(data stored in ACNUC7421 zone)

EMBL: BX897699

ID   BX897699; SV 1; circular; genomic DNA; STD; PRO; 1931047 BP.
XX
AC   BX897699;
XX
PR   Project:PRJNA196;
XX
DT   24-JUN-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Bartonella henselae strain Houston-1, complete genome
XX
KW   .
XX
OS   Bartonella henselae
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Bartonellaceae;
OC   Bartonella.
XX
RN   [1]
RX   DOI; 10.1073/pnas.0305659101.
RX   PUBMED; 15210978.
RA   Alsmark C.M., Frank A.C., Karlberg E.O., Legault B.A., Ardell D.H.,
RA   Canback B., Eriksson A.S., Naslund A.K., Handley S.A., Huvet M.,
RA   La Scola B., Holmberg M., Andersson S.G.E.;
RT   "The louse-borne human pathogen Bartonella quintana is a genomic derivative
RT   of the zoonotic agent Bartonella henselae";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(26):9716-9721(2004).
XX
RN   [2]
RP   1-1931047
RA   Frank A.C.;
RT   ;
RL   Submitted (08-JUN-2004) to the INSDC.
RL   Frank A.C., submitted on behalf of the Dept. of Molecular Evolution,
RL   Evolutionary Biology Centre, Uppsala University, Sweden. E-mail:
RL   siv.andersson@ebc.uu.se
XX
DR   MD5; d8ce18b7889ca0d4849ae651a4119f30.
DR   BioSample; SAMEA3138249.
DR   EnsemblGenomes-Gn; BH00220.
DR   EnsemblGenomes-Gn; BH00230.
DR   EnsemblGenomes-Gn; BH00290.
DR   EnsemblGenomes-Gn; BH00350.
DR   EnsemblGenomes-Gn; BH00370.
DR   EnsemblGenomes-Gn; BH00420.
DR   EnsemblGenomes-Gn; BH00470.
DR   EnsemblGenomes-Gn; BH00670.
DR   EnsemblGenomes-Gn; BH00680.
DR   EnsemblGenomes-Gn; BH00970.
DR   EnsemblGenomes-Gn; BH00990.
DR   EnsemblGenomes-Gn; BH01060.
DR   EnsemblGenomes-Gn; BH01070.
DR   EnsemblGenomes-Gn; BH01330.
DR   EnsemblGenomes-Gn; BH01340.
DR   EnsemblGenomes-Gn; BH01380.
DR   EnsemblGenomes-Gn; BH01420.
DR   EnsemblGenomes-Gn; BH01680.
DR   EnsemblGenomes-Gn; BH01880.
DR   EnsemblGenomes-Gn; BH02480.
DR   EnsemblGenomes-Gn; BH02720.
DR   EnsemblGenomes-Gn; BH02790.
DR   EnsemblGenomes-Gn; BH02800.
DR   EnsemblGenomes-Gn; BH02810.
DR   EnsemblGenomes-Gn; BH02820.
DR   EnsemblGenomes-Gn; BH02830.
DR   EnsemblGenomes-Gn; BH03000.
DR   EnsemblGenomes-Gn; BH03100.
DR   EnsemblGenomes-Gn; BH03260.
DR   EnsemblGenomes-Gn; BH03550.
DR   EnsemblGenomes-Gn; BH03770.
DR   EnsemblGenomes-Gn; BH03880.
DR   EnsemblGenomes-Gn; BH04090.
DR   EnsemblGenomes-Gn; BH04220.
DR   EnsemblGenomes-Gn; BH04650.
DR   EnsemblGenomes-Gn; BH05280.
DR   EnsemblGenomes-Gn; BH05570.
DR   EnsemblGenomes-Gn; BH05870.
DR   EnsemblGenomes-Gn; BH05930.
DR   EnsemblGenomes-Gn; BH06000.
DR   EnsemblGenomes-Gn; BH06010.
DR   EnsemblGenomes-Gn; BH06030.
DR   EnsemblGenomes-Gn; BH06490.
DR   EnsemblGenomes-Gn; BH06530.
DR   EnsemblGenomes-Gn; BH06570.
DR   EnsemblGenomes-Gn; BH06610.
DR   EnsemblGenomes-Gn; BH06800.
DR   EnsemblGenomes-Gn; BH06970.
DR   EnsemblGenomes-Gn; BH07260.
DR   EnsemblGenomes-Gn; BH07270.
DR   EnsemblGenomes-Gn; BH07310.
DR   EnsemblGenomes-Gn; BH07320.
DR   EnsemblGenomes-Gn; BH07330.
DR   EnsemblGenomes-Gn; BH07340.
DR   EnsemblGenomes-Gn; BH07350.
DR   EnsemblGenomes-Gn; BH07360.
DR   EnsemblGenomes-Gn; BH07370.
DR   EnsemblGenomes-Gn; BH07380.
DR   EnsemblGenomes-Gn; BH07390.
DR   EnsemblGenomes-Gn; BH07700.
DR   EnsemblGenomes-Gn; BH07880.
DR   EnsemblGenomes-Gn; BH08000.
DR   EnsemblGenomes-Gn; BH08020.
DR   EnsemblGenomes-Gn; BH08040.
DR   EnsemblGenomes-Gn; BH08430.
DR   EnsemblGenomes-Gn; BH08550.
DR   EnsemblGenomes-Gn; BH08960.
DR   EnsemblGenomes-Gn; BH08970.
DR   EnsemblGenomes-Gn; BH09000.
DR   EnsemblGenomes-Gn; BH09150.
DR   EnsemblGenomes-Gn; BH09170.
DR   EnsemblGenomes-Gn; BH09190.
DR   EnsemblGenomes-Gn; BH09440.
DR   EnsemblGenomes-Gn; BH09510.
DR   EnsemblGenomes-Gn; BH09530.
DR   EnsemblGenomes-Gn; BH09580.
DR   EnsemblGenomes-Gn; BH09590.
DR   EnsemblGenomes-Gn; BH09600.
DR   EnsemblGenomes-Gn; BH09630.
DR   EnsemblGenomes-Gn; BH09870.
DR   EnsemblGenomes-Gn; BH09880.
DR   EnsemblGenomes-Gn; BH09900.
DR   EnsemblGenomes-Gn; BH09910.
DR   EnsemblGenomes-Gn; BH10040.
DR   EnsemblGenomes-Gn; BH10190.
DR   EnsemblGenomes-Gn; BH10670.
DR   EnsemblGenomes-Gn; BH10680.
DR   EnsemblGenomes-Gn; BH10690.
DR   EnsemblGenomes-Gn; BH10700.
DR   EnsemblGenomes-Gn; BH10770.
DR   EnsemblGenomes-Gn; BH10780.
DR   EnsemblGenomes-Gn; BH10870.
DR   EnsemblGenomes-Gn; BH11120.
DR   EnsemblGenomes-Gn; BH11130.
DR   EnsemblGenomes-Gn; BH11340.
DR   EnsemblGenomes-Gn; BH11450.
DR   EnsemblGenomes-Gn; BH11480.
DR   EnsemblGenomes-Gn; BH11490.
DR   EnsemblGenomes-Gn; BH11500.
DR   EnsemblGenomes-Gn; BH11600.
DR   EnsemblGenomes-Gn; BH11680.
DR   EnsemblGenomes-Gn; BH11900.
DR   EnsemblGenomes-Gn; BH11910.
DR   EnsemblGenomes-Gn; BH11980.
DR   EnsemblGenomes-Gn; BH12010.
DR   EnsemblGenomes-Gn; BH12110.
DR   EnsemblGenomes-Gn; BH12120.
DR   EnsemblGenomes-Gn; BH12130.
DR   EnsemblGenomes-Gn; BH12190.
DR   EnsemblGenomes-Gn; BH12240.
DR   EnsemblGenomes-Gn; BH12370.
DR   EnsemblGenomes-Gn; BH12460.
DR   EnsemblGenomes-Gn; BH12490.
DR   EnsemblGenomes-Gn; BH12540.
DR   EnsemblGenomes-Gn; BH12570.
DR   EnsemblGenomes-Gn; BH12590.
DR   EnsemblGenomes-Gn; BH12600.
DR   EnsemblGenomes-Gn; BH12610.
DR   EnsemblGenomes-Gn; BH12620.
DR   EnsemblGenomes-Gn; BH12630.
DR   EnsemblGenomes-Gn; BH12640.
DR   EnsemblGenomes-Gn; BH12650.
DR   EnsemblGenomes-Gn; BH12660.
DR   EnsemblGenomes-Gn; BH12670.
DR   EnsemblGenomes-Gn; BH12750.
DR   EnsemblGenomes-Gn; BH12790.
DR   EnsemblGenomes-Gn; BH12800.
DR   EnsemblGenomes-Gn; BH12880.
DR   EnsemblGenomes-Gn; BH12940.
DR   EnsemblGenomes-Gn; BH13000.
DR   EnsemblGenomes-Gn; BH13040.
DR   EnsemblGenomes-Gn; BH13050.
DR   EnsemblGenomes-Gn; BH13060.
DR   EnsemblGenomes-Gn; BH13070.
DR   EnsemblGenomes-Gn; BH13080.
DR   EnsemblGenomes-Gn; BH13100.
DR   EnsemblGenomes-Gn; BH13110.
DR   EnsemblGenomes-Gn; BH13130.
DR   EnsemblGenomes-Gn; BH13150.
DR   EnsemblGenomes-Gn; BH13240.
DR   EnsemblGenomes-Gn; BH13450.
DR   EnsemblGenomes-Gn; BH13510.
DR   EnsemblGenomes-Gn; BH13520.
DR   EnsemblGenomes-Gn; BH13600.
DR   EnsemblGenomes-Gn; BH13630.
DR   EnsemblGenomes-Gn; BH13660.
DR   EnsemblGenomes-Gn; BH13670.
DR   EnsemblGenomes-Gn; BH13680.
DR   EnsemblGenomes-Gn; BH13690.
DR   EnsemblGenomes-Gn; BH13710.
DR   EnsemblGenomes-Gn; BH13720.
DR   EnsemblGenomes-Gn; BH13730.
DR   EnsemblGenomes-Gn; BH13740.
DR   EnsemblGenomes-Gn; BH13750.
DR   EnsemblGenomes-Gn; BH13760.
DR   EnsemblGenomes-Gn; BH13770.
DR   EnsemblGenomes-Gn; BH13780.
DR   EnsemblGenomes-Gn; BH13790.
DR   EnsemblGenomes-Gn; BH13910.
DR   EnsemblGenomes-Gn; BH13930.
DR   EnsemblGenomes-Gn; BH14260.
DR   EnsemblGenomes-Gn; BH14280.
DR   EnsemblGenomes-Gn; BH14440.
DR   EnsemblGenomes-Gn; BH14630.
DR   EnsemblGenomes-Gn; BH14640.
DR   EnsemblGenomes-Gn; BH14770.
DR   EnsemblGenomes-Gn; BH14820.
DR   EnsemblGenomes-Gn; BH15150.
DR   EnsemblGenomes-Gn; BH15160.
DR   EnsemblGenomes-Gn; BH15900.
DR   EnsemblGenomes-Gn; BH15940.
DR   EnsemblGenomes-Gn; BH15950.
DR   EnsemblGenomes-Gn; BH16260.
DR   EnsemblGenomes-Gn; BH16380.
DR   EnsemblGenomes-Gn; BH16500.
DR   EnsemblGenomes-Gn; EBG00001182737.
DR   EnsemblGenomes-Gn; EBG00001182738.
DR   EnsemblGenomes-Gn; EBG00001182739.
DR   EnsemblGenomes-Gn; EBG00001182740.
DR   EnsemblGenomes-Gn; EBG00001182741.
DR   EnsemblGenomes-Gn; EBG00001182742.
DR   EnsemblGenomes-Gn; EBG00001182743.
DR   EnsemblGenomes-Gn; EBG00001182744.
DR   EnsemblGenomes-Gn; EBG00001182745.
DR   EnsemblGenomes-Gn; EBG00001182746.
DR   EnsemblGenomes-Gn; EBG00001182747.
DR   EnsemblGenomes-Gn; EBG00001182748.
DR   EnsemblGenomes-Gn; EBG00001182749.
DR   EnsemblGenomes-Gn; EBG00001182750.
DR   EnsemblGenomes-Gn; EBG00001182751.
DR   EnsemblGenomes-Gn; EBG00001182752.
DR   EnsemblGenomes-Gn; EBG00001182753.
DR   EnsemblGenomes-Gn; EBG00001182754.
DR   EnsemblGenomes-Gn; EBG00001182755.
DR   EnsemblGenomes-Gn; EBG00001182756.
DR   EnsemblGenomes-Gn; EBG00001182757.
DR   EnsemblGenomes-Gn; EBG00001182758.
DR   EnsemblGenomes-Gn; EBG00001182759.
DR   EnsemblGenomes-Gn; EBG00001182760.
DR   EnsemblGenomes-Gn; EBG00001182761.
DR   EnsemblGenomes-Gn; EBG00001182762.
DR   EnsemblGenomes-Gn; EBG00001182763.
DR   EnsemblGenomes-Gn; EBG00001182764.
DR   EnsemblGenomes-Gn; EBG00001182765.
DR   EnsemblGenomes-Gn; EBG00001182766.
DR   EnsemblGenomes-Gn; EBG00001182767.
DR   EnsemblGenomes-Gn; EBG00001182768.
DR   EnsemblGenomes-Gn; EBG00001182769.
DR   EnsemblGenomes-Gn; EBG00001182770.
DR   EnsemblGenomes-Gn; EBG00001182771.
DR   EnsemblGenomes-Gn; EBG00001182772.
DR   EnsemblGenomes-Gn; EBG00001182773.
DR   EnsemblGenomes-Gn; EBG00001182774.
DR   EnsemblGenomes-Gn; EBG00001182775.
DR   EnsemblGenomes-Gn; EBG00001182776.
DR   EnsemblGenomes-Gn; EBG00001182777.
DR   EnsemblGenomes-Gn; EBG00001182778.
DR   EnsemblGenomes-Gn; EBG00001182779.
DR   EnsemblGenomes-Gn; EBG00001182780.
DR   EnsemblGenomes-Gn; EBG00001182781.
DR   EnsemblGenomes-Gn; EBG00001182782.
DR   EnsemblGenomes-Gn; EBG00001182783.
DR   EnsemblGenomes-Gn; EBG00001182784.
DR   EnsemblGenomes-Gn; EBG00001182785.
DR   EnsemblGenomes-Gn; EBG00001182786.
DR   EnsemblGenomes-Gn; EBG00001182787.
DR   EnsemblGenomes-Gn; EBG00001182788.
DR   EnsemblGenomes-Gn; EBG00001182789.
DR   EnsemblGenomes-Gn; EBG00001182790.
DR   EnsemblGenomes-Gn; EBG00001182791.
DR   EnsemblGenomes-Gn; EBG00001182792.
DR   EnsemblGenomes-Gn; EBG00001182793.
DR   EnsemblGenomes-Gn; EBG00001182794.
DR   EnsemblGenomes-Gn; EBG00001182795.
DR   EnsemblGenomes-Gn; EBG00001182796.
DR   EnsemblGenomes-Gn; EBG00001182797.
DR   EnsemblGenomes-Gn; EBG00001182798.
DR   EnsemblGenomes-Gn; EBG00001182799.
DR   EnsemblGenomes-Gn; EBG00001182800.
DR   EnsemblGenomes-Gn; EBG00001182801.
DR   EnsemblGenomes-Tr; BH00220.
DR   EnsemblGenomes-Tr; BH00230.
DR   EnsemblGenomes-Tr; BH00290.
DR   EnsemblGenomes-Tr; BH00350.
DR   EnsemblGenomes-Tr; BH00370.
DR   EnsemblGenomes-Tr; BH00420.
DR   EnsemblGenomes-Tr; BH00470.
DR   EnsemblGenomes-Tr; BH00670.
DR   EnsemblGenomes-Tr; BH00680.
DR   EnsemblGenomes-Tr; BH00970-1.
DR   EnsemblGenomes-Tr; BH00990.
DR   EnsemblGenomes-Tr; BH01060.
DR   EnsemblGenomes-Tr; BH01070.
DR   EnsemblGenomes-Tr; BH01330.
DR   EnsemblGenomes-Tr; BH01340-1.
DR   EnsemblGenomes-Tr; BH01380-1.
DR   EnsemblGenomes-Tr; BH01420-1.
DR   EnsemblGenomes-Tr; BH01680.
DR   EnsemblGenomes-Tr; BH01880.
DR   EnsemblGenomes-Tr; BH02480.
DR   EnsemblGenomes-Tr; BH02720-1.
DR   EnsemblGenomes-Tr; BH02790.
DR   EnsemblGenomes-Tr; BH02800.
DR   EnsemblGenomes-Tr; BH02810.
DR   EnsemblGenomes-Tr; BH02820.
DR   EnsemblGenomes-Tr; BH02830.
DR   EnsemblGenomes-Tr; BH03000.
DR   EnsemblGenomes-Tr; BH03100.
DR   EnsemblGenomes-Tr; BH03260.
DR   EnsemblGenomes-Tr; BH03550.
DR   EnsemblGenomes-Tr; BH03770-1.
DR   EnsemblGenomes-Tr; BH03880-1.
DR   EnsemblGenomes-Tr; BH04090.
DR   EnsemblGenomes-Tr; BH04220.
DR   EnsemblGenomes-Tr; BH04650-1.
DR   EnsemblGenomes-Tr; BH05280.
DR   EnsemblGenomes-Tr; BH05570.
DR   EnsemblGenomes-Tr; BH05870.
DR   EnsemblGenomes-Tr; BH05930-1.
DR   EnsemblGenomes-Tr; BH06000-1.
DR   EnsemblGenomes-Tr; BH06010-1.
DR   EnsemblGenomes-Tr; BH06030-1.
DR   EnsemblGenomes-Tr; BH06490-1.
DR   EnsemblGenomes-Tr; BH06530.
DR   EnsemblGenomes-Tr; BH06570.
DR   EnsemblGenomes-Tr; BH06610.
DR   EnsemblGenomes-Tr; BH06800.
DR   EnsemblGenomes-Tr; BH06970.
DR   EnsemblGenomes-Tr; BH07260.
DR   EnsemblGenomes-Tr; BH07270-1.
DR   EnsemblGenomes-Tr; BH07310.
DR   EnsemblGenomes-Tr; BH07320.
DR   EnsemblGenomes-Tr; BH07330.
DR   EnsemblGenomes-Tr; BH07340.
DR   EnsemblGenomes-Tr; BH07350.
DR   EnsemblGenomes-Tr; BH07360.
DR   EnsemblGenomes-Tr; BH07370.
DR   EnsemblGenomes-Tr; BH07380.
DR   EnsemblGenomes-Tr; BH07390-1.
DR   EnsemblGenomes-Tr; BH07700-1.
DR   EnsemblGenomes-Tr; BH07880.
DR   EnsemblGenomes-Tr; BH08000.
DR   EnsemblGenomes-Tr; BH08020.
DR   EnsemblGenomes-Tr; BH08040-1.
DR   EnsemblGenomes-Tr; BH08430-1.
DR   EnsemblGenomes-Tr; BH08550.
DR   EnsemblGenomes-Tr; BH08960-1.
DR   EnsemblGenomes-Tr; BH08970-1.
DR   EnsemblGenomes-Tr; BH09000.
DR   EnsemblGenomes-Tr; BH09150.
DR   EnsemblGenomes-Tr; BH09170.
DR   EnsemblGenomes-Tr; BH09190-1.
DR   EnsemblGenomes-Tr; BH09440.
DR   EnsemblGenomes-Tr; BH09510-1.
DR   EnsemblGenomes-Tr; BH09530-1.
DR   EnsemblGenomes-Tr; BH09580.
DR   EnsemblGenomes-Tr; BH09590.
DR   EnsemblGenomes-Tr; BH09600.
DR   EnsemblGenomes-Tr; BH09630.
DR   EnsemblGenomes-Tr; BH09870.
DR   EnsemblGenomes-Tr; BH09880.
DR   EnsemblGenomes-Tr; BH09900.
DR   EnsemblGenomes-Tr; BH09910.
DR   EnsemblGenomes-Tr; BH10040-1.
DR   EnsemblGenomes-Tr; BH10190.
DR   EnsemblGenomes-Tr; BH10670-1.
DR   EnsemblGenomes-Tr; BH10680-1.
DR   EnsemblGenomes-Tr; BH10690.
DR   EnsemblGenomes-Tr; BH10700.
DR   EnsemblGenomes-Tr; BH10770-1.
DR   EnsemblGenomes-Tr; BH10780.
DR   EnsemblGenomes-Tr; BH10870-1.
DR   EnsemblGenomes-Tr; BH11120.
DR   EnsemblGenomes-Tr; BH11130.
DR   EnsemblGenomes-Tr; BH11340.
DR   EnsemblGenomes-Tr; BH11450.
DR   EnsemblGenomes-Tr; BH11480.
DR   EnsemblGenomes-Tr; BH11490.
DR   EnsemblGenomes-Tr; BH11500-1.
DR   EnsemblGenomes-Tr; BH11600.
DR   EnsemblGenomes-Tr; BH11680.
DR   EnsemblGenomes-Tr; BH11900.
DR   EnsemblGenomes-Tr; BH11910.
DR   EnsemblGenomes-Tr; BH11980.
DR   EnsemblGenomes-Tr; BH12010.
DR   EnsemblGenomes-Tr; BH12110-1.
DR   EnsemblGenomes-Tr; BH12120.
DR   EnsemblGenomes-Tr; BH12130.
DR   EnsemblGenomes-Tr; BH12190.
DR   EnsemblGenomes-Tr; BH12240.
DR   EnsemblGenomes-Tr; BH12370.
DR   EnsemblGenomes-Tr; BH12460-1.
DR   EnsemblGenomes-Tr; BH12490-1.
DR   EnsemblGenomes-Tr; BH12540.
DR   EnsemblGenomes-Tr; BH12570.
DR   EnsemblGenomes-Tr; BH12590.
DR   EnsemblGenomes-Tr; BH12600.
DR   EnsemblGenomes-Tr; BH12610-1.
DR   EnsemblGenomes-Tr; BH12620-1.
DR   EnsemblGenomes-Tr; BH12630-1.
DR   EnsemblGenomes-Tr; BH12640.
DR   EnsemblGenomes-Tr; BH12650-1.
DR   EnsemblGenomes-Tr; BH12660-1.
DR   EnsemblGenomes-Tr; BH12670-1.
DR   EnsemblGenomes-Tr; BH12750.
DR   EnsemblGenomes-Tr; BH12790.
DR   EnsemblGenomes-Tr; BH12800.
DR   EnsemblGenomes-Tr; BH12880.
DR   EnsemblGenomes-Tr; BH12940.
DR   EnsemblGenomes-Tr; BH13000.
DR   EnsemblGenomes-Tr; BH13040.
DR   EnsemblGenomes-Tr; BH13050.
DR   EnsemblGenomes-Tr; BH13060.
DR   EnsemblGenomes-Tr; BH13070-1.
DR   EnsemblGenomes-Tr; BH13080.
DR   EnsemblGenomes-Tr; BH13100.
DR   EnsemblGenomes-Tr; BH13110.
DR   EnsemblGenomes-Tr; BH13130.
DR   EnsemblGenomes-Tr; BH13150.
DR   EnsemblGenomes-Tr; BH13240.
DR   EnsemblGenomes-Tr; BH13450.
DR   EnsemblGenomes-Tr; BH13510.
DR   EnsemblGenomes-Tr; BH13520.
DR   EnsemblGenomes-Tr; BH13600.
DR   EnsemblGenomes-Tr; BH13630.
DR   EnsemblGenomes-Tr; BH13660.
DR   EnsemblGenomes-Tr; BH13670.
DR   EnsemblGenomes-Tr; BH13680-1.
DR   EnsemblGenomes-Tr; BH13690-1.
DR   EnsemblGenomes-Tr; BH13710.
DR   EnsemblGenomes-Tr; BH13720.
DR   EnsemblGenomes-Tr; BH13730-1.
DR   EnsemblGenomes-Tr; BH13740-1.
DR   EnsemblGenomes-Tr; BH13750-1.
DR   EnsemblGenomes-Tr; BH13760.
DR   EnsemblGenomes-Tr; BH13770-1.
DR   EnsemblGenomes-Tr; BH13780-1.
DR   EnsemblGenomes-Tr; BH13790-1.
DR   EnsemblGenomes-Tr; BH13910.
DR   EnsemblGenomes-Tr; BH13930.
DR   EnsemblGenomes-Tr; BH14260.
DR   EnsemblGenomes-Tr; BH14280.
DR   EnsemblGenomes-Tr; BH14440-1.
DR   EnsemblGenomes-Tr; BH14630.
DR   EnsemblGenomes-Tr; BH14640-1.
DR   EnsemblGenomes-Tr; BH14770.
DR   EnsemblGenomes-Tr; BH14820.
DR   EnsemblGenomes-Tr; BH15150.
DR   EnsemblGenomes-Tr; BH15160.
DR   EnsemblGenomes-Tr; BH15900.
DR   EnsemblGenomes-Tr; BH15940.
DR   EnsemblGenomes-Tr; BH15950.
DR   EnsemblGenomes-Tr; BH16260-1.
DR   EnsemblGenomes-Tr; BH16380-1.
DR   EnsemblGenomes-Tr; BH16500.
DR   EnsemblGenomes-Tr; EBT00001761447.
DR   EnsemblGenomes-Tr; EBT00001761448.
DR   EnsemblGenomes-Tr; EBT00001761450.
DR   EnsemblGenomes-Tr; EBT00001761452.
DR   EnsemblGenomes-Tr; EBT00001761454.
DR   EnsemblGenomes-Tr; EBT00001761459.
DR   EnsemblGenomes-Tr; EBT00001761461.
DR   EnsemblGenomes-Tr; EBT00001761462.
DR   EnsemblGenomes-Tr; EBT00001761464.
DR   EnsemblGenomes-Tr; EBT00001761466.
DR   EnsemblGenomes-Tr; EBT00001761467.
DR   EnsemblGenomes-Tr; EBT00001761469.
DR   EnsemblGenomes-Tr; EBT00001761471.
DR   EnsemblGenomes-Tr; EBT00001761473.
DR   EnsemblGenomes-Tr; EBT00001761476.
DR   EnsemblGenomes-Tr; EBT00001761477.
DR   EnsemblGenomes-Tr; EBT00001761480.
DR   EnsemblGenomes-Tr; EBT00001761482.
DR   EnsemblGenomes-Tr; EBT00001761484.
DR   EnsemblGenomes-Tr; EBT00001761486.
DR   EnsemblGenomes-Tr; EBT00001761488.
DR   EnsemblGenomes-Tr; EBT00001761489.
DR   EnsemblGenomes-Tr; EBT00001761491.
DR   EnsemblGenomes-Tr; EBT00001761492.
DR   EnsemblGenomes-Tr; EBT00001761493.
DR   EnsemblGenomes-Tr; EBT00001761495.
DR   EnsemblGenomes-Tr; EBT00001761498.
DR   EnsemblGenomes-Tr; EBT00001761499.
DR   EnsemblGenomes-Tr; EBT00001761502.
DR   EnsemblGenomes-Tr; EBT00001761504.
DR   EnsemblGenomes-Tr; EBT00001761508.
DR   EnsemblGenomes-Tr; EBT00001761510.
DR   EnsemblGenomes-Tr; EBT00001761511.
DR   EnsemblGenomes-Tr; EBT00001761513.
DR   EnsemblGenomes-Tr; EBT00001761516.
DR   EnsemblGenomes-Tr; EBT00001761517.
DR   EnsemblGenomes-Tr; EBT00001761519.
DR   EnsemblGenomes-Tr; EBT00001761522.
DR   EnsemblGenomes-Tr; EBT00001761523.
DR   EnsemblGenomes-Tr; EBT00001761525.
DR   EnsemblGenomes-Tr; EBT00001761527.
DR   EnsemblGenomes-Tr; EBT00001761529.
DR   EnsemblGenomes-Tr; EBT00001761531.
DR   EnsemblGenomes-Tr; EBT00001761533.
DR   EnsemblGenomes-Tr; EBT00001761536.
DR   EnsemblGenomes-Tr; EBT00001761538.
DR   EnsemblGenomes-Tr; EBT00001761540.
DR   EnsemblGenomes-Tr; EBT00001761541.
DR   EnsemblGenomes-Tr; EBT00001761542.
DR   EnsemblGenomes-Tr; EBT00001761543.
DR   EnsemblGenomes-Tr; EBT00001761544.
DR   EnsemblGenomes-Tr; EBT00001761545.
DR   EnsemblGenomes-Tr; EBT00001761546.
DR   EnsemblGenomes-Tr; EBT00001761547.
DR   EnsemblGenomes-Tr; EBT00001761548.
DR   EnsemblGenomes-Tr; EBT00001761549.
DR   EnsemblGenomes-Tr; EBT00001761550.
DR   EnsemblGenomes-Tr; EBT00001761551.
DR   EnsemblGenomes-Tr; EBT00001761552.
DR   EnsemblGenomes-Tr; EBT00001761553.
DR   EnsemblGenomes-Tr; EBT00001761554.
DR   EnsemblGenomes-Tr; EBT00001761555.
DR   EnsemblGenomes-Tr; EBT00001761556.
DR   EnsemblGenomes-Tr; EBT00001761557.
DR   EnsemblGenomes-Tr; EBT00001761558.
DR   EuropePMC; PMC1196136; 16109957.
DR   EuropePMC; PMC1214607; 16151107.
DR   EuropePMC; PMC1347342; 16428394.
DR   EuropePMC; PMC1489502; 16825371.
DR   EuropePMC; PMC1539124; 16893981.
DR   EuropePMC; PMC2147075; 18094753.
DR   EuropePMC; PMC2395075; 18367567.
DR   EuropePMC; PMC2568045; 19086373.
DR   EuropePMC; PMC2600320; 18598628.
DR   EuropePMC; PMC2704820; 19411426.
DR   EuropePMC; PMC2711468; 19881921.
DR   EuropePMC; PMC2883598; 20548954.
DR   EuropePMC; PMC2897887; 20625509.
DR   EuropePMC; PMC2937705; 20660218.
DR   EuropePMC; PMC3291365; 17326937.
DR   EuropePMC; PMC3492683; 23166430.
DR   EuropePMC; PMC3769854; 24031650.
DR   EuropePMC; PMC3938422; 24586319.
DR   EuropePMC; PMC4295888; 25590435.
DR   EuropePMC; PMC4465226; 19242658.
DR   EuropePMC; PMC4517744; 26197233.
DR   EuropePMC; PMC470741; 15210978.
DR   EuropePMC; PMC4867040; 27226890.
DR   EuropePMC; PMC4964325; 27410916.
DR   EuropePMC; PMC5387305; 27790856.
DR   EuropePMC; PMC5475225; 28490579.
DR   EuropePMC; PMC5875183; 15870453.
DR   EuropePMC; PMC5928811; 29436346.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00518; speF.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; BX897699.
DR   SILVA-SSU; BX897699.
