgttccgatg cgggcacaag ttccataact ggaagcctgc    323100
     aattcatcga cattcgtcag acccggcacc tgatgcagac tgattcggtc agtggtgtcc    323160
     ccctggccca actgaccgtg ggcattgtag ccggtgcacc agacggtttt gtctgttttc    323220
     aacacgcaag catgatggcg gcccaaagtg acggacacgt tattggaacc agcagcggtg    323280
     atttcgacgg gcgcataata gaaatcaaca gcaaggtcca agtaagggat gatatcaacc    323340
     tgaccccaac agtaaagttt gcctgcctta atggcgcaca cagtgctgcc aaaactcatt    323400
     gccaagtccg tagctcctga agacagtccc gccggaatat tcggatttcc cgacgtgctt    323460
     cctgaagcgc gaataaagtt gcgaccccag cattgaacac cgcctgacac aacggcacat    323520
     gtgccggtgc tggaactgac aagcttggtg gctccagagg tcaaattttt cacctgggtc    323580
     ggagcctgat aaatacgatc tgtcagcaga tttccggttt tgctatagta gctgtcaccc    323640
     agacatttca ccgccccgct gaagatgccg caagcatgct cagtgaagat ggaaatggag    323700
     ctggcaccgc tgaatttcgg gctgagaacg tgggcattgg actgcagagg ttgctgatcg    323760
     ccgtgctggc cgaatccaga gaatcctgtg caataaacct ggccactgcg cacgaaacag    323820
     gtgtgagccc ctgtagagcc cgcaacggca gtgacaccgc cagagcctcc aacaacggga    323880
     gtcaaaggaa tcaccgaggt tcctgtcggc tgattgatgc cggcttcgcc aaaatagttt    323940
     ctgcctttac aatgcaaatc gccggataaa gctgcgcaga actggatacc aaagtaaata    324000
     tctgtggctc cggcaagttc cgccatcaaa agcggcgagg tgacgtccgc agtggtattg    324060
     cttaaaagct ggttgtcgga attgttaccc cagcaataga cctgattgga attgtttttc    324120
     gcacaggtgc catagtatcc cgtccaaaca tcagtgacag ttcccaggcc gttgatcgcc    324180
     gtcggcgtgc ccaccagagt ggtgctgcca acacccactt cgccgttgga gttttgcccc    324240
     cagcagtaca atcctccgga tttaatggca caagcatgga actggccact tgagattttt    324300
     gtcacgcccg aattcaagct tggaattgcg acgggtgctg ttgtcgggga ggcggttgct    324360
     ggatccccga gaatgccacc ttctttgata ccccagcaat aaacggcccc gttttgaatg    324420
     gcgcaagagt taccccagcc aatgctgact tgggtgacac ccgaattcat tccggttaca    324480
     agtgttggtg tcaaacgagt gcttatcgag ctggttccgg taaaaccacc ccccggataa    324540
     gtaccatgac ttccctgacc ccaacagtaa agcgccccgg tgtttaacac agcacagacg    324600
     ttattataga gagaagctat ccccatggcc ggggcggcca acggaaccag cagtggtgaa    324660
     gaactaggat agtagtgtcc ttgtcccagg ggcgcggccc cattgtggcc ccaacaatag    324720
     acgttaccgt tactggtcag ggcgcaggtg tggttgtcac cggcaacaac atccacggca    324780
     tcctttccgg ccgggctgtc attgtcgttg ataaagatat cggcgttgga aatataagat    324840
     gtaccgccgg tgataccggt gattttgatt ggaatgcgtt tgtaaagttc gtcagccgcg    324900
     ttgttgattg ttgtcagact gccaaatgtg accgaagttg cccccgacgc aacagaagca    324960
     gtgcccgaag tggttggcat cgtatagtcc gtgccaactg tggcacagtc agtgccggtg    325020
     caggtgtcgc gcgtccagtt gatggagaca gatcctttgt ctgttggatg cgacagtgtc    325080
     gccatcaggc tggtggaaga accttcaaca acgtaaacgt cctgaatcgt gaccagcggt    325140
     ggagcttcgt catccgtgat agtcacggtg tgaacggtgt tagcccccaa agaaccaccc    325200
     accgggccgc tcagggtgat tttgaatgtt tcgtcatatt cttcagtgct gttatcaaga    325260
     atcggaattg aaatattcac ggaagtgctg ccagccgcaa ttgttgccgt gccgttggtg    325320
     gcggtatagt cagatcccat cgttgcagaa ggtgcggaac cattggaata tgtatagctg    325380
     acactgacgg cgatatcgac ggcggacggg atgctgacgg ccacggtaag cgtcggatcg    325440
     ttgtattcag aaacactgga tgtcgtagcg ctaaactgaa tagccggaga atttttagtc    325500
     caggtcacag cggttgcagt cgcataggtc tgccagtttc cagcggtgtc tttgccgacc    325560
     acgcacactt tgatgcttcc attagccagt gcggaaatgt tgtcagtgat atttgttgag    325620
     ctggatattt cagaggccga gtatccggtt gccacagtac agtccgtgga accagcgaca    325680
     cccaatttgt atttgtaggc gacaacatca ctgccgttga catcaatatt cagtgcatac    325740
     tttgcactgg accccgtggg ctggccggac agggttgcgg tcggtggagt gttatcgaag    325800
     gtaatcgatg ctgaactagc cattgcactg acgttgccgg cagcatcttt cacccaggca    325860
     taaagtgttt tggcttcatt cacagtcgtt accgtgaatg tggctggtag tgaagctccg    325920
     gctgtccacg tgcacgatgc cacggccgtg ttgttttcca taatacaata agtagccggg    325980
     ctgccactga cggccgaagt gatattaaat gttgtgctgt tcgtcggggt cgtgtttgtc    326040
     accgtgaagg tggtgatgct tggggcggtc gtgtcgatca cgatattttt gttcgtgccc    326100
     aaagagcccg cggcccccgt tgccggcaag gtcagagtcg cattgttggc cgcggcatcg    326160
     cgaatggtgg cagaagccac tgtcagggac gtggtggcgg cataattcag gtctgccgcg    326220
     gtgtccgtgg cttgaactgt atagttaaag acaagggtgt tcgtcccggt gcccgaagcg    326280
     taagatgcag aacgggcagg ggtcgtgttc agggcaatca acggagttcc agtgacagtc    326340
     acgttttcag agaacgtgat gcgcacatca ataacatcac cgacagtata tgctccattg    326400