DR   StrainInfo; 114970; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1931047
FT                   /organism="Bartonella henselae"
FT                   /strain="Houston-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:38323"
FT   CDS_pept        1..825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26817"
FT                   /db_xref="GOA:Q6G5B1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26817.1"
FT                   /translation="MKREKKSFHLHMLSDATGETLISVGRAVASQYTMSQATEHIYPMI
FT                   RNKTQLQRALDEIQQEPGIVLYTIIDKKIKILLRKRCEKIEIPCIDILHPVLNAFKSYL
FT                   GIPTNLRVSAQHGLNADYFRRIEALDFTIEHDDGQSPNSLSDADVILVGISRTSKTPTS
FT                   IYLANRGIKTANVPLIPGINLPDTLLGAKNALIIGLIASVERISHIRQNRNLGDDFSLE
FT                   SYTDRINISEELTYAKRICERFSWPVIDVTRRSIEETAAEIFELLSRFREGK"
FT   CDS_pept        837..1433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="BH00020"
FT                   /product="Septum formation maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26818"
FT                   /db_xref="GOA:Q6G5B0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26818.1"
FT                   /translation="MLAETLILASLSSYRAQLLKKAGLNFFVKGASFDEREVEKTGKTK
FT                   NPKELSCFLASAKAKNVSERFPEALVIGCDQILDLEGQVFHKVKSIEEAHQRLCILSGK
FT                   IHSLHSAVALFQNGQEIWVEAFSAHMSVRPLSSEFIERYLARVETDILNSVGVYQIEGE
FT                   GIHLFEKIEGDFFTIIGLPLLPLLIKLRHFEVIDG"
FT   CDS_pept        1426..2307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BH00030"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26819"
FT                   /db_xref="GOA:Q6G5A9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26819.1"
FT                   /translation="MVNLTIKREKKKIPRAFVVGTPIHHSKSPKIHNFWLKQYDLQGEY
FT                   LAQEVTSEEFRDFLTSLKRRGFCGGNVTLPHKQEAFHLANYKDDVATMIGAVNTLWYEG
FT                   DKLCGTNSDAYGFSANLDDSAPDWMGETALVFGAGGAARAILYALKKRGFERICLVNRT
FT                   KQRAESLAEHFGKPVEVCDWYKAHEILYQADLIVNTTSVGMINSNEKESTSFFCDFHKT
FT                   KTTALVTDIVYTPLVTPFLQRAKAHGLRTVDGLGMLLHQAVLGFERWFGIRPRVTKALR
FT                   ATILQDMGEKRG"
FT   CDS_pept        2304..2891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BH00040"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26820"
FT                   /db_xref="GOA:Q6G5A8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26820.1"
FT                   /translation="MKIIGLTGSIAMGKSTVADFFRQAGISVFSADEAVYKLYKSEPTL
FT                   SLIEYKFPGVFENGKVNRQKLSEILINDNEKLQTLEKIIHPLVQEKEKKFIDTARQQGE
FT                   KLVVLDIPLLLETKGEKRVDSVVVVSAPLAIQKERAMIRQNMSEKKFAFINGRQMSDEK
FT                   KRARADFIIDTGKDLENTREQVLFVIKSLLKN"
FT   CDS_pept        2896..3603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BH00050"
FT                   /product="DNA polymerase III epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26821"
FT                   /db_xref="GOA:A0A0R4J9B9"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26821.1"
FT                   /translation="MREIIFDTETTGLDKEKDRIIEIGCVEMVDRYLTGRRFHVYLNPQ
FT                   GVIIPDEVVAVHGLTNERLKNEKSFSDIADEFLEFINGATMIAHNASFDIGFLNAELAR
FT                   ANKPLISVDNILDTLAMARRKFPMAPNSLDVLCKRFGIDNSHRVFHGALLDAEILADIY
FT                   IELIGGKQGVLVFGNNGSVHEESENDKNAFSAVKIRPQNLSPRLSVQEKTMHADFVKKM
FT                   GEKALWNSFKIPQ"
FT   CDS_pept        3932..6838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BH00060"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BH00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26822"
FT                   /db_xref="GOA:A0A0H3M1T0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26822.1"
FT                   /translation="MKATDHLFLVDGSGYVFRAYYALPPLKRKKDGLPVGAVAGYCNML
FT                   WKLLCDARNTATGIVPTHFAVVFDYSSDTFRKQIYPQYKANRVMPPEDLIPQFSLIRQA
FT                   TKAFNLPCIEKEGFEADDLIATYAQLATKVGAKTTIISSDKDLMQLVNTHVSLYDGMKD
FT                   RHIGISEVIEKWGVAPEKMVDLQALTGDPTDNVPGIPGIGPKIAAQLLNQFGSLDLLLQ
FT                   HVTEVKQTKRRENIQAYSEQAKISRELVQLKTDVPIENDLDDFILEPQDGPRLIAFLKA
FT                   MEFATLTRRVAEATACDAAVIDVLDIDVEWEKSGYERDSNFKRAERESLHDFSENSPQR
FT                   LAQKRQDQALSQKITRDTYTTIFDEKTLKEWLSQAQEQGFFAFDTETTSLDPIQAKLVG
FT                   FSLALQPEKAAYVPLEHVEGENDLLKGGRIVSQIETQKALTLLKPILEDQAVLKIGQNI
FT                   KYDWLVMKQYGIVIHCFDDTMLLSYALEAGTLTHNMNALSERWLGHKPIAYKDLTHNGK
FT                   KITSFAEVDLKQATLYAAEDADITLRLWQVLKPQLVAQGMTRIYERLDRPLIEVLARME
FT                   ERGILVDRQILLRLSGELAQAAFILEEEIYQLSGEKFNLASPKQLGDILFGKMGLPGGA
FT                   KTKGGQWSTSAQTLEELAAEGHILPRKIIDWRQLAKLKSTYTDALPSYILPKTGRVHTN
FT                   YSLAITSTGRLSSSEPNLQNIPVRTAEGRKIRTAFVAPKRHVLLSADYSQIELRILAHI
FT                   ANITALKEAFSRGQDIHAITASQIFGVAIEGMPSDIRRRAKAINFGIIYGISAFGLANQ
FT                   LGLSRQEAGRYIQLYFERFPGIKDYIETTKTFARQNGYVETIFGRRIHYPEIKAASPQV
FT                   RSFNERAAINAPIQGSAADIIRRAMIQMEDALEKEKLSAKMLLQVHDELVFEVPEEESK
FT                   KTMAVVKKVMENATMPVLSLSVPLEVKVMVAQNWDEAH"
FT   CDS_pept        complement(6854..7735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26823"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26823.1"
FT                   /translation="MAYTLHKMTKKLHKQKFFQFAAFIQKKFDSPLFKAIRKRSCHWSD
FT                   ISNHNDNYDLTVASYNVHKCIGVDKVFNPTRIVQVITELQVDILALQEADKRFGERIGL
FT                   IDLQLLKAETGLIPVPLNTMSPHGHGWHGNALFLRKGHVCDTLQITLPGIEPRGAVIAD
FT                   LEMEVGPIRVIAAHFGLLRHSRNQQTKMLLSLLQKRPLMPTLLIGDFNEWRIGKGSSLN
FT                   HFAPYFDSTVGTVPSFPSRFPLLALDRILAFPHQLVIRIENHHSPLARIASDHLPIKAY
FT                   LDLSHAMATLKK"
FT   CDS_pept        complement(7827..8600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26824"
FT                   /db_xref="GOA:A0A0R4J868"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J868"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26824.1"
FT                   /translation="MADFKNSRPASLFHADASIDQGLRSYMLGVYNTMAIGLLITAAAA
FT                   YAVASLATTTEMSQAAAQISSSVYLTSFGVTFYTSPFSYIIMFAPLVAVLFLSFKINTL
FT                   STSTARSLFFGYAALVGLSLSSIILRYTTESIVQTFVISAATFGALSLYGYTTKRDLTA
FT                   MGSFFFIGLVGLMLSMIVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDA
FT                   NDTQGRKIIMGALNLYLDFINMFVFLLQFLGSNRD"
FT   CDS_pept        complement(9215..11056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26825"
FT                   /db_xref="GOA:A0A0H3LVH7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26825.1"
FT                   /translation="MNEKNSAPPKKFLSADDRSFLLSSRAFAPLFWCQFFSAFNDNFVK
FT                   NTLVFLIITCSALEYQPSLISLTNGVFSLPYLLFSATGGQLADCFSKAKIARLIKFFTL
FT                   FIALATAGSLFLSSITLLMFCLFLFSSASALFGPIKYATLPDHMAKSHLPRANAWIETA
FT                   TFIAILLGTLWAGLSFDFQNELQIIPALVIIISAILSWATSCFMPENIPAQSDLIVDCN
FT                   IIRATKSILKCCIQEKRLLIVSLIVSWFWFIAATLLSIIPILMAFFNYLPNGTIMFLIL
FT                   FSIFGALGSAIAAWLSAERINLLLAAIGTFVFGLVCIDLSIIFNGLDPELKAEKFIDFF
FT                   SHSKLLRMIFDFALAATSSTFLVVPGFSALQAWAKPHKRARVIAANNILNSAIMVMGAG
FT                   IITFIQYLGTSVDKIVLILGISSLITAIVLLKYLPTNPLHDFIFIFFRIFFRLEIKGIE
FT                   NFSKVEKSSILAFNHVSFLSTFLALTICEIINLRNPIIVIDVHTAKLWWMRPFIKYINV
FT                   FPIDLTKSFKNRHFINTIIQKKPLIVFLEKNISVTKDFIKVYEKSAAIIDKAKVVPIKI
FT                   YGFENSFFSSFSNIHTRRKLFPKITAVIHEPVDFNMI"
FT   CDS_pept        complement(11591..12082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="BH00100"
FT                   /product="Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26826"
FT                   /db_xref="GOA:Q6G5A2"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26826.1"
FT                   /translation="MTRKSFPFFLLGLILTVGIDQAVKYWVMHNIPLGTETPLLPFLSL
FT                   YHVRNSGIAFSFFSSFSHWGLIFLTLIILIFLLWLWKNTQYNKSLTRFGFTLIIGGAIG
FT                   NLIDRICFYYVIDYILFYINDVFYFAVFNLADTFITLGVIAIIIEELLSWIKRKSTFSE
FT                   "
FT   CDS_pept        complement(12079..12942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00110"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26827"
FT                   /db_xref="GOA:A0A0H3LV82"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26827.1"
FT                   /translation="MDCLNMCMPKTGKVKEITSLSNPIIKDLKALSQKKNRNREGLFMA
FT                   EGLKLVIDALNLGWKIQTLIFSKSKISNTAIENTAAHTVANGGLVIKASQKVMESIARR
FT                   DNPQTVIGIFKQQWQSLEMITGQAEDVYVALDRVRDPGNLGTIIRTADAVGAKGVILIG
FT                   ETTDPFSPETVRATMGSIFSVPLYRFDESAFLNWSTHFKGMIVGTHLKGSIDYRTIDFK
FT                   NGPVILLMGNEKQGLPDILANCCDKLARIPQSGRADSLNLAVATAIMLYEIRRSYLTLE
FT                   PRKAAL"
FT   CDS_pept        complement(12930..13862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00120"
FT                   /product="Sam dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26828"
FT                   /db_xref="GOA:A0A0H3M1T5"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1T5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26828.1"
FT                   /translation="MLAQCFQPNSSGIYPQEKLPLILETGVSPDYALIDSGNGKKLERY
FT                   GAYRIIRPEGQALWKPALSEKHWANVDAIFTGNRDEEGVGRWYFPKKPLDETWPLSWNG
FT                   LSFLGRFTSFRHVGVFPEQDAHWRFMEKQIVNATRPIKLLNLFGYTGIASLISARAGAN
FT                   VTHVDASKKAIAWAKANQEKAGLSDRSIRWICDDAVKFVERELRRQKTYDMILLDPPAY
FT                   GRGPHGEIWQLFDHLPAMITNCRKLLSDEPLAVVLTAYSIRASFYALHTLMRDEFINLG
FT                   GTVESGELILREKTTGRALSTSLFSRWIA"
FT   CDS_pept        complement(14030..14326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26829"
FT                   /db_xref="GOA:A0A0R4J893"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J893"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26829.1"
FT                   /translation="MTTKRIILAIVLVTITVLLIAFIIANRQIVTLTLDPFRINSENFT
FT                   YQAPLFIWLFIFFGVGILLSSIIHWFTCRKYKKALKESKAELEKLKISIADMV"
FT   CDS_pept        complement(14335..14613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="BH00140"
FT                   /product="Integration host factor beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26830"
FT                   /db_xref="GOA:A0A0R4J829"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J829"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26830.1"
FT                   /translation="MVKSELVQIIARHNPHLFQRDVENIVNAIFEEISTALVNGNRVEL
FT                   RGFGAFSVKSRSARNGRNPRTGEAVMVEEKWIPFFKTGKDLRDRLNQ"
FT   CDS_pept        14805..15455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26831.1"
FT                   /translation="MSLQDHSKIFSTSEELSFGDAFKKASRHSRSISILKFLLPLCALT
FT                   TALVFCWFTFFFVPVAFDPVISKDEESEMMKLTMLNPKLEGYTRSHEPYWLKAEKAFQD
FT                   HTRSGVIGLQNITAEAFLGKQRRVFLDAQGGNYDNMNGCLQLDKPFRITTNDGMIAQFM
FT                   AADINLSEGQLNTDKRVNIRRAGLHLAANALQIREKGQEMYFHGGVHLVFDKQ"
FT   CDS_pept        15567..16145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26832"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26832.1"
FT                   /translation="MGITLALSLGMLGLGAVSGYAEVAHFGIHLSDDKEPVELYANSLE
FT                   IRDKEGIALFNGDVSVIQGEHLLRTAKLVVYYDKTRKEADKNQGNTKTALSTWFGSTGI
FT                   KKMEALGKVYIKIATQIATGDKGVYDGKSKMMSLTGKNVVLTNGDNVATGCKLTADMKS
FT                   GKAFLEGCKTSEKKGRVSIIFKQSQKNSH"
FT   CDS_pept        16152..16946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00170"
FT                   /product="ABC transporter/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26833"
FT                   /db_xref="GOA:A0A0R4J6U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26833.1"
FT                   /translation="MFGIKRKKQADGHNFASEALRKRLKGTLIASHLVKFYRGRQVIND
FT                   VSFGIRTGEAVGILGPNGAGKTTCFYMVTGLIKSDGGSIKIDGFDITHLPMYRRARLGI
FT                   GYLPQEASIFRGLSVEKNIKAVLEVVEKDRLKRREDLDALLHEFKIDHLRKMPALSLSG
FT                   GERRRLEIARALASRPNFMLLDEPFAGIDPIAIFDIQQLIRYLTRRGIGVLITDHNVRE
FT                   TLGLVDRAYIIHAGQVLVHGCPNDIINDADVRRIYLGNQFSL"
FT   CDS_pept        18188..18652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="BH00180"
FT                   /product="Nitrogen regulatory IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BH00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26834"
FT                   /db_xref="GOA:A0A0H3LWZ4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26834.1"
FT                   /translation="MNLSELIAPEAIIPALKANSKKQVLQILAEKAAGLTGLNERVVFD
FT                   IVLQREKLGSTGLGGGIAIPHGKLPNINRIIGIFARLESPVDFEALDDEPIDLVFLLLA
FT                   PENAGADHLKALSQIARVLRCSDVVQKLRNTHDANALYALLIQNSTSNAA"
FT   CDS_pept        19662..20171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00190"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26835"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M489"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26835.1"
FT                   /translation="MKMFKKKFIAAFVMVFISAGATCAQAPNRLDQFEAWGAYSYKSPQ
FT                   KTICYVLSMPLESLPTTVKHGDNFFLVTKRSHSPLSFEPQFMAGYPLKEGSRVTVTIGS
FT                   KDFDFFTKDSSAWLASPALEKQLVSAMRAGKNMKVSAFSKRGTHTTYIYSLKGVTAALN
FT                   AAQKCH"
FT   CDS_pept        20212..21438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26836"
FT                   /db_xref="GOA:Q6G592"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G592"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26836.1"
FT                   /translation="MAVSYDLRPIGTCPVRESDNIIVKERSKLSLIGLSQDEMAEALKA
FT                   IGIPERQTRMRVRQLWHWLYVRGVSNFDEMLNISKPMQEIFKKHFSIARPEIAGEQISK
FT                   DGTRKWLLRFPPRGAGRPVEIETVYIPEEGRGTLCLSSQVGCTLTCSFCYTGTQVLVRN
FT                   LTAEEILAQLLVARDCLGDFPDRNTPDGAIVPVEGRKITNIVMMGMGEPLYNFEAVKKA
FT                   LLIASDGNGLSLSKRRITLSTSGVVPGMIRTGEEIGVMLAISLHAVNDTLRDMLVPINK
FT                   KYPLALLMDACRQYPGLSNAKRITFEYVMLKDVNDSLDDAKRLVQLLKGIPAKINLIPF
FT                   NPWPGSNYQCSDWEQIERFADVVNQAGYASPIRIPRGRDILAACGQLKSASERLRKSER
FT                   LHLEHIVNS"
FT   CDS_pept        complement(21443..22081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26837"
FT                   /db_xref="GOA:A0A0R4J8P0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26837.1"
FT                   /translation="MSFLPEWHIIIQFSLASLVLALIPGPDIMLSVGRTIVQNKKAGIM
FT                   CACGSATGFAIQVVAVALGLSVLIFTSPRIFFVLKIVGAFYLLWLAIQTLYKPSTLSFK
FT                   KTSPKNQSLKRNYFTAIVINLLNPKVLLFNMTFLPQFINANDPMVTQKLLILGLSYIPI
FT                   SFPINISIVFMAHKFSKGIKQNPSYLRFLDWLISGIFTSFALSILIDEY"
FT   CDS_pept        22318..23747
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00220"
FT                   /product="argininosuccinate synthase"
FT                   /note="Identified by comparison to Agrobacterium
FT                   tumefaciens"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        23371..23481
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00230"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        24179..25840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BH00240"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26840"
FT                   /db_xref="GOA:A0A0H3LV91"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26840.1"
FT                   /translation="MMRDQSDALSLTPELKNAAVQSRAWPFEEARKIIKRYEKTGYPER
FT                   VIFETGYGPSGLPHIGTFGEVARTTMVRHAFQILTENKVKTKLLCFSDDMDGLRKVPDN
FT                   VPDREKVESYLGQPLSRIPDPFGDMYPSFGAANNARLRAFLDRFGFDYEFASATDYYSS
FT                   GRFDETLLKILDCYDKVMAIVLPTLGEERRATYSLFLPISPFSGKVLQVPMIARNVEKG
FT                   TVTYIEPETGETIETEVTGGKVKCQWKVDWAMRWTALGVDYEMAGKDLIDSTNLSSKIC
FT                   KVLGGKPPEGFNYELFLDEMGQKISKSKGNGLTIDEWLTYAPTESLGLYMFAKPKTAKR
FT                   LYFDVIPKAVDEYYAHLSAYGRQKWQDRLNNPVWHIHNGCPPQGDLPVSFAMLLNLVSA
FT                   SNAENKEVLWGFISRYAKEANAQTYPELDQLVQFAIKYFDVFVKPNKKFRAADDSERAT
FT                   LAQIDAKLASLPETADGNTIQNALLDVARLTERYQDHNKKSPEGGPGVSNVFFQMLYEV
FT                   LLGQERGPRLGSFIALYGINEMRALIAEALARPMGE"
FT   CDS_pept        25840..27417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="BH00250"
FT                   /product="Peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:BH00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26841"
FT                   /db_xref="GOA:A0A0H3M1U0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26841.1"
FT                   /translation="MEKRAQEVKRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEVK
FT                   AKKDRIQTRSDWMHIERDRGISVVTSVMTFEYEDHIFNLLDTPGHEDFADDTYRTLTAV
FT                   DSAIMVLDGARGIEPRTLKLFEVCRMRDIPIVTFVNKMDREARDPIELLDEIEEKLALD
FT                   TAPITWPIGTGKDFVGTFDLHHNRFRQKDDEVTQQAVSGPDEVVNLLPENERLSFIEGV
FT                   ELARSACKNFDFQAFQEGHMTPVYFGSALRNFGVRDLINALVAFGPSPRDQGADQRTVR
FT                   ATESQMTGFVFKIQANMDPNHRDRIAFFRVCSGTLERGMKTKLVRTGKSMTLSAPQFFF
FT                   ARSRQIADQAYAGDIVGIPNHGTLRIGDTLTEGENILFKGVPNFAPEILRRVCLGDPMK
FT                   AKKLKEALHQMAEEGVVQLFIPDDGSPSLIGVIGALQIDVLKERLKIEYGLPVSFEPAR
FT                   FNICRWISAQSKDEMQKFLTNHYSAIAHDLEGDPVFLAENHFSLNYEAERAPKIKFAAF
FT                   KDYQIRSE"
FT   CDS_pept        complement(27517..27840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BH00260"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BH00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26842"
FT                   /db_xref="GOA:A0A0R4J8Z7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26842.1"
FT                   /translation="MSCIKVDKSNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEIS
FT                   MEMQNQVKIAKVNIDENPELATQYGVRSIPTLLMFKDGNIASNMVGAASKGRVSEWIKE
FT                   GLR"
FT   CDS_pept        complement(27936..31418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="BH00270"
FT                   /product="ATP-dependent nuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BH00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26843"
FT                   /db_xref="GOA:A0A0H3M492"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M492"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26843.1"
FT                   /translation="MTLFSIPEAALDAQATATHPKTNVWVSANAGSGKTHVLSERVIRL
FT                   LLNGTPPARILCLTYTKAAAAVMQSRIFRTLSSWNELDDTQLQQTLSQLENKPITAQKL
FT                   TYARQLFARALETPGGLKIQTIHAFCESLLHHFMLEANIAGHFELVDDISRKKLLQEAR
FT                   RQLLEHESAQSALKQLLKVISEHTFNQLLYEATEKQHKLSDFLTSVLSENGEKKLHALF
FT                   QLAPDDTNEQLLEKIQQTARLPLYALTHCQTYGNKSLKEMIAKFSQLEEACDEENIIDI
FT                   ISNIYFKMKGEPRNFSRLSCKKSDEIWPFIQQTIEDKQSKLSLLLEKYQCSKIATLNKA
FT                   AFQLCARYLKIYANLKKANGFLDFNDLIERTLHLLKRQGASQWVHYKLDNGLDHILLDE
FT                   AQDTNPEQWQIIQLLAQEFFTGHSQRTNIRTLFAVGDEKQSIYSFQGAAPENFAENGRM
FT                   IQKKVQQVNQKFEKIQLNYSFRSTPDVLKSVDLVFEKPENYKGLSAENTKTVHEAIRAH
FT                   SPGEVILWDAISKEKSEFPDAWHLSVDHLDTPETRLAEKIAETIANWLHNGEMLPAKGR
FT                   LMRASDIMVLVRKRDHFVSALSRALKLRNIPIAGADRLQLTKHMSVRDLMALARFVLQP
FT                   KDDLSLACVLKSPLFSLSEEELYQLAAHRTGSLWQSLCMHASHVSSHASFRDAFENLNH
FT                   YRTLVDKIPVFEFYSYILNNDKGRQKILARLGSEANDVLDAFMDYTLTLQKTGLPGLQA
FT                   FLETLSANDPEIKREFDQNHEEVRIMTVHAAKGLEASVVFLVDPGSAIWHSQHAPHLLK
FT                   TPSSHPQWSDQQAFIWRPNEKFDTKLSQQALSYLKERAEEEYRRLLYVGMTRAEDRLFV
FT                   CGYSGEKTSPHTWLQLVKNALKPHAFVIDGPAEDIAAWRYCITASSYAPIKQEVPCAEY
FT                   QTLPSLPTFFSHKVPEEPALPKPLRPSVASLSIEADTEISSNLKYLSLSPVLGETNINR
FT                   AFSIEYGNIVHRLLQHLPNCPAQKRRDYAQYYLNTKASHWQETQKEKALCHVWQILDHS
FT                   SLKPLFSDHSRAEVSLMGIVKIRGKEQAISGQIDRLYITENSIIFADFKTGAPPEDEAA
FT                   IAPHYLLQMALYRKLLQAIHPDKDIQALLVYSKEVKVFKLPPKKLDALLDEIA"
FT   CDS_pept        complement(31415..34537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26844"
FT                   /db_xref="GOA:A0A0H3LVK1"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26844.1"
FT                   /translation="MTYKPRVFSISSGTAFLPHFVDALLSSALIDDFAPNGDIQTALAD
FT                   TLIYVPTRRAARALRTAFVEKSDTKSTFLPTIRALGDVDEDSFLFGENHNNILNPPIEE
FT                   SERLLLLARLIRPWRENLPDHLRTMFGTEDVLIPAHTADAIWLAQDLAHLMDEMETEAT
FT                   DWSKLKEIAPDMVAEWWQITLDFLTIVTQSWPQILKERGRSNPAEWRNQVLKMHAETLW
FT                   RTQPNKPILAAGVSGSIPAVSHLLKVIASLPKGAVVLPGLDLHMDEEQWEALGTINEKK
FT                   TICNVFDRTANAFSHPQYHFKKLLSLIGCQRIHVREIGQQSAIKKKRTALLSEALRPAS
FT                   TTERWVQIVRDDYENLCENWSFIEAINEREEALAIAVALRNAIEEPQKTAALITNDRNL
FT                   ARRVAAELQRFGIEANDSGGIPLAQTLPATLLRLLLENVFQSGDPIAFLSLLKHPLTTL
FT                   GQNRHRLREMAENFELFVLRGNTSCINLCECDKFFETWTEIYSHKISETNVIDQQNCEE
FT                   ARLLCHLLVKAVEPLASLMKQKKECTVNEAMVATVEVFENFGRDENNSLAHLYQHEAGQ
FT                   TLLTFLRELVSDQSGLKFQLCEWLAIFSALIATRSVTPSPGGHPRLFIWGTLESRLQTV
FT                   DTVVIGGLNEGSWPITTRNDAFLSRPMKIMLTLEPPEKRIGLSAHDFQWAMGMNKVVMS
FT                   RALRVNHAPSLPSRWLQRLETVIGKQVWKQIRARGEIFLHWTKMLDHTNIIAGAKRPYP
FT                   VPPLDARPRHFSVTEIATLRYDPYAIYAKKILRLKPLKALIHAPGASERGILYHAIFSA
FT                   FCTKVKNPNSANVLDVLLNIGREEFNKFNLPLDIEAIWWNNFENLAPFFLQWEQSLGPR
FT                   KRYAEVVSQKIPIGTTGLTLSGRADRIDVLPGKMVEIIDFKTSTPPSSKQVRDLLFPQL
FT                   ALEAALLMQGAFTDFQDLTPVNLSYIPLNGKGKIIPQSIFLKKDTKDHQSAMDLGEKAW
FT                   KHLIALMDYYQNPQQGYLSHAVPITKRYEGDYDHLARLWEWSSGFQKADQS"
FT   CDS_pept        36400..37859
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00290"
FT                   /product="chlorosome protein"
FT                   /note="Identified by comparison to Bartonella quintana"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(37929..40394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00300"
FT                   /product="Sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26846"
FT                   /db_xref="GOA:A0A0H3LV96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26846.1"
FT                   /translation="MLSFGDYNSKEKAQKMIRICTHIFCFLFLFFPTCAAAQLLETYLP
FT                   STFTLPDGPWLLLALCGGISCASLFTCMAVIMRAKKTLQKPLQTFQTDLSEKLKYYEWL
FT                   LEETGQYLLIWENPTALPRVVGNIPTLQKVGIHQQDFQRFEFWLEENSLRELDYALKQL
FT                   RYKSHPFELSLFTKNNMLLHVTGVIAGTVAIARFQDISLQQSENARLQKNIARILTELR
FT                   MQRNLLDVIQEPVWIKDSEGKICFINRAFREITGFREGSNEVVDLFNETTQRKTDETET
FT                   VFQEHVHTVLDGERHRFHLTRITTAEGMAAFARDDSAYENLANELRRVFQNHCETLDQI
FT                   STAVAVFDSNQKLKFCNHAFKILWPLENSFLESEPSHTLFLERLREKGLIGEHPDWRTW
FT                   KEELLKAYRQTESNQQIWNLPDGRTVRVISSPHPQGGVTWLYENLTEKIDLEQRYNTLI
FT                   KIQGETLDKLSEGVVVFGTDGCLRLSNPALSKLWSLPYNLLVEGTHITQLQSYCSPLTL
FT                   RQEWDWFTKFITGFAEERDTYSGRMDLKNGMIIDYTLVPLPNGETMLTFVNVTDTVHVA
FT                   RALQEKNEALESADRLRNEFVQHVSYELRTPLTNIIGFSDILRDQIFGPINERQQEYLG
FT                   HIHSESGSLLNIVNDILDLATLDAGIMELDIKPVNIADAMVQAVARVEERLNGRHITLL
FT                   QQISPSLNFISVDATRLHQIFVNVLSNAINFATEASTIEFCAEEKDDDIVFSVHNEGSD
FT                   IPEDILDRIFKRFSSHSHHGGRAGAGLGLSLVKSFVELHGGRVEIFTGTGQGTTVKCFF
FT                   PISKEDKVF"
FT   CDS_pept        complement(40432..41829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="BH00310"
FT                   /product="Adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26847"
FT                   /db_xref="GOA:Q6G584"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G584"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26847.1"
FT                   /translation="MTAQDYVVKDIALAAYGRKELDIAETEMPGLMACREEFSSSQPLR
FT                   GARISGSLHMTIQTAVLIETLKAIGANVRWSSSNIFSTQDHAAAAIAATGTPVFAVKGE
FT                   TLEEYWTYIDAIFQWPDGNPSNLILDDGADATNYILMGSRAETNKDILSHPKTEEEELF
FT                   FKQIQRRMEATPGFFTRQRAAIKGISEETTTGVHRLHQLQKEGLLPFPAININDSVTKS
FT                   KFDNKYGCRESLVDGIRRATDVMIAGKTAIVCGYGDVGKGSAASLSGAGARVKVTEIDP
FT                   ICALQAAMDGYEVVNLDDAASSADIIITTTGNKDIVRLDHMRKVKDMCILGNIGHFDNE
FT                   IQVAALQNLPWTNIKPQVDMITFPDGKRIILLSEGRLLNLGNATGHPSFVMSASFTNQV
FT                   LAQIELFTRSGHYKNEVTVLPKYLDEKVARLHLDQLGIKLTTLSQEQAAYIGVTPQGPY
FT                   KPDHYRY"
FT   CDS_pept        complement(43332..44336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00320"
FT                   /product="NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26848"
FT                   /db_xref="GOA:A0A0H3M1U1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26848.1"
FT                   /translation="MIMQLDCALYQHPKLITVFGGSGFVGRHVVEALTKRGYRVRIAVR
FT                   SPQKAYYMLQIGEVGQTQMLRTDIKCRASVARALLGSDGAVFLPGSLAQANQPNFQKTQ
FT                   IEGAQNVSELTAEAGIPLIYMSALVANKNASFLYARVKSMSEEIIHNEHPQAIIMRPSI
FT                   IFGPEDCFFNNLANLSCFLPIIPLFGGGQSKLQPVYVGDVAEFIVRALEGQVISGKSYD
FT                   LGGPQIITFQNVLEYILKIIHRKKTILSMPLSAGLFIGGLLGTIGKLPLAPTLVTASQI
FT                   RFLQIDNIVSQEAIENGYTLEGVGITPKAMAALLPSYLWRFRPHGQFSRNLPA"
FT   CDS_pept        complement(44374..45693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="BH00330"
FT                   /product="Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26849"
FT                   /db_xref="GOA:A0A0H3LX02"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26849.1"
FT                   /translation="MKKNHVQRIIDDLLKNYPKKFDLSLERILRLLESLDNPHLKLAPV
FT                   IHIAGTNGKGSASAICRALLESAGYRVHVYSSPHLVNWNERCRIGQREGGKLVTEEQLA
FT                   ETIQQVVKANGQKLITVFEIFTAAAFILFSTHPADVVILEVGLGGRFDATNVIKKPAVS
FT                   LIMPIDYDHETFLGNTISQIAFQKGGIIKSGVPVVISKQDHDETLSTLITLTDKNKAPY
FT                   FLFDQDYQSYTEHGRMVFQNNQGLMDLPLPNLIGAHQIANTGASLEAIYQAGFQLSEKT
FT                   ISHALQNIYWPARMQHLTHGNLVDQMSPGIDLWLDGGHNPAAAKIVAAELTKWKQKSNR
FT                   PIIMIVGMLNTKDAVSYFRPLTNLVDTVYTIPLINNNAGICPTILAEAARKVGLPANPQ
FT                   AHFQEALQRINAEHKEVIVLIGGSLYLAGDILRDNKTPPC"
FT   CDS_pept        complement(45697..46617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="BH00340"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyltransferase
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26850"
FT                   /db_xref="GOA:Q6G581"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G581"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26850.1"
FT                   /translation="MNWITNYVRPKINSILGRREIPENLWIKDPTSGEMVFHKDLEVNQ
FT                   YVIPSSGYHMRISAKNRLTHFFDDGVYTPLENPKVVIDPLKFRDEKRYIDRLKDYRSKL
FT                   GIDDNILSARGTIEGLPIIATVQDFAFMGGSLGMASGEAIIKAFDTAIAEKCPLVLFSA
FT                   SGGARMQEGTLSLMQMPRTTVAIEMLKEAKLPYIVVLTNPTTGGVTASYAMLGDIHIAE
FT                   PGAMIGFAGPRVIQQTIRETLPEGFQSSEYLLKHGMIDMVVSRLEMKTTIARLLRLMMK
FT                   YPPVVNPSNTSSTNSQASLSKAEAA"
FT   CDS_pept        complement(47175..47357)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00350"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(47628..48347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M497"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26852.1"
FT                   /translation="MIFTAAYRALQRLLTPEYRIMILKALGLTFIVLFIIWLFVRQLFM
FT                   SYFAVWIAHFFPVLSNWRGLLELSILIIFNLGLALLMAFLIAPITAMIGSFFIDSAAEI
FT                   IEKEDYPNQPIGSTLSLGRSLILSLKFVTLSLLGNAIAFILFFVPGINLIAFYIINGYL
FT                   LGCEYFMFAAYRFRSEREARAFLHVHSMTIFGAGLLIAFFVSIPLLNLATPLFAAALMT
FT                   HLHKMLSQKTSYASHSV"
FT   CDS_pept        48785..48916
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00370"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(49481..50893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="BH00380"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26854"
FT                   /db_xref="GOA:A0A0H3LVL4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26854.1"
FT                   /translation="MASLTIRNLPAKVKEILRIRAAQNGVSMEEEARRLLSNFTTPTIS
FT                   SSQASPVEMQSLQSKSILLIIGGSIAAYKALDLIRRLQERGARLNIIMTKAAQKFITPL
FT                   AAEALSGRTVYSDLFSREEEHDIGHIRLARDADLIILAPATANRIAKIATGRGEDLADC
FT                   VLLAARCPLLIAPAMNPAMWTHPTTVRNVAQLCADGVHIVGPEIGKMAERNESGLGRLS
FT                   EPLTIIAAAEALLNITERPLSGRHFIVTSGPTHEPIDPVRYLANRSSGKQGHAIAKALA
FT                   NLGAKITLICGPVDLADPPQVKTIHVETACQMLQTVQATLPADGAIFVAAVCDWRSQTP
FT                   SLQKIKKSAHKTPPSLQMVKNPDILATIGHASNRPPLVIGFAAETCDLIANAQKKCVEK
FT                   GANFILANNITLPDGKNVMGADTNQVYLVSRENIEQWPHMSKQQIAQKLASLVVSFFCP
FT                   SSAAHSNEQRTL"
FT   CDS_pept        complement(50964..52550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="BH00390"
FT                   /product="Ubiquinone biosynthesis protein aarF"
FT                   /db_xref="EnsemblGenomes-Gn:BH00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26855"
FT                   /db_xref="GOA:A0A0H3LV99"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LV99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26855.1"
FT                   /translation="MVQISTYFQLIRTGWVLAREGVLSALPHDDLQGFPALCHRIASML
FT                   ARRKTKKKRRSEKLSYAINRLGPSYIKLGQFLATRPDIVGRDIAEDLAQLQDRVQTFSC
FT                   TAAIDQIESSLGRSINDLFANFYPPIAAASIAQVHPAEYYDEVGHKKKCAVKVIRPNIR
FT                   TRFAKDLRSFYLIAHLQERYIPAARRLRPVCVVDTLAQTTRIEMDLRLEAAAISEMAEN
FT                   IQHDTGFRVPKIDWERTGRNVLTMEWIDGIRISEISALKEAGFDLQALAITLIQSFLRH
FT                   TLRDGFFHADMHPGNLFVDPQGCIVAVDLGITGRLGKKEKHFLAEILYGFITRDYHRVA
FT                   RAHFEAGYVPPHHNIESFAQANRAIGEPIHGQSAQSISMAKLLTLLFEVTELFDMQTRP
FT                   ELLLLQKTMVVVEGVARNLDPNFNMWKASEPVVKEWISKNLGPVGIAKDFSEGAQALFS
FT                   LVRNTPQLIQNFQRMEEDLNQMIKTGFNLSPTTLKKLAVEQSRSNRYGRYSLFIIALCC
FT                   ICLTFYLFHFF"
FT   CDS_pept        complement(52554..53336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="BH00400"
FT                   /product="Ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BH00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26856"
FT                   /db_xref="GOA:Q6G577"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G577"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26856.1"
FT                   /translation="MTAETERIGVKGGMEYSFGFTKIDEAQKQSMVDGVFHSVAENYDK
FT                   MNDILSLGLHRMWKNSMVAWLSPPAVFHWKVLDVAGGTGDIAFRILNASRQKAHATVLD
FT                   INGSMLSVGKKRAEKNGLAPLIDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHIDQALR
FT                   EAFRVLKPGGRFLCLEFSNVEMPLLDKIYDLWSFHAIPKLGQLIANDGDAYRYLVESIR
FT                   KFPKQDDFAHMINHVGFSRVSYRNLTGAIAALHSAWKI"
FT   CDS_pept        complement(53453..55885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BH00410"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BH00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26857"
FT                   /db_xref="GOA:A0A0H3M1U4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26857.1"
FT                   /translation="MSDEITSQMEGDDYGAASIKVLKGLDAVRKRPGMYIGDTDDGSGL
FT                   HHMVYEVVDNAIDEALAGHATLVNVTLHADGSCSVRDNGRGIPTDIHPTEGVSAAEVIM
FT                   TQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLQLRIRRNGKIHEMSFTHGVADAPL
FT                   KIVGDCGKESGSEIRFLPSSETFTMVEFDFETLERRLRELAFLNSGVHILLVDQRHADI
FT                   KSVELHYEGGLTEFVKYIDQSKKALLDHPIYITSEKDGMNVEVALWWNDSYHEKVLCFT
FT                   NNIPQRDGGTHLVGFRSALTRQINGYAESSGIVKKEKVNLTGDDCREGLTAILSVKVPD
FT                   PKFSSQTKDKLVSSEVRPIVENLVNEGLSAWLEEHPNEAKIVTSKVVEAAAAREAARKA
FT                   RELTRRKGALDITSLPGKLADCQERDPAKSEIFIVEGDSAGGSAKSGRSRQNQAILPLR
FT                   GKILNVERARFDRMLSSDMIGTLITALGTSIGKDEFSPDKLRYHKIIIMTDADVDGAHI
FT                   RTLLLTFFFRQMPELIERGHLYIAQPPLYKVTRGKSFQYIKNEAAFEEFLIDTGLEETT
FT                   LELSTGEVRAGADLRQLAEDARVLRQLLNGLHTRYNRNIVEQAAIVGAFNPEAFATPEK
FT                   AKKTADNVASRLDLIADDMERGWNGEFTPNGDLYCERILRGVKDVITLDAGLINSVDAR
FT                   QIDRISQNLMETYSSPPLLHRKDKSERILGPMSLLESIFTNGKKGITLQRYKGLGEMNA
FT                   EQLWETTLNPDARALLQVKINDATDADSLFSRLMGDEVEPRRAFIQDNALSVANLDI"
FT   CDS_pept        complement(56615..57124)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00420"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        58671..59540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00430"
FT                   /product="ABC transporter, periplasmic amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26859"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26859.1"
FT                   /translation="MKIKKTINRFNAFIEILFIAWGFLLSSFAEAETAGKLPSFFNSHE
FT                   RLVQPDISGIIRLRFVTTVDFPPFNFLDKTGHLAGYNIDLLRAICSKLNLKKLCEVEVV
FT                   PWEKLIDHVKNGNAEVIIAGLKETIKTHQDLVFTGSYLRFPARFVASRFMNFDEPISDK
FT                   LTHLNSGILSESAHEKLFRSYFPEAKWQGFKNRAELYKALQDHKIDLIFDDGFALSLWL
FT                   NDPKSADCCYFVGGAYMAPQLLGRGMQLAVAKKNEQLVDILNYALKSLEDDGKLTELYL
FT                   RYFPISFY"
FT   CDS_pept        complement(59552..61084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="BH00440"
FT                   /product="Competence protein comM"
FT                   /db_xref="EnsemblGenomes-Gn:BH00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26860"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26860.1"
FT                   /translation="MIACVTTVAFRGLEAVPVDVQVMISSGKIGMAIVGLPDKAIAESR
FT                   ERVQAAFHACGLSMPNKRVTINLAPADLPKEGSHYDLPIAVGLMLAMGLLPPDVEQDYI
FT                   ILGELSLDGSLTAVNGVLPAAMTALSCDKGLICPYQCGPEAAWANAEMNILAPETLLTM
FT                   VNHFKGTQIQKRPQPRQYTIQNELPDLCEIKGQKTAKRALEVCAAGRHNLLFVGPPGAG
FT                   KSMLAQRLPSILPPLDSRELLDVSLIASITGETIQNTISLHCPFRAPHHSASMAAMIGG
FT                   GLKARPGEVSLAHNGVLFLDELPEFSPQVLDSLRQPLESGECVIARANHHISYPARIQL
FT                   IAAMNPCRCGMAGEKNHVCAKGIRCQIDYQSRISGPLLDRIDLRIDVPALTAMDLMQPE
FT                   QSEKSCAVAKRVARCRTIQTKRFTKLGLDHIRTNGDCPAKIIEQIAIPDKNAATLLRDV
FT                   SEKMHLSARAYHRILKVARTIADLDEADYLSRHHLAEAISYRLGTERLTALT"
FT   CDS_pept        61518..63479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00450"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26861"
FT                   /db_xref="GOA:A0A0H3LVM7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26861.1"
FT                   /translation="MVYQTGVFLKSGTTRSVLIGFCLVLAFPKSLAAFELFGIPLFGHK
FT                   KINSSSNVDGAEKFYNVDVVASPGASSEGVKIVKAVSSLVIDRDKALSSSSGLLAKARS
FT                   DYRAILSALYAEGYYGGVISIKINGLEAADLSPVTQLPKQSKIVITIDAGPQYVFSVAG
FT                   IDKVAPFVKDKSNKMPTVEELGYKVGFVAKSETILKTEQWAIEGWRRQGYAKAKVIKSE
FT                   VVADHVARLIDAQITVDPGRQAYYGPLSVRNVSKKPAVDSAYIAWMTGLKLGQRYDSEA
FT                   VTKANERLVRLDVFRAVNIHEAETINPNGSLPLTLVVQERKPRRFGAGGSYSTLDGAGF
FT                   EAYWMHKNLFGHAERLKIETKINGVGGNKNQSYDFKSFNYLLGSTFIKPGILTPDTDFR
FT                   AELKVQQDVLENYTTKAIRGRLGITHIFNNNLSGQIAVEVSKGYSRDIYFGNRDFTTIG
FT                   LPFGLIYDSRNNKFNATKGLYGEVLLEPFYEMRFSNCVSKMTLEGRSYWALDEKERFIF
FT                   AARAKLGTIVGSDTAQIPSDTLFFAGGGGSVRGYAYRNIGIKTDNDAVVGGRTLFEGSA
FT                   ELRFSLNDKIGVVSFLDGGIVGDKARFDFSKKMKWGTGIGGRYMTNLGPLRIDLAFPLK
FT                   REKGDPRIGFYVGIGQAF"
FT   CDS_pept        63479..68125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26862"
FT                   /db_xref="GOA:A0A0H3LVA4"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26862.1"
FT                   /translation="MKKIMRLSAFFFGFLFFSLSTLVFTQKGNSLSNQATGEDHSWFVS
FT                   LIERKLSAPNRQVRFHNMQGALSSQTSIDAITISDKKGVWLRITNAKMDWNRLALLRGR
FT                   MSINQLSMDQVTFLRKPQENSSFVSSLEAGNFSLPTLPFAISIDTLAVQHVAFEKDLFG
FT                   FPADISLKGNLTLANGDFDVDIAAQRLDAPGSFSVLTKISDSNRTAKIDISADEPQNGI
FT                   LANVFKFEKRPALNLAMKGEGTFDDLVVRLYLEADQYPVLDGNVIFTSIAEGHGFSTKL
FT                   VGKLGPLMSPQYQSFFESDLTLKVKARVIKEGITYLDHMVIQNESMNVVANAEITADGF
FT                   LRRLFVDGKMALDKKNESARLSVSEMPKHADNIALNIDYGREGQHSWNGRLVIHHLNNK
FT                   NIHIRDAIFDMGGVSENLDDAASRHVGIQVKGTLQGVKKNKSTLGEDLGQTVRVHIDTD
FT                   IVSRKPVLIHDFSITGQGFSAWLKGKMDHFVFKGNLGLKAQTLASFNLLSEQSLSGSAD
FT                   IKAKGMIGLISGVFDLELSGMADNTKIGVESFDRLFKGNFTLLGGAAYDTTNLILRHLN
FT                   LKSQYANIKANGYFSSERAKMDLYAQISDLACLDPRMNGTLTIKSTARGHDHLIKLDTH
FT                   AHVAEAFLVGKKLQNTTLTMKTLVDNTSPVTSFTGSVKGEGTFSNKPLYLSASFKDSHQ
FT                   IRKFEDIDMKVGSTKIMGDLSQAAGFMKGALHIDADDILLLSALFLQEGNGKLKGDFIF
FT                   DEENGRQKANLKAHIDHLSFAKNKIKKLTVKGDVFDPFGMIQFEGLINAEHIQTPVMMI
FT                   NRLHAHANGKNGQTVFTVQAMFPNNTNAQLSGSMVTVELPDGIQREVQIKTIDVKQHNL
FT                   HATLPKSATIIFDKEGMTIDELGIAINGGKIILAGNIQDSLNLHLTMNAFPAALVNLWK
FT                   SNLGVAGTVTGQITIRGSFQKPDVTYDLKGEELTTLAFQNKKIMPFVLSAKGKTVDQNL
FT                   TLNANLTGEGVQAQAQGRISLDKNKLDLHVNLQDLPARLMNSFIEGQALGGAVVGRIDI
FT                   AGTMKDPSASFELASQSLTAMTHKGPLLINMNARGSYKKSTFHIERMIATGDKGLDLSI
FT                   NGPVSLNGSAVKLNVKGAMPLAFVDLLLAKRGAHITGMTRVDATINGELLNPQLVGSFS
FT                   IVNGSFFDSQTNLGLNNITVEGKLNGDHILLEKALAVSSEGGSISASGRISNNLQPDLV
FT                   LHLNNANYNDGSMILATLSGKITMTGHFGDGLVIGGDITVEKAEVLVPDHFQNAKFLDI
FT                   KNKNLTKSIKKTLERADVENTNKNRVESQESSSVILSNMRLTARNQFFVRGRGLDTELG
FT                   GRINIVGPLNDVHPVGEFRMIRGRFDILSQRLSFDQGQASFSGNLNPTVYFVANKNSGD
FT                   IRFTVTVSGTIDNLEINFSSQPNLPQDEILARLIFNRSLNELSPFQIAQLAAAAADLAG
FT                   ASNTSLLNTLRAKIGLDDLDVIIDEKGNTGLRIGRYIHNNIYLGFEAGSNGKTKGTINL
FT                   DISRHLKAKGAIGNEKDSSIGLFYERDY"
FT   CDS_pept        68755..69490
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00470"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(70373..72139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="BH00480"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26864"
FT                   /db_xref="GOA:A0A0H3M1U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26864.1"
FT                   /translation="MVKKQISTFDKHLIIRLLRENFHKHARWYSAAIFSMIIISCTTAA
FT                   SAWIMRDVVNYIIDAQNFGMIIVISIIIAFIFILKGIATFAQTYFLNKAGNSIVAEQQR
FT                   KIYARMMEQSVSFYHNNTSSDLLVRVTHNATAVRNIIDIIITTFVRDLLSVSGLLLVMF
FT                   IQNFTLITLTLIVGPLAFLGVRMALKRVRRLVEKELLSLGEIIKIVQESTIGIRVIKAF
FT                   SLEELMRKRMNKAICNVEKQANNIATLQAITNPIMETLTGVAIAGIICFSGYLATQRAG
FT                   VQGEFMSFIVALLLAYEPAKRLANVRVKIESGLVNIRTMFEVLDHPLTVIEHEKAKDLH
FT                   KTQGAIRFEDVSFAYTDNQMVLKDVNLEIEPGKMTALVGPSGSGKSTFINLIMRLYDPT
FT                   KGRILINNQDIRYTTFRSLRNLMTYVGQDTFLFQGTVKYNIGLGKEGASDDDIIKAAKT
FT                   ANAHDFIMDLPNGYDTQVGDNGCNLSGGQKQRLAIARAMLHDSEILILDEATSALDSHT
FT                   EAQISESLYHLTKGRTTIIIAHRLSTIARAHKIVVIKNGELIEQGTQKELLAKEHSFYK
FT                   KLHNIQFKKQKS"
FT   CDS_pept        complement(72362..72880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BH00490"
FT                   /product="Translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:BH00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26865"
FT                   /db_xref="GOA:Q6G570"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G570"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26865.1"
FT                   /translation="MTHTPKDGPRANQDIRVPRVQLINDEGQHQGVVTIQEALAMAAEV
FT                   GLDLVEIVPNAEPPVCKIIDLGKLKYQTQKKAAETRKKQKVIEIKEIKMRPNVDVHDYG
FT                   VKLKAIHRFIGNGDKVKITLRFRGREMAHQDLGLKLLQRVKEDTSEIAKIESEPKLEGR
FT                   QMMMVIAAK"
FT   CDS_pept        73074..73853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26866"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26866.1"
FT                   /translation="MDQNIPCQFFSFENTALAVRHRKGHCFPGLVWLSGYQSDMLGSKA
FT                   MLVDNFAQKNDLSCLRFDYSGHGESEGDFFQGTISRWVKESLAIFETYCEGPQILIGSS
FT                   MGGWIALKLAMMLAQKNKRLAGMVLVAPAPDFTQTLVEPKLGLEEWKILEEKGYIERPA
FT                   VGDEEPMPFTKGLIEDGRDNCVMKGCLDIGCPIHILQGMEDDKIPYQHTLTLMNHLPLH
FT                   DVTLTLVRDADHRFSRPQDLECLETVLSILIDRINAG"
FT   CDS_pept        73890..74636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26867"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26867.1"
FT                   /translation="MTIYEQHFIFSDRIVPIRVRENKYARRLILRIDARGREICVTTPP
FT                   AINLYSIQGFIAKHQSWIEARLARVQIAHANSYLKEGTKIPLLGIPHTIQRKEGRGITE
FT                   IVAGDVRQEPKIVVYGQLEYLPRRIADVLKKQAALIITPLVKCYARKVERKVKSICYKD
FT                   TKSRWGSCSIHGNLSFSWRLVMAPQEVIEYVVAHEVAHLIEMNHGPKFWALCEKLCPKS
FT                   EAYRTWLKENGHMLQAVNFHSYRLEI"
FT   CDS_pept        74859..76031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BH00520"
FT                   /product="Succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26868"
FT                   /db_xref="GOA:Q6G567"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G567"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26868.1"
FT                   /translation="MPVLTDPLQILQALIRCPSVTPHEAGALSTLEQFLTKMGFHVERP
FT                   IFADKNTEDVENLYAKMGKEGPHLMFAGHTDVVPPGDLENWKYPPFEGVIDQGKLYGRG
FT                   AVDMKGGIACFVAAFARVLEKRTIKGRVSLLITGDEEGPALNGTVKLLKWAEQKGEKWT
FT                   AALVGEPTSVKTVGDVIKIGRRGSISGIMTVKGRQGHVAFPERAANPLPLASKLIQSLI
FT                   QTTLDEGTENFQPSNLELTAIDTGNPAMNVIPAQATVHFNIRYNDLWTKEMLMAEIENR
FT                   LALVQSKNNNGQYPYYQLEWIPSLGDVFLTKNDKLINTLSNAIKSVTGNIPECSTSGGT
FT                   SDARFIKDYCPVIEFGLPGQTMHMVDECVTVDAMETLTSIYECFIVDFFA"
FT   CDS_pept        complement(76229..77428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="BH00530"
FT                   /product="Oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26869"
FT                   /db_xref="GOA:A0A0H3LVN9"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26869.1"
FT                   /translation="MNEPFGIYIHWPFCAAKCPYCDFNSHVRLHGVDQPRFVTAFEREI
FT                   ETQYHKIGPRCIKSIFIGGGTPSLMTPQTVDALLQILARTWNIDDKAEITMEANPSSVE
FT                   AERFRGYRVAGVNRLSLGVQALNDKALRQLGRLHDVKQALHAIALARKIFPRLSFDLIY
FT                   ARPGQTLEQWKCELFQAIDLAADHLSLYQLTIEEGTAFKRLHAAGRLFLPESELAADLY
FT                   QLTQEITALHGLPAYEISNHAISGAESVHNLLYWRYHEYAGFGPGAHGRFIEHSQNHSS
FT                   ASSKADPSQIENRERSVTINEKYPEHWLELVEKTGHGCIETEQLTTEQQANEMLLMGLR
FT                   LCEGLDLIRYKSLSSKNLPMEKLIDLQQQGLVEMVENQRLKATNKGRILLDYIINQLAH
FT                   "
FT   CDS_pept        complement(77425..78072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26870"
FT                   /db_xref="GOA:Q6G565"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G565"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26870.1"
FT                   /translation="MRSIANKKLVIATHNIGKLQEITTLVAPFGLTIQSAKELGLPEPK
FT                   ETGTTFEENAYIKAFAAAKNTGLPALSDDSGLEVDALNGAPGVYTADLALQSDGTRDFL
FT                   KAMQKIEEKLQKIGAHKKSQRKCRFISVICIAWPDAHADYFHGRVEGSFIWPPRGDKGF
FT                   GFDPVFLPDGYKNTFGEMTTEQKHGWKLNDQTPLSHRACAFKLLAENLLKLS"
FT   CDS_pept        78383..79453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BH00550"
FT                   /product="Heat-inducible transcription repressor hrcA"
FT                   /db_xref="EnsemblGenomes-Gn:BH00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26871"
FT                   /db_xref="GOA:Q6G564"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G564"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26871.1"
FT                   /translation="MKHKLIDDELKYLDERSRDIFRHIVEAYLNDGGPVGSRNLSRLLR
FT                   QTLSPATIRNVMSDLEHLGLIYAPHVSAGRMPTQSGLRFFVDAFMEAGDLPNEERENIE
FT                   AQVKEAGHAQSVEHFLVQASQVLSDLSRGAGLVLATKHEGTLKHIEFVRLDGEHALAVL
FT                   VTQQGGVENRIVHLPEGVTHAQLTEATNFLNAHIQGLTLSEAKEEIARLCSETRAALDH
FT                   LSHHLVETGLALWGGEGADHKIRLIVRGRSNLLEDVKAEEDLKRLRHLFDDLETRESMA
FT                   QLLDLTDEGSGVRIFIGSENKLFSLSGSSLVVAPYRDSQQKVIGALGVIGPTRLNYARI
FT                   VPMVDYTAQLVSQLLR"
FT   CDS_pept        79589..80251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BH00560"
FT                   /product="Heat shock protein (hsp-70 cofactor) grpE"
FT                   /db_xref="EnsemblGenomes-Gn:BH00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26872"
FT                   /db_xref="GOA:Q6G563"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G563"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26872.1"
FT                   /translation="MSDEKNKFTDASFENCDLKNPSDRDALKQAADKFLKAHAAEADAD
FT                   VKGGGEALVDPLAALQDENKELKDQLLRLAADMENLRRRTARDVADAKAYSIANFARDM
FT                   LSVSDNLNRALDAIPEGAKENDAGLKTLAEGVEMTERAMIAALERHGVQKIHPEGQKFD
FT                   PHFHQAMFEIPNSDVPDNTVQQVVQAGYIIGERVLRPAIVGVAKGGAKDISVESDSD"
FT   CDS_pept        complement(80379..80918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00570"
FT                   /product="ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:BH00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26873"
FT                   /db_xref="GOA:A0A0R4J6P1"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26873.1"
FT                   /translation="MYRLFSALQIPQKTTQELISLQNGLPKAQWINPQNFHITLSFFGE
FT                   IESLLADELIRAFDTIKLPPFVLHIKSFEIFSSENTPHSLVVRIEPCETLNLLHKKMQC
FT                   IRNHLRLPPDERQFTPHITLARLLDIQPEDLSYYLSSRSNFSFPPFEVNNFVLLLSPSP
FT                   SSNAPYIVKGSWRLQG"
FT   CDS_pept        complement(81512..81742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="BH00580"
FT                   /product="Phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26874"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26874.1"
FT                   /translation="MHARASAKFVQIVDNFNAIVEVEKDGQTVGGSSIMGLMMLAASSG
FT                   CNLTIRVWGPEASDALDALEKLINNKFGEEN"
FT   CDS_pept        complement(81827..82225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00590"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:BH00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26875"
FT                   /db_xref="GOA:A0A0R4J6Y8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26875.1"
FT                   /translation="MIGLVLVTHGELAVEFLHAVEHVVGTQEKFATICIYPDDDIDQRR
FT                   GDIIAAVSSTDTNHGVIILTDVFGGTPSNIAIPAIEKGRVEMIAGVNLPMLIKLISIRQ
FT                   CPDISLSEALRIAQEAGRKYINVPSMTL"
FT   CDS_pept        complement(82353..82817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="BH00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26876"
FT                   /db_xref="GOA:A0A0R4J8G9"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26876.1"
FT                   /translation="MKTKNKILHANCLQLGGKGLLIIGPSGSGKSTLTLSLLDRAGWSK
FT                   REAKLISDDYTMLRVENGKLQGSTPEGLQGGIEIRGVGLYTIEFEKQTTIDCVILLGPE
FT                   YERFSTNQTFKFADLHIPLLKLPSLHEADCTAICQAIEAFFFRKVWLKSV"
FT   CDS_pept        complement(82841..84625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="batS"
FT                   /locus_tag="BH00610"
FT                   /product="Two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26877"
FT                   /db_xref="GOA:A0A0H3LVQ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26877.1"
FT                   /translation="MTKNTQLETLQKITPNGLPSSPFSILSDLRFRTQRLLRQLLFSSL
FT                   TRRIVILNLAALAILVTGILYLNQFRDGLIEAKIKSLCIQGKIIAGAIAASATVDTNSI
FT                   LIDPQKLLELQAGESVTPAPQSTDSWDFPINPEQVAPLLRRLITPKTTRARIYDRDATL
FT                   LLDSRVLYSSGEVFSYDLPPLKTEKKLWERLYSWFSNALYGNGLAIDREQAKKRGIVHP
FT                   EVYRALNGSLATAKRRNRQGQLIVSVAVPVQRYRAVVGALLLSTTGSDIDDIVKGERLV
FT                   IFKVFAVVGSVLLVLSLFLAHTIAHPLSKLSASANRVRNGNNKRVEIPDFSMREDEIGH
FT                   LSTSIRDMTNALYMRIEAIERFAADVSHELKNPLTSLRSAVETLPLAKNEEAQEQLIEI
FT                   IQHDVRRLDRLITDISDASRLDAELARETAQIVDVTLLLESLVHAVQEVYRNRQNIDIS
FT                   LNIIPRPHGKPYLVLGHELRLGQVISNLIENARSFIPHDNGKICITMKSNAANLVLIIE
FT                   DNGPGIRSENIERIFERFYTDRPSEDTFGQNSGLGLSISRQIIEAHNGTITAENIVDPE
FT                   LENSKTGARFIIVLPFAR"
FT   CDS_pept        complement(84665..85387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="batR"
FT                   /locus_tag="BH00620"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26878"
FT                   /db_xref="GOA:A0A0R4J6D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26878.1"
FT                   /translation="MKDNPTITQTIVLVDDDRNILTSLSFALETEGYRVESYTDGASAL
FT                   KGLTLHPPHLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDDEIDELFGLKMGADD
FT                   FITKPFSQRLLIERVKAILRRASTRNQPLTTGASPTSSLKRGDLVMDQERHTCTWKDKP
FT                   VILTVTEFLILQTLAQRPGVVKSRDALMDAAYSDQVYVDDRTIDSHIKRLRKKFKQVDD
FT                   DFAMIETLYGVGYRFHEV"
FT   CDS_pept        85828..86283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26879"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26879.1"
FT                   /translation="MGFFNFIKTVGEKLGIGDSEPTEKDFKTAFDNFQLGTEKVNIQVE
FT                   NGKVVLSGEVPDRETLEKALLVVGNAQGISSVDIGQLKVADTACMKASRFYEVKSGDNL
FT                   WKIAEEVYGKGQGDKNTFIFEANKPMLKSPDKIYPGQVLRIPEIDRA"
FT   CDS_pept        complement(86412..86972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26880"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26880.1"
FT                   /translation="MITFIVEQMKDLILQISAFVQYLLKKVIKNVVWVLLLASIAHPHP
FT                   AIAQQYKVGEIEILHPWTRATPRGIKVGSGYLYIINHSNTPDRLVSVSTNGVQTTEIHS
FT                   MAVVNDIMKMEKMHNGIEIPGNGEITLKPGGDHIMFMGLSQPFKLGDKISATLTFEKAG
FT                   TVDVEFSVNATVDRLPSKTAPTP"
FT   CDS_pept        87832..89724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BH00650"
FT                   /product="Heat shock protein 70 DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BH00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26881"
FT                   /db_xref="GOA:Q6G554"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G554"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26881.1"
FT                   /translation="MAKVIGIDLGTTNSCVAVMDGKNAKVIENSEGARTTPSVVAFTDG
FT                   GERLVGQPAKRQAVTNPEGTIFAVKRLIGRRFDDPMVEKDKALVPYKIVKGDNGDAWVE
FT                   EAGKKYSPSQISAMILQKMKETAESYLGEKVEQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKKDGKTIAVYDLGGGTFDISVLEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVGYFADEFKKEQGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFESLVDDLVKRTVEPCKAALKDAGLKAGEIDEVVLVGGMTR
FT                   MPKIQEVVQSFFGKDPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIERNTTIPTKKSQVFSTADDNQNAVTIRVFQGEREMANDNKLLGQFDLVGIP
FT                   PAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEH
FT                   AAEDKKRREGVEARNQAEALIHSTEKSLTEYGDKVSTEEKEQIETAISDLKSVLDSTDT
FT                   EEVKAKMQKLAEVSMKLGQAMYEASQAATPNTETDTKSDDVVDADFEEINDKKK"
FT   CDS_pept        89883..91028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="BH00660"
FT                   /product="Heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BH00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26882"
FT                   /db_xref="GOA:Q6G553"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G553"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26882.1"
FT                   /translation="MKVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAGDKEAERK
FT                   FKEIGEAYEVLKDPQKRAAYDRFGHAAFENNNNGGGSPFSGFSAGGFADIFEDFFGEIM
FT                   GGGHRKRSDGRERGADLSYNMEVTLEEAFSGKTAQINIPSSVVCDACEGSGAKKGSKPQ
FT                   TCGTCHGAGRVRAAQGFFSIERTCPVCHGRGETIKDPCPKCQGTRRVEKNRSLSVNIPA
FT                   GIEDSTRIRLSGEGDAGIRGGPSGDLYIFLSVKPHEFFQREGADLHCRVPISMVTAALG
FT                   GEFEVSDLDGIKARVKIPEGTQNGRQFRLKGKGMPMLRRQQVRGDLYIHITIETPQKLT
FT                   QEQRELLQKFEKLSNHENSPQSHGFFSRMKEFFENISGKNE"
FT   CDS_pept        92098..92845
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00670"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(92964..93272)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00680"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        94170..95075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="BH00690"
FT                   /product="Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26885"
FT                   /db_xref="GOA:Q6G552"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G552"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26885.1"
FT                   /translation="MDDVENGVADVFEKQAAFLSSALPYMQKYENETVVVKYGGHAMGD
FT                   PALGRAFARDIALLKQSGINPVVVHGGGPQIAEILMKMGIESRFENGLRVTDERIVEVV
FT                   EMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKAYKTVIDPDSHIERVLDLGFV
FT                   GEPVEVDRTLLDLLACSEMIPVLAPVAPGRDGKTYNINADIFAGAIAGALEAKRLLFLT
FT                   DVPGVLDKKGKLLKELTISEAENLIKNETISGGMIPKVETCMKALQNGVEAVVILNGRT
FT                   PHSVLLELFTEQGAGTLIVS"
FT   CDS_pept        95098..96018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26886"
FT                   /db_xref="GOA:A0A0H3M4B4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26886.1"
FT                   /translation="MKPFMNNTKQLKRPLLNKQELALFAATILWGITFLVIHIAVRYSG
FT                   PLFFVGFRFMVASLICGAIFWRSLKGITVYEIFAGMAIGLGMFLGYALQATGLQTIISS
FT                   QSAFITALYVPIVPILQWIVFKKPPRLACWLGIIFAFIGLILISGKKSGSFDFSKGEIL
FT                   TLLGALAIAGEVILIGIFAHKVDSRRVTIIQLFFSGLFSFFCMPFIGESIPPFSWVWLN
FT                   IGIGLALMSAIIQLAMNWAQKSISPTRATLIYAGEPVWAGIVGRLAGEHLSPLALLGGA
FT                   LILIGIVVAELQPSQWRKKKNNLKK"
FT   CDS_pept        96596..98401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="BH00710"
FT                   /product="GTP-binding protein lepA"
FT                   /db_xref="EnsemblGenomes-Gn:BH00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26887"
FT                   /db_xref="GOA:Q6G550"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G550"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26887.1"
FT                   /translation="MTVDRNYIRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVL
FT                   DSMDIERERGITIKAQTVRLHYKAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLL
FT                   VVDASQGVEAQTLANVYQAIDNSHELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSEAV
FT                   EISAKTGLGVSDVLEAIVTQLPSPRTGDVNKPLKAMLVDSWYDAYLGVIVLVRVIDGIL
FT                   KKGQIIRMMGTGAKYPVERVGVFTPKMIQVDELGPGEIGFITASIKEVADTRVGDTITE
FT                   ERCPCEEALPGFKPAQPVVFCGLFPIDAADFDDLRAAMGKLRLNDASFSFEVETSAALG
FT                   FGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMHDGSVKELHNPADMPDIV
FT                   KISSIEEPWIRATIMTPDNYLGSVLELCQERRGIQVSLSYVGTRAMVTYDLPLNEVVFD
FT                   FYDRLKSISKGYASFDYQMRDYTEGDLVKMSILVNGESIDALSMLVHRTIAEKRGRSLC
FT                   EKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRKRKLLEKQKEG
FT                   KKRMRQFGKVEIPQSAFIQALKMNK"
FT   CDS_pept        complement(98477..99325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="BH00720"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26888"
FT                   /db_xref="GOA:Q6G549"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G549"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26888.1"
FT                   /translation="MTDLTQLEMIIEKAFDDRNSINTTTKGEILESVEHALNLLDKGEV
FT                   RVVKRQKNGKWHVHQWLKKAVLLSFRLNPMQIMTGGVNGTSWWDKVPSKFSHWQEADFK
FT                   KADFRSVPGAIVRHSAYIAPNVILMPSFVNLGAFVDEGTMVDTWATVGSCAQIGKHVHL
FT                   SGGVGIGGVLEPLQANPTIIEDHCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIIDR
FT                   TTGEIFIGEVPPYSVVVPGSLPGKPLPNGEIGPNLYCAVIVKRVDQKTREKTSINDLLR
FT                   D"
FT   CDS_pept        99433..100296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26889"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26889.1"
FT                   /translation="MKKDYTEKTEEEQKHWTPLLQAKDSLQQVKKFSNSAQMRSPTYRL
FT                   AYIDQEFMMRPELRSQRIGLEFLKPEMTLQECDIQSTVVLFGGARIPKPGKEAWAAKNE
FT                   TQKKNLHAMSHYYDEAREFARLCSCYSATTEYREFVVVTGGGPGIMEAGSRGAVDVGAP
FT                   TVGLNVVLPHEQEPNSYVTPHLCFNFHYLGIRKMHFLMRAKALAIFPGGFGTLDELFET
FT                   LTLIQTGRMKRVPILLFGKEFWDNVINFDYLSAQGTISPSDVDLVKFVDAAAQAFEEIR
FT                   CFYKLP"
FT   CDS_pept        complement(100329..101072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BH00740"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BH00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26890"
FT                   /db_xref="GOA:Q6G547"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G547"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26890.1"
FT                   /translation="MPRFKLTLEYDGSNYAGWQRQAELRTIQSALEQALFHFSGQQLTI
FT                   TTAGRTDAGVHATGQVAHVDFEKNWRTHTVRDALNAHLQKQGDNIAILHVQNVPDSFDA
FT                   RFSAIKRHYLFKILNRRSPPALNTKRVWWIPKPLNAQAMHEAAQKLVGKHDFTTFRSAH
FT                   CQAKSPIRTLERLDVQREGEEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTTQDLEAA
FT                   LHAKDRTRCGMVAPPSGLYLTKVEY"
FT   CDS_pept        complement(101074..102009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BH00750"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26891"
FT                   /db_xref="GOA:Q6G5F1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26891.1"
FT                   /translation="MVLRLSFMGTPDFSVPILQALLDAGHDIAAVYSQPPRPAGRRGLK
FT                   LIPSPVQNLAKAKSIPVFTPQTLKTAEQQTKFTELAVDVAIVVAYGLLLPKTILETPRF
FT                   GCFNAHASLLPRWRGAAPIQRAIMAGDKETGMTIMKMDEGLDTGPIALSCAIPITDNTT
FT                   TNELAHKLSHIGADLMIEMLSALEKGQLKLTAQSGENITYASKIKKEETRIDWTKPAEF
FT                   IHRYIRALSPFPGCWCNMNIAGREERVKILGSRLTTRPSLEIGRIEKGPDSLLIHCGQG
FT                   CLEVTYLQRSGGKVLECATFLQGAHISAVF"
FT   CDS_pept        complement(102009..102539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BH00760"
FT                   /product="Polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26892"
FT                   /db_xref="GOA:Q6G5F0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26892.1"
FT                   /translation="MPMRPLVIVPDPILREISKPVEYIDSAVQKLADDMLETMYHAQGV
FT                   GLAAIQIGIPLRMLVLDVSRNDEQKNPLVIINPEVLWLSDERNIYKEGCLSIPEYFAEV
FT                   ERPKRLCVRYQNREGKQTEIEADDLLATCLQHEIDHLNGRLFIDYLSKIKRDMVIRKFK
FT                   KRAKEKNTQEAVL"
FT   CDS_pept        102631..103815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26893"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26893.1"
FT                   /translation="MFDSFFSFILADESFVKLSALLLLIFVCLVFFMLMHSYRKKALWE
FT                   SETAERSREVQMQMATLLKTQAEMQGRMQTMAEIFGQRQAELNKSLSEQLNGMTANLGQ
FT                   TLQVQTKSTYENLNRLQERLAVIDAAQNNIQSLAGQVVQLQAILSNKQTRGTFGQGRME
FT                   AIIADALPANAYIFQAVLSNGKRPDCLIHMPNKAPSLVVDAKFPLEAWNAMRKATSAQE
FT                   RQEAERQFRTDMEVHIRDIAQKYLISGETHDTAFLFVPSESIFATIYEDFESLVQKANR
FT                   AHIIIVSPSLLMLSIQVVQTIMKDARMREQAHLIQSEVAKLMEDFGRMDTRIRALQKHF
FT                   YKAGEDIEGILISSSKIMKRANRIETFQLKDNNSEPMEIKTSAQSQTLRLVDEE"
FT   CDS_pept        103924..104511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26894"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26894.1"
FT                   /translation="MRHLLFLGVLVFLLGGCTTTSPIYTNNACAILAQKDGFFDNWGKA
FT                   SKRAEIRYGIPIPIILATIKMESNFRHNARPARKKLLGFIPWKRPSTAYGYSQALDSTW
FT                   AMYLRSTGRSFAWRTNFADAADFVAWYHRQSVQRNGVRFDDAYSLYLNYHMGHSAYARS
FT                   KGYVPGTLAQAAQRMAIMSRHYDQQLKACGRR"
FT   CDS_pept        complement(105287..105538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26895"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J950"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26895.1"
FT                   /translation="MGEHKQNLSLQDMTHSDTGQIAYLKKVCTDDLAKNFPDLPPMTPG
FT                   ITVWALFGETGYPIILSDERSIALAGANEHELQIVTLH"
FT   CDS_pept        complement(105558..105986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA1"
FT                   /locus_tag="BH00800"
FT                   /product="Heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26896"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26896.1"
FT                   /translation="MTHVTPFSNPFLLGFETIEKTLRRIGKADETYPAYNIERLHKNDD
FT                   ASHIRITLAVAGFKVNNLNILLDDNQLIIHGKQTDSQNHQYLYRGIAARQFQRTFVLVE
FT                   GMHVTNAELKNGLLSINLYQPKTKKQMKQIPIKVSNKS"
FT   CDS_pept        106095..106835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BH00810"
FT                   /product="Endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BH00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26897"
FT                   /db_xref="GOA:A0A0H3LVS5"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26897.1"
FT                   /translation="MTHKTIKLSKEKKVAGILYSEDEIEEIFRRFSIQRPTPKSDLIYT
FT                   NVFTLLIAVVLSAQATDASVNKVTKELFRLADQPEKMVALGEEEIARHIRTVGLWRAKA
FT                   RNIYALCSFLIDHYGGQVPDNREALMALPGVGRKTANVVLNVAFGWPTLAVDTHILRLG
FT                   NRLGLAPGKTPEIVEEKLLKIIPFRYLRYAHHWLVLHGRYICQARKAQCTRCIIADLCK
FT                   AAIKTNAIPAPLVEVQGNGAPIFF"
FT   CDS_pept        106984..107187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BH00820"
FT                   /product="50S ribosomal protein l35"
FT                   /db_xref="EnsemblGenomes-Gn:BH00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26898"
FT                   /db_xref="GOA:Q6G5E5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26898.1"
FT                   /translation="MPKMKTKSSAKKRFKITASGKVKVAAAGKRHGMIKRSNKFIRDAR
FT                   GTMVLSEQDAKKVIQHYLPNGL"
FT   CDS_pept        107221..107622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BH00830"
FT                   /product="50S ribosomal protein l20"
FT                   /db_xref="EnsemblGenomes-Gn:BH00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26899"
FT                   /db_xref="GOA:Q6G5E4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26899.1"
FT                   /translation="MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQY
FT                   AYRDRKNRKRTFRALWIQRINAAVRAEGLTYGRFIDGLSKAGIEIDRKVLSDIAIHESA
FT                   AFSALVASAKKALEYLKDTTPNAFEGAVK"
FT   CDS_pept        107716..108801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BH00840"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26900"
FT                   /db_xref="GOA:Q6G5E3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26900.1"
FT                   /translation="MSDIERLEQEICLALEMAGDEQALEAVRIAALGKKGSISEKLKAL
FT                   GKMSASERQKVGPVLNGLKNRVLELWTQKRDFLRRQAMDACLTRETVDITLPVRSSPIE
FT                   RGRIHPISQVIEEIIAIYMKMGFSLAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFD
FT                   VNKTGERKLLRTHTSPVQIRTMEKQKAPIRIIIPGKTYRMDSDATHSPMFHQVEGLVID
FT                   KTSTIAHMMWLHETFCKAFFEVSSVKMRFRPSFFPFTEPSMEVDIQCDRSGSEVKFGEG
FT                   QDWLEILGCGMVHPHVLKNVGLDPDEYQGFAWGMGIDRIAMLKYGMPDLRAFFDADLRW
FT                   LDHYGFRCFDMHAFFPGLRNV"
FT   CDS_pept        108833..111247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BH00850"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26901"
FT                   /db_xref="GOA:Q6G5I2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26901.1"
FT                   /translation="MKFTLSWLKDHLETDASLDEICDKLTAIGLEVDHVDDRSYLKGFV
FT                   IAKVLTAIKHPDADKLQILSVDTGADKPVQVICGAPNARAGLVGVLALPGTYVPGLDVT
FT                   LSVGKIRGIESFGMMCSWAELELSNEHDGIIELPEDVPIGASFAVYAGLDDPVIDIGLT
FT                   PNRSDCTGVRGIARDLAATGIGRLKELSLPQLGTTFETSLDVSLDFSQSALLCLGFAWC
FT                   EVRNVQNNASPQWMQQRLNAIGLRPINALVDITNYISFDLGRPLHVFDADKIKGNLRVR
FT                   CGREGEQLQALNGKVYNLGVKDCVIADEEGVVSIAGIMGGERTSCDETTRRVIIESALW
FT                   DAQSIAQTGRALGLISDARYRFERGVDPAFMETGLEIATELVLRLCGGEGSKMKIVGYQ
FT                   QPEIRQITFPLSEIKRLTYLEIEHEQTMTILTQLGFDSEGQGNVVVVKVPTWRPDIVGK
FT                   ADLVEEVMRIYGLDKIKPIPLESFMEVKDPVLTVSQLRSRITRFALAGRGMRETVTWSF
FT                   ISEKQALAFGGGQAQLKLVNPISADMSVMRPSLLPGLLVAAQRNADRGFPDFALFEVSN
FT                   IYEDDTPDKQHRVAGGIRRGTEQFGGAGRFWNGNARAVDVFDAKADALAVLEACGLESG
FT                   KVQIEVGAPDWYHPGRSGVIKLGSKIILGFFGVFHPATLEKLDISGPLCGFEIFLDRIP
FT                   EPKKKATKSRSPLKLSSLQMVRRDFAFVVDKMVDSSLIVRAASGADKKLIHSVQVFDVF
FT                   EDLSLGEEKKSVAIEVALQPIERTLTDEDIEELALKLVENVTRMTGASLRC"
FT   CDS_pept        111537..112445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="BH00860"
FT                   /product="Iron transport protein yfeA"
FT                   /db_xref="EnsemblGenomes-Gn:BH00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26902"
FT                   /db_xref="GOA:A0A0H3LVC1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26902.1"
FT                   /translation="MNVKTFFIIIWASAIFFTSDFALCAGKFKAVTTFTIIADMARNVA
FT                   GDVADVESITKPGAEIHEYQPTPRDLMRAQGANLILWNGLELELWFEKFFQNIKDVPSV
FT                   VVSKGIVPIKIGEGPFSGKPNPHAWMSPTSALIYVDNIRDAFVKYDPEHAPIYKENAEI
FT                   YKQKIRSTIDPIKTELEAVPQDKRWLVTSEGAFSYLARDFDLKELYLWPINADQQGTPQ
FT                   QVKHVIDMVRKYNIHAVFSESTISPAPAKQVARETGAKYGGVLYVDSLSEKNGEVPTYI
FT                   DLLRVTSGRISAALLEGVKGQ"
FT   CDS_pept        112442..113272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeB"
FT                   /locus_tag="BH00870"
FT                   /product="Iron transport protein yfeB"
FT                   /db_xref="EnsemblGenomes-Gn:BH00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26903"
FT                   /db_xref="GOA:A0A0H3M1V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1V7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26903.1"
FT                   /translation="MIGSGIFAQGVTVTYRNGHTALREVNFESPTGSITALVGVNGSGK
FT                   STLFKAIMGFVRPSKGKIRMFDLPVDTALKKNLIAYVPQSEDVDWNFPVLVEDVVLMGR
FT                   YGHMNFFRYARARDYEAVRVALERVDMLAFAKRQIGELSGGQKKRVFLARALAQQAKAI
FT                   LLDEPFTGVDVTTEDKIIALLQDLRKEGAVILVSTHNLGSVREFCDHTVLIKGTVLASG
FT                   LTETVFTKENLEKTFGGALHHHIFNLQGKKKDDVFTRGKQSAFLENIERVEHVA"
FT   CDS_pept        113272..114123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeC"
FT                   /locus_tag="BH00880"
FT                   /product="Iron transport system membrane protein yfeC"
FT                   /db_xref="EnsemblGenomes-Gn:BH00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26904"
FT                   /db_xref="GOA:A0A0R4J8Z0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26904.1"
FT                   /translation="MSWLLEPLSYQYMVNAMWVSGLVGCVCAFLSAFLMLKGWSLIGDA
FT                   LSHSIVPGVAGAYLLGLPFSLGAFFSGGLAAAAMLFFNHRTKLKEDTIIGLIFSSFFAF
FT                   GLFLKSLKPMAVNIDTIVLGNILAVSSSDIIQLAFIGFFSLLILLLKWKDLLVSLFDET
FT                   HARAIGLNVKFLKILFFTLLAACTVAALQTVGAFLVICLVVTPGATAYLLSDRFVSILV
FT                   IAVMIGTFTSVLGVYVSYFLNAQTGGVVVLFQAFLFILAFIFAPKHGFIAARLRINAAK
FT                   KV"
FT   CDS_pept        114131..115036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeD"
FT                   /locus_tag="BH00890"
FT                   /product="Iron transport system membrane protein yfeD"
FT                   /db_xref="EnsemblGenomes-Gn:BH00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26905"
FT                   /db_xref="GOA:A0A0R4J7M1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26905.1"
FT                   /translation="MVDQLLLPFQFSFMLKGMLIVMILSVPMAMLSCFLILKGWALLGD
FT                   AISHAVFPGVVIGYMTTPWVIAFLTSFPFAWFQHMRSENITMTLITCGAFVAGMVCALA
FT                   TGFLGGNSRIKQDTVMGVVFSSMFGLGLVLATAIYSSLDLNHILFGNLLGVNWLDITQT
FT                   AIISAIVTFILGAKWRDFMLYIFDLVQGRAMGLRIAVLHYTLLTMISLTIVAALKAVGI
FT                   VLVISLLIAPGAIAYLITKRFSFMLVIAILVAGLSGFLGIYLSLFIGSDSASTIVLILT
FT                   LIFIAIFMWIFFRRVTVQEI"
FT   CDS_pept        115434..115817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26906"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26906.1"
FT                   /translation="MKKYFKMSHPLRICTSIVGWVMIVLGVIGIVLPIMPTMPFLLIAS
FT                   WCFARSSPRFHHWLNNHRVFGPPIKQWEEKRAISTFIKAFAVVSMVGGFLSFLVMIHPA
FT                   LWFALLVATILLLIAVYIVTRPS"
FT   CDS_pept        complement(116889..118193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BH00910"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26907"
FT                   /db_xref="GOA:Q6G5H6"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26907.1"
FT                   /translation="MNHPDIARRVYNHTWKLDPIIRSLLDTDFYKLLMVQMIWGLYPNV
FT                   NVTFSLINRSKTIRLADDIDEMELRAQLDHALNLRFTKKEMIWLAGNTFYGRKQIFEPD
FT                   FLQWLENFQLPEYELTRKDGQYILHFHGPWTHSSMWEIPALSIISELRSRAAMKKLDRF
FT                   TLDVLYARAKAKMWSKVERLKKLPNIKISDFGTRRRHSFLWQRWCVEALKEGIGNSFTG
FT                   TSNVLLAMDTDLEALGTNAHELPMVIAALTNNDNELRKAPYQVLQDWNRYYGGNLLIVL
FT                   PDTFGTEAFLRNAPDWVADWTGFRPDSAPPLEGGERIIQWWREKGKDPREKLLIFSDAL
FT                   DIDTIEKTYHHFHGKVRMSFGWGTDLTNDFVGCSPQETATFDALSLVCKVTHANGRPAV
FT                   KLSDNPEKTIGNPQEIQRYLNFFGNENRVAKPIKT"
FT   CDS_pept        complement(118324..126888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00920"
FT                   /product="Cyclic beta 1-2 glucan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26908"
FT                   /db_xref="GOA:A0A0H3LVC5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26908.1"
FT                   /translation="MVPILSFMKCFFSQKTIRCCLTETNSPIRLTYKSQDELYTLGYAI
FT                   ASGETLLIPEYEKSKHFQKRLNENAKLILHAFQNSDIAARNDETLAPSAQWLIDNHYTI
FT                   DKTIQQLRRNLPKSFIKQLPLYKQKTGMPRIFALAWLYIAHTDSGFSQETLTATINGFQ
FT                   KFCALKIGELWALPSVIQMLLIENVRRLSLRIEQTRHMRHIAHQVADKISLTENEPKLH
FT                   ALLTFYETLTADSTFAAHLFYRLRSASFDATTALTWLEKQLHSQGSSLEIVKANEHARQ
FT                   AADGITMGNIIRALKAIDDVDWTVWFETVSIVDSILREKSDFSEIDSHSRNIYRQVIEK
FT                   IARFSPLNESEIARKAVKMVHSSSQDTSHHNNSSVGWYLVDDGRYAFEKVCSYTPPLHI