     gccttgttgg atgtaacagt ggtgacagtg ggaaccgtgg tgtcaataac aatcgcgctg    326460
     gaacaaaccg aagtgatcga gttcccggca gcatccaaag aaatgacctg ataagtgtaa    326520
     gtcgtgccgt tcacgcctgt gaagtttgat gtggtcgcag aactggtcgc agcgttttct    326580
     gttccggtgt acgtgtcaca agaagcccct gtatagaaac ggactttttg tgaagccaga    326640
     tccgtgctgg tggatttgct ccaagaagcc acaaggctgg tggtattcgt cggggacgtc    326700
     tgctgccagg ccagggacgt tgcattcgcc ggagccgtaa tatcataggt caccgtagaa    326760
     tccgtcgtgg tcgaagcgtt gttggtattg ccggccggat cgctgacttt ccccgctgtg    326820
     atggacggaa tcaaagttcc ggctgttgtg atggcggtgg cctgcagggt ccatgtgata    326880
     ttgtcagaag tcgaaagatt ccacgtgata ccggaagccg ttccaccttg ggtgatgtca    326940
     gccgcggtaa aggtgctggc attgacagcc tcggtgaaga ccaccgtgaa ttccactggc    327000
     agggtgttgg ttggatcggt ctgaccggct ttttgattga tggtcaaaga cggcttggtc    327060
     gtctcgtaag tgatttgatt gtcagtgctg gtgctggcgg tgttgttatt gccagccgca    327120
     tccgtcactt tattggcggt gatggatggg atcagggtgc cggcccccgt gatggccgtg    327180
     gccttcaggg accaagtgat attatcagac gtcgtcagac tccaggtgat gccagaagcg    327240
     gttccggatt gcgtaatgtc tgcgactgcg aagttggcaa tggcttcgct ggccacgatg    327300
     gtgaattcca ccgggacggc gttggtcgga tcagcctgac cggctttttg attgatggtc    327360
     aaagtcgggg ctgccaaatc ctgtgtccac gtcgccgtgg tcgccgaggt cagggcttgt    327420
     tcgacactgg ccgagttttt accgatcacg cagaccttga tatcggtgtt acccaaacca    327480
     ttgacagagt cagtgatatt ggtggcaatc gcgatatcgc cggaataatc cgtcgccacc    327540
     gcacagtttg tggatgcggc agggcctact ttatagcgat aggtctgaac gtcagccccg    327600
     gccacgtcaa tattcagtgt tgtctggttg gtttttcccg taggttgacc cgtaatggtg    327660
     gcaataaccg cggatgtgtt cacattgaac acaaagtcgt tgttggtggc ggctgtggaa    327720
     ttcccgacag catcgcgggc agaaatgcgt gcagtgtact gagtgccatt ggaaagggtg    327780
     cacccggtga aggtgtggga tgtcgtggct acggtctgtt gggcacaaac agaagcggaa    327840
     gcatcactgc tgcggatttc aaccagatac tgggtgctgc cagcagcggc ggcccagtga    327900
     acggttcccg tagatccatt ggtcagccat tcatcttgtg ttgaatcggt gccgccagtc    327960
     acaccagcga ttacaaaggc atcaggcgct tgagtatcaa tgacgatatt tttattggca    328020
     gcaagtgaac cagctgcacc cggagctggc aaagtcagaa tcatgtcatt gccaaagctg    328080
     tctttgagtg tagcgccagc caacgtcaag gcattgacag actcgtaatc aagatcagca    328140
     gagttgtcac ccgcttgaac agtgtattgg aacaccaaag tgttcgtgcc agtaccgctg    328200
     atatacgtcg ccacgcgatc cgtggagccg gtttcaatca aaagctctgg cgtgccgcca    328260
     gctacagtca cgttttcagt gaactgcaca gacactggca ctacctgagc ggccttatag    328320
     gaaccgttcg ccaacgaaga tgtcacagaa acaacagtgc ctggaagatc cagcgtgtac    328380
     tgaactgtgc ccgctgcaga aagggcgttg ccggccaaat cagtcagtgt tgtttttgcc    328440
     gtcagggtgc agacctcggc attggcaggc aatgtcgtca cagtcaaatt caccacggcc    328500
     gaagtcgcac ttgctgctga cacaccggcg atagaaacat tcgcccctgc agagcagctg    328560
     ataccccagt tcgtggcatt ctcaaccgcc gattgcagca tggcttcgct gaaagttacc    328620
     gtcacggaag ctggaaggct ggaacgaaca cttgtcacgg gattaaatga cgccactgtc    328680
     ggcgccgtgc gatccatggt cagagcggtc gagcaggcag aaacggacac gttcccggaa    328740
     gtgtcgatga ctgtgaggtt gtacgtgtaa gtttcgccat ccgctccggc aaaattgcga    328800
     gtggtggcag aagttgaaag ggaaatagct gtgccttcca aaagcaggca ggacgcgtct    328860
     ttatagtact ggattttttg ttcggcgatg tcggtggaat cagacaaagt ccagattgcc    328920
     gcagccggag tcacttttgt aggcgacgtt tgaatccagc ttaaagacgt tggcaaggac    328980
     ggtgcgctgg tgtcataggt cacttgattg tcagagcttg tagaaacagt attcagattc    329040
     ccggcaaggt ccgagaactt gtcagcgttg ataataggct ggatcacgcc gttgttatcc    329100
     acacctgaaa ccgtcagttc atagtgagtg ctgtcgattt tagtcagtgt gtgtgtgtta    329160
     accagggcag atccggtgaa gctgacatcg gcatccgtta aagagctttc agcaagggct    329220
     tcgctgaaca ccaggctaaa gcgcatgggc agggtgttgg ttggatctgt ttgtccggct    329280
     ttttggctga tgaccacaga cgggcgaatc gtgtcgtagt tccagttgta agttgttgcc    329340
     gctgtaaacg gctgccagaa gttgttggaa tccttaccca ccacgcagat tttcagattc    329400
     tgattggcta aagcggcaag atcgtcggtg attttcgcac caacagcagc ttcagtggaa    329460
     tagcccgaag aaaccgcaca gtctgtggaa ccttgcgggc ccactttgta gcggtaatga    329520
     gtcacattcg tgcctgaaac agtgatgtcc aggtcttcca cgttgctagg attggccggg    329580
     cgaccaccca gaacagccgc aacttccacg cccaggcccg aaatccccaa agaaccgtta    329640
     tccgcgatat cgggattggt gtaattccaa gtcagagttt gggaatgagt gttcacctct    329700
     gtcgggctgt acgtgatgac aaccgagcat gaagtatgac cattcaaagt gctggaacaa    329760