FT                   KWQEYFCCAKIRIIALPVSLLTLALLLAIYALLQRSGIAPWMPLFFTTLALFPAMDAAF
FT                   AFFNTVVSWFIPSKQLIGYEYKEGIPKHARTIVVVPTLITSRNYIDEQVHNLEVHYLSN
FT                   PKGAIHFALLTDWVDAPFEQTQDDLNLLHYAQKSIDELNRRYHRDNLPVFFLLHRRRLY
FT                   NPSEKCWMGWERKRGKLHELNLLLRGDQNTSFYPPNPHLPIDCRFVMTLDADTRLTPES
FT                   VTKLVGKLNHPLNQPIFDPQNGKIVKGYSILQPRITPSLTTGKETSILQRVFSTNRGID
FT                   PYVFAVSDTYQDLLGEGTFVGKGLYNIDAFEKALNGKIKENTVLSHDLLEGGYARTALV
FT                   SNVEVIEDYPIAYKVDVARYHRWTRGDWQLLPYLFSCCRISAITRWKIQDNLRRSLTPL
FT                   MWLIAAIAGWSFLPLKSAIIWQIFLLFSLFISPILGVLQTLVPSHIDYSLRGKLQSIMN
FT                   KTTLTGANIFLKTTFLAHSTYFMTDAIIRTLYRMTISKKHLLEWKTSAATKSISNSFGF
FT                   YVLTMWPASLISILSLALLLFSHAPTSLIALPFGLAWFLSPLIAWFVSQPLTFPDTLNV
FT                   SSEDKKTLRSIARRTWLYYATFVNAQSNYLPPDNFQEDPKPLVAQRTSPTNIGLYLLSV
FT                   IAARDFGWISCKETITRIEYTLNSLAKMEKFRGHLYNWYATDTLKPLLPTYVSTVDSGN
FT                   LAGHLMTLASALREWAEKPYVFLQNHREGLSDVHAILAEIFKEIPDNQPILRSLRQQIE
FT                   ECITNFDHCVNAFVEKSNITSSSITNLSLIAHDIVQLIDELHQKIQTTESAQTLSWAKC
FT                   LVETCEAHHHDASNDYNTEQLCKKLNTLAVNARKIALDMEFDFLEHPERHLLSIGYNVQ
FT                   ENKLDENCYDLLASEARLASFFAIAKGDIKCKHWFHLGRLLIPIGWRGALLSWSGSMFE
FT                   YLMPSLVMHEPLGSLLDQTNRLIIHHQIQYARQRKLPWGISEAAFNARDHLMNYQYASF
FT                   GVPRLGLQRGLSRNVVIAPYASLLAAQYTPAQAVNNLKRLRNFGALGTYGYYDSVDFTP
FT                   SRIKTGEKYAVVRNYYAHHHGMSILAINNVIFQGRMRDHFHRDPAIEAVQLLLQERAPH
FT                   QIPIIHTKVVNPVHNNSREFDDAPLRMITNPLLKPRATLLLSHGFYSIMLTANGSGYSR
FT                   WHDYAITRFIPDPTEDQQGTLFFLRNTDNGRWWSVTGEPTRVVEEEAVSIFTDEKAEYR
FT                   KMVDDIQSTLECVVISEGCGEGRRIKLINTTNKDRLIEVTSYGELALATMDADQAHPAF
FT                   SRMFIETEIAEQGKTIFAKRRKRSPNDPEIHVAHFVTGTMDNIQETEAETDRSLFIGRG
FT                   RSLHRPAAFDRNACFSNSQGCVLDPIISIRCRIKIPAHEKAELIFWTFAANAKETLHNH
FT                   IKHYQQPNMFQQELSMAWTRSQVSLYQSGIQLREAMTYQKYATPLLYPDPIWRLSPKNL
FT                   AKTLGKQSDLWPMSISGDLPICLLRLDNEGDITVLRELLKAHEYWRMRGLLVDLVILNE
FT                   QAFSYIQDTKRAIEWVCESYRHHIHETDERQHIFILQRDQMNEQSFKVLLASARIILHA
FT                   QNGSLSEQLKRLNESHFDLVTRNSHQGSHDKLNDKRRQISTQTEQSLFVSIGLISQQKS
FT                   STLPINGKDLQYWNGYGGFNHNNNYVIRLHGQTTTPHPWINVIANKSFGFHVSAEGALF
FT                   TWANNSRDYQLTPWTNDPVSNRPGEALYIVDRLSLKRFSPISAVECNESVVYESCHGFG
FT                   FSTFKSQHSEITLELTHTLDQKKPIRLSRLILKNEGKKSRSLRLYNYVEWVLGNIRTKY
FT                   APFLLPFYDSKRGAHFIQNPYHLEKSQQVAFLSASEIPTSTTTDRNEFIGLTGTVTHPH
FT                   ALRKADALSNRIEAGCDPCSALAYDIDLLPGQTKEIIFYLGCAENRQEAEKLLDQVRTN
FT                   DFEILLTKQKQQWSDFVSPFQVKTPDPSFDIMVNHWLPYQIYACRMMARTAFYQASGAF
FT                   GFRDQLQDSLSLLLLQPQLAREHLLNAAAHQFPEGDVQHWWLPDTNAGVRTHISDDIVW
FT                   LAYATALYVNTTGDYEFLDTTIAFIEGAVLPVEQNDAYFRPTQSSKVATIYEHCALALD
FT                   LAIRRSGQHGLPLILGGDWNDGMNLLGVQGKGESIWLGWFLGTTLQAFIPLAQKYRDNI
FT                   RVKTWNAYLKRLKKSLEENGWDGAWYRRGYFDDGTPLGSKINDECKIDTIAQSWAVISQ
FT                   MASPERQKQAMASMLEYLCDKKSGLLRLFWPPFDKTTLEPGYIKGYPPGIRENGGQYTH
FT                   GAIWSILALAEMGENDKAYALFSMINPITHGKNPEIYRVEPYVMAADIYAIEPRRGQGG
FT                   WTWYTGSAGWFYRTAIEAILGIKRQADQLFLHPHLPSSWPKYEAKMKFHDAFYTITVKW
FT                   GNTNMLYINGREYSDIYKGIKLKKIGKHEIICTLKS"
FT   CDS_pept        complement(127083..128783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BH00930"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BH00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26909"
FT                   /db_xref="GOA:A0A0R4J9H4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9H4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26909.1"
FT                   /translation="MSQYNPTTADFEALLMQSFQTNDLNEGSVVKGRVIAIEKDMAIID
FT                   AGLKVEGRIPLKEFGAKGKDGSLQIGDEVEVYIERIENAMGEAVLSREKARREESWIRL
FT                   EEKFNAGARVDGVIFSQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVSPLMHNSQSFEIL
FT                   KMDRRRGNIVVSRRTVLEESRAEQRSEIVQNLEENQIVEGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILTIGQTIKVQIIRINQDTHRISLGMKQLESDPWESISARYP
FT                   VGKKITGAVTNITDYGGFVEIEPGIEGLIHVSEMSWTKKNVHPGKILSTSQEVEVVILE
FT                   IDPSKRRISLGLKQTFENPWVAFANKFPVNSQIEGEVKNKTEFGLFIGLEGDVDGMVHL
FT                   SDLDWNRPGEQVIDTYNKGDIVKAVVLDVDIEKERISLGIKQLSSDKVGEAAASGELRK
FT                   GAVVTCEVTAVNDNGIDVKLTDHNLETTIRRTDLARDRDEQRPERFSIGQRVDARITAF
FT                   DKKTRKLSVSIKALEIAEEKEAVAQYGSTDSGASLGDILGAALKKQEQD"
FT   CDS_pept        complement(128916..129563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BH00940"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26910"
FT                   /db_xref="GOA:Q6G546"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G546"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26910.1"
FT                   /translation="MKPFVIAIDGPAASGKGTLARKIATHYHLHYLDTGLTYRGVAHAL
FT                   LQQKLALDDEKNALVYARELDFNTLNPALLSSHELGNAASKIAIIPTVRETLVAKQRNF
FT                   AKILPGSVLDGRDIGTIVCPDADVKLYVLANVQIRAKRRYQEILKKGAQADYHEILVNL
FT                   EQRDSRDITRKQSPLKQAKDAYLLDTSELSIEATFTVACALIDPIIKARIIG"
FT   CDS_pept        complement(129560..130888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BH00950"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26911"
FT                   /db_xref="GOA:Q6G545"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G545"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26911.1"
FT                   /translation="MQKTIPMTAYKSTRLSGIIKIPGDKSISHRSLILGGLASGETHIH
FT                   GILESDDVFNTAAAMQALGACIIKKDDLWIIRGTGNGCLLAAQKPLDFGNAGTGARLVM
FT                   GMVGPYHMKTTFIGDASLSKRPMARILDPLQLMGVEIEATHGNYLPLTLYGPKMTNPIC
FT                   YRIPVASAQVKSAILLAGLNTAGTTTVIEPILTRDHTEKMLKAFGAKLEIEKNAEGTRF
FT                   IHLNGHPHLTGQTIHIPGDPSSAAFPIVAALLIEDSDITIENVLINNSRMGLIETLWEM
FT                   GAQIELLNQRQTGGEDVANLRVKSSVLKGVTVPKERAPSMIDEYPALAVAAAFAEGKTV
FT                   MLGIEELRVKESDRLSVLAQGLKINHVDCEEGQDFLIVHGKGSAKGLGGGHVTTHLDHR
FT                   IAMSFLIFGLVSEKPVTIDDKRMIATSFPEFIPFIQQLGGKIS"
FT   CDS_pept        131075..131455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26912"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J927"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26912.1"
FT                   /translation="MAKQELGTKRVDPETGKKFYDLNRDPIVSPYTGISYPRSYFEVAA
FT                   AEANSEEEVDTEELDTALEKSAFMLLEDDGDDPKDDDLPDLEDSDVDLGDDDDTFLSHD
FT                   EDDEDDDVTDILGGGVSKDDDS"
FT   tRNA            131572..131647
FT                   /locus_tag="BH00970"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:131605..131607,aa:Ala)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        132510..134348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BH00980"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26913"
FT                   /db_xref="GOA:Q6G543"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G543"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26913.1"
FT                   /translation="MPSYRSRISTHGRNMAGARSLWRATGMKESDFGKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAQQIVASGGIAKEFNTIAIDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMINAHCADALVCISNCDKITPGMLMASLRLNIPTIFVSGGPMEAGKIKWKDQDLTVD
FT                   LVDAMVAAAAENNSEEEVAEMERAACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRQMLFEEAGRQIVTLVKRYYEKGDETVLPRSIASRKAFENAMTVDISMGGSTNT
FT                   VLHLLAAAQEGEVDFTMTEIDRLSRRVPVLCKVAPAVANVHMEDVHRAGGIMGLLGELD
FT                   AVGLIDTSAYTVHAKTMKEALCRWDVKRTNEPKTHEFYRAAPGGISTQTAFSQSRRYDS
FT                   LDLDREKGIIRDKEHAYSQDGGLAVLYGNLAKDGCIVKTAGVDQSILTFKGPARIFESQ
FT                   DSAVSAILNDTIQSGDIVLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKVCALITDGRFS
FT                   GGTSGLSIGHVSPEAAEGGAIALVEEGDIIEIDIPNRTIHMLVEDDELMHRRVKMEAKG
FT                   KAAWQPTEKRKRKVSKALKAYAAMTTSAAKGAVRNI"
FT   CDS_pept        134491..134639
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH00990"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(136627..139371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="BH01000"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /db_xref="EnsemblGenomes-Gn:BH01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26915"
FT                   /db_xref="GOA:Q6G542"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G542"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26915.1"
FT                   /translation="MDNKTDNKNNLTPQSAPSSAPHKERLTPMMEQYIEIKAVNSDCLL
FT                   FYRMGDFYELFFNDAIEAAQVLGITLTTRGKHLGEDIPMCGVPVHTADDYLQKLISCGY
FT                   RVAVCEQTEDPAEAKKRGSKSIVRRDVVRLVTPGTLTEEKLLDPTRANYLMTLARIKTS
FT                   DGEEFALSWIDISTGIFRVTESRLEKLLADIMRVDPQEIIVADSFFHDKSHKSLFNVLD
FT                   CIVSPQHASLFDVITAERDICSYFKLSTLEGIADYSRPELSAIAAAIRYIEKTQITHRP
FT                   PLMRPERQNESATLFIDAATRLSLELVRTTSGQRDGSLLKAIDRTVTGGGSRLLLDRLI
FT                   APLTTPSAIDKRLDSIAFFLRNTSLAEDIKLILKGGPDMPRAVSRLALGRGGPRDMASI
FT                   QRGFEIIRELHQLLSNELLPQEISDVQQIFSHLPTALHLRLEQALADDLPLLKRDGGFI
FT                   RPHYHKELDEMRTLRDESRRVIAELQAQYAQETDIKTLKIKHNNILGYFIEVTNLQATA
FT                   LTNTPQAKARFIHRQTMANAMRFTTTELAELESRIAHAANHALTLELEIFDTLVHEITE
FT                   QVDFIRKAAESLAVLDVSVALAHLAEEQGYCRPKIDQSLTFCITAGRHPVVEQALRKQA
FT                   AEPFVANNCDLSLQENHQYAAIWLLTGPNMGGKSTFLRQNALIAIMAQMGSFVPATSAH
FT                   IGVVDRLFSRVGASDDLARGRSTFMMEMVETATILNHATQHSLVILDEIGRGTSTFDGL
FT                   SIAWATVEYLHEVNHCRAILATHFHEMTALTEKLDRLHNVTMKVKNWDGDVIFLHEVTP
FT                   GAADRSYGVQVAKLAGLPKAVITRATDVLQQLEQGEMAGKGHKLIDDLPLFSLKTTSSL
FT                   NEDTNKYSMLHEAFKNIHPDELSPKQALEALYHLKQLEKNNPL"
FT   CDS_pept        139581..141878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="BH01010"
FT                   /product="NADP-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BH01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26916"
FT                   /db_xref="GOA:A0A0H3M4C6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26916.1"
FT                   /translation="MKKNEQDQKTHQTVYNISEREALDFHSRGRPGKLEIVATKSMATQ
FT                   YDLALAYSPGVAVPVKAIAQNPELAYDYTTKGNLVAVISNGTAILGLGNLGALASKPVM
FT                   EGKAVLFKRFADIDSIDLEIDTNDPENFINLVRHLEPSFGGINLEDIKAPECFMIESRL
FT                   REVMNIPVFHDDQHGTAIIVAAGVLNALYLTGRDMENTRLVCNGAGSAGIACIELIKAM
FT                   GFRSENIILCDTKGVVYEGRKEGMNQWKSVHAVRTDKRTLAEAMEGADVFFGVSAKGAI
FT                   TPEMVKSMAPRPIIFAMANPDPEITPEEVMQVRKDAIIATGRSDYPNQINNVLCFPYIF
FT                   RGALDVRATVINEDMKIAAARAIADLAHEEVPDSVAEAYRGKRLKFGPNYIIPVPFDPR
FT                   LFTVVSIAVAKAAMKSGVAQRHIDDLEAYERDLNARRDPISSMMRGVYNHVRQSPKQIV
FT                   FAEGEEEQVMRAAVSYVHQKLGQAILIGREEQVRENAAIAGIDLEREGISVMNAKLSCR
FT                   LDAYANYLYKKMQRQGWLLRDCHRRINNDRNYFAACMVALGDADAMVTGVTRNYETALI
FT                   DIRRVIDEKPRERLIGISMAICRGRTVFIADTAVYENPNAEEFAHIAEQTASFVRGLGY
FT                   QPRVAFVAFSTFGYMKGQVTRHIQDAVNILRERRADFEFDGEISADVALNVKLMQQYPF
FT                   MGLTEPANILVMPGYHASSIASKMLQELGEATIIGPILIGLERSVQIVPFSGSDTDVVN
FT                   IATLAAYHAEKL"
FT   CDS_pept        complement(141929..142405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="BH01020"
FT                   /product="Protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:BH01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26917"
FT                   /db_xref="GOA:Q6G540"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G540"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26917.1"
FT                   /translation="MAESEINNNDGEPVFAVLTQYLKDLSFENPSAPRSLRPREKAPQI
FT                   DININVNANPIGDDNYDVVLSLSVKASDDSETLFHVELIYGGVFHIKNIPQEHVMPLVF
FT                   IECPRLLFPFARQIISDATQNGGFPPLWIDPIDFAALFQKRVAEEQKNSQTLSS"
FT   CDS_pept        complement(142551..143057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26918"
FT                   /db_xref="GOA:A0A0R4J865"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J865"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26918.1"
FT                   /translation="MIKSYPINPRFFIIFTLGIFLVEIAGFIFVGKEIGILATLSLIIL
FT                   TTIAGSILLRIQGGSLLKNLQRELLQGQTLEHYIINDGCIIIGAILLILPGFVSDILGI
FT                   LLLIKPVRGIAWYLLSSLRNKMNKHNKNSTKTQNESEEIIDLKAEDYQIRNTTESSWRK
FT                   NDNNH"
FT   CDS_pept        143241..143933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26919"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26919.1"
FT                   /translation="MEFDIVLVLALVIMVVVFMQLRNVLGKRIGFEKPPFDPYSSRSKK
FT                   QIETETADNNASLSHQVNSQKNDFSEIDAIAPEGSELNKGLRALHQNDPHFSPQFFIKG
FT                   AQVAYEMIVTAFAKGDRNQLRRLLSQDVFESFDAAIEQREKNNERVQFTFVGINKIEFV
FT                   AAAMQEKEEFLTIRIVSEMISATYNEQGERIDGDPDTIVEIRDIWTFVRNSLSTDPNWK
FT                   LFATEDED"
FT   CDS_pept        143996..144616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26920"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26920.1"
FT                   /translation="MSTDEWRTERDPLVSQDRFLWEKVCCTIIPLHKKRYSSFAKEVVN
FT                   VSKDAVKINNKKQYITQILPLSQANQQKLTEVKREKKAIAQTHKIHFFDRVVHRKIAKG
FT                   HYSIEARLDLHGCMQEEAYFFLKKFLQSSQQNGLRYVLVITGKGRSPGSNGVLYQSVPH
FT                   WLSTPAFRYYVHAFEQAARQHGGDGALYVRLRRFLPGKGYDVV"
FT   CDS_pept        145455..146129
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH01060"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(145476..145715)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH01070"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(146540..147550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01080"
FT                   /product="Heat shock protein hsp33 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BH01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26923"
FT                   /db_xref="GOA:A0A0H3LX41"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26923.1"
FT                   /translation="MSEEREQAKDEASLNNIYLSEDDTVIPFQIEELDIRGRAVQFGKA
FT                   LDSILTRHQYPEPVSYLLAEALVLTVLLGSSLKLKGKFILQTHSNGPINMLVCDFSPPF
FT                   SLRGYARFDEEKLKQAIANNQISSETLLGKGTLAFTIRQGAHTQDYQGIVALEGSNLQE
FT                   ATRAYFDQSEQILTDIRLAVAILINRDQKGKQQKSWRAGGILTQLLPQASSHHKIYEPN
FT                   KKPQETKTRAQLENQWKEAKALTSTIESTELTDPQIGSKRLLFRLFHEQGVRVFNPISL
FT                   VDQCSCSREKIKEILEGFPPEERNQMVKDKYISVTCEFCSTTYRFKPLEFPENKT"
FT   CDS_pept        complement(148532..149737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="BH01090"
FT                   /product="Acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26924"
FT                   /db_xref="GOA:A0A0R4J8W0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26924.1"
FT                   /translation="MNSTTIQPLYECFARRNLHFEQGNAVWLISDKGERYLDFTSGIAV
FT                   NVLGYAHPKLIDTLKRQAEKLWHVSNLFQSPEQEALAAQLCVNSFADKVFFCNSGAEAV
FT                   ECAFKTARHYHYASGHPTRFEIITFEDAFHGRTLATLAATGQEKYLQGFGPKADGFIQI
FT                   PLCDEIALRNAINKNTAAILIEPIQGEGGIRTVSHEYLRLLRKICDENGLLLILDEIQT
FT                   GIGRTGKLFAYEWSGITPDILTLAKGLGGGFPLGACLATEKAAKSMTPGTHGSTFGGNL
FT                   LGMAVGKTVLDIILEPGLLDHVQQMGYKLKSGLSNILNDYPDIICAINGVGLMLGIQCV
FT                   VPSQVVVSALESEYLLSVSANNNVVRFLPPLIIKEEEVNESLHRIEKAIASLSQTNKKQ
FT                   LV"
FT   CDS_pept        150217..150750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26925"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26925.1"
FT                   /translation="MGWTCERVELLKKFWSEGLSASQIAAQLGGVSRNAVIGKVHRLKL
FT                   PGRGKTAQGGGRVQKALVGVSSSPVRMRRTPSTVLPTNTASCSVGATALKVDVVVEDVT
FT                   EVDLPEKSNVVVPISRQLNLLQLSENTCRWPVGDPLSPDFHFCGADSGENSPYCAFHAK
FT                   IAFQPISERRRIRI"
FT   CDS_pept        complement(151611..152258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="BH01110"
FT                   /product="Thiol 3A-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26926"
FT                   /db_xref="GOA:A0A0H3LVD1"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26926.1"
FT                   /translation="MKITPPKPEKNISLPLFFDLVGPFVFFLLLLMFLFYFMQSKHPND
FT                   TSLLPNTLAEKLAPKISLPLFDNENYLLNSDQFKGRVTLINFWGSWCPSCREEHPLLMK
FT                   IAQDQRFDLIGINYKDNKENAQRFLNNFGNPFKFIGFDVSGYTAINWGVYGPPETFLLN
FT                   KENIIIAKHVGPLTWQIYQKKILPKIEKAIMTEEILKNKRLIYKDNLSSSQY"
FT   CDS_pept        complement(152233..152484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26927.1"
FT                   /translation="MFDFHNMHSGFLGNLSQQIDFFLGTLHHKQIVILSYIFSAISLLC
FT                   FIGYIFCKTLYQKKILQQLNKKELFRKEKYHENHPSKT"
FT   CDS_pept        complement(152497..153252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="BH01130"
FT                   /product="Heme exporter protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BH01130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26928"
FT                   /db_xref="GOA:A0A0H3LX45"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26928.1"
FT                   /translation="MNETFHTHKMNTLPASFTRFMKISSAVLPWLIGITLCLLILGFIL
FT                   IIYSPDDYQQGITVKIMYIHAPFAWLSTCCYIIISAAALGSLIWKYHLADVTLKCGAPI
FT                   GAIFTALALVTGALWGRPTWGTWWVWDARLTSVLILLFIYLAIVMLARAFNNQAKAARA
FT                   TAILTLVGLVNIPIIKFSVNWWNTLHQSASLLRAGGPTIERAMLWPLITMLLCFSFMFI
FT                   SLYLMAMRNEINSRHIQILQIKKARRAQH"
FT   CDS_pept        complement(153299..153964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="BH01140"
FT                   /product="Heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BH01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26929"
FT                   /db_xref="GOA:A0A0H3M4D2"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26929.1"
FT                   /translation="MKALFWRDLKLTLAPQASSLKGLLFFIAIIMIIPFAIGPNPKVLS
FT                   QIGPGILWLGALLAGLLNLNKLFQTDHDDGNLDQFILSGQRQSFTLIVLTKCLAHWVGT
FT                   MLPLIFATPFLAFMLHLDAIITFTTILTLLCGTPAIIFIGAIGAALATSLLHSTLLIFI
FT                   IILPWIIPIMIFGVSAATAPTNPNVSFLTSLTLLIGFSLLLSLFSSFIAAITLKLLSE"
FT   CDS_pept        complement(153961..154587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="BH01150"
FT                   /product="Heme exporter protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26930"
FT                   /db_xref="GOA:Q6G529"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G529"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26930.1"
FT                   /translation="MVLSGKDLTAYRNEDVLFQGLSFCLFPQQLMTITGPNGIGKSTLL
FT                   RIIAGLFKAAEGHVSLKDQEQIYPVATACHYLGPQNAMKPFLSVIDNLQFWSAFYGQPL
FT                   HSPHEVLADIGLSDLEHVPFNVLSTGQKRRIAIARLLLSYRPVWILDEPISGIDSYAQT
FT                   LLTNIFQYHLNQGGMIIAATHSPLGIPENHKITLEKFLPPQEKIQ"
FT   CDS_pept        154889..157576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="BH01160"
FT                   /product="Aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26931"
FT                   /db_xref="GOA:A0A0H3LVW8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26931.1"
FT                   /translation="MTQIDSFNCRRTLDVSGKEYTYYSLIEAEKNGLKGISHLPFSMKV
FT                   ILENLLRFEDGRTVNKEDILNVAKWLKDKGSAGAEIAYRPARVLMQDFTGVPAVVDLSA
FT                   MRDAMVKLGGNAEKINPLIPVDLIIDHSIIVDAFGNPMAFKENVEHEYERNSERYRFLK
FT                   WGQQAFQNFRVVPPGTGICHQVNLEYLAQCVWMKGDEKYQTVYPDTCVGTDSHTTMVNG
FT                   LGVLGWGVGGIEAEAAMLGQPVSMLLPEVIGFHLTGKLKEGVTATDLVLMVTQILRKKG
FT                   VVGKFVEFFGPGLEHMTLADRATIANMAPEYGATCGFFPIDRETVRYLNMTGRNENRIA
FT                   LVEAYAKAQGMWHDEMGTDPVFSDTIELDMGSVVPSMAGPKRPEGRIALETVGQGFEKA
FT                   LVEDYKKAFGQDDRYRVEGEKYTLRHGDVVIAAITSCTNTSNPSVLIAAGLLARNAVAK
FT                   GLKSKPWVKTSLAPGSQVVAAYLHNSGLQKDLDVLGFNLVGFGCTTCIGNSGPLYPSIS
FT                   KAINDNGLIAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAHALAGTVRKDLTKEPLGE
FT                   GSDGQPVYLRDIWPTSKEIQEFIEKNVTRKIFTEKYADVFKGDENWQKVRVPTEATYSW
FT                   DEQSTYVRNPPYFDNMRKVPDALSDIKNARILGLFGDKITTDHISPAGSIKVDSPAGKY
FT                   LTNHGVKVADFNQYGTRRGNHEVMMRGTFANIRIRNFMLGENGREGGYTVHYPSGTEQA
FT                   IYDAAMAYKREGIPLVVFAGIEYGNGSSRDWAAKGTNLLGVKAVIAQSFERIHRSNLVG
FT                   MGIVPFVFEEGESWQSLGLKGDEKVTIEGIHNLKPRQKIVATITFSDGTVKTVPLLCRV
FT                   DTEDELDYLHHGGILQYVLRNLAV"
FT   CDS_pept        157800..158066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BH01170"
FT                   /product="30S ribosomal protein s20"
FT                   /db_xref="EnsemblGenomes-Gn:BH01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26932"
FT                   /db_xref="GOA:Q6G527"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G527"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26932.1"
FT                   /translation="MANTPSAQKAVRKVAARTQVNRARRSRVRTFMRKFDDALAGGDRA
FT                   SAEVAFKNFEPEIMRAVSKGVFHKNAAARKVSRLAKRLKALSV"
FT   CDS_pept        158771..160342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BH01180"
FT                   /product="Chromosomal replication initiator protein D"
FT                   /db_xref="EnsemblGenomes-Gn:BH01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26933"
FT                   /db_xref="GOA:Q6G526"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G526"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26933.1"
FT                   /translation="MVDKLNSKASSFKRVSVDILSAERIIKANMTDVDSKVVGNASLEH
FT                   PVISEEEGAAAFARVMAQLKAQVGIEAYTSWFGRLKLAEYSRNLVKLSVPTAFLRSWIN
FT                   NHYGSLLTNLWKQENSAILRVEVIVRGMKRVSKAVVCGKNAAPVVLEEKTASSFLENYT
FT                   EHSVRGVEAGIFGSPLDSRYTFESFVEGSSNRVALAAARSIAEGHKSALRFNPLFIHAS
FT                   VGLGKTHLLQAIAAAALKRLKPARVIYLTAEYFMWRFATAIRDNDALSFKEQLRDIDLL
FT                   IIDDMQFLQGKSIQNEFCHLLNMLLDSAKQVVVAADRPPSELESLDLRVRSRLQGGVAL
FT                   EIEAPDYEMRLEMLRQRLKVAQQDDNMIVISDEVLQYIAKTILGSGRDIEGAFNQLLFR
FT                   QSFESDLSLERIDEFLGHLTRSGESKRIRIEEIQRAVARHYNVSKQDLLSNRRTRTVVK
FT                   PRQVAMYLAKMLTPRSLPEIGRRFGGRDHTTVLHAVRKIEDLVCDDQTLAKELELLKRL
FT                   IGEQAA"
FT   CDS_pept        160539..161660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BH01190"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26934"
FT                   /db_xref="GOA:A0A0H3LVD5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26934.1"
FT                   /translation="MRITVDRNQLLKSLGRVHRVVERRNTVPILSNVLIDADKNGVQLK
FT                   ATDLDLEVTESFVANIKQEGAITVPAHLLYDIVRKLPDGSEIVLSVDMNQASTMSVVSG
FT                   CANFQLQCLPKVDFPESLPGQFGYRFSLSTSGLKHLLDCTQFAISTEETRYYLNGIYFH
FT                   VIDDGVLKLRLVATDGHRLAQVDMEAPSGVEGMPGVIVPRKTVGELQKLLSEEVDEDVC
FT                   VELSETKIRFSIGSVVFTSKLIDGTFPEYQRVIPLGNDKKLIVNRQDFSSAVDRVSTIS
FT                   SDRGRAVKLTIEQGQLKLIVHNPDSGSAEDQLAVTYTSDPLEIGFNSRYLLDIAGQLSS
FT                   DEMVFMLAEAGAPALIRNNGVADALYVLMPIRV"
FT   CDS_pept        161681..162814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BH01200"
FT                   /product="DNA replication and repair protein recF"
FT                   /db_xref="EnsemblGenomes-Gn:BH01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26935"
FT                   /db_xref="GOA:A0A0H3M1X6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26935.1"
FT                   /translation="MAGHVHKVAVRQLKLLRYRNYFSFNIRFSGQHVVFTGHNGSGKTN
FT                   LLEALSFLSPGRGLRRAAYSDVSFANGGGEGFVVFARLECALYGEVNIGTALEMSDNSR
FT                   KVHINGVNETGDCLTDYCHMSILTPSMDGLFTGSSLERRRFLDRMVLAIDPLHSRRIAD
FT                   YDRVMRARNRLFLDGNEDCAWFDALEKQMAELATAISAARIDVIRLLNDMLARTPSQLP
FT                   FPRAFLQIDGFLEAALSKISAVEVEEQFCDRLQHNRAIDRAAGRTLEGPHRTDLQVFYA
FT                   DKNMAAASCSTGEQKALLTGLVLCHARLTGLMSERTPILLLDEIVAHLDSHRRAALFDI
FT                   LDDLGGQTFMTGTDPILFNALKGRAEFFAIKDGTLLQ"
FT   CDS_pept        162862..163308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="BH01210"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26936"
FT                   /db_xref="GOA:Q6G523"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G523"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26936.1"
FT                   /translation="MSMIITILNGPNLNFLGKREPEIYGTETLKDIEQFCKECATRLGV
FT                   RIHFYQSNYEGQLVEWIQEAIGVSAGLIINPAAYSHTSVAILDALKMFTGTKVEVHLSH
FT                   IYHREAFRHHSYTSAAVDAVIAGCGGDGYWLALEYIVKRFNRNK"
FT   CDS_pept        163432..164403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="BH01220"
FT                   /product="Cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BH01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26937"
FT                   /db_xref="GOA:A0A0H3LX51"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26937.1"
FT                   /translation="MKNFVRQLEILAVLGGLLLISGCKIDVLQPSGYVARQQLILITVC
FT                   VLVMLCVVIPVMVSVVFLAIKYRASNTAADYLPDWGHSNKIEAFMWGIPIVIVTILGLL
FT                   TAYYTYKLEPTNSLPVDVVGEEKPLQVDVVALDWKWLFIYPGYGVASINEIYAPKGRQV
FT                   LLQLTSENSVNAFWVPKLGTVLYAMPQMNAKLHLVAEEQGIFKGSSANYSGDGFAGMRF
FT                   KWHSVSSQDFDKWIAKVRANGQILDRASYRQLTIAPRMGDSTAKEKDAEVRYFAPVEKR
FT                   LYYRVVNRCVDENTVCNEDLMKRAAAQTLWGALCSVFDADVI"
FT   CDS_pept        164478..166496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="BH01230"
FT                   /product="Cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BH01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26938"
FT                   /db_xref="GOA:A0A0R4J986"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J986"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26938.1"
FT                   /translation="MFGRLTDPTAGAFHALTHEPIVLYTCIAIVLGGLIVVLALTILGW
FT                   WGVLWRNWITTVDHKRIGIMYIILGIIMLVRGFADAIMMRTHQAFALGSETAGYLPPEH
FT                   FDQIFSAHGVIMIFFMATPILFGLFNYLIPLQIGARDVAFPFANNLGFWITAAGAILIN
FT                   ISLGVGNFGRGGWLMYPPFSELQGSPDTGVDYYLWSLQLSGIATTMGAINFVATIIKMR
FT                   APGMTMMRMPVFCWSAFVSNVLILVIYPVLAVAFALLACDRYLGMNFFTNVGGGNPMVW
FT                   INYVWIFGHPEVYVLVVPAFGIVSEVVSTFSSKRLFGHTSMVWAMLVILILSLLVWGHH
FT                   FFTMGGGEAVNTFFGIATMIIAVPTGVKVFNWLLTMYKGRIRFEPPMLWCMGMIFTFVG
FT                   GGLTGVLMSIVPADWQFHNSLFLVAHFHHTIIGGVVFAYLAGLAFWFPKVFGYKPNRAL
FT                   GIASFWCWFIGFHLAFFPVYALGLMGATRRLQHYMEPSWQPMFMIAALGAFIILLGILC
FT                   FVLQVVLAIWYGIKHKGRLPVTLNDSWGDARTLEWFTSSPPPSYNFAVIPKVQSDDAYW
FT                   NMKKNGYQRQINGFSKIHMPSNTSAGIIAGFFSLVLGFALVWHIWWLVVIGFIGFIATI
FT                   VCHSLTGDHHGYYISAEEVQKTEDAFTAVLKEQGVTV"
FT   CDS_pept        166493..167158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="BH01240"
FT                   /product="Cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BH01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26939"
FT                   /db_xref="GOA:A0A0H3LVY0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26939.1"
FT                   /translation="MSATTMDNAHVDEHHHDSSSIMTFGFWVYILSDLILFSTLFSSFA
FT                   VFSASYGGGKAGNEFIDLNFVLVETAILLLSSITYGFVMIQAHKGNIGGVRLWMTITFV
FT                   LGLFFIGMEIYEFHELLKEVFYYDPGAYAGIDPATGLQLFGKEVLSAYWSAFFALVGTH
FT                   GLHVSAGLLWMIVMFFHIHHCGLDQDNKTRLACLSIFWHLLDIVWVGVFTMVYLLGAL"
FT   CDS_pept        167158..167844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="BH01250"
FT                   /product="Cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BH01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26940"
FT                   /db_xref="GOA:A0A0H3LVD9"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26940.1"
FT                   /translation="MSMHNETHNPSTSSYLVGFILAVFFTLGSFIPVMYGMMDSWAIST
FT                   KVVYLIGMAIIQIIVQIIFFLHLNSGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNY
FT                   NMMGGSGRVVEPEISGGTNPSVSEQLSDIQEIEKHLSGKDISAQKAPAVQIPVEPVPGS
FT                   EMPLGQAPTVQTPIEPIPGSEIPLEQAPAVQTPIEPVPGSEIPLGQAPAVQTPVELAPG
FT                   AEMPME"
FT   CDS_pept        168283..169305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BH01260"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26941"
FT                   /db_xref="GOA:Q6G518"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G518"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26941.1"
FT                   /translation="MHAVSMTIIGAGSYGTALAIVLARNGHHVLLWGYNPQHIRELQEY
FT                   RCNQAFLPDVQFPDNLCPEDSLETAIKASRNILIAVPSHVFHQVLYNIRPYLDQHSRII
FT                   WATKGLEHGTGRLLQEVAREILGDKIPLAVFSGPTFAKELAIGLPTAITIAASDTEFSE
FT                   ELQQLFHFDKSFRVYKNSDMIGVQLGGAVKNVIAIGAGISDGMGFGANARIALITRGLA
FT                   EISRLGIAMGAELSTFMGMTGLGDLVLTCTDNQSRNRRFGMLLGQGVDIEEAKKQIDQI
FT                   VEGYLNTKEVHMLAQRIRVEMPITEQIYHVLYCGKSVSEAANALLSRQLKDEMYDTVRF
FT                   "
FT   CDS_pept        complement(169588..170406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI1"
FT                   /locus_tag="BH01270"
FT                   /product="Enoyl-[acyl-carrier-protein ] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26942"
FT                   /db_xref="GOA:A0A0H3M1X9"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1X9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26942.1"
FT                   /translation="MKGLMEGKRGLIMGVANDHSIAWGIACQLAKAGAELAFTYQGEAF
FT                   GKRVQPLAEKIGCKLVLECDVEKIENVDRVFKRLEKEWKTIDFVVHAIGFSDKTQLKGR
FT                   YVDVTTRENFKRTMVISAYSFTEIAQRAGKLMPNGGTLLTLTYGASQQVVPNYNIMGVA
FT                   KAALEAMVRYLAADFGPQNIRVNAISAGPIRTLAGNGIAAARAIFSYQRRNAPLRRNVN
FT                   INEIGKSALYLLSDLSSGVTGEIHYVDSGYNIMSMPTLEELKQSEEAQEE"
FT   CDS_pept        complement(170455..171675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="BH01280"
FT                   /product="3-oxoacyl-[acyl-carrier-protein ] synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:BH01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26943"
FT                   /db_xref="GOA:A0A0H3LX56"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26943.1"
FT                   /translation="MRRVVVTGMGIVSAIGNNPGTVLTSLYEAKSGISYAPQYAKLGFR
FT                   SRVYGKPDINIEELVDRRALRFHGRGTAWNHIAMDQAIADAGLEPHEVSNEHTGIIMGS
FT                   GGASTQSIVEAADITRQKSPKRVGPFVVPKAMSSTASATLATFFKIKGVNYSISSACAT
FT                   SNHCIGNAYEMIQYGKQDRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDVPEKASRAYDA
FT                   HRDGFVIAGGAGVLVLEELECAKARGAKIYGEIVGYGATSDGHDMVAPSGEGAERCMRM
FT                   ALATVKNKIDYINPHATATPVGDPPEIEAIRRIFGAGDQCPPISATKSLTGHSLGAAGV
FT                   QEAIYTLLMMNHNFICESAHIEELDPAFADMPIVRERRDHQQLNTVLSNTFGFGGTNAT
FT                   LVFQRYG"
FT   CDS_pept        complement(171733..172242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="BH01290"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein ]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26944"
FT                   /db_xref="GOA:A0A0R4J7H6"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7H6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26944.1"
FT                   /translation="MAEQKSRYTYEELLSCARGEMFGKGNAQLPAPPMLMIHRITEINE
FT                   TGGEYNKGMLRAEFDITPDLWFFNCHFIGDPVMPGCLGLDGMWQLTGFFLGWLGEPGKG
FT                   RAISTGEVKLSGMVTPQTQLLEYGIDFKRIRRGNLVLGIADGWVKADGESIYKASDLRV
FT                   ALFKED"
FT   CDS_pept        172475..172978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur1"
FT                   /locus_tag="BH01300"
FT                   /product="Iron response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26945"
FT                   /db_xref="GOA:A0A0R4J8C4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26945.1"
FT                   /translation="MLVNTDNLGFNEEEQSTKDCGKVVRCYSISMLEKHLRQNGLRPTR
FT                   QRLELANMIFSQGNRHIAAEELYEEAIRLGVPVSLATVYNTLHQFTEAGLLRIIAVEGS
FT                   KTWFDTNTSDHYHFYIEGENRILDIPCNLEEAPIIGNLPQPPEDMEISHVDLIVRLKPK
FT                   KLIG"
FT   CDS_pept        complement(173034..173594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26946"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J930"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26946.1"
FT                   /translation="MQHSRWFRFLLLASCFLMAEVFVFSSLDFLHAQTLNQNLGPSGLP
FT                   LPRFASIKPTRVNVRVGPGSDYAIIFTYKKQGLPIEIIQEYDQWRKIRDAEGDEGWVYQ
FT                   SLLSGKRTAITIPWQKDKTKRLILRKSPADNAEVVAEVEPNVIGNIRHCNGYWCELNIN
FT                   NIRGWVYQSQLWGIYPDEKINSW"
FT   CDS_pept        complement(174773..175006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BH01320"
FT                   /product="30S ribosomal protein s21"
FT                   /db_xref="EnsemblGenomes-Gn:BH01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26947"
FT                   /db_xref="GOA:Q6G512"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G512"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26947.1"
FT                   /translation="MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAR
FT                   EKAEAVRRTRKLARKRAQREGLISNGRGSPLK"
FT   CDS_pept        175273..176901
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH01330"
FT                   /product="formate-tetrahydrofo"
FT                   /note="Identified by comparison to Sinorhizobium meliloti"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(177534..177610)
FT                   /locus_tag="BH01340"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:177574..177576,aa:Arg)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        177993..179135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26949"
FT                   /db_xref="GOA:A0A0H3M1Y2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26949.1"
FT                   /translation="MEFSKKIFLLMFFVVILMVTYWARKQSSEQFIPLVDKTTNASHKL
FT                   SKVSMGRPPTNVVVDLVKIQDFHKRLNVLGSGQAFASVELTPWSSGVINKFFVSAGTKV
FT                   QVGDVIAKLDSKKEEIAAAKAKVQRDNSASTLSRILKLRASKTATEVQEINARLELDNA
FT                   NLALRNAELDLDRRTIRTPISGTVGILPIDEGNAVALNTVIGRVENRERILVDIWVPER
FT                   YASHIHKGDEVTATLMAQPDKTFVGHIYAIDNVINPESRTLHVQIEIKNEKDTLMSGMS
FT                   FSVALQFYGDLLPVVNPLAVQWNSKGSFVWRVRDGKVEPIPVSIIQHKADQVFVKAALK
FT                   SGDQIVIKGVQMLYPGSQVTIDDSKARQQQLLSLPEQDVQ"
FT   CDS_pept        179132..182266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="BH01360"
FT                   /product="Acriflavin resistance protein d"
FT                   /db_xref="EnsemblGenomes-Gn:BH01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26950"
FT                   /db_xref="GOA:A0A0R4J7B3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26950.1"
FT                   /translation="MSQELNTKQLRVQEEQDGIIGLFIRRPVFTFVLNAMIIIAGFAAW