     gtcccgccgt ttccagggaa ggatccaccc ttaaaggaaa aaggagcaga caaagtgcca    329820
     agagtcagac cttgcgcggg agcgtctccg gtgttttgga aggtcacgga tctttcgatc    329880
     accgtgtctt tcatctgcgg accgaaatcc aatgtcgcag cggcagtcac tttggcacgg    329940
     gttgttttgt ctttcacaac aaaggaaata acgttgttat ccaagccttc aaagcgctcg    330000
     ccagtgaaac gaagttcgaa agtttcatcg ctttcgatca cggcgtcgcg ggtggctttg    330060
     atgataaagc tgacagaagt gatgcccggc tgaaccagca gggtgccatt ggaggcttca    330120
     aagtcgccgt cttcatcgtt caacgtccag cccaggtctt ctggctttag tgtcacgccc    330180
     ggcacacttg gagtttcaac tcccagtgtg atctgatgtc cgatgccttc ttccagaatg    330240
     acagtcttgc cggattccac ggtgattttg cgaaggatct gattttcact gagcagagga    330300
     gacaatgagg cgtccatgca gcttgtaagc atgagcgcaa gaagggcagt tgagatgtgt    330360
     tttaggtacg taccggcttt gaacatctta aggtactttt cggctgttcc ggcagtgttg    330420
     ttgagctttt ttgacagaaa atagtccagt gttttctgag gtttagttct tttaagatat    330480
     gaaacatttc tttatttggt attcgaggtg accttggatt ttctcacgca gctgcccgga    330540
     tccgctgcct tcgtggcggg atggacagct taagaagtcg atcatcgact ttgtttccga    330600
     agtgacgctg acccatcggg attcctatag tgaattcaat gccttatgcg tatctagttg    330660
     agaaggttga ctaattacgt aactagttac ataattagtc ttatggaact attcaaacga    330720
     gctggaaaaa tggcaatggg tacgcgggtg cgattcctga gcgagcagat cggtcaggat    330780
     gcggcagaga tttaccgtgt gtatgaaaac gatattcaac cgaagtggtt cccggtgttc    330840
     tatgttcttt caaatgaaga gcaaaacacg gtcacttcca ttgctgaagc gatcgggcat    330900
     tcccacgctt cggtgagcaa aattctgact gaaatgtcca aggccgggct ggtgctggaa    330960
     aaaacagact ctcaggaccg tcgtcgaacc aaaatcaccc tttccaaaaa gggcaaagac    331020
     ctctctgaaa aaatagaaag acagtacgcg gacgtcaacg aggcgatcga gcagatctcg    331080
     gcgcaggcca cgaataattt gtgggccgcg attgaagagt gggaatacct gctgggacag    331140
     aagtctttgt tgagccgggt tctggagatc aaaaaacgga gagaatctat ggatgtcaaa    331200
     atcgtagctt atcaacccaa gtacaaagag gccttttaca aactgaatga agaatggatt    331260
     tccaagtact tcacgatgga aaagcctgat cgtgatgctt tggaaaatcc agaatcctat    331320
     attcttaaaa agggcggatc tatttttgtc gctctattga atggggaacc tgtcggtgtc    331380
     tgtgctctga tcaagcgtga ggatctgggc tgttacgagc ttgcgaagat ggcggtgtcc    331440
     ccgaaagctc aggggaaaag catcggcttc ctgctgggac aggcgattgt tgaaaaggcc    331500
     cgggaaatgg gcgagcagcg cctgttcctg gaaagtaaca cgatcctgaa accagccatt    331560
     cgcctttatg aaaagctggg ctttgtaaaa gtcgtcggcc caccaacgcc ttatgaccgc    331620
     tgcaatatcc agatggagct gaagttgtga ttgtttctga tgcggactat gagctgaagg    331680
     tacgaagcag ttttgacaag cagaatctga tgaagactct cggggcgcag cttgttgctg    331740
     taggcccagg gacttgcgag atcgagctgc cgttttcgtc ttcacttggt cagcagcacg    331800
     gttttttaca tgccggcgcc acgacttcaa ttgcggattc ggcagccgga tacgcggcct    331860
     atacgctgac cccaaagggg tcttcggttc tgacgacaga gcttaaaatc aatttgctgt    331920
     ctccggctca aggggaaaga ttctttgccc gtgctgaggt gctgaaggcc ggtaaaacat    331980
     tgactgtggt gacgtccaaa gtttttgcgg ttcaaaaagg gcaggagaag ctgtgtgcct    332040
     ttctcactgc cagtatcatg accgtgcccc atgcggaaac aatctagagt tagaatgtgg    332100
     ctgctttgat ggtctgaatg atctttttgc tgatggtgtt gttgtgtttt tccggtcggt    332160
     acgccagata gatttcgtcc ttgaataccg gtgcatcttt cattttttca aggttcttgt    332220
     actgggcggc aacccttgct ggcaaaagtc cgtagccaaa acccaaagaa gtcagcttcg    332280
     cgaccacctc cagatttcct gaactcagca cgcccgtgaa gtttgtcttc ttgctcagtt    332340
     ttttcagaat gtactgcgac tgcgccagat tctggtcata aatcaatttg tcctgggcgt    332400
     ttttagcgtg gaagatcgtc acctcgtcag tgcaaagctt actgataacc agatcggggt    332460
     gttcgatggg gttcacgacg ataccaaagt cagcttccca gctgatcact ttttccgtca    332520
     tctctctgga caggccatga atgaagttga aatcaaggcc cagaaactct ttttgcagct    332580
     tcggcataaa agaccccagt gtataaagag ccacggaggg gtgaattgcg atggtgtagc    332640
     tgccttggat caggcctgat tcgggattgg ccaggttttg ggcctgttcc cattcataca    332700
     tcaagcgtcg tgagcgctgg cggaattctt cccccagttt ggtcagctgg atgccgtttt    332760
     ttagccggat taaaagattt ccacccagtt cgcgttccag tcgtttgatg gaatagctta    332820
     aggcaggttg ggagatgcca atgatctcgg acgccctggt gacattcagg gtttcacaga    332880
     ccgttataaa gtattttatg tcatccatca ttaaagacat aaatagtttt tatcacaatg    332940
     aaataaacta gtcattttat ttatacgtga aaactcgtta gtttccgcag caggaggaaa    333000
     cggagagtat gaaacctgca gcccttgaac taatttcaat tcagagttct gaaagcttaa    333060
     aattacggtc cccaatggtc gacccggcaa ccgaggtggc gacaagaatg ctggctcagg    333120
     tgatggatta tcgccgggtt cctcatgccg gtgacctgtg tggcaattcc gaatgtcaaa    333180
     cctgcgcatc ctttcatctg ccgaagatca tctcggctgt tcgcagaaat gagcctgtga    333240
     cttttgtttt gccggccttt cctggcaagt ccccgaaccc ggaaaaggtt ctgggggcgt    333300
     taccagacta tgccgagcag ctggcattgc agttcctggg taaccttggt cagcaagtca    333360
     gacagtacta ttcaccgggg atcaaaatca ttctgtgctc ggacggccgg gtgttcagtg    333420
     accttgtggg catgaaagaa agcaatgtca cggcctacca gtctggattg tccgggctta    333480
     ttggtgaatt gcagctgtca gacattgaaa ctttcaatat ggatgacttt tacggcgaac    333540
     ttagtttcaa ccaaatgcgt gatgaactga tgaaacgcta tggaagctcg ctggatttct    333600
     taaagcacaa agtccgtaac gggatggcag agcttgccac cgcagaagag cagggcgctc    333660
     atcgcatgta ctgcggaatc accagattcc tgtttgaaga ttctctgcat gcaggacaga    333720
     cgaaaagccg ctcggcgatt cagaaagaat cccgcctgaa agcctacgaa gtcattcgca    333780
     gaagcaatgc ctggagtgag ctgattgcag aaagatttcc ggacgctgtc cgcttgtcca    333840
     ttcacccgca gacctgcggt tctgcaaagc ttggcattcg cctggtgggg aatgaatcct    333900
     ggatgacccc gtggcatggc gtcgctgttg aaacggcaaa gggctttgtc ctgctaaaaa    333960
     aatccgaggc cgagaccttg ggagcagaat tgatttactc atccggtggg cagccaagcc    334020
     gctacaaact aagaggtgaa ctatgaactt tcaagtgact catctaaagc ctttcggagc    334080
     gattgtagaa cccaaggccc agggggccag tgtgaaagac ctggatctga aagccttgca    334140
     tcagcttttt ttgcaggaac agatcgtggt gctaagaggt ttcaccactt tcaaaaactc    334200
     tgaggaattt gccagctact gcgagacgtg gggtgaaatc agcatctggc ctttcggaaa    334260
     agtgctggag ctggtcgaac aggaaaatcc ccaggatcat atttttgatc acagctatgt    334320
     tccaatgcat tgggatggca tgtaccgacc ccaagttccg gagtatcaga tttttcactg    334380
     tgtaaaggcg ccactttccg ggcatggggg ccgcaccacg ttttccaaca ctgtgctggc    334440
     tcttaaaaat gcctcgccgg aactgaaagc gttttggggc aaagtgacgg gcatctatca    334500
     gcgtgagatg gagttttaca aaagtaaaac ggtgtctccg attatcacaa aacatcccaa    334560
     aagggatttt tcagtcattc gctataacga accaccaagt gcagataagg ggcattttgt    334620
     gaatcctccg gaccttgaat ttgccggggt tccggtgggg gagctggagg cttttcatca    334680
     aggactcaaa agtgctcttt atgcgcctga aaatttctat gctcatgagt ggcaggatgg    334740
     agatgtcgtg atcacagata atttcacgct tttgcacgga cgcgaagcgt ttacctcgaa    334800
     atccccgcgt cacctgcagc gagtgcaggt gcaaagcagt ccgccgtttg ataacccggg    334860
     cctggaatcg tacaaatgag cccgcaagtt gttgatcttg tcattgtcgg cgcgggaccg    334920
     gtcggattga tgtgtgctta tcttgcgaag ctttgcggga tgagcactgt gattgttgat    334980
     aaatccgagg gaccactgca agtggggcgc gcggatgcat tgaacgccag gactttgcag    335040
     cttttggaag tgggtaaatt gtttgaccag ctttatccgt tgggaaagcc ctgcaataca    335100
     agttctgtat gggctgatgg aaagtttctt tcccgccagt cttcttggtg ggacgagctt    335160
     gaggggtgtt ttcataagca ctttctgatg ctggggcagt cttttgttga aaagctgctg    335220
     gatgaaaaac tgaccctttc aggcgccgct gttcgccgtt ccacggtgat taaagatgtc    335280
     gaggttcttc aggacaactg cctgacgacg ttgtcttccg gtgaaaagat acaatcccgt    335340
     tatgttattg gtgccgatgg ttcccgctcg tttgtacgtg aaaagttcaa ggtgcctttt    335400
     gaaatcgtca gaccccagat tgtctgggcg gtgcttgacg gtgtcgttga aacggacttt    335460
     ccaaaagtgc ccgaaatcat cgtctttcag gcagacactt cggacgtggc gtggattcct    335520
     cgcgaagggg acattgatcg tttctatgtc cgaatggaca ccacagagtt tactttggaa    335580
     gaagctgttg caaaaatcaa tcgtgcgatc aagccccatg ttctgggctt taaaaagatg    335640
     gagtggtttt cacagttttc ggtgaaggag tccgtggctg aaaagttctt cattcaggat    335700
     cgggtgtttc ttgttggcga tgccagccat attcactcgg tcaacggcgg gcaggggctg    335760
     aacacggggc tggctgatgc tttcaatctg atctggaagt tgaacatgac tttgaatcac    335820
     ggggcttcgt tggatctgct gcaaagctac gaatctgaac gcaaacccgt tgctttaagt    335880
     gtcatcgagg cttcggggga acttgttcgt tcaaccaagt attctgcgaa tgggactcat    335940
     gccgaggatt atgtgcgcat cgtgcaaaaa cgcgcgggaa atatcacggg catggggatt    336000
     cgttacgcag gtgaggggct tatcgggtcc cggttgtatg actctgaggt ccgcttcggg    336060
     tccgagacgg ttcggctgta ctctttgttg aattattcca agtatacgtt gtttgtcttt    336120
     ggggatgtgg agcttgattt tgagttgccg gagtatgttc agcttgttgt cgttggctct    336180
     tcggattctg tctatgtcgg gcaggcggtg ttggtgagac cggatgctta tattgaatca    336240
     acggtctcgt tgggtcgggc tcgggagctt ctgtcgtctt ttatttagag gtctaaatcc    336300
     agttcgtaga tgcctcgggc ggcgaggact tcctgggtgg agtttagttt tcttacttcg    336360
     gtgagttccc aggagtagta gccgggttcc catcttgtgg cgcaggctgc ggggatgtct    336420