FT                   LNVDVRELPDVDTPVITIMTAFAGASAETIDREVTRIIEDAVSRVSGVKTISSTSSFGR
FT                   SRVEIHFNVGIDLNVAASDIRDALSRITYSLPKNADSPLIIKADSNAAAMMYLVVTSPT
FT                   MSIDDLTMIVDDQIVDALSAVDGVGDVQVDSARTKIFQIDVDQAKLASYGLTVADISRV
FT                   LADMTTDVPVGSLRNSKQTLVVRATARLTTSEAFEQVVLKPHVRLGDVAHVTLSPDLET
FT                   VILRINGKTGIGLGIVRKAQSNTLNISQGVRAVVDRLKTVIPSSVHMSIISDDAIFIKG
FT                   ALHEVEVALVIAVLSVILVIFLFLRDIRVTLIPALSIPVALIGTIAAIYLVGFSLNILT
FT                   FLGLVLATGLVVDDAIVVLENIVRWRNMGFGSRAAAVLGTREVFFAVLATTLTLVAVFV
FT                   PISFLPGQVGALFREFGFVLAISILLSSFVALTLCPMLASRFLKGHAESNGKGAYHFTF
FT                   LYKLGSFFRKGYHYSLHKCLGRPWTVIFASLIFAGLCFGGYTKLQQELTPAEDRALIFL
FT                   VINGPQGISTQYLNEQVEQIETSLQPLRDSGEIINSYSIAGIGGSTNTAFLVLLLSSWD
FT                   KRLRSQQEIVEDVNAKVGQFPAVFVFAVQGNSLGVRGTGQGLQFAILGNDYTKLQPIAE
FT                   KLVNALQADPHFIRPRLTVDTTQPQFFIEINREKASDLGVDIINLGNTLQTMLDGKKIG
FT                   SVYVDDHSYDVKLTSRKNPINNPHDLENIFLKTKDNQYVPLSVIASLHEKAIAPQLKRE
FT                   KRMSAVVLSTNLAPGVVLGSAYQTVQKIAAPLLLEGNYIVPLGEAATLGETSSNFMIVF
FT                   GIAFVIILLVLAAQFESFVSGFIIMATVPLGIGCAVISMLLSGVSLNIYSQIGLILLIG
FT                   VMAKNGILIVEFADQLRDKGKSVCEAIEEAANIRFRPVCMTMICAILGGIPLVLAKGAG
FT                   AEARIALGWVIVGGLGLATIFTLYVTPVVYLFLGRFVRSKSEEALRLRRELNQAE"
FT   CDS_pept        182449..184128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpi"
FT                   /locus_tag="BH01370"
FT                   /product="Glucose-6-phosphate isomerase (gpi)"
FT                   /db_xref="EnsemblGenomes-Gn:BH01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26951"
FT                   /db_xref="GOA:Q8L1Z9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L1Z9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26951.1"
FT                   /translation="MRYKSMGDSLSIRNEKAFEAALQALRRHAIKDGVYDIRRHFIEDE
FT                   QRFSNFSLNLDDFLFDFSKCGVTFKTLQLLDDLAVAADVLGRRDAMFSGKAINTTEKRS
FT                   VLHIALRLPADEVFMLDGTDLVHDIQGVLADMERFSDMVRDGSYKGNSGEKIIDIVNIG
FT                   IGGSDLGPAMVTYALKPYHDGPNCHFVSNADSAHISDTLSVLNPATTLFVIASKTFTTA
FT                   ETIANAQVARQWIMSHLGKEAVCKHFIAVSSALDKVAEFGIDSSRTFRFWDWVGGRYSI
FT                   WSAIGLVVMLAIGGQNFRQFLEGAQHMDRHFKTAPLRKNIPIRFALLGFWHRVVCGYAS
FT                   RAVIPYAQRLARFPAYLQQLDMESNGKQVSLDGKTLTFSSGPVVWGDSGTNGQHAFFQL
FT                   LHQGTDVIPVEFILFIKGHEQNLHPMYDMLVANCLAQSKALMKGRSVEDARRMLLKSGI
FT                   DERESENLALHKSFAGNRPNMMLVQDLLTPFALGRLIALYEHRIFVEGILMNINSFDQW
FT                   GVELGKELANELLPILRGENKTNNRDSSTLGLLAHIQARRGE"
FT   tRNA            complement(184164..184253)
FT                   /locus_tag="BH01380"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:184217..184219,aa:Ser)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        184541..185017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BH01390"
FT                   /product="50S ribosomal protein l21"
FT                   /db_xref="EnsemblGenomes-Gn:BH01390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26952"
FT                   /db_xref="GOA:Q6G508"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G508"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26952.1"
FT                   /translation="MFAVIKTGGKQYRVVANQVVRVEKIIGNAGDVVEFNDILMAGQED
FT                   NAIIGAPVVRDALVTAEIIEQARARKVIAFKKRRRQNSKRTRGHRQEVTTLRILEILTG
FT                   GLKPKKAVAKSIKEEAAVLKATTQETKSAASVKKAAKKSAPQKQAAVASNSKED"
FT   CDS_pept        185032..185301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BH01400"
FT                   /product="50S ribosomal protein l27"
FT                   /db_xref="EnsemblGenomes-Gn:BH01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26953"
FT                   /db_xref="GOA:Q6G507"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G507"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26953.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKKFGGEAVIAGNIIVRQRGTRW
FT                   HPGDNVGIGKDHTLFALSKGMVSFQRKANNRSYVSVIPVVETVE"
FT   CDS_pept        186721..189225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruB"
FT                   /locus_tag="BH01410"
FT                   /product="Multiphosphoryl transfer protein (mtp)"
FT                   /db_xref="EnsemblGenomes-Gn:BH01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26954"
FT                   /db_xref="GOA:A0A0H3M4E2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26954.1"
FT                   /translation="MNRGFNESEILSTKSVKLAAAFDHKNDAIHAAAELLVQVGAVDKS
FT                   YLASMLKREAVTNTWLGNGIAIPHGMVENRDLIIRDAVAVIQIPAGVDWCDGNKARLVI
FT                   AIAACQDCYREICKKLTLLLFDKERLEELSTTADKQQIVTMLFSQDTKRERAFIGDLSV
FT                   RQEWTLDYPSGLHARPASLWVDFAKKAQGSIRVRHGQYTVEMKNLVGLLQLGAKNGDVL
FT                   IFSTDASEGVQLLKEAISVVKKVSISEKCVMRETEAQTKAFHGWYPRSMQKGISGVGAS
FT                   PGLALGKIFILRHDDISITDQPISFASGKACLENALTKTKQKMASIINDITVRVGADSA
FT                   AIFSAQMVLLEDENLIAQVCRFMAEGHGVAWSWDKAVRQFAGMFSKVDNPLLAARAVNL
FT                   VDVGRRVLGEINPSYRSFFLNDIPRGVILVTDDLSPSDVAQLDCTKVQGLATAWGGPLS
FT                   HTAILARTLSIPMVVAAGVDVLAIEPDIQAIIDGDNGFIYPDPTSEDVKEAEKRISIVV
FT                   KKRDNGICVCRLPVQTTDGQRIRIMANVNYANQVPVALNLGAEGIGLMRTEFLFLESPH
FT                   IPDEDAQFNVYRAMTAAVGDKPLIIRALDIGGDKQVQHLHLSKEDNPFLGVRGTRLLLR
FT                   RRDLLVPQLRALYRAAKEGGDLWILFPMVMSVSEIVAMKKIAEEIRNDIGAPKLKFGIM
FT                   IEVPAAAIMADVLSAHVDFFSIGTNDLTQYTMAVDRQNPYLVSEADSLDPAVLRMIYHT
FT                   IQGAAKHRCWVSVCGGMAGDPFAAMILTGLGIHELSMISCDISSVKACLQAHSFEDMKV
FT                   LAKKALQCETARAVRALSNDVR"
FT   tRNA            189669..189758
FT                   /locus_tag="BH01420"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:189703..189705,aa:Ser)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(192843..193124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26955"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26955.1"
FT                   /translation="MTSLCNKELSDTLVGLYDDYKRGFDIGEELKLCVDLALTLELELS
FT                   IHRLSETDTVLKKEIIQTLQNRRNSHSNEDETIDETGTIIQMDFKERN"
FT   CDS_pept        complement(193105..193584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26956.1"
FT                   /translation="MSKSQYKMSKITYASGKMRPPSLIQKLNVYKPFLLIVDINSTNFA
FT                   LVGNGEILGHLFYRQNSPSYTQIKSRLVIYPKCCKLYSEDIAIPLHDWKIENLGAIKLL
FT                   TKHNSLKTGTLHQIDKTMMLVYMAAFGEDSGVRSKISKPHGKTATWRNQHDLFMQ"
FT   CDS_pept        complement(193653..193946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26957"
FT                   /db_xref="GOA:A0A0H3M1Y6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26957.1"
FT                   /translation="MTITQKGDHHSILAKLRHRNIILAKLEKAYKIPSSNIKNIWTQLN
FT                   EKIEHTIADFIRLLAKQMFINRYLKSCIRISKAEKKRDTVSLVHHLFYNNAA"
FT   CDS_pept        194092..194595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26958"
FT                   /db_xref="GOA:A0A0H3LX66"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26958.1"
FT                   /translation="MAKKEIEPKTEQAKRLRLIRKSLQLHRDQIATRLGINKAIYDHAE
FT                   RGTTFPNVEFLTALSQQLKVNLNWFITGNGEMFTDMAKAKAAGFKPQAIPAGLMKRLGH
FT                   LAYTTYRDAKITLPPEDVAELAAGLYGKLQELIYNINDMEEVEATLPLLKLHLKRQVEA
FT                   EKAH"
FT   CDS_pept        complement(194851..195150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26959"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26959.1"
FT                   /translation="MTITQKEDRHSVLAKLCHRNITLTKRIETYQIVSSTVKNIWTHPN
FT                   EKTKHALANLSGLHAKPIFVDCYFESCNRISKLAKHLLPFLSPYCAITSLESRF"
FT   CDS_pept        195297..195839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26960"
FT                   /db_xref="GOA:A0A0H3LW04"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26960.1"
FT                   /translation="MARPETEPKTELAKRFREVRRILGFTERKQFAEHLGVTAGSIGTY
FT                   ETGVSEPTASALSKYQEICGVSLDWLVTGNGEMFTDMAKAKAAGFKPQAIPAGLMKRLG
FT                   HLAYTTYHDAKITLPPEDVAELAAGLYGKLQELIHNINDMEEVEATLPLLKLHLKRQIE
FT                   VEKAHRAIPGNTANSSD"
FT   CDS_pept        196976..202156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="badA1"
FT                   /locus_tag="BH01490"
FT                   /product="Surface protein/Bartonella adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BH01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26961"
FT                   /db_xref="GOA:A0A0H3LVF3"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26961.1"
FT                   /translation="MKKLYSTQNWAKAVSLGTAMAALLSSVSPVFAANLAIRGGVIEST
FT                   GAASVSYQFGSHGSIVFAGDDDFCGVDNVVGRGGKQQESLNNKITAEQQYENFINNQAD
FT                   NNGRHPYGTTTKKVTWQSEGILTPEGAYMGTNTGGSPNIMPEAYGVYSFVTGCGAAATG
FT                   NYSTAFGAGATTKAGGAQAFGVSALASGKASVAMGVSSEASGDSAVAIGGLATASGKSS
FT                   IALGTKTKAEKNYAIAIGLEAEAKASGSIAIGSRNSDRTEEDPNRRVIAEAENAIAIGT
FT                   HTYAKMDDTVAIGANAQALVKDGVAVGGASVSRVEKGVFGYDPAANAPITDSSIAWKST
FT                   AGAFSVGDVNGQITRQITGVAAGTNDTDAVNVAQLRAMKDVVAGAWKISANDTDPTNVN
FT                   PSDTVDFSVKNSDAGKDNLTIAKNTVDNKHKIEFTLNDNLKLTSVTTGQNSMSEDGFIF
FT                   ANGAKITVDGIDAGDKVITGVKAGEDDTDAVNFKQLKEFTSGIKGGGWKLSVNGADTTD
FT                   VKANSTVDLFAVKHKDDDGSDTDNANIRIVKDENNKVSFDLNDYIKVNRVETGITSLSN
FT                   AGLMIKDGPRVTKGGIHAGGKQITGVAEGTKDADAVNYKQLKEIRDAATTHWQLSVNGG
FT                   NGISIGQNDTVNLQSAGKEGSQNIKIVGDNDRNVTFDLADNITVTSVTAGRSKMSDDGF
FT                   LFDGDKGPRITIDGISAGKKKITEVEKGTDNTDAVNVAQLNEVRELISEAGGWKLSVNG
FT                   TDTINVKAGSTVDLFAVKQKEDDNNESENTNIKIVKSRDNKVSFDLSEYIKVGRVETGL
FT                   SSMSNAGFMIKDGPNMTKGGINAANTKITGVQKGTNENDAVNVAQLNEVKNQIAGNSLV
FT                   KWDEEEQLITVGKEKEGTKINIANINNQNRVISGVADGGLGEDSKDAINGSQINKISGD
FT                   VAKYFGGDAAFENGTFVGPRYNLSFVSADGSIEQKVFENVGDALTGLDANVKNVNSRLT
FT                   YVDNKFDQKFADFSKDALLWSDEEKAFVALHGEGRKTNSKITFLKDGDIDVNSTDAING
FT                   SQLFKTNQTVANLIETLNGVHKDISKYFGGGADVIAGKAPTYIIQNNKYNDVGSAFNEI
FT                   DASITDIHNQINSVTSNSLVKWVDGQNLITIGAQKGGTKISIANSNGSDRTISGVKAAE
FT                   LKENSTEAVNGSQLFTTNQTVSNLINTLNDVHENISNYFGGGANVLDGLAPTYVISGET
FT                   YRDVGSAFTGVNISIKNLDDKIIEMKENNLVQQEGISGVITIGAKTAGTKISVAGVGGL
FT                   GRTISGVKAAENGDEAVNKDQLDKSIKGISKDALLWSEDEQAFVALHEKDGKKTKSKLK
FT                   SLLDGNISKGSTDAITGNQLYVMSNKLAAYFGGGAKYENGKWTAPSFEIVQVDANGRIV
FT                   KNSYNTVAEAFDGINSGMSNINNRIDDVINKVDSDALKWNKDKNAYDAGRNGQPSKIIN
FT                   VVDGKIAEGSKDAVNGGQLWKTNERVTKVENRVTDVENHVKIIDKKVDNISNTIADIGD
FT                   TVINIENKVDTIDNKVNNIAEDAVRYDRDEKGQKTNKITLKGGDPSEPVMIDNVADGKI
FT                   EKGSKEAVNGGQLHDYTKEQMKIVLDESKHYTDQRVNNIVIDAIDDAVERANNYTNMKF
FT                   EALNYSIENVRKEARQAAAIGLAVSNLRYNDTPGKLSVGFGSGLWRSQSAFAFGAGYTS
FT                   ESGSIRSNLSITTSGGHWGIGAGFNMTLN"
FT   CDS_pept        204160..204621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01500"
FT                   /product="Surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26962"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26962.1"
FT                   /translation="MIDNVADGKIEADSKQAVNGGQLRDYTEQQMKIVLDDAKKYTDEQ
FT                   VKDRVSNGVNEAKSYTDMKFETLSYVVEDVRKAARQAVAMGLAVSNLRYYDIPGSLSLS
FT                   FGTGIWRNQSAFAIGVGYTSEDGNIRSNLSITSADSHWDIGAGLRIKLN"
FT   CDS_pept        205378..214488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="badA1"
FT                   /locus_tag="BH01510"
FT                   /product="Surface protein/Bartonella adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BH01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26963"
FT                   /db_xref="GOA:A0A0H3LX70"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26963.1"
FT                   /translation="MKKLSVTSKRQYNLYASPISRRLSLLMKLSLETVTVMFLLGASPV
FT                   LASNLALTGAKNLSQNSPGVNYSKGSHGSIVLSGDDDFCGADYVLGRGGNSTVRNGIPI
FT                   SVEEEYERFVKQKLMNNATSPYSQSSEQQVWTGDGLTSKGSGYMGGKSTDGDKNILPEA
FT                   YGIYSFATGCGSSAQGNYSVAFGANATALTGGSQAFGVAALASGRVSVAIGVGSEATGE
FT                   AGVSLGGLSKAAGARSVAIGTRANAYGEESIAIGGGLKQGSDNKIGSAVAQGLKAISIG
FT                   SDSVGFQHYAVAIGAKSRALLLKSVALGSYSVADVDAGVRGYDPVEDEPSKNVSFVWKS
FT                   SVGAVSVGNRKEGLTRQIIGVAAGTEDTDAVNVAQLKALRGMISEKGGWNLTVNNDNNT
FT                   VVSSGGALDLSSGSKNLKIAKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGP
FT                   QITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQVAASGFVKQDSDTKYLT
FT                   IGKDTDGDTINIANNKSDKRTLMGIKEGDISKDSSEAITGSQLFTTNQNVKTVSDNLQT
FT                   AATNIAKTFGGDAKYEDGEWTAPTFKVKTVTGEGKEEEKTYQNVADALAGVGSSITNVQ
FT                   NKVTEQVNNAITKVEGDALLWSDEANAFVARHEKSKLEKGASKATQENSKITYLLDGDV
FT                   SKDSTDAITGKQLYSLGDKIASYLGGNAKYENGEWTAPTFKVKTVKEDGKEEEQTYHNV
FT                   AAAFEGVGTSFTNVKNEITKQINHLQSDDSAVVHYDKDDKNGSINYASVTLGKGKDSAA
FT                   VTLHNVAAGNIAKDSHDAINGSQIYSLNEQLATYFGGGAGYNKEGKWTAPTFTVKTVKE
FT                   DGEEEEKTYQNVAEALTGVGTSFTNIKSEITKQIANEISNVTGDSLVKKDLDTNLITIG
FT                   KEVAGTEINIASVSKADRTLSGVKEAVKDNEAVNKGQLDKGLKHLSDSLQSEDSAVVHY
FT                   DKKTDETGGINYTSVTLGGKDKTPVALHNVADGSISKDSHDAINGGQIHTIGEDVAKFL
FT                   GGAASFNNGAFTGPTYKLSNIDAKGDVQQSEFKDIGSAFAGLDTNIKNVNNNVTNKFNE
FT                   LTQNITNVTQQVKGDALLWSDEANAFVARHEKSKLGKGASKATQENSKITYLLDGDVSK
FT                   DSTDAITGKQLYSLGDKIASYLGGNAKYEDGEWTAPTFKVKTVKEDGKEEEKTYQNVAE
FT                   ALTGVGTSFTNVKNEITKQINHLQSDDSAVVHYDKNKDETGGINYASVTLGKGKDSAAV
FT                   TLHNVADGSISKDSRDAINGSQIYSLNEQLATYFGGGAKYENGQWTAPIFKVKTVKEDG
FT                   EEEEKTYQNVAEALTGVGTSFTNIKSEITKQIANEISSVTGDSLVKKDLATNLITIGKE
FT                   VAGTEINIASVSKADRTLSGVKEAVKDNEAVNKGQLDTNIKKVEDKLTEAVGKVTQQVK
FT                   GDALLWSNEDNAFVADHGKDSAKTKSKITHLLDGNIASGSTDAVTGGQLYSLNEQLATY
FT                   FGGGAKYENGQWTAPTFKVKTVNGEGKEEEQTYQNVAEALTGVGASFMNVQNKITNEIT
FT                   NQVNNAITKVEGDSLVKQDNLGIITLGKERGGLKVDFANRDGLDRTLSGVKEAVNDNEA
FT                   VNKGQLDADISKVNNNVTNKFNELTQNITNVTQQVKGDALLWSDEANAFVARHEKSKLE
FT                   KGVSKATQENSKITYLLDGDISKGSTDAVTGGQLYSLNEQLATYFGGDAKYENGQWTAP
FT                   TFKVKTVNGEGKEEEQTYHNVAAAFEGVGTSFTNIKSEITKQINNEISNVKGDSLVKKD
FT                   LATNLITIGKEVAGTEINIASVSKADRTLSGVKEAVKDNEAVNKGQLDTNIKKVEDKLT
FT                   EAVGKVTQQVKGDALLWSNEDNAFVADHGKDSAKTKSKITHLLDGNIASGSTDAVTGGQ
FT                   LYSLNEQLATYFGGGAKYENGQWTAPTFKVKTVNGDGKEEEQTYQNVAEALTGVGTSFT
FT                   NVQNKITNEITNQVNNAITKVEGDSLVKQDNLGIITLGKERGGLKVDFANRDGLDRTLS
FT                   GVKEAVNDNEAVNKGQLDANISKVNNNVTNKFNELTQNITNVTQQVQGDTLLWSDEANA
FT                   FVARHEKSKLEKGVSKATQENSKITYLLDGDISKGSTDAVTGGQLYSLNEQLATYFGGG
FT                   AKYENGEWTAPTFKVKTVNGEGKEEEQTYHNVAAAFEGVGTSFTNIKSEITKQIDNEII
FT                   NVKGDSLVKRDLATNLITIGKEIEGSAINIANKSGEARTISGVKEAVNNNEAVNKGQLD
FT                   TNIKKVEDKLTEAVGKVTQQVKGDALLWSNEDNAFVADHGKDSAKTKSKITHLLDGNIA
FT                   SGSTDAVTGGQLYSLNEQLATYFGGGAKYENGQWTAPSFKVKTVKEDGKEEEQTYQNVA
FT                   EALTGVGTSFTNVKNEITKQINHLQSDDSAVVHYDKNKDETGTINYASVTLGKGKDSAA
FT                   VTLHNVADGSISKDSRDAINGGQIHTIGEDVAKFLGGDAAFKDGAFTGPTYKLSNIDAK
FT                   GDVQQSEFKDIGSAFAGLDTNIKNVNNNVTNKFNELTQSITNVTQQVKGDSLLWSDEAN
FT                   AFVARHEKSKLEKGASKAIQENSKITYLLDGNVSKGSTDAVTGGQLYSMSNMLATYLGG
FT                   NAKYENGEWTAPTFKVKTVNGEGKEEEQTYQNVAEALTGVGTSFTNIKSEIAKQINHLQ
FT                   SDDSAVIHYDKNKDETGTINYASVTLGKGEDSAAVALHNVAAGNIAKDSRDAINGSQLY
FT                   SLNEQLLTYFGGNAGYKDGQWIAPKFQVSQFKSDGSSGEKESYDNVAAAFEGVNKSLAG
FT                   MNERINNVVTAGQNVSSNSLNWNETEGGYDARHNGVDSKLTHVENGDVSEKSKEAVNGS
FT                   QLWNTNEKVEAVEKDVKNIEKKVQDIATVADSAVKYEKDSTGKKTNVIKLVGGSESDPV
FT                   LIDNVADGDIKEGSKQAVNGGQLRDYTEKQMKIVLEDAKKYTDERFNDVVNNGVNEAKA
FT                   YTDMKFEALSYAVEDVRKEARQAQLLVWRYLTYVTMIYRDL"
FT   CDS_pept        214443..214646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01520"
FT                   /product="Surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26964"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26964.1"
FT                   /translation="MAVSNLRYYDIPGSLSLSFGTGIWRSQSAFAVGAGYTSEDGNIRS
FT                   NLSITNAGGHWGVGAGITLRLK"
FT   CDS_pept        214664..215236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26965"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26965.1"
FT                   /translation="MIEKRSILINILFFLALLGKGESFADENNSVYTVHPPHLSIPNGA
FT                   AGETRRIIMQFYYWTLICDEKQKLKQGICNVTQTVHDKEGNTIFSWSLVSTKNGQAVML
FT                   FRTLPNADTNVPIRMFVESVKKPVLIHYKQCNEEICLAQSPVGPVLSKQIEQNKEVRIS
FT                   YKVKEGKIFSFTVPFKGLSAAVYSLQR"
FT   CDS_pept        216149..217459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="BH01540"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26966"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26966.1"
FT                   /translation="MTPLDYGLKESKQGRVRDTKTEQLSGHHGSKQNNHSTFLQIEACS
FT                   ISVDIKKKQRKRRWKQKQSLIQSNTACNFRGRAIGGVKKTKNQKTSFFPRFSQSKSLPL
FT                   YAALDLGTNNCRLLIASPSEPGYFQVVDAFSRIVRLGEGLVNNGFLNTQAMDRAIEALK
FT                   ICHLKLKQRHIKRYRLVATEACRSAKNGRHFIQRVLDETGLKLEIVDRETEARFAVSGC
FT                   GTLIEPNTDAIVLFDIGGGSSEIVLLDVSQKRSLRLAEQITAWTSLPVGVVTLAERFGG
FT                   SDISLNDFEKMKSYVRGFLNNFSDRYKLGILAQGSKFHLLGTSGTITALAGMHLNLERY
FT                   DRKKIDGIWMNDADITLMMQRLLSWDVKKRGTNPCIGRERADLILAGCAILDVIREVWP
FT                   SQRLRVADRGLREGILIDLMLNDGVWRHYKKRRSFKR"
FT   CDS_pept        217493..218236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="BH01550"
FT                   /product="Cell division protein ftsJ"
FT                   /db_xref="EnsemblGenomes-Gn:BH01550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26967"
FT                   /db_xref="GOA:Q6G4Z3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26967.1"
FT                   /translation="MKKTTKKTAGGYGGSGSHKLYQRVKKKAGTITASSRRWLERHLND
FT                   PYVHQSKVDGYRSRAAYKLIEINQRYKFLKKGQKIIDLGAAPGGWCQVSGCIVGSSDEK
FT                   PSVVGIDYLHVDPLPGVVMLEMDFLHSDAPQKLIDALGTKPDVVLSDMAAPTTGHRQTD
FT                   HLRTIYLCEVAADFALSVLKPGGHFLAKAFQGGAENTLLTTLKQNFKTVHHVKPPASRS
FT                   ESVELYLLALEFKAKTERKEQLFLF"
FT   CDS_pept        219209..220231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgtA"
FT                   /locus_tag="BH01560"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26968"
FT                   /db_xref="GOA:Q6G4Z2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Z2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26968.1"
FT                   /translation="MKFLDQAKVYIRSGNGGAGAISFRREKFIEFGGPDGGDGGRGGDV
FT                   WALVVDGLNTLIDYRYQQHFRAKTGGHGKGRNMTGQKGDDIILKVPVGTQIFEEDNTTL
FT                   ICDLTEVGQRYRLAKGGNGGFGNLHFTTSTNRAPRRANPGLSGEERTLWLRLKLIADAG
FT                   IIGLPNAGKSTFLASVTAAKPKVADYPFTTLYPHLGVARIDAREFVLADIPGLIEGAHE
FT                   GVGIGDRFLGHVERCRVLFHLISAQEEDVVKAYQIVRNELKAYGNNLNDKTEIIALSQI
FT                   DTLTIEERKAKQEFLQKVTGKSVMMFSAVSREGLENLLRAGAHIIEMARKKDVVREEQD
FT                   "
FT   CDS_pept        220237..221376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BH01570"
FT                   /product="Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01570"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26969"
FT                   /db_xref="GOA:Q6G4Z1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Z1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26969.1"
FT                   /translation="MAVGLQKLVHYKRIVIKIGSALLVDPQTGLRAEWLKSLISDVANL
FT                   HQKGVEILLVSSGAIALGRTLLRLPKGALKLEESQACAALGQIELAKTYSDTLAQYGLK
FT                   TGQILLTLFDTEERRRYLNARATINVLLRFGAVPVINENDTVATSEIRYGDNDRLAARV
FT                   ATMMGADLLILLSDIDGLYTKSPHRDPTAEFIPFIASITSDIEKMADVAHSELSRGGMK
FT                   TKLDAGKIANSAGTAMIITSGKRMNPLAAIDRGERGSFFAAGEKPVNAWKTWISGHLDP
FT                   SGILMIDQGAVKALESGKSLLAAGVVAIEGRFNRGDTVAIVDTNGVEIARGLVSYGKDE
FT                   SVRIMGRKSEEIESILGYEARSAMVHRNDMVLRCLTDSA"
FT   CDS_pept        221444..222682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BH01580"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26970"
FT                   /db_xref="GOA:Q6G4Z0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26970.1"
FT                   /translation="MKDMGRKARRAATVLAVMSSEQKNKALEMIALSLEAHSDEILRAN
FT                   HQDLLNATQNNLTVAMVDRLKLNEVRLCTIIDSVRQVACLPDPVGQVMDEWTRPNGLHI
FT                   SRVRTPLGVIGIIYESRPNVTIDASTLCLKAGNAAILRGGSDSFHSAHALHCALVKGLK
FT                   KAGFPKDAIQMVATKDRGAVGEMLKGLDGAIDVIVPRGGKNLVARIQVDARVPIFAHLE
FT                   GLCHIYIDQSADLDMARNIVLNAKLRRTGICSAVETVLIDRQALEKFLPILTALQKKGC
FT                   EIRATEDIVFLMPDAKLAFEEDWSHEYLDAIVSVKTVESVEGAIAHIKRYSSGHTESII
FT                   AEDMEIVEKFFNHLDSAILLHNASTQFADGGEFGFGAEIGIATGKMHARGPIGVEQLTS
FT                   FQYHIKGNGQVRP"
FT   CDS_pept        222712..223305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="BH01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26971"
FT                   /db_xref="GOA:A0A0H3M1Z3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M1Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26971.1"
FT                   /translation="MPYVERSNIVGLFGGSFNPPHEGHLLVAKTAIRRLRLNQLWWMVT
FT                   PGNPLKDCTHLPPLEKRMRLSLELIDDPKIRVTGFEQAIGSKVSVETISHILAHYRRVH
FT                   FVWIMGADSLATIHHWYRWHDIISMLPIAIIDRPLVHMSALSSSMAHIYRSFRLDERES
FT                   IRLPFMKPPAWIYLHGALSFQSSTNLRLKENAFF"
FT   CDS_pept        223654..224082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26972"
FT                   /db_xref="GOA:A0A0H3LX75"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26972.1"
FT                   /translation="MSLENISQKYSCSIVPLAEKKIFSVNDGLNVILKSLEDTKAEDIV
FT                   SIDIQGKSSLADYMVIASAHSQRHVSSVADHLLRTWKDSGYGRASVEGLTEGNWVLIDT
FT                   GDIIIHLFRPEIRLFYNLEKMWLTPDLNNTKLALFGDH"
FT   CDS_pept        224084..224566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26973"
FT                   /db_xref="GOA:Q6G4Y7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26973.1"
FT                   /translation="MHVSIFAVGRMKKGAEQALVHHYLDRFSKSCSAVGFHFKILQEIS
FT                   ESRAPTACQRMEEEGRRLIEFLPEKCRLIVLDERGKTVSSFAFAEQLGFYRDEGVRDVI
FT                   IALGGPDGHNEQIRNRADFLLSFGFMTWPHQIARILLTEQLYRAVTIASNHPYHRF"
FT   CDS_pept        224663..225943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="filA"
FT                   /locus_tag="BH01620"
FT                   /product="Filament-A percursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH01620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26974.1"
FT                   /translation="MVRQMKKLLHRKMQCLYEECAIFVVLFLSMFFFLSVSHAEDTVRS
FT                   AEARKTLGEIRQSISLSRERVAFLSRQVERLKKDQRALSDALIKAAKEERAVANDISER
FT                   EEKLKEMLKKRKQVHQSLKSRRTEFAEVLSILERMGLKPPPALVVRPEDVLASVRSSVL
FT                   LGAVVPQMQEKTQALTESLKELTNLSNAITVEYAALKTKMQNQAEQRKHLELLLDKKAK
FT                   LQKRSEEELTEQQQKNSALVKKAQSLEELILELDRQSQLNSDVSVQMQKTLQLLEQSNF
FT                   ENRKGSLLFPVLGKNIQHVKNSSQITRFGEMIETEAEAIIVAPADALVAFAGPFRSYGQ
FT                   LIILNVGNGYHIVLTGMSKINVTQGQFVLSGEPLGTMGMQFIANSVALDIGKTAPMLYI
FT                   EFRKHGKPVNPTPWWRTEKTKRNRNDS"
FT   CDS_pept        225933..227243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BH01630"
FT                   /product="Carboxy-terminal processing protease ctpA"
FT                   /db_xref="EnsemblGenomes-Gn:BH01630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26975"
FT                   /db_xref="GOA:A0A0H3LW12"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26975.1"
FT                   /translation="MIRKVILLVAGVFLGACSMIMVQSVAANNEGDVYKQLAIFGDVFE
FT                   RVRMQYVTVPDDKKLIENAINGMLTSLDPHSSYMNAQEAKEMRDSTKGEFGGLGIEVTM
FT                   EKNLIKVVSPMDDTPASKAGILAGDLISKIDGVQTNGQTLNEAVNKMRGAPGTPITLTI
FT                   IRSGIDKPLEIKVVRDIIKVKAVKYRVEGDIGYLRLIQFSEQTFGNLQAAIKDIQSKIP
FT                   QDKLKGYVLDLRLNPGGLLDQAVSVSGAFLNKGEIVSTRGRRKNDVTRFDAKPGDIIKG
FT                   KPLIVLINGGSASASEIVAGALQDHRRATILGTQSFGKGSVQTIIPLGENGALRLTTAL
FT                   YYTPAGTSIQGTGITPDIIVEQPLPEKYKGYDVKLGESELKGHIKGERENNKGSGSAAF
FT                   VPRDPKEDAQLNEAYKLLRGEMANAAFPPDPNKDILK"
FT   CDS_pept        227284..227805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="invA"
FT                   /locus_tag="BH01640"
FT                   /product="Invasion-associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26976"
FT                   /db_xref="GOA:Q6G4Y4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Y4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26976.1"
FT                   /translation="MDAVVNLTTLPYRRSVGILVFNHEGKVWVGRRLMVCIHEDTKIYH
FT                   RWQLPQGGIDENEEPLDAARRELYEETGIRSIELIKEAKYWFHYDFPQEIVGSVLGSKY
FT                   RGQIQKWFAFQFTGELSEIKINPPPDGHKAEFDQWKWVDLETLPSIVISFKKHVYMKIV
FT                   NEFRGSFKGL"
FT   CDS_pept        227945..228505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="invB"
FT                   /locus_tag="BH01650"
FT                   /product="Invasion-associated protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BH01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26977"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="PDB:3DTD"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26977.1"
FT                   /translation="MKKLFNLFIFFTLLSISSVAFASNSKSTTTKDTVATLPNGASSLT
FT                   ETYGLWSINCGIQEGKKVCFMHRQEVNDQNRVVVAMSVVLNADGVVSGNLTVPFGILVS
FT                   KPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEPP
FT                   LNDLFVQLNGFSNALNRLIALQK"
FT   CDS_pept        228835..229122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26978"
FT                   /db_xref="GOA:A0A0R4J6Y7"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26978.1"
FT                   /translation="MVYALLQVIDLIFNIYIDILIANVIFSWLYAFNIVNTRNRFVFLV
FT                   GRFLYRVTEPVLAPIRQFLPNFGAVDISPIVVFLIIYFIRNFMWYVYAGM"
FT   CDS_pept        229153..229488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26979"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26979.1"
FT                   /translation="MFHQVDTNNIILFVYIIPKASGDKIMGIECKNDGKRHLVIRLRAI
FT                   PENGKANKALIKFLAKQWKIPSSYISLKSGGTSRYKQLYFSGYLEKLKEILRALEDHAV
FT                   TKNKLSC"
FT   CDS_pept        229763..229888
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH01680"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(229952..230482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BH01690"
FT                   /product="Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26981"
FT                   /db_xref="GOA:A0A0H3M4F9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="PDB:3SW5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26981.1"
FT                   /translation="MNIKEIAVGKNPPEDVNVIVEVSLGGQPIKYEMDKKSGALFVDRF
FT                   LYTSMVYPGNYGFVPHTLSEDGDPIDVLICNTRPLLPGCVINVYPIGALIMEDDGGKDE
FT                   KIIAIPTPKLTQRYNNIHDYTDLPEITLKQIEHFFEHYKDLEPGKWAKIEGWRDKSFAH
FT                   ELIKQAIERNKEL"
FT   CDS_pept        complement(230549..232375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="BH01700"
FT                   /product="GTP-binding protein typA"
FT                   /db_xref="EnsemblGenomes-Gn:BH01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26982"
FT                   /db_xref="GOA:A0A0H3LW16"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26982.1"
FT                   /translation="MQLRNIAIIAHVDHGKTTLVDELLKQSGNFRDNQRTSARMMDSND
FT                   IEKERGITILAKVTSVVWKDTRINIVDTPGHADFGGEVERILNMVDGAIVLVDAAEGPM
FT                   PQTKFVVGKALKVGLRPIVAINKIDRADARADEVINEVFDLFAALDANDEQLDFPILYG
FT                   SGRDGWMAETPEGPKDQGLSPLFDLVTRHVPSPSIAEGPFRMIGTILEADPFLGRIITG
FT                   RIHSGSIKPNQNVKVLRQDGKVLETGRISKILAFRGLERQPIEESIAGDIVAIAGLQKG
FT                   TVADTFCDPAVNEPLTAQPIDPPTVTMSFLVNDSPLAGTEGDKVTSRVIRDRLLKEAEG
FT                   NVALKIEESTDKDSFYVSGRGELQLAVLIENMRREGFELSVSRPRVVMQKDENGTTLEP
FT                   IEEVVIDVDEEYSGTVVQKMSERKGEMIELRPSGGNRVRLVFYAPTRGLIGYQSELLTD
FT                   TRGTAIMNRLFHAYEPYKGDIGGRVNGVMISNDNGESVAYALFNLEDRGPMIIDAGVKV
FT                   YQGMIIGIHSRDNDLEVNVLKAKKLTNMRASGKDEAVKLTPPVKMTLERALSWIQDDEL
FT                   VEVTPKNIRLRKLYLDPNERKRFEKTRSSLSN"
FT   CDS_pept        complement(233816..235192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="BH01710"
FT                   /product="Mg2+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26983"
FT                   /db_xref="GOA:A0A0H3LVG7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26983.1"
FT                   /translation="MTEIKTTFDFKNSSPEVLAEELKNYHFADSIDIINDLDIMERVTI
FT                   LSLLPLDYTIELFDKPELEQPAAILELLPVNRSIEILDGMSADAAADVFQEMDTETRTR
FT                   LYALLKPITRAELKKLTSYPEHTAGALMTTEFIAVPANWTVKKTLNHIRDVERTRETVY
FT                   TSYVIDPKTGTLLKAVSLRNLILASPDDQILNVSTHDTPITISPFTHHEDIARLFQRHD
FT                   LLSVPVIDDGNHVIGIVTVDDVLDTMVDEMSEDAYKFGGMEALDKPYMQINFLGMMKKR
FT                   GGWLALLFVGEMLTASAMQYFEAELEKAIILTLFIPLIMSSGGNSGSQATSLIIRALAL
FT                   RELTLKDWWKVIIREIPAGLSLGILLGIIGVMRIVFWQQLGIYDYGKHWMAVCVTVGAA
FT                   LVGIVTFGSLSGSMLPFILKRLRFDPASASAPLVATLVDVMGIVIYFSVASVILSGTLL
FT                   "
FT   CDS_pept        235545..237569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="BH01720"
FT                   /product="Peptidyl-dipeptidase dcp"
FT                   /db_xref="EnsemblGenomes-Gn:BH01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26984"
FT                   /db_xref="GOA:A0A0H3M202"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M202"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26984.1"
FT                   /translation="MTKAALLDWKGFSGLPDFFSISDEDFKPTFEQALKEAEEEIETIA
FT                   MVQEPPTLESFLQPFELSGKRLDRVCSIFFLRSGAHSNALIQQLEQEFVVKLSRYSSKI
FT                   MMDVRIFAKINALYKQSQQGVYDNETTRVLELWWKKFVCNGAKLDEKSKKRLVEINEKL
FT                   AFLNATFGQHVLKDEAEWILFLEQTDLSGLPDDLIASMKEIACERGHEGAYALTLARSI
FT                   VEPFLKFSHRRDLREKAFQAWSKRGENNNENDNRAILLEIVALRNEKAKLLGYKSFADL
FT                   KLDNTMAKSIDAVMGLLTPVWERARAKAASEQIELQNFANNRGSNESLAAWDWRYYAEK
FT                   LRAEKFSFDGAEIKYYFQLDRIIEAAFAVAKKLFGISFEEKNAVALWHPDARLWEVKKS
FT                   DGSFLGHFIGDYFARSSKRSGAWMNSLQVQHKLDGGQKPIIYNICNFAKPPKGEIALLS
FT                   LDDAQTLFHEFGHALHGLLSDVTWPSVACTSVSRDFVELPSQLYEHWLTVPEILKSYAT
FT                   HAKTGLPIPQALMDKIVSAQTFDAGFSAVEFISSALVDMAIHQRETISDPTMFEHQELE
FT                   KLQMPNTIIMRHRPPHFTHIFSSDGYAAGYYSYLWSEVLDADAFQAFEETGDVFNSQLA
FT                   DRLKRFIYSAGGSRDPEELYKAFRGRLPSPEAMIKKRGL"
FT   CDS_pept        complement(237726..238787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26985"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26985.1"
FT                   /translation="MFLFRPILLIFLLFSLLVVSVIQPSPSQATNFFKWLLEHNKQEQK
FT                   PPQIIEQKTYKPQKTIIQKNTHKLKKENAKRILVIGDFVASAVANALKNLFTDNSDIII
FT                   INNTIPDSGLVRTDHISWKSNLSELIDKNKPDVIIMIIGANDNQPITTSYGIFSVLQPE
FT                   WLNIYKQRIIEITESLHTSGKPWIWMGQPAFGNEHLTQKMKIFNELYRKETEVAGGYFL
FT                   DIWNGFTDEQGRFSFSGYDIHGKIAKLRTNNGIHFTFEGKKKLAFYLEKPLKNILNFDS
FT                   SPYKNRYLTNTNNRQFITQEPNNILQQPPMSLDDIAQQNTRLLNKINQNFVKKLWFPPN
FT                   GHQKDRADNFSLP"
FT   CDS_pept        complement(238803..240059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01740"
FT                   /product="Peptidoglycan-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26986"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26986.1"
FT                   /translation="MQKTESKTFFYSEKPINSRALIIGLAVLFSVFLMFFAQLSYANVG
FT                   FQQWIKEFKKVALTNNILSSTFDMAFKGINAIDPEVLKKAAYQPEFVDPSWNYFDNRVH
FT                   DIAIMEGQSQTKKWQKWLSQIEKRFGVDRNILLAIWSMESNYGKVLANKDVMRDTIRSL
FT                   ATLAYADQKRAKYAQAQLIAAMTILQNGEITRAQLTGSWAGAMGHTQFIPSSYLAYAID
FT                   MDGDGRRDIWTSVPDALATAANLLYMNGWQSKLPWGVEVKLPQGKNLPEDWHSFEQWAK
FT                   LGVKQANGKHLPSLSERAILKYPDGPEGPIFLVTKNFFVLKRYNNADRYAFAVALLANR
FT                   IAGHSGLVQDWQRPFPPLTFYERKELQSRLAALGYYKGEMDGIIGTASRKALKAFQLRH
FT                   GLTANGYPTPEVLSLLRKQ"
FT   CDS_pept        240324..241223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="BH01750"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26987"
FT                   /db_xref="GOA:A0A0H3LW25"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26987.1"
FT                   /translation="MKVRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVD
FT                   EAREAGIEHFIFVTGRNKAVIEDYFDTQVELYTTLAERGKRGELDHLQALQLPPGTTSF
FT                   TRQQQPLGLGHALWCARELVGEEPFALLLPDMLIQAKKSCLSEMVNLYEKTAGGNIVAV
FT                   QECDPGEAHKYGIVGKGKQIANGFEITKMVEKPKKGTAPSNLYINGRYILQPEIFNILS
FT                   DQERGSGNEIQLTDAMMRLLNEQDFFGFQLEGRTFDCGSKAGFIEANVAFSLARADMHS
FT                   QVSASLKNLLEIIKIEKL"
FT   CDS_pept        241257..242252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01760"
FT                   /product="Polysialic acid capsule expression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26988"
FT                   /db_xref="GOA:A0A0H3LVH1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26988.1"
FT                   /translation="MTAQSSHMLVLQSTVTSAFKTIASEKQGLEALEEALLGYLSSAFQ
FT                   AAVQTIRNANGHVVITGLGKSGHIGAKIAATLASTGTPAFFVHAAEANHGDLGMIGSDD
FT                   VILALSWSGETSELSGIINHAARFRTPLIAMTSGEHSVLGRQADIVLLLPKIEEACPHG
FT                   LAPTTSTIMQLAMGDALAVALLEMRGFTATDFKIYHPGGSLGASLKYVRDIMHQGESIP
FT                   LVAQGTAMAKAMSVLVEKHFGCVGVVNQEGELIGIVTDGDLARNIHVNLSKFNVDELMT
FT                   KDPKIVEPNTLVGAATAFINEHHIGAFFVVENKKPIGIVHFHDLLRIGAA"
FT   CDS_pept        complement(242439..242798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01770"
FT                   /product="Outer membrane lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J906"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26989.1"
FT                   /translation="MKHTCRILCLIITALGLGACGFSQYYGPNIQTGIDGKWLDENGII
FT                   SSFQNGVFETRAADTEEKLSEGTYNYVSAQHIEIEIRSILRGTISKVSCMISHNATQLL
FT                   CTSQTGTQFFLKRKF"
FT   CDS_pept        243052..244437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01780"
FT                   /product="Sigma 54 activator homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BH01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26990"