     ttttcttcga aggggcggac ggatttgatt tttacgattg ctaccgggat gccgatgtcg    336480
     gtttcgcctt cgttgaagag gaagtttttg ttttctacga tgagcaggtc gccggtgagg    336540
     tcggcagggg gaagccagcg gcggacttcg atgatttttt cgccgttggc gatgcgggtt    336600
     ccgttggggt ggactatgga gagggttttg tgtttcatcg ttcgctccgg ggtttgtctg    336660
     gcttgtttcg cgctttgctt gaaactcgct ggggttctgg gtttgcggtg gggagtgggg    336720
     ctcgtcgcat cacgctcctc ggggctttga aaagtggtta tgccgcattg tcttgtagaa    336780
     ttagatactt gtcaggatat ggtcaaccgg aaagccatgc cccgagcacc ctttaggcag    336840
     ggctttcggt taagcgattt agttttttaa aagcaggcac cttgacattc catgtagagc    336900
     tcacattttt gcaaggatga ggggggctta tcggaactca gaactataag ggacttttgt    336960
     ttcatgcggt cgacagaagt gttcgtgtcg gcagaatgct taacatcgta gaactactaa    337020
     aggaccttgc cggatattgc gttgcttctc agggtattga cgcagttatc agtgcaaaaa    337080
     gggacgttat tgagctttat atggtcttta agtggttaac gttgatcatg atgtgggtat    337140
     tcggcttgaa cggtttttgg tcttcggctg tagttgctta tctaattgcc caaaatgtat    337200
     ttacctattt tgaccatcat gtctggagtg tcaggggtaa tctcgatgaa gaccggatta    337260
     aaatgcgatt tgtgatggtt ctgcaagccg ttgtcttcaa tgtcgtctgt ttttcatatc    337320
     tgtttgcgaa tcagtttaat ggagacttca actggggatc tttctcttcg tcaaacccat    337380
     tgatcccatt gtcctttagt ttcatgaaca cgctcagcgg tggaagttcg gtcgcgacac    337440
     cgacaactgc agcaggagtt gtccttttgg gacttcaagt gttcacaact tttgtattcc    337500
     tcaccgttat tttaaccaag gctacgacta aggaaggtgt gtaatgtact acagagatca    337560
     agtgtatgtt tgctttgatg ctgacgagga catggattac tatagaacga tgaagatgtg    337620
     ggtcggcaat aagaacatca attttgattt taataatgcc cacgacctta acactcttcg    337680
     tgacggcagc tctgaagaga ctattaaaag aaagctcaga gagcgaatga acaatgctgg    337740
     ccttcttgtt gtacttgttg gcgaaaaaac tcgaaatctc tataagtatg tacgttggga    337800
     aatcgaaatt gcgctgaaag acggtatccc aattgttgtt gccaatttga atggaaaaag    337860
     aagctttgat gatcatcgct gtccagcaat tttggacaat gagctcgcac tgcatgtttc    337920
     ttttaactcc aaggttatgc agaaggcatt cgacgaatgg ccaagagagc actacaagtt    337980
     taaagctcaa ggaacgtcag gagaccgctt tttcgttgac caagtttatg agcagcttgg    338040
     attaaacaaa acccaagcac agctagaagc ggagcgtttg aattcgctcc gggattattt    338100
     agcaagaaaa ggtcagcctt ttaggttcta attctagtgg ggcctcggtt tcgcggggga    338160
     gtggggctcg tcgcatcacg ctcctcgggg ctttgccctg cgcttttgcg caccctcgag    338220
     gtcgcatcct gcgacgtcga tgaacccctg tgccggcgtt cgccgcgtgc cgcgagcttt    338280
     gtagaatagt tttcgccggc gctctaagtt caaaccactg gatgtcgatt gtaaaaataa    338340
     aaaacccgaa tctttcgatt cgggtttttg atttttagaa aaattggcgt tcccaagggg    338400
     atttgaaccc ctgtatcctc cgtgaaaggg aggtgtccta ggcccctaga cgatgggaac    338460
     gtttagagaa aacaaacgaa ctaaaaatgg tggctcgcga tggattcgaa ccatcgaccc    338520
     cttcattaaa agtgaagtgc tctaccagct gagctagcga accactgtcc gtttgaggaa    338580
     gtgctaattt gtagtaagag gggtccaaag tcaatacact ttcttgcagt tttttaaaaa    338640
     tttttgcgaa tttttgataa aaaaaaggcc tttgctcaag ctctgagcaa aggcccccta    338700
     aaaaccgcta aatatgctta attgttgaac aaaggcttga cccacagtgt ctgttctcgg    338760
     cccggtccga cggaaattac gtcgattggt gtgcccaatt gtgagcccag gtagtcaatg    338820
     tagttcgttg ttgggcgcgg aagatccgag agtgttttca ctttcgtcaa atcttgtgtc    338880
     caacctggga tccattcgat cactggttcc actttttcaa gctcataagg tgaagttggc    338940
     agatcagtga tgatttcacc gttcaatttg tacgctgtgc acacgccgat acgatcgtgt    339000
     cctgtcagta catccaattt catcatcgct agattcgtaa tgccattcac gcggatcgcg    339060
     tatttcaacg ctaccagatc caaccagccg caacgacggc ttctgccggt ggtggagcca    339120
     aactcgtggc cgtcggcttg aatctttttg ccgatttcat cgttcagctc agtcgggaag    339180
     gggccgctgc ccacgcgagt ggtgtaggct ttgaacacgc cgatgacttt ctgaacgctc    339240
     gcagggccga tgccggcact ggcgcaggcg ttggaagcca gagtggaaga gctcgttaca    339300
     aaaggatatg tgccgtgcag gatgtccagc atcgtgcctt gcgcgccttc gaacagaact    339360
     ctttttccgg acttcaaact tttactgata aacagcgaag tgtctttcgt gcggtatgga    339420
     gccagctctt cagccacggc cagaagatcc ttgatcagat catcggcttt gaaagtggag    339480
     cccttgtagt agttctccag catgaagttc ttttcagtca gtgccagttc cagtttcttt    339540
     ttcagattgt ctttgtcgaa aagatcaccg aacaaaatcg cgcggcggga agcgcggtct    339600
     tcataagccg ggccgatgcc tttgccagtg gtgccgatct tgccgtcgct cagtgcggct    339660
     tcacgagcag cgtccagagc tttatggtat ggcaaaatca aagttgccgt atcagagatc    339720
     aaaagttgtt ttgggttttg caaaaagcct gtgtctttca gctttttgat ttcatcacgg    339780
     atcgagaaaa catcgatcac gacaccggag gcgatcacac atgttgtttc cgggcgcagg    339840
     atgccgctgg gaacaagatg cagaacggtt ttttgtccgt tcactaccag ggtgtggcca    339900
     gcattggctc cgccctgata tctcacaacc atgtccgctt tttcagcgaa cacatcgatc    339960
     agtttacctt taccttcatc gccccattga gcaccgacaa caacaacgcc tgacataata    340020
     cgtacctctt aaaacagacc ctagaactgt ctctcaaaga ggggatatca ggcaagttta    340080
     ttcgccctta aatggagccg ccccatacca aggggccctt ggcgggaggg tgtcagaggt    340140
     cgatccgtcc acaaaaaagg ccataagctt attagctgca atctgggagg ctttaaagaa    340200
     cgcgtcctct gtattggctc caatgtgcgg agtcaaaacc aggttcgggt atttcagcaa    340260
     attagagttt ctgttcaagg gctctttttc gtacacgtcc aaacccaccg aacgcagcca    340320
     gcctttttcc agggcttcgc acagatcgtt ttcgttgatc accgaaccac gtgacgtatt    340380
     gatcaggacg atgcctctgt ggatgtattc aaactgtgag cggttcagca tgtgttcggt    340440
     ttccagggtc tttggcacgt ggaagctgat cacgtcagcg gtcttcagaa cctcttcata    340500
     actgaggcgg ggaatgtgca ggcgttcaaa gacttcgtct tcttgatagg gatcataggc    340560
     gaccacattc atgccgaagg cttgcgccag ctctgccacg cgggatccaa tacgtcccaa    340620
     gcccacgatg ccatagtttc tgccagccag ttcaatgccg gtgatttgat cgcggttcca    340680
     ttcgccggct ttcaccatct tgtgcgccgc ttgaatgttg ttcacgcacg acaaaaccaa    340740
     gccccaggtt aactgagcgg cggattcgat gttcgccgtc ggcgtatgca tgacagtcac    340800
     gccccatttt tgcgtggctt cgagatcaat gtgatcaaag ccgctggtgc aagtcacgat    340860
     cagctgcaac tgacgggctt ttttcaaaag ttcctcgtca attttggtgc gactgcgaat    340920
     gatcagggcg tgggcgctga ccagatgttc cagtggcaga tgctgggggt tgtcgctgcg    340980
     aacgacttca aattggctgt gctgttgcaa atacaggaag ctgtcttggg caaagcggtc    341040
     ggtgatcagg atttttttct tcacggattt tgctccagcc agtttttcgc ctcggtcgtg    341100
     atgttggaaa tatgctccaa cgacataaaa tctgaatcaa agtggcgcag ggtgtgcccc    341160
     aagcactcca ccagacgaat cagttcgtga tcctgaatgt aacccatgtg tcccacacga    341220
     atgatgcggc ctttggcctg atcctgtccg cccatgatgg tgatgttgtg aacttcttcc    341280
     aggtgcaggc ggattttttg tccgtccatc tgtggtggca ccagcaacgc agtcaccgag    341340
     ttgctggggg actgcgcata caaagtgaag cccagcttca gaccaaagat gcgggtgaac    341400
     tccgcgcggc gatgaatgtc gtggaaaagt ttttccaagc cctgctggga aatcagcgtc    341460
     agcaccacat ccaaagcgcg gatcaaagcg acgttggaag aatagaaagt ttcaccggca    341520
     gcattggctt ttttctcttt gcggatatca aaataatatc tggggcattt ggcgtcgggg    341580
     atgaatctcc aggccttctt cgaaaaggat agcagcgaca aacctgttgg cagcataaag    341640
     gctttttgcg atccggcgac aatgccgtca ataccccagg catccatcgg cagagggtac    341700
     gcccccaatg cggtgatggc atccaccagg aacaaggtgt cgggatattt ttgagtgatt    341760
     ttacccaaag cctcaatcgg gtgggccaca gcggtgctgg tttcgcacgc ctggcaaagc    341820
     acggcgcggg tgtcaggatt tttctgcagc agttcttcaa cgtcagaaac tttgacggct    341880
     tcaccccaag gagcgttgat ggtcagaact gaggcgccaa aatgcgcggc catatcagcc    341940
     cagcgctcgc caaatttgcc tgaaacaatg gcaataactt tgtcgccggg tgacaaggtg    342000
     ttgaccagta aagcttccat cccgccagag ccggtggagg tcaaaagata gacatcttgt    342060
     tcggtttgaa aaacagtttt gatctgagtc agaactttct taaggatttt atcgaattcc    342120
     ggagtgcgat ggtgaatcat cggcagtgcc agcgctttgc gcacctcagg atggatattg    342180
     acggggcccg gagccagcaa actgtaatcg tcttgagttg ccatatttct tccttgattg    342240
     cgtcgcgcag tcactatttc tgtgatgact tcctgctaat tttatactca actggggtcg    342300
     tggacgcaat atttaaagct tttcgcatca ctctgattct gtcgctgttc ctctcgggat    342360
     gtgcctatcg cctgggcagc gggacgcgca gtattcctgg cggctataag cagatttctg    342420
     tgcccatttt caaaaataaa acacaggaaa ccgggatcga agtggcgttc acaaacacac    342480
     tgattcagga gttccagcgc tcccgagttg cccgaattgt ggacaattct ttgtcggaag    342540
     tggcagtgat cgggcagatt gattctgttc agtatctgcc gggcgccaaa cgtgtggccg    342600
     gagactcttc cgcgccttat ttgcctaatg gaactgtcgt tgcgtcagag tatcgtatct    342660
     tgctgaatgt gacggtgaaa gtcgtgcgtc aggcggatgg gactgaactt tggagtgggt    342720
     ccttcagtgg agagagaaca tacgcagcac ctcaggtaac gctggccggt gttaactcca    342780
     taaatccgct ttacaatctt tctgcgcgaa ggcagaacat tgacctcatg gcttatgaca    342840
     ttatgtccga agctcatgat cgtattaccg aaaatttcta aaaggatatt caactcgtgg    342900
     cactcatcga tgcgcagaaa ttctatcgcg atcttgaaaa aggtcagact gcgccgatgt    342960
     atttcctttt cggggaagag ccttacctgc tgaatcaatc cgtcgagcgc ttcaagtacg    343020
     cggtcctgac cgaaggcgcg gtggatttca actacagcct gttctatgct tccgatgcgg    343080