FT                   /db_xref="GOA:A0A0H3LX89"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26990.1"
FT                   /translation="MVGPILVASEDYGRRVELSAMLRGFGYRVIEAENGLRTIDLLHRR
FT                   KNIVLALLDVVMSDLSVGDLIKMIRVAGVAVPIVVIAQQENQELLQKALTAGAIDYWIH
FT                   PVTLLRLRVTLDTLALISALEREVHYIRRKKENHLRFSDLSIKSRAMQIVLEQSKRAAS
FT                   SLQNLLIEGEVGTGRETLARIIHHEGLLSEGDFIRFQCLAIVDPEEENHQWFKEFIPLV
FT                   SSLEKGTLCLCDVDRLEPIQQKRFMHYLKEREKATKDKVFPFRIIAISTSRLSDLVKEG
FT                   FFLHSLFEQFSQLSISVPALRELRDDFPDLTQRLIDRIITETGRSHVHGLAGSALSLLM
FT                   QYDWPGNRNGLENFLFRAILLSDGPLLTVRDFPQLMGNSLMNVPKIIESNMQEDHEQES
FT                   VKFLDVDGHVRTFAEMERDIIEKAFKHYKGHMSEIARRLRIGRSTLYRKIEGLRAISSQ
FT                   ERK"
FT   CDS_pept        244865..246436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01790"
FT                   /product="Phopholipase d-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26991"
FT                   /db_xref="GOA:A0A0H3M4G6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26991.1"
FT                   /translation="MTLLQIVISFIIFFFIASMLAIYTYGRFVKNARGEHSYALTVKKD
FT                   ETKLDRIISQLAEKTDGLGVDKDALSLIISNLDAFCVRAVGAAKAGRSLDLMYYIWDDD
FT                   LTGRLLLSEIVEAADRGVRVRLLLDDINAQARDPAYMALDKHPHIEVRMFNPGRSRKGG
FT                   VRRGLEIILRAITVTRRMHNKAFIVDGRMAFVGGRNLADSYFDAGKESHFRDLDLMLIG
FT                   PSVKKVENIFDDFWNSAVVLPIHTLVVPKSVNDLAFWREKLRQFRDSKAAKVYLDYVKK
FT                   HISFDCFIQTGKRLFLADKVVVLSDPPEKVLRKKAENWLMKALSQVIEDAQKTVQITSP
FT                   YFVPGKVGTQNFSNLVSKGVDVKILTNSLAATDVALVHGGYVPYRKMLLKSGVKLYELK
FT                   PGGNMHGLRLFRSSKASLHTKAFLVDRKTAFIGSLNFDPRSAALNTEMGILFECAPITT
FT                   RLDLLFAEETTGEMSYHLRLNDNNRIYWDFIENEKQYSVNYEPESNFWRRAFAKIISWL
FT                   PIESQL"
FT   CDS_pept        246588..248087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BH01800"
FT                   /product="Inosine-5-prime-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26992"
FT                   /db_xref="GOA:A0A0R4J9I1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26992.1"
FT                   /translation="MAKIVETGTGALALTFDDVLLQPGHSLVMPSQVDLSTRIAADIKL
FT                   NLPLLSAAMDTVTESRLAIAMAQAGGLGVIHRNMSPTEQAEEVRQVKKFESGMVVNPVT
FT                   IGPDATLEEAKALMRSHGISGIPVVENGIKGETAGRLVGILTNRDVRFASDLKQKIYEL
FT                   MTHENLITVRENVQLNEAKYLLHHHRIEKLLVVDEHNRCVGLITVKDIEKAQLNPNAAK
FT                   DSQGRLRVAAAMSVGNDGVERAERLIDAGVDVLVIDTAHGHSQRVLETVERVKKMAFSP
FT                   ALIAGNVATPQATQALIDSGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMSAAEVADK
FT                   AGIPVIADGGIKASGDFAKALAGGACSVMIGSLLAGTEESPGEVYLYQGRSFKAYRGMG
FT                   SVGAMVGGSADRYFQDEVRDELKLVPEGVEGQVAYKGPIASVLHQLAGGLRASMGYVGA
FT                   KNLAEFREKATFVRITNAGLHESHTHDVAITRESPNYRRPV"
FT   CDS_pept        248946..250232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun1"
FT                   /locus_tag="BH01810"
FT                   /product="SUN protein (FMU protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BH01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26993"
FT                   /db_xref="GOA:A0A0R4J8G8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26993.1"
FT                   /translation="MRLGGRLQAAIDVLKEIEIRHRPIGEALKDWGVCHRFAGASDRAA
FT                   IGTIVYDVLRRRYSLQWRMESDDIRDSVFGTLLDTNKMTIEQIDGELEGDRFAPQLLGM
FT                   RQRQSWQRRQLVDAPDYIRGDIPQWCQAHLRPLFADNWVIEAAALATRPSLDLRVNSLK
FT                   ATPEKVFQELAKNKVQSFSWFRQALRIAPIEKFGRHPNVQVKPAFQKGHFEIQDLGSQI
FT                   VAHLVEAKERMQVLDYCAGAGGKTLALAASMKNQGQIYAYDSDKARLAPIFDRLRRAGV
FT                   RNVQPRAQREELQSLVGRMDRVLLDAPCSGTGTWRRHPDTKWRLTLEQVRQRQREQRAI
FT                   LNETIDYLKLNGRLVYITCSLFVDENEEQISRFLQQHCNFYAIDMRALWKQHFSSSSVQ
FT                   PVFSNYGLTLSPATTKTDGFFLSVLQKKH"
FT   CDS_pept        250364..251920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BH01820"
FT                   /product="GMP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26994"
FT                   /db_xref="GOA:Q6G5J3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26994.1"
FT                   /translation="MSISHSDTVLIIDFGSQVTQLIARRVRAMGVYCEVVPFQLALEGM
FT                   QRIKPKAVILSGSPYSVIDEGSPRAPMEIFEMDIPVLGICYGQQIMCVQLGGKVASGHE
FT                   REFGRAFLEVQENSALFEGVWEKGSCYQVWMSHGDRVTALPEGFRVIGTSKGAPYAAIA
FT                   DEKRRLYAVQFHPEVVHTLDGTKLLQNFVLKISNLKGNWSMASYREQTIAKIRQKVGKS
FT                   RVICGLSGGVDSSVVAVLLHEAIGDQLTCILVDHGLMRKNEAQEVLTLFRDHYNIKLIH
FT                   VNAANMFLNALEGEIDPEKKRKTIGRLFIEVFEEETKKIGGAEFLAQGTLYPDVIESIS
FT                   AIGKSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRSLGKELGLPEQFIGRHPFPGP
FT                   GLAIRCPGAVTREKLEILREADAIYLDEIRKAGLYDEIWQAFAILLPVQTVGVMGDGRT
FT                   YEFVCALRAVTSVDGMSADFYPYDMEFLSKTAARIINEVRGINRVVYDVTSKPPGTIEW
FT                   E"
FT   CDS_pept        252061..252825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26995"
FT                   /db_xref="GOA:A0A0H3M216"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M216"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26995.1"
FT                   /translation="MSEYRLNLRSVKFPMSEKKIVAHRGGANLYPENTLSAFRNAIALG
FT                   VDEIECDVHLLKSGEVVVFHDFYLEQLVGKKEYIHNIDNETRKQLHVKGSTEAPPLLEE
FT                   VLDLLGSTNVALHLEIKTCGEVERERLLSQKALALIKNRNLTERVSAISFDPISLHPFI
FT                   EAGITSGPCIDRFEGDMYQHFSKWKKLGYSDLSLDGSLVSQDFIESALEAGFTVGVWTI
FT                   NGRPRLSHWLDMPVHYITTDQPDLAIQLRTEK"
FT   CDS_pept        complement(252944..253990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="BH01840"
FT                   /product="Sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26996"
FT                   /db_xref="GOA:Q6G5J0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26996.1"
FT                   /translation="MAIIQLSNIKKQYENGILVIDDLNLTVADKELLVLVGPSGCGKST
FT                   LLRIIAGLEQVTSGELYIDNERINNREPADRDIAMVFQNYALYPHMTVRGNLEYGLKNR
FT                   KTPKDEINKRITHAAKLLQIEPFLDRKPRQLSGGQRQRVAMGRVIVRQPRVFLFDEPLS
FT                   NLDTQLRAQMCIEIKTLQRSLGTTSLYVTHDQLEAMTLADRIVVMNKGAIEQIGTPMEI
FT                   YDYPETTFVADFIGSPSMNFLDRKTLEQHLGHSLSYSQETDLLAFRPEVILLGEYPNQG
FT                   AVFHTQIELIKPVGTGCHVLTHWNNNIFTIEIKERLTHDYGQKLSFTVPHQSFHSFNKS
FT                   TGKRTREN"
FT   CDS_pept        complement(253993..254844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="BH01850"
FT                   /product="Sn-glycerol-3-phosphate transport system permease
FT                   protein ugpE"
FT                   /db_xref="EnsemblGenomes-Gn:BH01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26997"
FT                   /db_xref="GOA:A0A0R4J7X6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26997.1"
FT                   /translation="MVENRPVLKFLTHITLIIGIFIICFPVYVAIIASTHNSAAFSSGT
FT                   LPLLPGKYALENYKTIFGDGLMQLGLPNLWPLLMNSLIMAVGISIGKIIISLFSAYAIV
FT                   YMRFPFRKTAFALIFITLMLPVEVRIIPTYAVVAQLGMINTYGGMIIPLIASATATFLF
FT                   RQFFLTVPDELLEAARVDGAGPFKFFKDILLPLSKSNIAALFIIMFIYGWVQYLWPLIV
FT                   TTDQNHQTILIILKQLIVESLQHNPQWNILMAVSVVAMVPPVLVVIFMQRLFIKGLIET
FT                   EK"
FT   CDS_pept        complement(254855..255739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="BH01860"
FT                   /product="Sn-glycerol-3-phosphate transport system permease
FT                   protein ugpA"
FT                   /db_xref="EnsemblGenomes-Gn:BH01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26998"
FT                   /db_xref="GOA:A0A0H3M4H0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26998.1"
FT                   /translation="MQEKHAYFKNSLLPYWLLFPQLLVTFLFFFWPAIQAIKSSFERED
FT                   PFGFTTTFIGFENYVTIFSDLAYLKSLLITAIFSISVTATSMTISLLLAVCVDRVIRAK
FT                   KAYTTLLLWPYAVAPVLAGILWLFIFHPTAGIVPFFLQKIGIIWNYRINGIQAMIIIVI
FT                   AASWKQISYNFLFFLAGLQSVPRSQIEAAAIDGAGPFKRFWTVVFPQISPTTFFLLIVN
FT                   IQYVMFDTFGIIDNITSGGPARATSTLVYKVYDDGFKNQIIGASAAQSTILMLMVIVLT
FT                   FIQFRWIERRVQY"
FT   CDS_pept        complement(255847..257172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="BH01870"
FT                   /product="Glycerol-3-phosphate-binding periplasmic protein
FT                   precursor ugpB"
FT                   /db_xref="EnsemblGenomes-Gn:BH01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF26999"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF26999.1"
FT                   /translation="MSRFYLSIAAFTVAISVTTAGFAQTKISFWHSMSGELGKQTENLI
FT                   NDFNASQSEYKVIPSFRGEYEEGMISLISAFRGKQQPVLVQIYEIGTGTMMAAKGAIYP
FT                   IYQLMKDTKQEFDPTDYLPAISGYYSDVQGRMLSMPFNASTPILYYNKDIFKKAGLDPE
FT                   QPPKTWQDVESFSKKILETKAASCGFTMAYASQWIGIENFSALHNIPFGTKENGFSGLN
FT                   SKLTFNGPLQVRMWTDLKKWSDQGIFRYGGPAGALDATPMFMTQNCAIFMQSSGSRAGI
FT                   LSEAVFNVGFGMLPYYDNVEGAPQNSIIGGASIWALKGHTPEEYAGAAAFLKFLSKANN
FT                   QAKWHQITGYLPTTKAAYELSKKQDYYKKNVGADIAIRQITLNPPTVNSKGIRFGNLPQ
FT                   IRSILDQELEAVLNGSKTPKDGLDEAVERGNKLLREFEKANH"
FT   CDS_pept        complement(257571..257852)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH01880"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(258559..259479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01890"
FT                   /product="ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27001"
FT                   /db_xref="GOA:A0A0H3LVI1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27001.1"
FT                   /translation="MPRLIQKLVLLGVFLLLVLFSFSASAYNKIRVIASFSILADLVKN
FT                   VGGDHISMITFVGPNANTHTYEPTPRDAQELKKAHIIFINGLHLEGFIDRLITASGTKA
FT                   LVVEVSANISPLEIKNQEQSAQHRHSNIDPHAWQTIPNVEIYIKNIATAFCKIDQQFCA
FT                   TYSKNANSYIQKLKEKQETFKTKIATIPKDKRIIITSHDAFGYFAQEYGFTILAPQGIS
FT                   TEAEATAADVAKLIKQIKANKATALFVENISNPRLIEQISKETSLQIGGTLYSDALSNK
FT                   NGPAATYLDMMEHNVKTIIDAITKH"
FT   CDS_pept        complement(259481..260362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01900"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27002"
FT                   /db_xref="GOA:A0A0H3M220"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M220"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27002.1"
FT                   /translation="MYAFFLAPFVDFHFMQSALIGSILLSISACPVGVFLMLRGMSLVG
FT                   DAVSHAILPGVAIAFLFCGFSLISMTLGGILAGIIVALATALISRNSFQKEDASMTVFY
FT                   LIALAAGVIIVSLKDSTIDLLHLLFGSVLAIDTQALLLITTIMLITVCNLCIFWRALVV
FT                   ESFDPLFFKSLSPLSKYIHVSLLGLVVLNLVGGFQSLGTLLSVGIMMIPAITARFWLSR
FT                   LGPICILSTLLGIVASICGLLLSFHLSLPSGPAIIIAAGFIYLFSCFISPRGFIVSWFP
FT                   NLFYTFLPTLRK"
FT   CDS_pept        complement(260366..261118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH01910"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27003"
FT                   /db_xref="GOA:A0A0H3LX98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27003.1"
FT                   /translation="MNLHFNDATLGYGNRIAIENFSAKLKAGSLVAIMGDNGAGKSTLL
FT                   KAIVGLIKPLKGKITKPKKSRIAYLAQQCNIDQTFPIDVRALVKTGLWSFCGLWKNQRP
FT                   YYSKIQNALEIVGLTAFATRSLDTLSSGQLQRALFARIIVQDADLILLDEPFNGVDRKT
FT                   QKDLLTLIAHWQKQGRTVLTALHDPLIVQEYFPQMIQINKQNAFYGETTQFFSDTIHQA
FT                   ISPVISNSFRISVLKQYLPFNDSCSIGL"
FT   CDS_pept        261827..262051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="BH01920"
FT                   /product="Glutaredoxin-like protein nrdH"
FT                   /db_xref="EnsemblGenomes-Gn:BH01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27004"
FT                   /db_xref="GOA:A0A0R4J725"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J725"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27004.1"
FT                   /translation="MPVTIYSKPSCVQCDATRRAFDAKGINYRVVDISRDEQAYSFVQS
FT                   LGYRQVPVVVCGENHWSGFRPDMISGLCV"
FT   CDS_pept        262051..262449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="BH01930"
FT                   /product="nrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01930"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27005"
FT                   /db_xref="GOA:Q6G5I3"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5I3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27005.1"
FT                   /translation="MGLIVYYSSATGNTEYFVSQLDQRLFKIDKKKPSMLVDEPYVLVV
FT                   PTYADGEGKMAVPKAVIRFLNEDENRKLIRGVIGGGNRNFGRYYSLASKIIAEKCFVPC
FT                   LYRFELRGTEEDIICVKKGLERFWKQLV"
FT   CDS_pept        262431..264581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="BH01940"
FT                   /product="Ribonucleotide reductase alpha-chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27006"
FT                   /db_xref="GOA:A0A0H3LW39"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27006.1"
FT                   /translation="METVGIEQSQKSDQITDYHALNAMLNLYDENGHIQFDMDRLAARQ
FT                   YFLQHVNQNTVFFHNLKEKIDYLIEEGYYEKALFELYDFSFIKKLFKRAYAFKFRFPTF
FT                   LGAFKYYTSYTLKTFDGKRYLERYEDRICLVALYLAQGNKALAESFVDEIITGRFQPAT
FT                   PTFLNAGKKQRGELVSCFLLRVEDNMESIGRSVNSALQLSKRGGGVALCLTNLREAGAP
FT                   IKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADE
FT                   KVRIKTLSLGVIIPDITFELARNNEDMYLFSSYDIERVTGKPFSDISLTEHYRSFVDNA
FT                   KIRKKKISARVFFQTLAEIQFESGYPYILFEDTANRANPIAGRINMSNLCSEILQVNEA
FT                   SELEADLTYRTVGSDISCNLGSMNIAKAMDSDDFGRTVEAAVRALTAVSDMSNIACVPS
FT                   IAKGNAESHAIGLGQMNLHGFLAREQIYYGSPEAIDFTNIYFYIVAYHAIRVSNLIARE
FT                   RQKMFVGFEKSAYADGSFFAKYIEQEWKPQFSLVQELFARNNIVIPDQKDWQELKKLVI
FT                   EYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLD
FT                   FYQDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIY
FT                   YVRLRQVALSGTEVDGCVSCSL"
FT   CDS_pept        264593..265567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="BH01950"
FT                   /product="Ribonucleotide reductase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27007"
FT                   /db_xref="GOA:A0A0R4J9B2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27007.1"
FT                   /translation="MTKITTKNPVVCAVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSN
FT                   DIPSWASLTEEERKLTIRVFTGLTLLDTIQNTVGAISLMADAITEHEEAVLTNIAFMEA
FT                   VHARSYSSIFSTLCSTVEVDDAFRWSEENIHLQKKARLVLERYEGNDPLKKKIASTLLE
FT                   SFLFYSGFYLPMYWASRAKLTNTADLIRLIIRDEAVHGYYIGYKFQLGFAKLDETKKKE
FT                   VKDFAFNLLFDLYNIECKYTEDLYDALGLTEDVKIFLHYNANKALMNLGFEALFPSEVC
FT                   RVNPAILAALSPNSDENHDFFSGAGSSYVIGKAVATTDDDWEF"
FT   CDS_pept        complement(265564..266430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BH01960"
FT                   /product="Protoporphyrinogen oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27008"
FT                   /db_xref="GOA:A0A0H3M229"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M229"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27008.1"
FT                   /translation="MNKHSLNNVIRQTQEKLRSQGVSEANLDAKILVEWITDTNISDRV
FT                   LQPDLCLSFEQILQLEKAIQRRIAGEPVYRIIGKREFYGISFALSQETLEPRSDTETLV
FT                   DLVLPPLKKYGEKSEKITLLDMGTGSGAIAIAILKQIPQSYAVAVDISENALKTATKNA
FT                   KSAKVINRFTPLLSDWFDSVTGQFDLIISNPPYIPETDITKLAKEVHLHDPLRALIGGK
FT                   DGLDFYRKLSDKAANYLKEKGSIAVEIGYSQEKEVCDLFEKNGFKCLEMRKDLNGIPRA
FT                   LLFVCNP"
FT   CDS_pept        complement(266427..267506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BH01970"
FT                   /product="Peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:BH01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27009"
FT                   /db_xref="GOA:Q6G5T7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27009.1"
FT                   /translation="MVSLPQDRMRQLEKRFEIIESQMAKNPNAEIYVKLASEYAELQPI
FT                   VSSIRALNALYGEITDLETIISDKLTDVEMRTLAQEELPLLCQKMEQLEQKLQILLLPK
FT                   DVADEKSAIVEIRAGTGGSEAALFAGDLFRMYERYAASRNWKVEVVSLNEGEVGGYKEI
FT                   IATISGRGVFSKLKFESGVHRVQRIPETETGGRIHTSAATVAVLPEAEEIDIEIRPEDI
FT                   RIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVVQAEKSQHQNRARALQILRARLFDIE
FT                   RQKAENERSASRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVLEGDLDELI
FT                   HALISDHQTALLMEMDHHE"
FT   CDS_pept        complement(267701..268117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur2"
FT                   /locus_tag="BH01980"
FT                   /product="Iron response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27010"
FT                   /db_xref="GOA:A0A0R4J9A0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27010.1"
FT                   /translation="MHKKRNYEQELRTAGLRVTRQRRIILDILVDTKDHPNAFEIFQRA
FT                   NKIDSSISLSTVYRTMKILEGNGTIHRHSFSGGPSRFEQADGHHHDHLIDLETGQVIEF
FT                   HSDIIEKLQEEIAKSLGYDIIHHRLELYGKKRNF"
FT   CDS_pept        complement(268135..270852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BH01990"
FT                   /product="Preprotein translocase secA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27011"
FT                   /db_xref="GOA:Q6G5U2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27011.1"
FT                   /translation="MVGLGVFARKFFGSAHERRLKVLRKKAEQINVLEEQFQKLSDTQL
FT                   CKKTDEFRKRLVEGETVDLLLPEAFATVREAAKRVYDMRPFDVQLIGGMVLHDCGIAEM
FT                   RTGEGKTLMATLPIYLNALEGKGVHVVTVNDYLANRDAETMGKIFGFLGLTTGVILHDL
FT                   DSDARRAAYACDITYATNNELGFDYLRDNMAFDRSQMVQRGHHYAIVDEVDSILIDEAR
FT                   TPLIISGPLEDRTDFYNLIDTFIPALTPEDYEIDEKQKTTTFTEVGTEKIEKMLEQAGH
FT                   LKGESLYDIENVAIVHHINNALKAHKLFVRDKDYIVRNGEIVIIDEFTGRMMPGRRYSE
FT                   GLHQALEAKEHVAIQPENQTLASITFQNYFRMYRKLSGMTGTAITEAEEFSNIYGLDVI
FT                   EVPTNLPIQRRDEDDEIYRTAEEKYRAIVRDIRQAHEKRQPILVGTTSIEKSEQLAERL
FT                   RKEGITNFRVLNARYHEQEAYIIAQAGVPGAVTIATNMAGRGTDIQLGGNIEMRIRQEL
FT                   QDMPEGLERTAKIEEIKKDVKQLKEKALAAGGLYVIATERHESRRIDNQLRGRSGRQGD
FT                   PGRSKFFLSLQDDLMRIFGSNRMDGMLQKLGLKENEAIIHPWINKAIEKAQKKVEARNF
FT                   EIRKNLLKYDDVMNDQRKVIFEQRMEIMNAEDLTEMILEMRNEVVEDLVETYIPSGTYC
FT                   EKWDITALQEELHQLFNLELPIETWAKEDGIAEEQILERISNAVTKLENERIERFSPEV
FT                   MAYFHKAVLLETIDTLWREHLVHLDHLRSVVGFRGYAQRDPLNEYKTESFELFQAMLRN
FT                   LRRIVTSKLMRFEIIQQPIEPRIPEQTDVGDPILNDQNKKNSSTLWTPSQENKFVNPKD
FT                   RNPSDSTTWGKVGRNERCPCGSEKKYKHCHGAFV"
FT   CDS_pept        271267..272220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02000"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27012"
FT                   /db_xref="GOA:A0A0H3M4I0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4I0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27012.1"
FT                   /translation="MKFNFITLFLTSTLLASTNLGVMAQEGVKSVSNDLKTLEKASEKT
FT                   VAPSHVMAVIDGKEVTAGQLDELALEINPGLARFSDEQRRITVLKAYLDMLALAKAAIK
FT                   EGIDKSETYNKRMAVMRDNVLQQLYFKQTVVDQISDADLETLYKKEVAALPKEDEVKAR
FT                   HILVKTKKEAEAIIKRLNKGESFEEIAKKNSTDGSAAVGGDLGYFSHGQMVKPFEDAAF
FT                   GLKVGEYTKKPVESPFGWHIIKIEDRRVKQPPVFDDVKEMLRTQLIKERYQKLIADLRK
FT                   KIDVKYPDPNVTKLMQSLNQNEAPLSDETSDEEEAE"
FT   CDS_pept        272335..273567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="BH02010"
FT                   /product="Arginine biosynthesis bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27013"
FT                   /db_xref="GOA:Q6G5T6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27013.1"
FT                   /translation="MALEISRLFPQNIQELPSLSGVRIATAEAGIKYKDRTDLLFIVFD
FT                   KSASVAGVFTRSKCPSAPVEHCRISLPHGVARGVVVNSGNANAFTGRKGKQTVDTIICA
FT                   AANALKVKKNEIFIASTGVIGEPMEASSIVNLLPSMAKTAKEGNWLEAAKAIMTTDTFP
FT                   KLATRRFDCGGETITINGIAKGAGMIAPDMATMLSFVVSDAAISSQMLQSMLSEAVQES
FT                   FNSITVDSDTSTSDTLMMFATGKESFPCITSKTDPRYEVFSKQLRALLHELALQVVCDG
FT                   EGARHLIEVHVIGATTDNTAKIIALSIANSPLVKTAIAGEDANWGRVVMAVGKAGVEVD
FT                   RDLLTIWFGEHRLAINGERDPEYCEEKIGAYMQNKHITIRVDIGLGTGKATVWSCDLTK
FT                   EYVMINGDYRS"
FT   CDS_pept        273702..274115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BH02020"
FT                   /product="Mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27014"
FT                   /db_xref="GOA:A0A0H3LW43"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="PDB:3HHJ"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27014.1"
FT                   /translation="MPIKSSLLIVVACALLDQDNRVLLTQRPEGKSLAGLWEFPGGKVE
FT                   QGETPEASLIRELEEELGVHVQADNLFPLTFASHGYETFHLLMPLYFCSHYKGVAQGRE
FT                   GQNLKWIFINDLDKYPMPEADKPLVQVLKNFFI"
FT   CDS_pept        complement(275323..276186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27015"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27015.1"
FT                   /translation="MLSKDPRLYAFRDDLADKRFETEITAQRFIQGEKKRVNTAVAGLF
FT                   KENNKKSEKQTECLLGEELLIFEQGKTMSWGQSLKDGYVGYIDTTILCTSAIKQTHIVS
FT                   VPRTFQYLQADLRGPMEYPLSMGSKVSVVDETEVRGTIYAILESGKAIITRHLSPIGRV
FT                   YEDYVTVAETLIHTPYLWGGVSGFGIDCSGLVQLSMMMTGKMVLRDTDMQQKTIGRVLT
FT                   DSDKLKRGDLVFWNGHVAIMIDHENIIHANGYSMDVMIEPLEEAVTRIAKKYQYPIEKR
FT                   RPIQEM"
FT   CDS_pept        complement(276328..277695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="BH02040"
FT                   /product="Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27016"
FT                   /db_xref="GOA:A0A0H3M239"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M239"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27016.1"
FT                   /translation="MHLHHIHFTSTRIDNSCPIFLVNQRSLADLSLDASTTAWIKVNDF
FT                   TGKAGQILFIPHETGHLKKVLFGLGNGDEPFITGLLAKNLPAGNWHLEGTASHEINNYL
FT                   GLAFGSYQFNRYRQNSSSKSLSFYVNDTVDLNELKRIYETVFFVRDLINIPANDMNPDI
FT                   LEKETRHLGKTYGADVQSICGDELLTHNFPMIHAVGRASNTVPRLIELHWGQENHPKIT
FT                   LVGKGVTFDTGGLDIKSANNMLLMKKDMGGGAHVLGLAKLIMDAKLPFRLRVLIPAVEN
FT                   AISANAYRPGDILKSRKGLSVEIGNTDAEGRLVLADALAYGDEESPQFMLCMATLTGAA
FT                   HIALGPELPAFYCNDSVWAQQISQSAHSVYDPLWQMPLWKPYEEMLSSPIADLNNITGN
FT                   NFAGSIVAALFLNSFVEKTKHFAHFDLYGWVPKEKPGFPVGGSAQAIRALYNLFKN"
FT   CDS_pept        complement(277715..278713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="BH02050"
FT                   /product="Pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27017"
FT                   /db_xref="GOA:A0A0H3LXA5"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27017.1"
FT                   /translation="MIDTILPKINQEDNLVKSISDRYSPYRVFTAQEWSQFRADTPLTL
FT                   TFDEIKRLRSIDDPIDLEEVQRIYLSLSRLLSCHVEAVQELFHKRQQFLYQEGTRKTPF
FT                   IIGIAGSVAVGKSTTARILQELLKRWTSSLKVDLITTDGFLYPNAVLQQKNRMNRKGFP
FT                   DSYDIKKLLCFLSAIKAGIGNVRAPLYSHMIYDVLENQTVTIDRPDILIVEGINVLQVN
FT                   DLPKDGKIIPFVSDFFDFSIYVDAETEVIRHWYLERFKRLRKTAFQNPKSYFHRYALMH
FT                   EEESLKIAENIWQTINLKNLQENILPTRPRSNLILRKGKKHLVEYVALRRL"
FT   CDS_pept        complement(278829..279818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="BH02060"
FT                   /product="L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27018"
FT                   /db_xref="GOA:A0A0H3M4I4"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4I4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27018.1"
FT                   /translation="MKKIAIGTLGGTIAMAADNLGQMQPILTSDILIKSVPDLDSVADI
FT                   HAQTLIQIPSGSLSFKSLFEIIEWATQQIKAGAEGIVLTQGTDTVEETAFFLSLYWNKA
FT                   EPLIVTGAMRLPHEAGADGPANILAATRVAAHPQSRNRGVLVVINDTIHSPYWVQKSHT
FT                   IKIETFQSSPVGVLGIILEGKLIYFTDRNFFPTTFDLPKNYDHQVAILYSSLSSDTQLM
FT                   KFCFESGHYAGVVIAGFGSGHCSFEEADIVRQYTQKMPIIIASRTYTGPTTRKTYGYKG
FT                   SEVDMIASGALMSGYLSALKARLLLWAFLAQGLSLEQINAHWDDWTIS"
FT   CDS_pept        280022..280603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="BH02070"
FT                   /product="Heat shock protein hslV"
FT                   /db_xref="EnsemblGenomes-Gn:BH02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27019"
FT                   /db_xref="GOA:Q6G5G1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27019.1"
FT                   /translation="MAEHKPDIMYGTTIITVRKGGKVVMAGDGQVSLGQTIMKGNARKV
FT                   RRLGKSGAVIAGFAGATADAFTLLERLETKLEQYPDQLMRACVELAKDWRTDRYLRRLE
FT                   AMMLVADKKITLALTGLGDVLEPEDGIMAIGSGGNFALSAARALIDMDLDAETIARKAM
FT                   NIAAKICVYTNDHFTIETLDAELSSLEKAI"
FT   CDS_pept        280604..281914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BH02080"
FT                   /product="Heat shock protein hslU"
FT                   /db_xref="EnsemblGenomes-Gn:BH02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27020"
FT                   /db_xref="GOA:Q6G5G0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27020.1"
FT                   /translation="MCVVFSPRETVSELDRFIIGQSDAKRSVAIALRNRWRRQQLDGPM
FT                   RDEVMPKNILMIGPTGVGKTGIARRLAKLAGAPFVKVEATKFTEVGYVGRDVEQIIRDL
FT                   VEIAISLVREKKRDEVKVKAHINAEERVLDALVGKTASPATRESFRKKLRDGELDEKEI
FT                   EIEVSDNNSNSTSTFDIPGMPGAQMGIMNLSEIFGKMGNRTKVRKTTVKDAFKPLIDDE
FT                   SEKLLDQDQIIQEALRVAENDGIVFIDEIDKIATRDGGASAAVSREGVQRDLLPLVEGT
FT                   TIATKYGQIKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELNPLTREDLRRILTEP
FT                   EASLIKQYIALMATEEVHLEITDDAIDALADIAVDLNARIENIGARRLQTVMERVLDEI
FT                   SFTAPDKAGTSFKVDAAYVKKSIGDLAADVDLSRFIL"
FT   CDS_pept        complement(281934..282965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="BH02090"
FT                   /product="Ribosomal RNA small subunit methyltransferase c"
FT                   /db_xref="EnsemblGenomes-Gn:BH02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27021"
FT                   /db_xref="GOA:A0A0H3LW47"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27021.1"
FT                   /translation="MEWHFSLKEPHVLLFLPFEKYALPYPDPSQSWLSFGLTEIPVPEW
FT                   TKNLEIITPWRPDFLKFANAQFRCSPEINQTCTHDGALLQLSKYRGFNQNCFLDLLERV
FT                   KPGGWIIIGGNKTSGADSMMKWVKKIVPITNKFSKNHGLVFWIQVPQQIEKQNTAQLRS
FT                   PPLTFENKFQTTSGMFSHGRIDPGSAVLASHMCKTISGKTADFGAGWGFLSHAALERSE
FT                   KLTALDLYEADYNALKAAKQHLKHITTSLPIHFYWHDLVHEPITNLYDTIISNPPFHTQ
FT                   QTTDVSLGQHFIINAAKYLKPGGNLLLVANRHLPYETLLKRLFRTVLIYEKAHGFKVIE
FT                   AYR"
FT   CDS_pept        complement(283004..285205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BH02100"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27022"
FT                   /db_xref="GOA:Q6G5F8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27022.1"
FT                   /translation="MFKTHKIEIEWAGRPLTLETGKIARQADGAVIATYGETIVLATVV
FT                   SAKSPKPDQDFFPLTVNYQEKSYAVGRIPGGYLKRESRPSENETLISRLIDRPIRPLFA
FT                   DGYKNDTQVIVSVIQHDLENNPDILAMIASSAALTLSGVPFMGPIAGARVGYCNGQYIL
FT                   NPHIDEMSESKLDLVVAGTENAVLMVESEAQELPEDIMLGAVMFGHKGLQPILDAIIKL
FT                   AEVAAKDPRDFVPEDLSDLETAMLEMAEKDIRKAYTITDKQERYAALDALKTEIINKFM
FT                   PETEEDCKFSVDQIATVFKQLQAKIVRSNILDTKKRIDGRDLSTVRPIQSEVGILPRTH
FT                   GSALFTRGETQAIVVATLGTGEDEQYIDSLTGMYKETFLLHYNFPPFSVGETGRLGSPG
FT                   RREIGHGKLAWRAIHPMLPSKESFPYTIRAVSEITESNGSSSMATVCGTSLALMDAGVP
FT                   LARPVAGIAMGLIKEGERFAVLSDILGDEDHLGDMDFKVAGTANGITALQMDIKIDGIT
FT                   EEIMKIALEQAKGGRIHILNEMAKALTSARAELSEFSPRIEVMNIAVDKIRDVIGTGGK
FT                   VIREIVEQTGAKINIEDDGTIRIASADAKTIEAAKRWIHSIVDEPEVGVIYQGTVVKTA
FT                   EFGAFVNFFGSRDGLVHISQLTTERVTKTTDVVKEGDKVWVKLMGFDERGKVRLSMKIV
FT                   DQKTGKEIIGEDSIKAEQEKYTEETHKSENKRRRKKKEE"
FT   CDS_pept        complement(285469..285738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BH02110"
FT                   /product="30S ribosomal protein s15"
FT                   /db_xref="EnsemblGenomes-Gn:BH02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27023"
FT                   /db_xref="GOA:Q6G5F7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27023.1"
FT                   /translation="MSITAERKKAIVAEYANKVGDTGSPEVQVAVLSERIANLTNHFKF
FT                   HKKDNHSRRGLLKMVSQRRRLLDYLKGIDQNRYQTLIKKLGLRR"
FT   CDS_pept        286061..287689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02120"
FT                   /product="Transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27024"
FT                   /db_xref="GOA:A0A0H3LVJ4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27024.1"
FT                   /translation="MQSISTFKLFRNSVFRNLWSSTLISNLGGLIQAVGAGWLMALISS
FT                   SHSMVGLVQSATTLPLVMFSLMAGALADNFNRRQIMLYAQIMMMIISMILAILSSMSFL
FT                   TPWLLLCFTFLIGCGTAFYNPSWQATIGDIVSRENIPAAVSLNSVGFNLMRSVGPAIGG
FT                   AIIATLGVAAAFLFNAISYIPLIGTLFFWKPIYENNTLPRERLFGAVSDGLRYVAMSPN
FT                   LLSIMVRAFLFGIGAISILALLPIVVHKILGGSAFLYGTLLGCFGLGAMTAGIINASVR
FT                   NYFRLETIIASAFIGFSFSCFFLAMSRSLIISHIALFPAGLCWVLALSLFNTSVQLSTP
FT                   RWVVARVLALYQTASYGGMAIGSMIWGVLADGYSPTIALSICSLFLIFGALAGIKFRIQ
FT                   EIPRIDLDPLDHFREPELLLDLKARSGPIMIMIDYQIHEDDLEEFLKVMTRRRHIRLRD
FT                   GARQWVLLRDLERPQYWREAYHMPTWVDYLRHNHRRIKADAEVNKLLRRLNRAPDGIRV
FT                   HRMIERQTIPNVSEMHLKSSADQLP"
FT   CDS_pept        complement(288158..289117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BH02130"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:BH02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27025"
FT                   /db_xref="GOA:Q6G5F5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27025.1"
FT                   /translation="MARQSKKKGRPVSGWIILDKPKGMRSTEAVSQIKYLFHAQKVGHA
FT                   GTLDPLASGLLPIALGEATKTVPYVMQGTKTYRFHIAWGEERSTDDLEGEITHTSSKRP
FT                   TREEILALLPQYTGVILQTPPQFSAIKIAGNRAYDLAREGEVVEIPPRQVEIETFKLIE
FT                   MITKDHSIFEITCGKGTYVRSLARDMGRDLGCYAHIADLRRIAVAPFCENDLITWDELK
FT                   AVELDKSAKNEKDAPFERNFIKLDELLIETISALECLSHYTLSQTQAQQVMKGNTVLLY
FT                   HHDVPLDEDEVCVLYQDQLLAIGALEKNQFKPKRLFTI"
FT   CDS_pept        complement(289122..289529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BH02140"
FT                   /product="Ribosomal-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BH02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27026"
FT                   /db_xref="GOA:Q6G4W8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27026.1"
FT                   /translation="MKNAEPSQRQLRVGEQVRHAVAHILQQGILLDNLLKNMVISVVEV
FT                   RMSPDLKIAICFVSPLSTVHNASRADVVNALNKHSRFIRGEISHSLRQMKYMPELRFRL
FT                   DNSFDNFSKIDALLRSPEVARDLHHNDKVGD"
FT   CDS_pept        complement(289658..292195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BH02150"
FT                   /product="Translation initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27027"
FT                   /db_xref="GOA:Q6G4W7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4W7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27027.1"
FT                   /translation="MSENNNDKITVKRTLTLKRSVLETSTVKQNFSHGRTKAVVVETKR
FT                   RKITRTDEKAETPQPITKPHVAPQRSRPRFEDAKPNEPTAKSNLSSAEIEARLRALEEA
FT                   HIQERIIREQAEEEARRAKEREESLRQTIQKTEIDETPQEEEEPTLQTQTPSLSPAQSQ
FT                   IEPINIPITPKNTTVIEKRKADETKEDDRNSRRTNLAKSEVRAPKVLKGADEKRRGKIT
FT                   LNSALDEEGSARGRSMAAMRRRQEKFKRAQNQEPKEKISREVILPETITIQELAQRMTE
FT                   RSVDVIKFLMKQGQMMKPGDVIDADVAELIAVEFGHTVKRVLESDVEEGIFNIADNPQK
FT                   MQLRPPVVTIMGHVDHGKTSLLDAIRKANVVSGEAGGITQHIGAYQVEKNGQKITFIDT
FT                   PGHAAFTAMRARGARVTDIAVLVVAADDSVMPQTIESINHAKAAGVPIIVAINKIDKPT
FT                   ANAQKVRTELLHHEVFVETMGGETLEVEVSAKTGQNLDKLLEAILLQAEILDLKADPQR
FT                   TAEGVVIEAKLDRGRGSVATVLVQKGTLHPSDIIVAGNEWGRVRALIDDHGRHVKEAVP
FT                   STPIEILGMQGTPQAGDRFAVVTHEAKAREIAEYRQRLARDKAVARQTGSRGSLEQMMS
FT                   KLQTTGVKEFPLIIKGDVQGSIEAIASALEKLGNEEVRARIVHSAAGGITESDISLAEA
FT                   SHSAVIGFNVRANKQARDCAKTQGIEIRYYNIIYDLVDDIKAAMSGLRSPEQRETFLGN
FT                   AEILEVFNITKIGKVAGCLVTEGKIERGAGVRLIRDNIVIHEGKLKTLKRFKDEVNEVQ
FT                   SGQECGIAFENYEDIRTGDIIETFHIEHINRTL"
FT   CDS_pept        complement(292192..292827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27028"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M243"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27028.1"
FT                   /translation="MNERTCIVTRKNASAKALIRFVIGPNNQIVPDLKSNLPGRGVWVS
FT                   SRRSAIEEAIRKKAFNKSFKTDVEVASNLAHIVDTLLLKAALGSLSIARKAGAVVMGAT
FT                   KVDAAIRSGQVIFVLHAREATENGKQKISQAIHTIQQKTNQDIKTTSLFTSYEMRVAFG
FT                   ANPVMHAALLNMKAAEGFLKTINKLIAYRDDKHSKPGEMTAQAVKEIQ"
FT   CDS_pept        complement(292854..294440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BH02170"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH02170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27029"
FT                   /db_xref="GOA:A0A0R4J9H0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27029.1"
FT                   /translation="MATSANRLEILQIADAVAREKSIDREIVISAMADAIQKAARSRYG
FT                   QETNIRAEINSKTGEIKLQRLLKIVDIIEDYTSEITLSDALKRQADAKVGDFFADLLPP
FT                   MDFGRIAAQSAKQVIVQKVRDAEREQQYEEFKNKIGEIISGTVKRVEYGNVIVDLGRGE
FT                   AIVRRDELIPRESFRYGDRIRAFVHDVHREPRGPQIFLSRTHPQFMVKLFTMEVPEIYD
FT                   GIIEIKSVARDPGSRAKIAVVSRDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIPWS
FT                   PDAATFIVNALQPAEVSKVVLDEDAERIEVIVPDDQLSLAIGRRGQNVRLASQLTGWNI
FT                   DILTEQEESENRQKEFTERSKLFMESLDVDEMIGQVMASEGFSSIEEIAYIDLEEIASI
FT                   DGFDHETAAEIQNRAQEYLERKEKELDEKRKKLGVCDELRMLPGMTSAMLVAIGEDGVK
FT                   TMEDFAGYAVDDLAGWRERKEGQTQNFSGILTPFDITRADAEAMVLAARVQAGWINQAD
FT                   LVTENSAENEK"
FT   CDS_pept        complement(294490..295140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27030"
FT                   /db_xref="GOA:Q6G4W4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4W4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27030.1"
FT                   /translation="MKLTWIKCMSKTERISDIDEPRLFEENGVEAHIAAFVMPLLKPLG
FT                   FRLVRVKLLGLNGLTLQIMVERPDGSMTVEDCETVSRTVSPLLDVQNVIERKYHLEISS