     atgtggtgtc ggtgcgtgat gccgttgaaa ctttgccgat gatggctcag cgccgtttgg    343140
     tgatcctaaa agaagcccag gaattgaccg acaaggaatg ggccgagctg gagcctttgc    343200
     ttgaatcccc ggtggacagc accgtgtttg tgattctggc gtcccgcgtg gacaagcgca    343260
     aaaaacagat ccgtcttttg ctcgacaaag ccgactgtgt tgaattcaaa aaaccttacg    343320
     aaaatcagat cccttcctgg atcaactaca tcgcgcaatc cctgggtttg acgatcagta    343380
     acgatgccat cttgcttttg cataagctgg tgggtcatca cctgaccgaa atcgaagggg    343440
     agcttaaaaa actgggcgaa ttcgtgggcg agcgtcgtat tgaagtggca gatgtggctc    343500
     aggccgtgtc tcgctcgaag gaagaaaacg tttttgattt caccaaagcc atcggcgaaa    343560
     acgaccgtgt aaaggctttg gagcttttgg ttcacttgct ggatcagggg cagaacgaga    343620
     tcgggatcgt gtctttggtg gcccgccacg tgcgtatcct gctgactttg aagcggggaa    343680
     tggaagaggg cctgcacggc gcgaagctcg cgcattttgc ccaggtgccg ccttatttcc    343740
     tggaaagcta tctggatcaa gcccgacttt ggactgctaa aaagctggaa caaaccctgg    343800
     tggttctgtc tgagacagac aaggctttga agtcctcacc attgtccagt cacatctggc    343860
     tggagaatct tgttttaaag acctgcggca ctcaatacgc catgtgaact attccagcga    343920
     agctggagtg cagacaattt caagttgata gctgaataga ccgataagct ttgtgatgaa    343980
     caaagccaat cctgcatttg aagacaaagg ttatttccgc cgccagtatc cgcgacgtgc    344040
     gatgaagcgc aaagtgggca ttctgtgcga tggggtgtat tttgtgtgtg aatccggaga    344100
     ggtgggtgaa ggtgggatgt ccatcgtcac cgagtacgtt ctgaccgagg gccacgaggt    344160
     ggtcgtcagc ttccaggtgc cagccgggga ctttgtattc cttcgcggcg tggttcgttc    344220
     aacgcaaaaa aaagagggtg accataaagt cacccacgga ttgagcttca atcagattgc    344280
     gttctctaca aaacgacaaa ttcgcgcctt tgtatcagcg cgaaccgact cagaactcaa    344340
     ttaaaaaccg atttttatct tttcagacta cttcgttgca gaagcgcgag tagaaagacg    344400
     gctgatcttg cgggatgcag tttctttctt gataacgcca gtttttgcag ctttcattac    344460
     ttgagaagag aagttcttca acaattcagg aagagctttc agatctttag cttcgatagc    344520
     tttaacaagt tttttctcag ctgttttaac agtgcttttg cgagcgttgt taacagcagt    344580
     tttacggata gactgacgag ctctttttgc tgcagactta tgatttgcca agggataacc    344640
     tccacagtaa cttttataga cgaaccaaag ggattaacat agggtgtctc acgaagcaag    344700
     tggattaaaa gaagatcgca aaaaggtcct caaaagcgcc tttttaatgg cctccgggac    344760
     attaactagc cgcatccttg ggcttttccg cgatatagcc ctgggggctt tgttcgaccg    344820
     ggcggtcact gacgcttgga cggccgcttt ccgcatcccc aatctgttcc gccgcttatt    344880
     cggggaaggc tccctggctg tgagttttat tcccgttttc atgcaaacac aatcggaaga    344940
     tcccaccggg gatcgtgccc ggaatttagc caatgccttt tattcgctgc ttttggtgtt    345000
     tttaggggtt ttgaccctgc tggggatcgt ttatgtcgag cctcttttcc ggctgattct    345060
     ttcttcggat tatgccttgg atgccgccaa gtgggaactg accctgcgca tggggcggat    345120
     catgtttggg tttgtgttct ttgtctgcac ctatgccttc tatatgggga ttctgaatgc    345180
     cctgggcagt tttgggctgc ccgcgctggc gccggcgctt ttaaatgtct ctatgctggt    345240
     gttcaccttt atgccgccgc agtggtttgc ggtgcacgga gacggcctgg cgtggggagt    345300
     gttgatcgga gggctgttgc aggcgctgtt attggcagtg gctttaaagc agcgaaacta    345360
     tctgccacga ctgcagaaga cgttgtggac tccggaagtc aaagccgtgg tgcgggggat    345420
     gttgccgggg ctgatcggca tggggctttt gcagttttcg actttggtga atctgtactt    345480
     tgccagctcc cttcctgaag gttcgatttc ttatatttac tgggccgacc gtttgctgga    345540
     gcttccattg tcgttgattt cagtcagcat cggggccgcg ctgctgccaa cgttgagtga    345600
     ctttgccaat cggggactga aagaaaagtt ccaggaaacg gccgaagaaa gttttctgat    345660
     gaatctgttc ctggcatggc ccgcagcgct ggggctttat attttggccg agcccatcat    345720
     tgaggtgcta ttcttgcgtg gcaagttcac cgtgcaggat gtgcaaatga cggcagcgat    345780
     tttgcgcatt tatgctgtca gtttgttgct ggtgtcgtgc agtcgtgtgc tgatgccgct    345840
     gtattattcc gtaaagaaca cgaaagttcc catggtgctg gcgttggtgt ctttggcggt    345900
     gcatgtgtcg ctggctccgg tgttgatgcg acagtggggg cttgaagggc tgatgatttc    345960
     cggcgtggtt gcggcattaa taaatgccgt attgctgatg gggcttttga agaagtattc    346020
     cccgggaatc agaatgtccg tgctgcttcg tccggcgctg aagtttgtgc tggcgggggc    346080
     ggggatggtg atttctttgc aggcatatga actgctgatg gctcaaacag gaagagggct    346140
     gcagatgctg gccctctttg tcacaatcct gttggcggtt gtcgcctatt tcggtctggc    346200
     ttacgttttg ggttgcgagc agatttctag aatccgtcgg tcgtcccaac cttagctctt    346260
     tcgtcgtcat caaatggaat cacatcctga gaagcggact ttttcggagc cgcagccttc    346320
     attggaatca cattggattt tttcggtttc ggcatgaagg atgttttcgc tttggctttg    346380
     accggagctt ctgccgcagc agaggctttg gatacctcgc tgctgcccag gatcacttcg    346440
     ttcagttcca cagtcaggtt cagggaagtg gttgccagat tgttgatctc tccgctggtc    346500
     gctgcaattt cttctgctga agccgcgttg ctttgtgcgg cctgatccaa ctggttcatg    346560
     gctttaccga tttgttgaat accggtggtc tgctcagagc tggccgccgc gatttcgttg    346620
     ttcagatccg caactttttt gatggagttc acgatgttgg tcagaacggc accggacttg    346680
     tccgcagtag cactgccttc ttcgatctga gatacggaat ctttgatcag ggaagagatg    346740
     tccttagcgg acgccgcact tctttgagcc aaagttctga cggcctctgc gaccacagca    346800
     aaacctttgc cttgttcacc ggcacgggca gcttccacag ccgcattcag agccagcaga    346860
     tttgtctgga aggcaatatc atcgatcaca tgaatgatct cttcgatctt tttggaagac    346920
     tgagaaatgg aggtcatgga tgtgatcagg ttctggattt ctttttcacc ctgttcagca    346980
     gaatcacgcg agcttgcaga caaagccgcc gcttgtttcg cgttgtccga gttcatttgc    347040
     accatggagg tcatttcttc cagggcggcg acagtttctt caagagaggc agccgcctca    347100
     gtcgaagact gggacaatga attgccggct tcgttcaatt gttcaactgc agaagccacc    347160
     tggccaccgg ctgttgtcag acggtcagcg acagaaccca cggcgtttga aatgcgtgcg    347220
     gcaatccaca agagcacggc aaacacaatc acacctgtgg cagctgaaac cagatagatc    347280
     agatttttaa cataagcttc agtcgaattg gcttcgatga cgccgtcttt ggccatcttt    347340
     gcgtagatgt ctgtgacggc gctattccag gcgcgcacgg atttgccgat ttcattgtaa    347400
     cggccatcca gcaggacttc ggcttctttc actttggcgg ggtctgcaga acgaatcaag    347460
     gcgataacct tttccatgga agcatagtat tccgggaaaa gaggcttggc agtttggtaa    347520
     gccttgtctt cttccggtgt tcttggaatc ggatcataag tttcctgggc cttgcggaat    347580
     tcgtccatgc cttcggtggc ggtctttaga taggacgtca atttttcagg ctcatcaata    347640
     tgttccatcg ctgcccaagc accgtattgg aatttgttgc ccgcctggcg catttcacca    347700
     accatatcga aggtggggat aacttgttcg ttggcgacat ccaaaaggtg aaccacactt    347760
     gtgatcccgt tgatggcgat ggagcctaga atcgcaaagc caatcatggg catgaaagca    347820
     gccatcaaca actttccttt aatacctttg aaccatcctg ataatttgaa atctgacata    347880
     tgtagggtct ccgtaaaatt cttcatggtt ttttaacaga taattattcg gaatttgcaa    347940
     tagtacttcg tagtccagaa tttctaatac gagaaatggg ggagaaaaat gaaaaacccc    348000
     ctcctaagtc gagggggctg ttaacaaatc ttgatgtgtt tgcaggtcta gaatccgtct    348060
     gttgttccaa cctttgcacg gtcgtcttca tcaaacggaa tcatatcctg agattctttg    348120
     cgtgcaggtg tcgccttcat cgcaatcaca ttgctctttt tggacgtggg ctttgcaaaa    348180
     gtcggcacct ttttagaagt cttggccggg gatgctgccg gagcgtcgac catcaccgag    348240
     ccgccgccca ggatgatcgt gttcagatct acggtcaggt tctgattggt tgctgccagg    348300
     ccgttgatct caccgctggt ggccgcgatc tcttccgcgg aggccgcatt gctttgagcc    348360
     gcctgatcca gttgattcat ggctttgctg atttgctgga tgcctgtggt ctgttcagag    348420
     ctggccgctg caatttcatt gttcaggtca gaaaccttct tgattgagtt cacgatgttg    348480
     gccagaaccg ccccggactt gtcggcaatc tcgctgcctg tgtcgatctg ggaaacggag    348540
     tctttgatca aagaggagat gtccttggct gaggccgcac ttctttgtgc cagagcgcga    348600
     accgcttcgg ccacaacggc gaaacctttg ccctgttcac cggcgcgagc cgcttcgacc    348660
     gccgcattca gagccagcag gttcgtctgg aaggcgatat cgtcaatcac cgagatgatc    348720
     tcttcgattt ttttcgacga ctgagagatt tcggtcatgg agtggatcag ggactggatt    348780
     tctttttcgc catgttccgc cgaatcacga gagctcgcgg acagcgccgc tgcctgtttg    348840
     gcgttgtccg agttcatctg caccatggag ctcatctctt caagggctgc cacggtttct    348900
     tccaacgagg ccgccgcttc ggtggagctt tgtgataaag agtttccggc ttcgttcagc    348960
     tgttccactg cagaagccac ctggccacca gcggtggaca gacgggaggc gatggagctg    349020
     acagagttgg aaatgcgcgc cgcaatccaa agcaggatcg ccagaatgga gattgtggaa    349080
     gccagggtca caaacagcgt caggttgttg atgcgagtca cggcttcatc cgccgctttg    349140
     tcatcatccg ctgcggcctg gttgtagtac ttcatggatt cagaactcat cttgtgcatg    349200
     atggtgccga tttcccaaag acgtccgtcc aactggcttt ctgccagagc aaagccttca    349260
     ggagtgccag tgctgatttc ttcaatgacc agcatcagca gtttttcata ttcggcacgg    349320
     acctgcttgg ctggttcgaa ggccttttcc atttctggag tgaagggggt tgaggcgtac    349380
     agatccattg ccgaggtgaa ttctttgaca gcctctttgg cgattgccag gcgctcttgg    349440
     cgcttggctt cggttttcac gctcatcgct gcaaaaacct gatagccgta tttattgcgg    349500
     gcctggcgca tttcggccag agcctgcaga ttcggaatga tgtttttgtg ggagttttca    349560
     agataggctt caaacccttt cattccctga taagaaatgg catagacgat tccaaacccg    349620
     atgacgggca tggccgctgc gatcaaaagt tttcccttaa ttcctctgaa ccaggaacca    349680
     attccggtgg ggttcat                                                   349697

If you have problems or comments...

PBIL Back to PBIL home page