FT                   PGIDRPLVRKSDFFHWQGHIAKIETKIILEGRRKFRGTLTNITQDGFTLNTDKAAYGES
FT                   MYISIPFDDIIDAHLVLTDELIRDALKKNKDLSQQFISEDNQKLSKQERNYKN"
FT   CDS_pept        complement(295269..295970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27031"
FT                   /db_xref="GOA:Q6G4W3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4W3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27031.1"
FT                   /translation="MIDHNIRTGKAFFGRRKGKRLRNSQLVLIKKLFPTLDINLNNSVP
FT                   LNLTSLFSRKVKEVRLEIGFGGGEHLLHEMKHFPQTGFIGIEPFINGMAKMLMSLEEHK
FT                   QYQNQLRLYNDDATGLLDWLPNASLDGIDLFYPDPWPKKKHWKRRFINMKNLNRFARVL
FT                   KTGKKFRFASDIESYVNWTLYHCSNHHSFEWEAKNPKDWKTPYTLWSGTRYEAKALREG
FT                   RAPTYLTFIKK"
FT   CDS_pept        complement(295967..297235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BH02200"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27032"
FT                   /db_xref="GOA:A0A0H3M4J0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27032.1"
FT                   /translation="MSHQDYLFTSESVSEGHPDKICDRISDEIVDMIYKEAQKTGTDPW
FT                   LVRIACETLVSINRVVIAGEVRVPDTLLKRDKNREFIYDETGLPRINPARFRAVARRAI
FT                   RAIGYEQVGFHWKTVKIDVLLRPQSVDIARGVDNARDRHDEEGAGDQGIMFGYACRETP
FT                   DLMPAPIYYAHKILKLLAEARHKGEGETGKLGPDAKSQITIRYKNGKPIEVTSIVLSTQ
FT                   HLDESWDSHKVRTVVEPYIHQALHDIPISDQCSWYINPTGKFVIGGPQCDAGLTGRKII
FT                   VDTYGGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNIVAADLAERCTIQLSYAIGVAQ
FT                   PLSIYINFHGTGKVDESIIEAVIRKIMDLSPTGIRKHLDLNKPIYTKTAAYGHFGRKPK
FT                   RDGSFSWEKTDLIKTLQKMIKVP"
FT   CDS_pept        complement(297356..297772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02210"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27033"
FT                   /db_xref="GOA:A0A0R4J9K9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27033.1"
FT                   /translation="MTETRKKPDPIDVYVGTRIRLRRNILGLTQEKLGEKLGITFQQIQ
FT                   KYEKGTNRIGASRLQAIAEIMDVPVSYFFDKGVGTQQVEGFAESDNDFMDFCSSSEGIQ
FT                   LMRAFTNISDSKVRRKIIDLAKALSEEEDLTNKL"
FT   CDS_pept        complement(297921..299555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="BH02220"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27034"
FT                   /db_xref="GOA:A0A0H3LVJ8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27034.1"
FT                   /translation="MKVLNKMSSPKSNFVFLNSVKMSLFSLTGWKRQGVLFLCGALTSF
FT                   ALPPFYLTPLCFLTFPVFIVLLDKISALQNNRKCLLIYALSCGTFGFGYFIFGFWWLCN
FT                   ALLTDPITFGWAVPFAIFCPPLYLSLYWFFAGFIVGFLWTKGIARFFILAFALGLAEWL
FT                   RSILFTGFPWNALGYTAMPTPMLMQSDAIFGLYGMNILAVFIYSLPTVLFTDEKKKTAL
FT                   FLCLALILAHCGFGFYRLNTAPKMTDYQKSSYWVRIVQPSIEQNTKLSNTEREAIFAAH
FT                   MNLSATSIVEQHPEPDFIVWPEASIPYLLYDNSTITMRIASLLKPKQWAIIGAIRASNN
FT                   PLNEKTQYFNTIAVINATGNILTTSDKLHLVPFGEYLPYQNLLKKIGLHALADTIGGYS
FT                   TASVRKTVMMPNGFSYLPLICYEAIFPNEMVFKGSPPQAIINVTNDAWFGVTPGPYQHL
FT                   QQVQLRAVELGIPLIRAANNGISAVIDSYGRIVVALQQNAVGIVDSPIPSPITPIGNNE
FT                   YRIFSTFILFILMLLCGLGFGSTKQLK"
FT   CDS_pept        complement(299518..300537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="BH02230"
FT                   /product="Hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BH02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27035"
FT                   /db_xref="GOA:A0A0H3M244"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M244"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27035.1"
FT                   /translation="MANKVNAQNNSQTPSHIEEHPPQPANHTEKYSLMNHLFSFLRGRN
FT                   STSLRNDLTVALTADNEKDTALFSPEERTMLHNILRLREARIDDVMIPRSEIEALDINT
FT                   SLGEALKCFAKIGHSRIPVYAETLDDPRGMIHIRDILNYITRFITKSAQTEQTSDSLQL
FT                   TYTDLHTPIGELDLIRTVLFVPGSMLASTLLTRMQTTRTQMALVIDEHGGTDGLVSMED
FT                   IVELVVGDIEDEHDHVDNAIVREPNNKWLVDARTELEDVEKALGPDFIVGEYGDEVDTI
FT                   GGLIVSILDRIPAKGEIIEAVPGYRFRILEADKRRIKRLRIFRIPENESFKQNVISEE"
FT   CDS_pept        complement(300640..301116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27036"
FT                   /db_xref="GOA:Q6G4V8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27036.1"
FT                   /translation="MITIDILVESDGWNDEKMLYNITEKALKTIMHHLSLENVVSEISL
FT                   LFTDDKHMAQINAQWRGKNKSTNVLSFPAFPLKVGDSPGPMLGDIIIARETVVLEAENE
FT                   AKSFQDHLTHMIVHGILHLLGYNHETNEEASHMEELERKILQKLSIKDPYAELS"
FT   CDS_pept        complement(301137..302237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="BH02250"
FT                   /product="Phosphate starvation-induced protein phoH"
FT                   /db_xref="EnsemblGenomes-Gn:BH02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27037"
FT                   /db_xref="GOA:A0A0H3LXB5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27037.1"
FT                   /translation="MKASTQKVKRVKEKISTCSENTVISKKESASDVHHVVLIFENNKY
FT                   AKTVFGKFDENLTYIEQKLGLSLHPRGNEILIHGKTTATKHAQYVLQQLYEHVKIYQEL
FT                   TLADIEGAISMANLPHNQQESPTKTQPVTKRIPARLSTHKKTIHARTPTQDAYIHAMES
FT                   TELVFGIGPAGTGKTYLAVAHAAMLLERGIIERIILSRPAVEAGEHLGFLPGDLKEKVD
FT                   PYLRPLYDALYDMIPIEKVERILASGVIEIAPLAFMRGRTLAHAAIILDEAQNTTPMQM
FT                   KMFLTRLGEGARMIVTGDISQIDLPKGQKSGLIEAIRILSNVENITIIRFDEKDVVRHP
FT                   LVAAIVCAYDRDSRAKNKETPSHTSH"
FT   CDS_pept        complement(302401..303777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27038"
FT                   /db_xref="GOA:Q6G4V6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27038.1"
FT                   /translation="MNKANPKNIPPLAPKKVFIKTYGCQMNVYDSQRMTDSLSSKGYVA
FT                   TQTPNDADLILVNTCHIREKAAEKLYSDLGRLRVMRQERTPDKPLMVGVTGCVAQAEGS
FT                   EILRRAPIVDLVIGPQMYHRLPDLLEQTKQGKKIVATEYAVEDKFAHLPPHNKRAVRKR
FT                   GVSAFLTVQEGCDKFCTFCVVPYTRGAEISRSVEQITEEARQLIEAGVKEITLLGQNVN
FT                   GWHGQNVNGKTWRLGDLLYHLAKLDGLKRLRYTTSHPRDMDDSLIAAHRDLDILMPYLH
FT                   LPVQSGSDRILKAMNRQHKSIHYLQLIEKIRNARPDIAFSGDFIVGFPGETDEDFEETI
FT                   KLIKQVEYSSAYSFKYSPRPGTVGATMKNHVEEAVKDARLQHLQVLLLEQQNAFLRSKI
FT                   GQTTDVLIEKAGRHSGQMVGRSPWLLPVVVDTQASTGTVIPIHIKNTSSNSFVGEMTNM
FT                   "
FT   CDS_pept        complement(303809..304300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02270"
FT                   /product="Peptide N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27039"
FT                   /db_xref="GOA:A0A0H3M4J4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27039.1"
FT                   /translation="MSKLLSKKKHFWIAPLKADDSVPLYQIHQHCFVPAWEKKTFDHFL
FT                   TDQSIFGYKASLIGRPDEILGFCLCRLILDEAEIITIAVHPHCRRQGIGTLLIDSTLRH
FT                   LHHERALKLFLEVEETNLSALSLYKGFEFQKIAKRFAYYQSKNSRTDAIIMQKTFKQID
FT                   "
FT   CDS_pept        complement(304300..304983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27040"
FT                   /db_xref="GOA:A0A0H3LW56"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27040.1"
FT                   /translation="MLILALDTASIYCAVALIRQKSVIARISERMNKGHAEKLIGYIAQ
FT                   VTNQANTTLDQINRIAVNIGPGSFTGVRVGVSTARALSLALEIPAVGVSALEALAMQVS
FT                   NNNTGLAITVVIEAGRDMFYHQNFSEDLIPLGAPGLKTIENIIEDLPQQTRLTGPAADI
FT                   IALHIKNNKINKKILRDKTVCEAADIVNYAHLAAKKQTQDHPRPLYLRSADAKQQTDFA
FT                   LPRKK"
FT   CDS_pept        complement(305567..306613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27041"
FT                   /db_xref="GOA:Q6G4V3"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4V3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27041.1"
FT                   /translation="MGRNIKIIKKNLAFLNDFSPGILACLIISVLAYGLEILEKQLFGQ
FT                   AWLESLVLAILLGSITGSCFTLPKYFQKGITFCAKTLLEIAIVLLGASISVNAVLSAGW
FT                   NLLASIIFVIFVTLILSFTIGRLFGLSSHLAMLVACGNAICGNSAIVAVAPVIKAKHEE
FT                   VASSIAFTALLGVLIILFLPFLHPFLNLSFSQYGVLSGMVVYAVPQVLAATASVSFVSV
FT                   QIATVVKLVRVLMLGPLIFALSILYHRSAQTRLRLHTLVPWFIIGFIFMMLIRSSNLIP
FT                   EKTLIPIRFIAQLFTVISMAALGLGVDIRSLKKAGWRVILASTCSILILGVCSLIMIQL
FT                   NDLNPIMF"
FT   CDS_pept        complement(306688..307293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BH02300"
FT                   /product="Recombination protein recR"
FT                   /db_xref="EnsemblGenomes-Gn:BH02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27042"
FT                   /db_xref="GOA:Q6G4V2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27042.1"
FT                   /translation="MSKHIAGPEIERLIQLLARIPGLGPRSARRAALHLIKKKETLLEP
FT                   LGAAIQAAVQKVCICSVCGNVDTIDPCSICTDPRRDDATIIVVEDIADLWALERAKTLA
FT                   ARYHVLGGKLSPLDGIGPDELNIAPLIQRVVQNPITEIILAVNATVEGQTTAHYITDQL
FT                   SNFSVKVTRLAHGVPVGGELDYLDDGTLAAALQARTNL"
FT   CDS_pept        complement(307328..307654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27043"
FT                   /db_xref="GOA:Q6G4V1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27043.1"
FT                   /translation="MRDMMNMMKKAKEMQEKMQKIQEEMANLQVTGTAGGGLVSITLNG
FT                   KNTITAIKIDPSLLKPEEIEILEDLIMAAYNEAKTKIEIAMQEKTKSMTAGLPLPPDFK
FT                   LPFS"
FT   CDS_pept        complement(307669..309609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BH02320"
FT                   /product="DNA polymerase III subunit tau"
FT                   /db_xref="EnsemblGenomes-Gn:BH02320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27044"
FT                   /db_xref="GOA:A0A0H3LVK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27044.1"
FT                   /translation="MKNMPVETTYRVLARKYRPQNFSDLIGQEAMVRTLTNAFETGRIA
FT                   QAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTVLNTLGEHCTQIIEGRHIDVIEM
FT                   DAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLSTQAFNGLLKTLEEPPPHVKF
FT                   IFATTEIRKVPITILSRCQRFDLRRIESAVLSAHLRQIAQHENVEVEDQALSMIARAAE
FT                   GSARDALSIFDQAIAHSNGKISAVTVRAMLGLADQARIIDLFEFLMKGNVVNALHELRS
FT                   QYDAGADPLTILTELADFNHLVTRLRFTPEILEDLSLTEDERLRSLDFSKKLSVPVLSR
FT                   NWQMLLKGLQEVNQTARPLQAAEMLLIRLAHVTDLPTLDEALKKLMQETTPLTIVSNSS
FT                   HQESTSTNNTTKIEAANAYSSLQVANPSSHQPDCKTSVTNHLNDCLQSENLLKFQNLES
FT                   SHSPEVTEILETSQSVTNPQNITNLPHPSTHTTKQATQPKAIVIDSLHDIVKLAEQHDE
FT                   ITFKLLITEFVHPVSFEPGHIILRIAENAPHSLKNDIKKMLSQWTEKRLTITFVNEGGG
FT                   PTLQEESMAIQKTLFSNAEADPDIAKILYHFPEAKIVDIRLNKQENNLDLLPNTFKNAD
FT                   TFKNENDIDDE"
FT   CDS_pept        complement(310883..311290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M248"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27045.1"
FT                   /translation="MRKILTQGLVVANILACSTVAFAGFSETKWNFASDESVTIKAADT
FT                   IHQGVEYACKAFKPKKASFVLSYSSPSDLDKLKIVADNEKKITHDKEHKVFTLKGVKSL
FT                   HISFPSSGHYTFKNITKKKVIGINCDTGDYD"
FT   CDS_pept        311498..311758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27046.1"
FT                   /translation="MVTETFIFGACIFFCIGFISAELMCIFCRNVIGVFEHFDNGCCRL
FT                   YSSSVFIMKRSLAEKKAAVFQGALYREIFSMPFNLHEKCTI"
FT   CDS_pept        complement(311766..312629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="BH02350"
FT                   /product="Chorismate mutase /prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27047"
FT                   /db_xref="GOA:A0A0H3M4J9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27047.1"
FT                   /translation="MKILKKTNKISFQGEYGANSHIACTNMFPNMDALPSTTFEDALNL
FT                   VENGQADLAMIPIENTLAGRVADIHHLLPQSSLYIIDEYFLPIHFQLMVLPGVTHKEIE
FT                   TVHSHAHALAQCRKIIRNNGWQPVTSADTAGAAKFIKKNGKRSQAALAPLIAAELYGLD
FT                   ILEKNVEDSPHNITRFVILSRSQRHVPKPQNGEKIITSLLFRVRNVPAALYKAMGGFAT
FT                   NGINMTKLESYQIGGNFNATQFFVDIEGHPEDPMMQLALDELSFFSAELRIIGIYPAKN
FT                   GRRSHI"
FT   CDS_pept        complement(312626..313357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="BH02360"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27048"
FT                   /db_xref="GOA:Q6G4U6"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27048.1"
FT                   /translation="MALEPIILIPARIGSTRLPQKALAEIAGKPMIVHVAEQAKKAAFG
FT                   RIIVATDHNNIAKVVTAYGHECIITCRDHKSGSDRIYEALTHIDPERRYNVILNVQGDL
FT                   PTITPHEIISALRPLENSLTDIATLGAKIVEENEKTDPNIVKIIGTPLSHNRFRALYFT
FT                   RATAPYGDGPLYHHIGIYAYRREALEKFVALKPSPLEQREKLEQLRALEHNMRIDVEIV
FT                   DTIPLGVDTQRDLERVRKILA"
FT   CDS_pept        313464..314015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27049"
FT                   /db_xref="GOA:A0A0H3LW59"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27049.1"
FT                   /translation="MNRSKIVYFVFACLFLLIILVGILSYRIYDNSASVQPSKVTKNDR
FT                   LKEKQQTSDISLSLNDRLQRANIENGRKIFRQCGLCHTSGRHESNRVGPALWGIIDRPL
FT                   AAKTDFAYSRVLRANSDQRWDFMTLDRYLQSPREAFPGTIMFFRGIKNDQDRADLLLYL
FT                   RGLSDDPVPLPNDKKEDKPG"
FT   CDS_pept        314154..315275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02380"
FT                   /product="Peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27050"
FT                   /db_xref="GOA:A0A0H3LVK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27050.1"
FT                   /translation="MVVYILRRFFLLIPTLIGILTVTFIIVQFTPGGPIENIIAQLQGT
FT                   GGDAVGRVGGGSDLGLSSDVILDGAEVESSSSRVFKYRGAQGLDPEFIAKLEKQFGFDK
FT                   PPLERYLTMLGRYLRFDFGDSYTQGRSVIELIKSALPVSLSLGFWQLLISYSISIPLGI
FT                   QKALKEGAPFDVWTSALIIIGYAIPSFLFGIFLMVFFAGGSFLNWFPLSHLTSDNFDQL
FT                   SFGGKILDYLYHLVLPLTAMIISSFATTTLLTKNCFLEEIRQQYVITARAKGLSERSVL
FT                   YGHVFRNAILIVIASFPATFMASFFSGSLLIEMLYSLNGMGLLSYTSIVNRDYSVVFAS
FT                   LYIFSLIGLIVSLISDIVYMFVDPRIDFDKKDL"
FT   CDS_pept        315275..316417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02390"
FT                   /product="Peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27051"
FT                   /db_xref="GOA:A0A0R4J8H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27051.1"
FT                   /translation="MQETKGECVQSFKLQKEPFFSPLNARRWCNFKRNRRGWWSLWLFL
FT                   FLCFCSFSAEFIANDRPIIASYKGELLFPVFFDYPDEKFGGDLVVADFRDPFIQNEIAK
FT                   HGWALWPLVRYSYNTVMGNKTVALAPPFWLQSKEERCINYTQGSSDPECTISRWNWLGT
FT                   DDLTRDIFARVLYGFRVSIAFSILLTVISTIIGVTVGAIQGYFGGWVDLILQRLIEIWS
FT                   SVPSLYLVIIMAAVLTQGFWVLLGVMLLFQWVILVGVVRVEFLRARNFTYVNAARALGV
FT                   PNSTIMMRHLLPNAMVAALTYMPFLLTSGVSLLTSLDYLGFGLPPGYASLGELMRQATT
FT                   NLNAPWIGITGFVVIAVMLSLLAFIGEAARDAFDPRKTLQ"
FT   CDS_pept        316414..318024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02400"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27052"
FT                   /db_xref="GOA:A0A0H3LXC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27052.1"
FT                   /translation="MTNLLSVRDLSIALCQGQEQRYILEKVTFEIKEGETVALVGESGS
FT                   GKSVTALSILQLLPFLKTLYQSGEILFNDKDLLKQKEEDLRKVRGKDIAMIFQEPMTAL
FT                   NPLHNVERQIGEVLKMHSDMTNQSLRAHIIDLLTQVGIHEPQKRLGSFPHELSGGQRQR
FT                   VMIAMALANNPRLLIADEPTTALDVTVQARILELLVHLKKQNNMSMLFITHNLAIVRCI
FT                   ADRVYVMRKGKIVESAPIDQLFANAQKPYTKQLLAAEPKGYPLQADKSAPILMQGKKVR
FT                   VWFPIKKGLLRRTKGYIKAVQDMDVTIRVGQTLGVVGESGSGKTTLGLSLIRMLSSKGQ
FT                   IIFDDIDISNFTFKKMRSLRRHIQIVFQDPFGSLSPRMSVSEIIAEGLSIHEPKLSYSE
FT                   RNDRVIEALHEVNLDPSTRYRYPHEFSGGQRQRIALARAIILKPRFIMLDEPTSSLDVS
FT                   VQAQIISLLLHLQKKYHLGYLFISHDLKVIKALAHEVIVMRNGEMVEYGSADRIFSCPQ
FT                   NTYTQSLMAAAFALESDRL"
FT   CDS_pept        complement(318247..319011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="BH02410"
FT                   /product="Molybdopterin biosynthesis moeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27053"
FT                   /db_xref="GOA:A0A0H3M4K1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27053.1"
FT                   /translation="MIQEANTKLSNEEIERYARHIILPEIGGVGQQKLKAARVLVIGAG
FT                   GLGAPVLTYLAAAGVGTLGIVDNDIVSLSNLQRQVIHKTNTINQCKTDSAKATINAINP
FT                   HVTVEKHTLRLDKSNVGKLLNAYHIIVDGSDNFATRYLLADHTAQCAKPLISGAVGRFD
FT                   GSLTVLMPYKDNNPHYRDLFPNPPAPGTLSTCAETGIIGALPGVIGTLQAMEAIKLITN
FT                   IGEPLVGKILLYNGLSAQFKVITYKRSDSNAN"
FT   CDS_pept        319100..320038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="BH02420"
FT                   /product="Glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27054"
FT                   /db_xref="GOA:A0A0H3LW64"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27054.1"
FT                   /translation="MKIAIQMDHISTLQIQGDTTFALALAAQERGYSLFHYTPDRLSMR
FT                   DGCVIVKLEALTVHDKEGNHYQLGKPIRTQLMDMDVVLLRQDPPFDLNYITTTHLLECI
FT                   HPKTLVVNDPAWVRNSPEKIFVTEFPDLMPETLITKDIEEITAFRATFGEIIVKPLYGN
FT                   GGAGVFHLKQDDRNLASLLEIFAQIYREPFIVQRYLDAVRKGDKRIILLDGKPVGAINR
FT                   IAAETDVRSNMHVGGRAENVDLTKRDYEICQRIGPALKERGLLLVGIDVIGDYITEINV
FT                   TSPTGIREIKRFSGTDIAHLFWDVIEFKRSN"
FT   CDS_pept        320188..321234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02430"
FT                   /product="Periplasmic phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27055"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27055.1"
FT                   /translation="MSRLLSGGVGVIFAVLFSVNVGNARDQIQITGSSTVLPYQKIVAE
FT                   IFGEIYPHFKIPVIESGGTGGGIKEFCRGIGENAIDIVNASRAMKLSELQSCFDAGVKD
FT                   VEEIRIGYDGIVFATDINGPDWKLQPVDIYRALAARIMKDGKLQSNNVSKWSAVNSALP
FT                   GWTIAAYIPGEKHGTREVFEEKLLAAGCKESGAVDAMKSLGMDDKAIHIACVAVRKDGK
FT                   VIDIDGDYSETFARLTSNKTGVGVFGLSFYQNNADRLKVADISGFTPTVETISSGKYPV
FT                   SRPLFFYVKKAHLGIIPGLREYVDFFLSDQMIGPNGPLAEYGLVVASEKERQAQRSAFS
FT                   AGRVMSLK"
FT   CDS_pept        321300..322760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02440"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27056"
FT                   /db_xref="GOA:A0A0H3M253"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M253"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27056.1"
FT                   /translation="MRISFLISLLLIFACIGFCISYIRARTLEYTQYKMHSRTYYYGWW
FT                   TFLITVFPALIFLIFWDGGSAIYLEYSASQEIEACSTHVKELVNHDLILGIVRSLVKRL
FT                   PYFEGDLTTASYEEVQAQLLAKGFVFPHEVSDDVLRIAQSWVNSSEKLQFIGHGVLFVI
FT                   ASCGFICGIMQVSPRQRARNKVECLIVIGLICASIVAVLTTAAIALSMFFQTMSFFQSV
FT                   PFSNFFLGTVWDPRFSASGAEGEVGQFGLIPLLAGTLYIAFVAMLFAVPIGLFSALYMA
FT                   EYASARLRSIVKPLLEVLAGIPTIVYGFFALKFVGPFLRDLSVSLSGGVGFIMAQSVLT
FT                   AGVVMGIMLIPFVSSLSDDVITAVPRILREGSYGLGATQSETIKKVVIPAALPGIMGAI
FT                   LLTASRAIGETMIVVLAAGVAANLTLNPFEAMTTITVKIVNQLTGDFEFNSPQTLVSFA
FT                   LGMTLFIMTLLMNILALYIVRKYREQYE"
FT   CDS_pept        322757..324049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BH02450"
FT                   /product="Phosphate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27057"
FT                   /db_xref="GOA:A0A0R4J697"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J697"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27057.1"
FT                   /translation="MNEDFSFSRRNIGLKRRYWAERRFRAYGLIAIFIGLFFLFALLWS
FT                   VISQGYTAFFQTEMTLSIYLDEKVIDPSGQRLANPQILITANYPLLVRNALARKLNIDQ
FT                   NDRASLRDINRMFSNSVRVQLREIVTKNPQLIGTTQKIKVLAAADIDSAYKGQIDLHVA
FT                   EKNRKISNRQVEWMKRLAYDGTLYKTFNFGFFTFGASSRPETAGLGVAIIGSFYMIIIV
FT                   LVISLPIGIATALYLEEYARKNKFTDFIEVNINNLAAVPSIVFGLLGLAVFVNFFGLPR
FT                   SASFVGGLVLALMTLPTIIIATRSALRAVPFSIRAAALGLGASKTQVVFHHVLPLAAPG
FT                   ILTGTIIGVAQALGETAPLLLIGMVAFVVNIPATPMDPATALPVQIFMWAGEAERAFVE
FT                   KTSGAIIVLMIFLSIMNISAVFLRRRFERRQ"
FT   CDS_pept        324108..324866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BH02460"
FT                   /product="Phosphate transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27058"
FT                   /db_xref="GOA:Q6G4T6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27058.1"
FT                   /translation="MKIKMRGQDVKVFYGSKEALHGITLDIPEHQVTALIGPSGCGKST
FT                   FLRCFNRMNDTIEGAKITGLITLDGENIYESRIDVVELRARVGMVFQKPSPFPKSIFEN
FT                   VAYGPRIHGLVKSRAELHDVVEKSLRQAGLFEEVKDRLHEAGTSLSGGQQQRLCIARAI
FT                   AVSPEVILMDEPCSALDPIATARIEELIDALRKDYTIVIVTHSMQQAARVSQYTAMFHL
FT                   GHLVEVGETEVMFTSPKEQRTQDYITGRFG"
FT   CDS_pept        324888..325610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BH02470"
FT                   /product="Phosphate transport system protein phoU"
FT                   /db_xref="EnsemblGenomes-Gn:BH02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27059"
FT                   /db_xref="GOA:A0A0R4J8R0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27059.1"
FT                   /translation="MSMKHTVRAYDAELKYLEEKITEMGCYAEKMIERSVASIVCNDLQ
FT                   LAATVIADDLFLDEAERDIDEKAITIICKRQPMAVDLREIVGAIRISSDLERIGDMAKN
FT                   IAKRTVALSEIRQPKVFYCRFETITTLALNQLKEVLNAYTSRLLDHVDAVRERDGKIDA
FT                   LYTSLFRELLTYMTEDMRNITVCTHLLFCIKNIERIGDHVTNIAETLHYIITGYHMSFD
FT                   RPRDDLTYKVGIDEKEID"
FT   CDS_pept        325722..326508
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02480"
FT                   /product="integrase-recombinase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        327075..327920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27061"
FT                   /db_xref="GOA:A0A0R4J7S3"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27061.1"
FT                   /translation="MKKNFLTAFISCFLAPFVIVGCASDHFNAGKVGDNKKAKTAVYPL
FT                   TERQCLMRAMYFESNRTSREGMIAVGTVVMNRVNSSAYPKTICGVVGQYKQFAPGVLTR
FT                   PMTEPASVARVREAADAVLRGERDKKVKNAKFFHTAGLSFPYKNMHYVRIAGGNAFYEK
FT                   RSRDGSLQVPHNDRPYDVAYAFAQERSGNVPSFMDVGLASKEIKTEERQNASPSIEVAK
FT                   VDKAHTTPFVVVQLDKVPIPTYAPNRTNEETKPALAYTLLSSDQLNAVVAMLEERYRSR
FT                   "
FT   CDS_pept        327952..329199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02500"
FT                   /product="Aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27062"
FT                   /db_xref="GOA:A0A0R4J8V8"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27062.1"
FT                   /translation="MYFDIHETISSEKLNRLAEITVKVGLNLQKGQDLVLTAPISALPF
FT                   VRRIAYHAYKAGAGVIIPLFSDDMLLLTRFENAHTASFDCAPSWLYEGMAQAFRNGAAR
FT                   LAIVGDDPSLLSNQDFNKVARLSKATSIAYQPALKEISNFAMNWSIVAYPTAGWAATIF
FT                   PALPINEAIKKLADAIFSASRVTGEDPVHAWGVHNANLKQRSSWLNEQRFSALHFKGPG
FT                   TDLTVGLADDHEWQGGASVAQNGVVCNPNIPTEEVFTTPHAHKVEGFVRSTKPLSYQGT
FT                   LIKNIEVRFEAGRIVEARASKGQEVLQQVLQSDEGASRLGEVALVPHSSPISKSDLLFY
FT                   NTLFDENAACHIALGQCYSKCFLNGASLTPEEIAARGGNKSVIHIDWMIGSGEIDIDGI
FT                   TQEGMRVPVFRKGEWA"
FT   CDS_pept        329258..330133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="BH02510"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27063"
FT                   /db_xref="GOA:Q6G4T2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27063.1"
FT                   /translation="MPELPEVETVRRGLEPVITGAKIVSVTLNRRDLRFPFPEAFSERL
FT                   IGRTIMGLGRRAKYLLFHLSQNETILSHLGMSGSWRIEDDFLRERSSTVSKFVKHDHVV
FT                   MDIQAKDGKVYHLTYNDVRRFGFMLLVDTRSLYEHPLLKKLGLEPMSNAFSGSYLQEVF
FT                   VNKKISLKGVLLDQSIVAGLGNIYVCEALWRSRLSPQRGAFTLALKTECARELAASLAQ
FT                   NIRNVITEAISSGGSTLRDYIRTDGSLGYFQHSFSVYGREGKECLHCGIPIVRILQSGR
FT                   SSFYCSQCQK"
FT   CDS_pept        330217..331605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27064"
FT                   /db_xref="GOA:A0A0H3M255"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M255"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27064.1"
FT                   /translation="MLNKVLTHLDENIEKSLERLFSLLRFQSISTDFAYKDECRKAADW
FT                   LVEDLKSIGFKASRRDTSGHPMVVGHHPGPSDDCLHVLFYGHYDVQPVDPLNLWEDDPF
FT                   TPSLKEREGEKVICARGASDDKGQLMTFIEACRAFKKETGQLPVRVTVLFEGEEESGSS
FT                   SLVPFLKANKDELKADCALVCDTSMWDADTPSVSVALRGILGEEIIITAANRDLHSGYF
FT                   GGAAANPIRILTKVLAGLHDENNRVTLPGFYDGVEETPPHILQSWNALNCTAENFLGPI
FT                   GLSLPAGEKGRSVLELVWARPTAEINGISGGYEGEGIKTVIASQASAKVSFRLVHKQDP
FT                   EKIRQAFRDYVCSLIPADCSVVFKEHGASPAIQLPYDSPFIKAAKDALSQEWNNPALLT
FT                   VMGGSIPIVADFQSILDMETLLVGFALADDRIHSPNEKYNLKSFHKGQRSWARILATLA
FT                   KTGG"
FT   CDS_pept        331606..332226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd1"
FT                   /locus_tag="BH02530"
FT                   /product="Ribonuclease d"
FT                   /db_xref="EnsemblGenomes-Gn:BH02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27065"
FT                   /db_xref="GOA:A0A0R4J6U7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27065.1"
FT                   /translation="MTEIRVHQGDLPNLDNYRIDAVAVDTETLGLQPHRDRLCVVQLSS
FT                   GDGTADVIQIAKGQKSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFCTKI
FT                   ASKLTRTYTDRHGLKEICGELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLK
FT                   DIFEERLKREERESVAKACFQFLPMRANLDLLGWSEIDIFAHS"
FT   CDS_pept        332819..333130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02540"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27066.1"
FT                   /translation="MNMKYFITASATFVSISVAQVATASVVATQKLVEGVSSSRSFLSD
FT                   AYRSKSLDKVLRAEFACLDNNQGKAVELVTVASSTQRRGSRGGGRRGRPQFSRGPMSF"
FT   CDS_pept        334187..335017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpbC"
FT                   /locus_tag="BH02550"
FT                   /product="Hemin binding protein c"
FT                   /db_xref="EnsemblGenomes-Gn:BH02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27067"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27067.1"
FT                   /translation="MNIKWLITASAFTFVSVAQAADIVVPPSPTPVAPVIVAPTFSWTG
FT                   FYIGGQIGGFSSKTKMDILSKGKTIPVSDDFLPKLSGFMGGLYAGSNVDLGNGLILGVD
FT                   TDIIWTDKDDTKTVPPYEIAENHVNYVNKMLKDAGINIGDNKLEAGKYTRALGFTFKEK
FT                   WAGATRVRIGFAAERIMPYVAGGIAYTQLQDITSISITKKETGKVIASGNLSDETKTLV
FT                   GYTLGAGVDLAMTNNVIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF"
FT   CDS_pept        335351..336190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbpA"
FT                   /locus_tag="BH02560"
FT                   /product="Hemin binding protein a"
FT                   /db_xref="EnsemblGenomes-Gn:BH02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27068"
FT                   /db_xref="GOA:A0A0R4J7W6"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27068.1"
FT                   /translation="MNIKSLMTTSVIALISASAAQAADVIVPHEVAPTVISAPAFSWTG
FT                   FYIGGQVGNFSSKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVET
FT                   DAVWADREDAKTSSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALK
FT                   EKWSGATRVRIGFTAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTK
FT                   TLVGFTLGGGVDFAMTDNVLLRAEYRYSDFGKKKFEKEGSEFSYKTNDFRVGVAYKF"
FT   CDS_pept        336688..337863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbpB"
FT                   /locus_tag="BH02570"
FT                   /product="Hemin binding protein b"
FT                   /db_xref="EnsemblGenomes-Gn:BH02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27069"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M256"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27069.1"
FT                   /translation="MNTKRLITVSIWALIAASTAHAADVGIPRQSVLAASPVITAPTFT
FT                   WTGFYAGIQAGGFSSKTDLSIVGKDKTVPLSKDLSPKLSGFEGGFYAGSNINLGDDFIF
FT                   GVDTDLTLSGQKHTKTIIIGVDDNAAVENAVARSGRSTRSASGNTSTTTQSSVSAVSSS
FT                   VIESALTLAKPAAANTGTHAHGHSGRQGGDAHSTYHGAGNGAYPHSMGAHSHVANPHAS
FT                   NPHGTQNMAGRTTQSTKVAEKNASGIYGIEQVKKEAYEHGLSQYGNVETLSHTLKQNWA
FT                   GATRVRVGFSVDRVMPYFAGGIAYAQLHDTISISIKKNDESVVTSKNLTDEKKTMIGYT
FT                   LGGGVDFAMTDNVLLRAEYRYSDFGKKKFAKEKLEINYKTNDFRVGVAYKF"
FT   CDS_pept        338116..341031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="BH02580"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27070"
FT                   /db_xref="GOA:Q6G4S5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4S5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27070.1"
FT                   /translation="MTVKNETVDYSKTLYLPQTNFPMRAGLPQKELELMERWEKRGLYA
FT                   QLRQQAKDRPLYTLHDGPPYANGHIHIGHALNKVLKDVIIRSFQMRGFNANYVPGWDCH
FT                   GLPIEWKIEEKYRAQGKNKDDVPLNEFRQECRQFAQHWITVQSEEFKRLGVVGDFNRPY
FT                   TTMAFHAEARIASELMKFALSDQIYRGSKPVMWSVVERTALAEAEIEYHDHESDVIWVK
FT                   FPVLQADSKDLYDAYVVIWTTTPWTIPANRAVSYSSQISYSIYEVKSAENDFGPQVGEK
FT                   LLFADALVMSCAEKAKLVLKRLRVISAKEFKTLVLSHPLKGLAGGYNNKIAMLDGSHVT
FT                   ESAGTGFVHTAPSHGREDFEIWNAYKPLLEQSGIDSSIPFPVDDAGFYTKDAPGFGPDR
FT                   KGGAIRVIDDNGKMGDANKEVINALIKADRLFARGRLKHSYPHSWRSKKPIIFRNTPQW
FT                   FISMDKDLGDGSTLRSRALKAISMTRFVPSSGQNRLASMIADRPDWVLSRQRAWGVPIC
FT                   IFANEDGVILKDERVNERILRAFEAEGADAWFAEGARERFLGERAHESWIQVVDILDVW
FT                   FDSGASHSFVLEDRDDLNWPADVYFEGSDQHRGWFQSSLLESCGTRACSPYKAVITHGF
FT                   TLDENGKKMSKSLGNTVVPQEIIKTFGADIFRLWVMTTDYWEDQRLGKQILQTNVDSYR
FT                   KLRNAIRWMLGTLAHDEGEEISYCALPDLEKLILHRLSELDQLVNRAYDDFDFKKIMRA
FT                   LLDFSITELSAFYFDIRKDSLYCDPPSSKKRKASLQVVREIFERMVIWLAPMLPFTMEE
FT                   AWLERYPESTSVHLEQFRPVPMEWQNESLAERWKKIRQVRKVVTGALELERADKRIGSS
FT                   LEAAPIVFISNPVLREALENLDMAEICITSALTITQGVPPSDAFILSDVEGVGVYPRKA
FT                   LGTKCARSWRYTQDVGSDPTYPDVSARDAAALRELQVLGKI"
FT   CDS_pept        341227..341820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27071.1"
FT                   /translation="MKKREVKIFSTSMLGVYLILTGCSAPTYGTGKPASLQFFEDVANI
FT                   TSLTPTNNNSQLVMKPHPKLVMPSSSALRFLPPPQQDVAQESSFNGKATLNQHTGSGKV
FT                   FGFPKKVSSMNGDIDSSKSVSRLSTKQRYEYLRLQRAQVGSAQYRQYLTEPPLSYRQPA
FT                   RIAPVGQQDKDEVEALKERERKNTSKMRSDKKSL"
FT   CDS_pept        complement(341883..342329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02600"
FT                   /product="Nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27072"
FT                   /db_xref="GOA:A0A0H3M4L4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27072.1"
FT                   /translation="MTLTPMEIALLEAQWAAKKDEVPVGAVITRGQSIIVRAGNSIKAA
FT                   YDPTGHAEIRVIRMACAAFQSERLPDCDLYVTLEPCAMCAAAISFARIRRLYYATSDPK
FT                   GGAIEHGPRLYKQSTCHHSPEVYSGFKEKEAAQLLKDFFAQKRC"
FT   CDS_pept        342605..344002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27073"
FT                   /db_xref="GOA:A0A0H3LW78"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27073.1"
FT                   /translation="MNENSESERIAKRLARAGIASRRDAEMMILAGRIVVNGTVVTTPA
FT                   LNVTRSDVIKVDGKPLSPIERTRLWLYHKPAGLVTTHRDPEGRPTVFSNLPKEMPRVLS
FT                   VGRLDINTEGLLLLTNDGGLARVLELPLTGWVRKYRVRAHGRVKQSALDNLKNGIAIDG
FT                   IFYGSIEASIEREQGSNIWLSVALREGKNREIKNILGALGLSVNRLIRISYGPFQLSDL
FT                   EEGAVREIKGRMLRDQLGERLIMQANADFDAPILKPFSNTAVVAEKRSHKDLTVANDGW
FT                   ISSHGGDLRRRQRKSSAERGRTRLSTKLDKKFMGKEKSEEGKIERFLPRSRHSNVWMAP
FT                   GARPQSAHRKSFYSEGIHHAHKSDLSVNRSFHRAKQSKDQLRKEKGVGFDQKRGKTSYS
FT                   KARVSNKKGDFFKKEGKVMKDSHDEHPFENRRRAKSFDGTMKKSRTHSGHTKTAKRFGG
FT                   SRASRRR"
FT   CDS_pept        343983..344552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27074"
FT                   /db_xref="GOA:A0A0H3LVM4"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27074.1"
FT                   /translation="MRVVGGKFAGRVLFAPVGQSIRPTSDRTRESLFNIFASQEGQFWV
FT                   NKRILDLFAGTGALGIEALSRGAKAAVFVENSVEGRGLIQKNLEALELQSIGRILRRDA
FT                   TKLGNIGTMLPFDVICADPPYGRCLGERAFMEVLQGGWAKANTLFVLEEKKDAIIHLPE
FT                   IFYLDDERFYGETTIRFYKLRSSLQV"
FT   CDS_pept        347407..348738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="BH02630"
FT                   /product="pmbA protein, maturation of antibiotic mccb17"
FT                   /db_xref="EnsemblGenomes-Gn:BH02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27075"
FT                   /db_xref="GOA:A0A0H3M259"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M259"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27075.1"
FT                   /translation="MTDKNQIDKAASLVEEAKRSGADAADAVIVRAHSTSVSVRFGKVE
FT                   STEASESDNFTLRVFVGKKVASVSANLATFPQELAERAVAMAKASPDSLFEGLADKEYL
FT                   ATHPKDLDLFDNFVPNSHFLTEDALKMEAAALSVKGVSNSGGAATAYGCSGFVLVTSDG
FT                   FCGAYRSSFFSRSCSALAGEGTAMERDYDYTTALHFSDLEAAEIVGRNAGLGAVRRLGA
FT                   VRAATGGVDVIFDPRTARGIAGHIAHMVNGASVARKTSLLQNFLGKAVMKPYVNVTDQP
FT                   LRLRGNSSRPFDGEGVEGQTLHIIENGILQNWLLSSSSARELGLKTNGHGVRSASSVQP
FT                   ARTNFAIEPGLVSPHDMIKDLQSGFYVTELFGHGVDFVTGQYSRGASGFWIENGEITYP
FT                   VSEVTLGSNLLHMLAHLTPASDIDRRYGTAAPTLLIEGMTLAGK"
FT   CDS_pept        348803..349528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02640"
FT                   /product="myo-inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27076"
FT                   /db_xref="GOA:A0A0H3LXE6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27076.1"
FT                   /translation="MKYFGCELDVWIKEGNSPVSEADLAVDHFLKERLLVARPNYGWIS
FT                   EETKDNRSQRSYERSFVVDPIDGTRGFLSGSTYWCVSIAIIENGRPIIGVVQCPAQGNV
FT                   YAAVTGEGATLNGIKLPLLPSQVNRKYKVSLDKSLAQKLPDDFCNQVSFYRHIPSLAYR
FT                   IVLVAQGEIDIVLIRPNCHAWDIAAADLILQECGGYFLPLDAPFLSYGIEPYQYGFLVA
FT                   GKNNCCQNMIDVVRQAKLV"
FT   CDS_pept        349574..349819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27077"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27077.1"
FT                   /translation="MIETNEKKQYLHLVFGGELKNLNSNQFKNVDDLDVVGIFPDYQSA
FT                   QEAWHAKAQSTVDNALQRYYILDLHRLLDLENGDAE"
FT   CDS_pept        350643..351965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="BH02660"
FT                   /product="3-deoxy-d-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27078"
FT                   /db_xref="GOA:A0A0H3LW81"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27078.1"
FT                   /translation="MVELKAHAALLIYRMIGFCLRPVVPFYLFVRTIRGKEEWCRQKER
FT                   LGKSYQVRPPSPLIWLHAASVGETFALFPLINYILSLKINILLTTGTVTSSSLVKKHFG
FT                   KRLIHQYAPLDLDLAVRRFISHWKPDLALICESEVWPLRIKELAKMRIPQILVNARMSE
FT                   HSFKAWQKRPVLARHIFRHIDLVIAQNKRDVAYYHALGVKSVALSGNLKADVFWVEDQA
FT                   LLAHYRDAIGNRPVWAAVSTHEGEEEIAFEVHKILKNYLPDLLTIIVPRHPERSEDLIK
FT                   KCSNKGLHFIRRSNSAAPERDTDVFLGDTIGEMGLFLRLSKVSFLGKSLCGEGGHNPLE
FT                   LALLGSAILTGPHVSNFQEMFEQFLMRDAAYMVQDKKQLAIQVYRLLTNELLRREMVDK
FT                   AYEIATGMAGALERTLKILDPFLQPLVIQTGLSQYRSRYAS"
FT   CDS_pept        351955..352974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="BH02670"
FT                   /product="Tetracyldisaccharide 4 27-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27079"
FT                   /db_xref="GOA:Q6G4R6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27079.1"
FT                   /translation="MHLSAPHFWWKNKSFLRFLLAPISWGYAYFSRRRMARHPPIVDLP
FT                   VLCIGNFTCGGAGKTPVVIAFAKVAKELGFVPGVVSRGYGGRVKGIHLVNEEHDNAYDV
FT                   GDEALLLARHAFVAISVDRYAAAQRLKKEGCNLILMDDGFQSRRLYMDYALLVVDAMRG
FT                   FGNGAVFPAGPLRVPLKTQFSLMDSVLLIGDSDACDYIAFLVNRTGKSLHHAHLESLAS
FT                   DKVAGKSFLAFAGIGNPDKFLKSIKELSGHVVQTYFYPDHYFFTNTDLKNLVQRAKMHN
FT                   LWLATTAKDYIRIQTSKMQEDLKNLVVFDINVNFVQKNFCRVLLQEVMIRFRERKHSL"
FT   CDS_pept        complement(353019..353255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27080"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27080.1"
FT                   /translation="MFSSNEREAKIHYSNNGYKIIEYGTYTLCAVSGQKILIDDLKYWN
FT                   HHRQEAYASCEISYHRELECNPYLNQLLKAQKK"
FT   CDS_pept        complement(353376..355214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BH02690"
FT                   /product="DNA mismatch repair protein mutL"
FT                   /db_xref="EnsemblGenomes-Gn:BH02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27081"
FT                   /db_xref="GOA:Q6G4R4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27081.1"
FT                   /translation="MIIRHLSENIINQIAAGEVIERPANVVKELVENAIDAEATRIEIV
FT                   TTNGGKNFIRVSDNGCGIPADQLTLAVSRHCTSKITDDVHNICFLGFRGEALPSIGSVA
FT                   KLKLTSRTQNAESAAEIIVTAGKIVGPKPAAANPGTIVEVRDLFFVTPARLKFMKTDRA
FT                   ETNSITDMIKRIAIAFPHIHFSLSGSDRTSLELPATANNTQGQLQRITQIMGKEFAPNS
FT                   IVLNAERESVRLTGFACLPSFNRSNSLHQFAYVNGRPVRDKFLWGAIRGAYADVMTRDR
FT                   YPVSILFIDLPPADVDVNVHPTKADVRFRDPGFIRGLIVGAIREALHHTGVRSTSTRSE
FT                   AMLAAFQTQKPLKTFKSTYKPSSYSPQPYHVESASMVNKPLDIISPVGLKEDAPPLMEG
FT                   LDIPSGDAYTPNTPAASEECSYPLGAARAQIHKNYIIAQTQDSLIIVDQHAAHERLVYE
FT                   ALKNALYSKPLPSQLLLIPEIVELSEEDATCLLTHKDALQKFGLGIEAFGPGAIVVRET
FT                   PSLLGEINVEALIKDLADEAAEYDTTDNLKTMLDYVAATMACHGSIRSGRLLHPEEMNA
FT                   LLRQIEATPNTGTCNHGRPTYIELKLADIERLFGRK"
FT   CDS_pept        355512..356600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02700"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27082"
FT                   /db_xref="GOA:A0A0H3M261"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M261"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27082.1"
FT                   /translation="MARLSGILADSDIQALIDNNFLKALWPFDAAQIQPASLDLRLGEK
FT                   AYRIRASFMPGADVRVLDKLERLKLHEFDLRDGAVLETGCVYIVPLLENLALPEILSAI
FT                   ANPKSSTGRLDIFTRVITDNAQEFDKICVGYHGPLYLEISPRTFPILVRTGSRLFQLRF
FT                   RKGHSYLNEIELHALHRDETLISDDLPNISAGGIGLSINLKGDENGLVGYRGKRHTSVI
FT                   DIDKHAVANILDFWEPLFDRGQRELILDPDEFYILVSRESVHVPPLYAAEMTPFDPLVG
FT                   EFRVHYAGFFDPGFGHMEAGGKGARAVLEVRSHEVPFILEHGQIIGRLVYEQMLKRPLA
FT                   LYGEDSGSHYQAQGLKLSKHFR"
FT   CDS_pept        357436..358587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="BH02710"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27083"
FT                   /db_xref="GOA:Q6G4R2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27083.1"
FT                   /translation="MIISSTLDYRKAAKRRLPPFLFHYIDGGAYAEETMRRNYADLQAL
FT                   ALRQRILRGVGEVDLSTKLFDQTLDLPIILAPVGLTGMYARRGEVQAARAAVAKGIPFT
FT                   LSSVSVCPIAEVQKAVGSAFWFQLYVLKDRGFMRDVLERSWASGVRTLVFTVDMPVPGA
FT                   RYRDAHSGMSGSYAGLRRILQAFIHPHWAWNVGIMGRPHDLGNVSTYLQKKIALDDYIG
FT                   WLGANFDPSIGWHDLQWIRDFWKGKMILKGILDPEDAREAIQFGADGIVVSNHGGRQLD
FT                   GVLSTVRALPAIAEAVKSDLTILVDSGVRSGLDVVRMIAQGADAVMIGRAFVYALAAAG
FT                   EKGVAHLIDLFANEMRVAMTLTGVRAIKEITRESLASPDVFEQ"
FT   tRNA            complement(359730..359805)
FT                   /locus_tag="BH02720"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:359770..359772,aa:Thr)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        360289..360414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27084.1"
FT                   /translation="MSDENRRTELEIKLMDQEKILDEIFCVIIEQWKSLDEISKK"
FT   CDS_pept        complement(361075..361395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27085"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27085.1"
FT                   /translation="MLRPLLKLMAFIFIALTIIVLAIDSAHSVSTSHWTTTPLNTMLVN
FT                   FLQTDIYGLNQSIRNIMPPFLSSICITLICLPGWSILGAVSIGFCLLNYKKPKPFHKIS
FT                   YT"
FT   CDS_pept        361576..363003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="BH02750"
FT                   /product="Phenylalanine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:BH02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27086"
FT                   /db_xref="GOA:A0A0H3LW86"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27086.1"
FT                   /translation="MLNDANNELKRNLQNRHIQMIALGGVIGTGLFYGSKEAIQLAGPS
FT                   AILAYLIGGLIIYFIMRMLGEMSVEEPSSGAFSFFAYKYWGRLAGFITGWNYWFLYILV
FT                   SMTELTVIGFYLDHWILIDHWKSSFIVLLLITLVNLFNVRFYGEFEFACALIKVAAVIS
FT                   MIIFGIFLIVTGVGGNQASIHYLWCHGGFFSYGAIGVVLATSVVMFSFGGTELIGIAAG
FT                   ETSNPQKTIPVAIRQVMWRIIIFYIGSISVIMIISPWNMIEKNSSPFVTIFETLGIPAA
FT                   GHILNFVVIMAAISVYNSGIYSNGRMLYSLAIQKNAPYIFSKLSTARVPYIAILFSSFC
FT                   TAIIVVINALVPDNSFMRIMALATAAAVITWAIIIIVHLKFRKAHKNKKEDFMYAFGLY
FT                   PYANYLCLCFLALLFCIMFVSGFGKNGLMTRLFDMIGIKMSFLETYIPMQMPDMSLAVV
FT                   IIPLWCLFLFLGYKLKR"
FT   CDS_pept        363045..363725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02760"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27087"
FT                   /db_xref="GOA:Q6G4Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27087.1"
FT                   /translation="MGIIKFDKVTQVFGDLYVLRNITVQLTERRIAVIGANGSGKSTFV
FT                   RLINGLQLPSHGFVSVDGLDTKNDAKAIKHKVGFVFQNPDNQIVLPLVEEDLSFGLKNL
FT                   KLSKEEVKERVDEILQRYDLQNFRNHAVHLLSGGQKQLVAISGVVAMKPDYIIFDEPTT
FT                   LLDLRNKRLITQVIEELSQTAIVVSHDLEFIRNFDRVLVFDKGEIVVDDIPLVAIKEYI
FT                   RRMS"
FT   CDS_pept        363722..364360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27088"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27088.1"
FT                   /translation="MIGLYIPRDTFIHNLKPGIKLLFLTVCGTTILMVSSIPILVLLLL
FT                   FVILFYKIAKIPFGTVIKQFKSMGLFLALIFVFQAIFVNWLIGIEVILHLIILFSLSSL
FT                   VSFTTRVSDMVASIEVGLQPFRRFGINPSQLSMVISMSIRFIPLLSEKFNEVREAQRAR
FT                   GFNTNIATLAIPLIIRTIRMASEVAEALEARSYNADTVDTIASDNINLS"
FT   CDS_pept        364374..364928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02780"
FT                   /product="Biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27089"
FT                   /db_xref="GOA:A0A0R4J9D6"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27089.1"
FT                   /translation="MNTKDLTYIALFAAIYAVLSFFPPISLPFLLGVPITAQSMGPMLA
FT                   GSILGAKRGALASLLFLVLVAIGLPLLPGGRGGIGVFSGASGGYLIGFPFAAFFIGFMV
FT                   ELFWQRLNFITLIVINALGGIGVVYAFGIPWTAYITKISLLKVLVASSGFLIGGCLKVL
FT                   IASFVALTVKKSVPLISSKEE"
FT   CDS_pept        366252..366632
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02790"
FT                   /product="exonuclease"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        367274..367522
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02800"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        368313..368600
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02810"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        368624..368975
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02820"
FT                   /product="phage related"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        369436..370097
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH02830"
FT                   /product="phage"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        370293..370475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27095.1"
FT                   /translation="MLSLTGCGIHKYASSCVGWLPIYLNQQDLNVISSNLAREILKHNK
FT                   QGERLCGWKHGKKKS"
FT   CDS_pept        370522..370674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27096.1"
FT                   /translation="MIITYQSVKVMSSFMKWSAFFLFLLILDFARLIDAIDDVIAHLKQ
FT                   LFSKN"
FT   CDS_pept        370808..371101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27097"
FT                   /db_xref="GOA:A0A0R4J6S3"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27097.1"
FT                   /translation="MLTSFGKTLRKLRIDHSERLLDMADKPGVSVAFLSSVEIGKKSVP
FT                   VGMEEKIIEFYSLDKAMASLLKKEADACVERTSQSNLLIHLVVKLLACFLEI"
FT   CDS_pept        371023..371178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27098.1"
FT                   /translation="MCRKNFTIKSSDSFSREIVGMFFRNLKCLSQQDLAAFKKLLEKVG
FT                   KKEGTL"
FT   CDS_pept        371485..372642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02880"
FT                   /product="hypothetical phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BH02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27099"
FT                   /db_xref="GOA:A0A0H3M272"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M272"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27099.1"
FT                   /translation="MRGIHRLSALLVKSASQGKYCDGAGLWLNVRKDNTRSWFFRYTYH
FT                   NKRREMGLGPVAQLSLKEARELAKHYSAILREGNDPIVFREQTVLKQQSNIFSEIATAA
FT                   FESKKAELKNEGKNGRWFSPLELHVIPHIGSLSIEKLTANIIRNVLAPLWHEKADTARK
FT                   ALNRINICLKYAAALGLDVDLQACMKARALLGKPRATSTNIPAMPWQEVPAFYQSLDDK
FT                   ILSNLALKLLILTGVRSYPLRYLRLEQIDKDIWTIPKENMKGIVGKVSDFRVPLSHEAL
FT                   KMIEKSLPFEKNGFLFAGSSGKPISDVTLSKFMKDKGFDYRPHGFRSSLRDWIAETTST
FT                   PFEIAETVLAHSVGSSVTKAYMRTDFLEQRHTLMEQWAAFITGAT"
FT   CDS_pept        372656..372886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27100.1"
FT                   /translation="MCLLSNQVPKKHLESIADRLPKQSFLRALKTLTRCMRVAYKGFVG
FT                   CSYAIQYPYGESIATDYRPCFLAPGIPLECQ"
FT   CDS_pept        372914..373504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02900"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27101"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4N3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27101.1"
FT                   /translation="MNTLIKITEQTIDQEAVQTVNARELHTFLEVKSNFRDWIKNRIED
FT                   YGFLENKDFISFAKILAKPNAPQENQDFMSFTQKRVKPKSGRPSIEYHLTLDMAKELSM
FT                   VERNEKGRQARRYFIECEKKLKSQSVEYDVDRRFDLPSHWEGMNAGEKALYLLGPIHVR
FT                   LIDAFRVDEENRKYKALIKEAKQVLATSVTKAA"
FT   CDS_pept        373624..373899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ1"
FT                   /locus_tag="BH02910"
FT                   /product="DNA-damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27102"
FT                   /db_xref="GOA:A0A0R4J821"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J821"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27102.1"
FT                   /translation="MGKIQARIPDEVQEVASAVIKSTGLTVSDAVRMFMTRIARDRALP
FT                   LDLFQPNLETLQAIEDAEMGRVERTSLDGLRAMIRDDKAEVCKSAK"
FT   CDS_pept        373912..374202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02920"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27103"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27103.1"
FT                   /translation="MREIVYTKSFRCDLKRESKGRYADTLETEETDLLLVIKALAENEL
FT                   LKVQWRDHALTGQWRNCRDCHIKPDLVLIYRKPDDETLELLRLGSHSELRL"
FT   CDS_pept        complement(374325..374555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02930"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27104"
FT                   /db_xref="GOA:A0A0R4J8H8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27104.1"
FT                   /translation="MCVGGNMARKKTQDDIELTEGEKEILQEIIMTYKSIKVMSRYTKW
FT                   IVLIILLLALDFSRLIDAVGNIFTQKPNIRL"
FT   CDS_pept        complement(374666..374893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02940"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27105.1"
FT                   /translation="MILWMKRNLLLTGAALAAFFMALAKAFTLGKKAEQQKQKEKTLKA
FT                   ATTRLEVENEVNQKSDTDVRAALSRWLRNK"
FT   CDS_pept        complement(374890..375552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02950"
FT                   /product="Phage related lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:BH02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27106"
FT                   /db_xref="GOA:A0A0H3M4N7"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27106.1"
FT                   /translation="MRTISQEGLALIKQWEGLRLNAYKDAIGVWTIGYGHTNNAGKPFV
FT                   YKGMAITEKQAEELLCQDLRQFENTVEQAVQVSLTDEQFAALVSFCYNVGTTAFCNSTL
FT                   LRKLNSGDYEAIPTELQKWTKAGGKRLQGLVHRRAAEAGLWAKGAFVSSNYQTVETQAP
FT                   TGLFKAEALAPVIGSFSGLGGLLAGNGPVQWALATIMVLAACAGIFFVAKRFQEHRL"
FT   CDS_pept        375712..376014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02960"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27107"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27107.1"
FT                   /translation="MFTIYKTEHFIKWLDSLKDEIAQAHIVKRIARIETGFLGNVKFFR
FT                   GIGELKIHHGPGYRIYFVKQGKQIILLLNAGDKSTQQKDIEKALQLVKEMKHGNY"
FT   CDS_pept        376001..376321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02970"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27108"
FT                   /db_xref="GOA:A0A0H3LVP5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27108.1"
FT                   /translation="MEITKFDTSEYFKTPETQRILLEDALESKDSKYLAHALGIIAKNQ
FT                   GMSKIAQNTGLSRESLYRSLSDKGDPRLSTFLSVLSALDLQMSLTPIQKNCKEQKALEE
FT                   AS"
FT   CDS_pept        complement(376365..376643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02980"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27109.1"
FT                   /translation="MKIDTNFLCDLWMALFQFSNDENINEKECTALVDIMSLVEKVLVL
FT                   KLQDDVPNIVKILAVLTDFGDSELPHSMDSLLRAYEPDLDNPIKKVA"
FT   CDS_pept        complement(376640..377371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH02990"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27110"
FT                   /db_xref="GOA:A0A0H3M284"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M284"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27110.1"
FT                   /translation="MNTLIEISEQVIDQETVQTVNARDLHAFLEIKARFNDWIKNRIKE
FT                   CKFQENINFITLTKNLVNGGKVKEYHITLDMAKHLSMIERNDKGHEARQYFIKCERLLK
FT                   QVATPQVDYSKPEALLGVLNHLQSQIEQKDHVIAELAPKAEALEGLKRSDGLFGLIEAA
FT                   KMLEVRPKDLTDYLRKHDWVYRRAPSGPLLPYQDKIKKGFMDCPAITIQRPDGTEKVLP
FT                   STKITPKGLACLREQIHGGVQ"
FT   CDS_pept        377391..377618
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH03000"
FT                   /product="anti-repressor"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(377623..378195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03010"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27112"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27112.1"
FT                   /translation="MNTLIEISEQVIDQETVQTVNARDLHAFLEIKSEFRNWIKNRIKE
FT                   CKFQENINFVTAVNFYRGGKVKEYHITLDMAKHLSMIERNEKGHEARQYFIKCERLLKQ
FT                   VATPQVDYSKPEALLGVLNHLQSQIEQKDNTIAELTPKAEALEGLKRSDGLFGLIEAAK
FT                   MLEVRPKDLTDYFYKNITLQLDNVATI"
FT   CDS_pept        complement(378223..378771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03020"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27113"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27113.1"
FT                   /translation="MNTLIPISEQTVGQETVQTVNARDLHVFLGITSKFADWIKNRIKE
FT                   CNFRENIDFIGFSKNLEKGGRPSIEYHITLDMAKHLSMIERNEKGHEARQYFNFLFDNM
FT                   SILCLLSNQVPKKHLKCIADGLPKQFIFRTLKALTHYMRVAYSGFVGCSYAIQYPYGKS
FT                   VTTDYAPCFLAPGTLFECH"
FT   CDS_pept        complement(379083..380390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpD"
FT                   /locus_tag="BH03030"
FT                   /product="Late control gene D protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27114"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27114.1"
FT                   /translation="MKPFCTVMANGEDITRTLMDYVLSIEITDEAEDKSDRITIELDDR
FT                   ARECDNGFLDIPLIGTIISVTLGYEGGKNRDMGAYLIDEISVSSPPQSLSVTGRAASMN
FT                   TSYRTPKSQSYHQQTLGNIIQEIAERNGYTPKVDPALAKIVVRHIDQTSESDMAFATRL
FT                   AEDYDAVAKPVDGKLVLAKRGEGKAITGETLPVVVIHEKLCSSWDFKYSARDEAGAANG
FT                   LATEAGDDQKAAADAREPEEVEEGEDVIHMDESDAPNLPKAETEAKTPENQEQDEEKKG
FT                   GVLASYHDIRTGEKKEVKVGKAPFHELKYTYHNQSEAVAAIAAYRNKSSRGKSSFSCDI
FT                   GGDPFVQAEAKLVQEPPFRPYIPAEWRIKSVKHKLDKTGGYTTKIDCELFDETQEDAAG
FT                   NVANTTPDKDDTLDPNAPPNACDEGEGVIHMDEEDR"
FT   CDS_pept        complement(380387..380611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpX"
FT                   /locus_tag="BH03040"
FT                   /product="Phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27115"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27115.1"
FT                   /translation="MSDLYVTKEGDMVDAICWRYYAKGQQALAVERVYAANFGLADYGP
FT                   ILKAGITIVLPILPYPKATPVIRIWGSQS"
FT   CDS_pept        complement(380608..380988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpU"
FT                   /locus_tag="BH03050"
FT                   /product="Phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27116"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M292"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27116.1"
FT                   /translation="MMLALGGFIFSIETAAYQTLDMSYGIPWVEQGRLGRKAALQLPAV
FT                   ANAEFSLTGVIYPDFKGGHGQIEYLRQMAHNGPHILVTGQGKILGKFVILSVEEKQSIF
FT                   HQNGTPKKQEFTIKLREYGEEL"
FT   CDS_pept        complement(380994..383294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03060"
FT                   /product="Phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27117.1"
FT                   /translation="MSEKVADAKVKLSLEDELTAPLKRVQKQFDTLSKKLSHSLGIPRF
FT                   SAAVQNMTKSLHGVQGALSTAASRASVFTGVLGLAGGGLVASVTALTMKTMHLGDSLHH
FT                   ASHHLGMSVASLQLWGDAADNSGYSAELFQQSLATLNRRSAQAYAGQKRGMMGFDALGI
FT                   SVKNASGKLKSNSVLLEEITDKMSKMKNQAQRQHIAALLFGGDGKEMASMLSQGMAPIK
FT                   ELFAKARKGKWLIGADVARYAADLSDKLGAFKKKIGGIASFIGARFMPVINDMVDGFSK
FT                   LIDENRDLIQTTVARWAKTLRKVLQDLLNPTSDLRKGISDLTERIKGWFRWLEPLIGEI
FT                   TLFKVGLVALGSFIFGPLIAALAAVGAAFVSLGITIMTTPIGWIIGGITALVAAGYLLY
FT                   KNWDKINGWLLTSLAIVSAVFIRLAFALSGPVLAAFTSVGSKITGLAVNLGKSLLSKIV
FT                   AADKAFIRFSATLGRSLLSALASAASAVASLALTLVGTLISAITAVGSAFISLGVAIMT
FT                   TPIGWILGGIAALVAAGYLLYKNWDTVISFISKLWDSFASLCSNAFNNLFALFKNFSPL
FT                   SWISKKINELIEWLFGVDLMAAGTNLINGLWEGIKSKWNALSDWLSGMMRKLTSWMPNW
FT                   MKEKLGFNVSINKTSTETIKTFTEETNTRAKKMLDTAVVTNTPPEKRKSGFNTGIVEAG
FT                   QMQATNTKVGAFKAPKPITVHKPVEIDARVMISNLNISVPNGLKDEIRAAVNQALERYA
FT                   KQQRLAIASSLSD"
FT   CDS_pept        complement(383404..383688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03070"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27118"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27118.1"
FT                   /translation="MTIQQSVTHQLLIPITFEGKEHTTITLQRPKTKDLQAIDKKEGVE
FT                   QTIAMIARLSGWPHEAISELDINDLSSIGEILESFIKRRDTSTGKPPQN"
FT   CDS_pept        complement(383690..384196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpFII"
FT                   /locus_tag="BH03080"
FT                   /product="Major tail tube protein FII"
FT                   /db_xref="EnsemblGenomes-Gn:BH03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27119"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27119.1"
FT                   /translation="MTVPVLPRVLKYFNIFVDGIPYQAKCESVTLPNLSLVVENYRGGG
FT                   MDSSIEVDLGLETLTLSMTISDCSPELMALLGRTDVNISLRSSMQAQGTPAEGVVMTMR
FT                   GLCKGFEMAEWQPGGKATSTATFTLQYFKYVQKDVEIVEIDVLNLIRKFNGVNQLAGHR
FT                   ENIGL"
FT   CDS_pept        complement(384196..385428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpFI"
FT                   /locus_tag="BH03090"
FT                   /product="Major tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:BH03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27120"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27120.1"
FT                   /translation="MATGFLHGVEVVEVDDGTRPLRAVQSGVIGIVGTAPDADEQAFPL
FT                   NTPVLVAGSLSQAAKLDRTGKRRGTLPNALDLIFKQVGAIVVVVRVQEGDNENTTLTNI
FT                   LGGVNANGAYEGVHAFIGAQSIVGQTPRILIAPGFTNKRTTTDLSIEGLDYQDEPLVTV
FT                   ESYGIAAELIGIAERLRAIVVLDAPNTTDEAALSTAKDFDSKRAILIDPFVKVNRDGKI
FT                   IEEPASAAVAGVIAKTDFTHGFWHSPSNKVINGIVGTARPIDFSIGDRSSRANLLNEQN
FT                   ITTIIRENGYRLWGNRTLSSDTKFAFLSVVRTADMINDAILRGHLWAVDRNIKKTYMHD
FT                   VSESVNAYLRDLKAQGAILGGRCTPDLELNTASAIESGRVYFNVEFTPTTPAEHITFRS
FT                   QIINDYLEEIF"
FT   CDS_pept        385668..385844
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH03100"
FT                   /product="anti-repressor"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        385898..386419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03110"
FT                   /product="Phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27122"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M299"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27122.1"
FT                   /translation="MNNLVTIDSAGIAVTTSLKIAEGVGNTHKTVIQLVRNNRKDFEEF
FT                   GSLGFEIQVSKRDGKGGQKREVAILNEPQATLLMTYMRNNDTVRAFKKALVKAFYDLRN
FT                   QLIDNDRDTRFDFPSNWNEMGATEKAVYIYGPLHMHLVKAFTLVEESKHYKTLVEEAKQ
FT                   VLEKTIVKAA"
FT   CDS_pept        complement(386465..386794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03120"
FT                   /product="Virulence-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27123"
FT                   /db_xref="GOA:A0A0H3LXH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27123.1"
FT                   /translation="MTTRNPNRCPSHPGEILAESLEHLNASKTEIARILQISRQHLHGI
FT                   LKGERPVTAVTAARIGKLLGNGPALWLQLQANYDTWHALRDIDVSSIPTLTANEVDTQM
FT                   EHSHS"
FT   CDS_pept        386882..387061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03130"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4P9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27124.1"
FT                   /translation="MNIKPIRTEQDYQEALEIVSAMFDNQPQEGTPEFDQMEALVLLIE
FT                   AYEAEHYPVSPTHA"
FT   CDS_pept        complement(387357..388682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03140"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27125"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27125.1"
FT                   /translation="MTKTKKLDMELPKEGRFISSEFPILRENLTKIDQAIAQVEKKIDE
FT                   KAPLQHTHTISEITDLESALNGKMAADKTFTFADLSDIEGAKDAANNYVLYKSSNNNFT
FT                   FGSAVSLLGAHQHKTEDIVGLDDFRAKINQDLTSYGRLANPNEWRNYNKFTSKVTMSGG
FT                   LELLGNSPFSLTHNNEVVTNLSTKGSLLKGPLKVDGDLVYTKAQVDALLDSLIKKRKEE
FT                   YVEITMLQSGNIPWPDGVSDDTEIEITAWGAGGSGGQRGGGGGGECVTLKIQKRQLQNN
FT                   DVITIGKGGYGNGGNGGNTLVGSVLTARGGKGNNGYIGGNSGGGVSGGSGSMSNNESGF
FT                   SGKSHAWHGGGGGGGGTNNGRGGNGGDSSYGGAGGGGSGGDGRVPNNGGNGGKSQYGGN
FT                   GGNGAELGKGGGGGGGYRDGEDGTASGAGRGGDGAVKLKVFV"
FT   CDS_pept        complement(388697..391840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03150"
FT                   /product="Virulence-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27126"
FT                   /db_xref="InterPro:IPR032096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27126.1"
FT                   /translation="MKHESGLPFAIDRSVGKDEQQSVVFYGRRSFLQGGELNEMQTIIR
FT                   GRHDRLGRLVAQEGDRVERADAFVNKDTKTVTLTEGKIYIAGDIFPVSNAVLENISMMG
FT                   RVEIGVKLQKKWVTYEDDPELLGQVPGSLAEGEPGAAREVAKLVWALKDDDQKGTFFPV
FT                   YILQDGVLIDQKSPSLLEPAMQAIATYDRAHGHYIVGGCRVTALGQEGQKQVFSIQEGE
FT                   ANINGFKRKRLAALRYEELEDFSTSAVPSETHIFAPPKGKTSFTFKTYYAPIAAVHSLL
FT                   LTKEKTVTITRGAVASGRDGVADKSITAFIKIVQGTREFKEGKDFKKTGDTIDWAPMGD
FT                   EPLPGSSYKVTYRYRASIKADKVTAQEITVSGGAEGGDIIVSYTYKLPRIDRIGLNTGG
FT                   NVVYIKGVSADQPMAPSVPDDVLSLATITNNWLSTPQVANDGTRVAPYDEMWRYFQRVL
FT                   SLDRLMQLERIKSNVDSKEPVAKKGMFADPFLDDSYRDEGFEQTGAIGHGILQLAIDPT
FT                   FYTAHLTAPITLDWTNEVIIAQELTTACEKINPYQNFAPLPGTVTLNPATDFWHEQRTD
FT                   WLSSVTNQLNMGWNRGRTIRNTEVRDDLINETREQIDFLRQIKLNFKIEGFGRGEILDS
FT                   LTFDGVNVLPTSRLVADSKGTLEGSFKIPPNITAGTKNVIARGKGGTTATGLFTGQGVI
FT                   DVKVMRRTTTVKIWTQVDPQAQVFTPDETRQITGIDFHLCKIGNQNHDLVIDLVTTENG
FT                   YPTADIQAQTSYSMKGAKEGWTGARYDVPLTVPDDRLTAFVIKTDDADHSVSLAKLGDF
FT                   DKDSQRYVSSHPYVTGPRFSSVNAQSWSAHQDEALAFRVLAARYRQTEKMVDLGTFDLV
FT                   DCSDLQVRAAVELPSSDCSVIFEIERNNGTIYQLLPFQLLSLSEYISEKVKLRAILKGT
FT                   EKLSPVLFAPVQLIAGKIHKTATYITRAFAFGEKARLTSYIKTFLPGGSSFTLEMQLDD
FT                   GTFVPLKLDETEQLAEPLWTERKFISGDKTARQARLKITLTGGPAARSMVRDFGAGIL"
FT   CDS_pept        complement(391842..392948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp27"
FT                   /locus_tag="BH03160"
FT                   /product="Phage protein gp27"
FT                   /db_xref="EnsemblGenomes-Gn:BH03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27127"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27127.1"
FT                   /translation="MVGSLLPSHATEFEKRLADACDFHQDVDGAVLGISRAKLITRPPR
FT                   FLPWLIEEYGLGELTPYVPNLYDLIDQGLAWQRLRGSVAAIELGLKWLELSARFTPAWS
FT                   GRAWWNSFQLDFDQLPEQSSLEAIEAIVDLSKSFRSDFRRSTYGYDVEATEGDMSHLDD
FT                   SMLDFESGVRLTARDTLFSFGRTTQIKHTLTKEEGKLIGNWIDDVDEELSWNQIDYPWE
FT                   LANFPWCSVKKHERDILIAKWFQNRPLYLALRDLDNTLIGYRRCYAVQPVEQAVEGVYS
FT                   HCGNRFNPSPTGTMLFLAARTDFEDVENKQAASVPLLVHGSLVEQTPLGKLWLGADELR
FT                   GGVEILKTPINIPLRADVREQFKILLRF"
FT   CDS_pept        complement(392948..393775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp26"
FT                   /locus_tag="BH03170"
FT                   /product="Phage protein gp26"
FT                   /db_xref="EnsemblGenomes-Gn:BH03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27128"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27128.1"
FT                   /translation="MSRALAKPEIITELSFEEIRAAVLTHLKELLPEYTFLESDPAVKV
FT                   IEAFSYRELLLRQRINEAARNNILDFATGESLDALGNWHGIARIEGESDERYRERVQLH
FT                   ARGGNGSGTEPYYKLIALTADSRVKDAIIYRKGKDPTIYVAIFGNNEEGTASEDLLQTV
FT                   SQALHRKNIIMTNDTIIVHAAVKKVLDLEADVWLLPEASLKILTTMEANLRTAWKQEQA
FT                   IGRELSLSWWVSKLMIPGVQKVIAIAPTKDSVVCDEEILSIGKITLNFKGRAR"
FT   CDS_pept        complement(393772..394101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp25"
FT                   /locus_tag="BH03180"
FT                   /product="Phage protein gp25"
FT                   /db_xref="EnsemblGenomes-Gn:BH03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27129"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27129.1"
FT                   /translation="MDRTTGKPLVGIEHLRQSIIDILSTRIGTRVMRRDYGSRIAELID
FT                   APVNSSFSIALYAAVAEALDKWEPRFKLKKIDFKMLGTGQVSLSFEGMYLPSGKPITME
FT                   GLLIQ"
FT   CDS_pept        complement(394110..394799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp24"
FT                   /locus_tag="BH03190"
FT                   /product="Phage-related baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27130"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27130.1"
FT                   /translation="MLERRDKEITDLKRRVANMVVVGKISHVDHKNARYRVKTGNLVSD
FT                   WIPDTQARAGKTRSYEGRDVGEQVVVVSSSGDLSQGVIVGSIHTDANQAADKGNLHKTL
FT                   YPDGTTIEYDDEQNSYALHLTSGGKFSLTISDGVSIKGDGKKLELQAAEGIKIISQGDL
FT                   SLSAEKNIALKAGGSVSLHSDDGIALHSSEGVSIHSSDLKHNGTNIGNSHVHGGVSPGG
FT                   SMTGGPN"
FT   CDS_pept        complement(394780..395322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03200"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27131.1"
FT                   /translation="MHPRETIRETFVALIKAAKTVAGDNVFNMRDFNLFIETMPAINIS
FT                   TQSETIEDGHDFGLRRRVLTVDVECYATCEDGARFVDQLAWEVEEIFYANPNLNNTVET
FT                   CRLQNIAFAFGDNGSLALHGAILTFDVTHITNIPCPDEGKATVGVVEPLVGFKPETGMG
FT                   NKDKYHKIEGDHVRATR"
FT   CDS_pept        395374..395646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03210"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27132.1"
FT                   /translation="MILLLIMSNKVAKIISLMKASPKNIKFSDLLAVCVYFFGEPRNNR
FT                   TSHFVFKTPWLGDPRVNIQKDSGNKTKVYQVKQVLQAIERMKHEQ"
FT   CDS_pept        395636..395953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03220"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27133"
FT                   /db_xref="GOA:A0A0H3LXI1"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27133.1"
FT                   /translation="MNNNHYTYRVLWSQEDEEYVGLCAEFPSLSWLDAQAEKALKGIMD
FT                   LVSEVVEDMQHNGEEVPVPLSHGKYSGKFQLRIPPELHRKLAIQAAENGVSLNRYISSK
FT                   L"
FT   CDS_pept        complement(396194..396472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03230"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27134.1"
FT                   /translation="MKIDTNFLCDLWMALSQFSKHENMNDKDCTALVDTMSVIEKALIL
FT                   KLQDEMPSILKILTVLTDFGDSELPHSMDSLLRAYEPDLDNPIKKVA"
FT   CDS_pept        complement(396469..397227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03240"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27135"
FT                   /db_xref="GOA:A0A0H3LWC6"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27135.1"
FT                   /translation="MAQYLIDIYQTSIGGDTVQTVNARELHTFLEIGKDFSTWITDRIN
FT                   KYNLLENQDFVCSPILGSKGRGGHNRKDYHLTLSVAKELSMLENNKKGREARLYFIECE
FT                   RRLKQVATPQIAPPQVDYSKPEALLGVLNHLQSQIEQKDHVIAELAPKAEALEGLKRSD
FT                   GLFGLIEAAKMLEVRPKDLTDYLRKHDWVYRRAPGAPLLPYQDKIKKGFMDCPAITIQR
FT                   PDGTEKVLPSTKITSRGLACLREQIFGGVQ"
FT   CDS_pept        complement(397246..397800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03250"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27136"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27136.1"
FT                   /translation="MTLIKISEQAIGQEIVQTVNARELHAFLEIKARFNDWIKNRIKEC
FT                   KFLENINFITLSKNLENGGKVKEYHITLDMAKHLSMIERNDKGHEARQYFNFLFDNMST
FT                   LCLLSNQVLEKHLKHIADRLPKQSFHRQLKALTHYMLQAYNNIVGCGYAIQYPYGKGIT
FT                   TGYVPCFSAPGALHRVSMKNL"
FT   CDS_pept        397821..398012
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH03260"
FT                   /product="anti-repressor"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        398185..399258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03270"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27138.1"
FT                   /translation="MLDTLNIIAMIVCLLSLPMMIVGLVLVCIKKWRKNGLKTLGIGVL
FT                   LFISSAIVGASVHKDKPDQVAHNNEIVSSSSTSSIDVSSQDESMTQVPAESIDKQITSI
FT                   QDNKSDENDGLGFWGWFWLIFFAFFAFSIFAYWQDKRKKRFEEKVPEQVSMSLPPAHPS
FT                   SYFSVVNKTSPAFKNERLEKGIKIFLLCALLIGGVVAIISISPWLLVATIIVLLLGVAV
FT                   HSENKKVKLFEEQVAMLQPDIPPSNFEEGCKMLQELDASEYDYRLARNEKLLGVQERVS
FT                   FDISKKTRLLGRLLVTDKAIVFESPERNERTTWTRIASVAITYKGCQISRRTGVPLNYQ
FT                   FTAFSSPRFTAVIRTLG"
FT   CDS_pept        complement(399294..399647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03280"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27139.1"
FT                   /translation="MRWHGLLHKMIQDVRNTFGQPVIYTRKDNQQSFQITAIYTIKHSE
FT                   SEAGGRIPTTIAKKELDLCINDIGGIPPKPQDSVVVMAPENTEDASQEYFIVSDVQASE
FT                   SGMYKLILREQKQ"
FT   CDS_pept        complement(399649..400725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp20"
FT                   /locus_tag="BH03290"
FT                   /product="Phage protein gp20"
FT                   /db_xref="EnsemblGenomes-Gn:BH03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27140"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27140.1"
FT                   /translation="MDMNFFKHDAFSATTMMKAIENYEFQPGLISSLNLFEEVETSTTV
FT                   VGIERRDNTLSLIQTSERGAPLVEGDRDGRNLRFFKTTRIAKSDTVKSEEIQNRREFGT
FT                   EDQLETAMKYIARKQKKLISEIELTWENMQLGAVQGVVLDADGSVIVDWYKEWEIAPPK
FT                   PIDFKLNNETTNVADHVDQVIMKMIEASKGAFSDRSRIIGLCGNEFFSKLKNHKTIRET
FT                   YLNTALAQTLNSAGGVATPSAIGSGSFGSFDFAGVTFINYRSIHNYNVSAKAGTKRAIG
FT                   IKPDECQFLPANAPGVFQKTFAPGESLDFANTVGKPLYTMLIVDNDRNAWVKPEVYSYP
FT                   LYICTRPEMLFKAVSGGK"
FT   CDS_pept        complement(400738..401106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp19"
FT                   /locus_tag="BH03300"
FT                   /product="Phage protein gp19"
FT                   /db_xref="EnsemblGenomes-Gn:BH03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27141"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27141.1"
FT                   /translation="MSQVFYEDVRNGAYLGPYDPDMSNEEVIFASGAFIEAGTVMGKIM
FT                   ATGKYVPLNPSASDGSTRPVGISFATVDATEADQRAVITARLCTVKASELLWPDAITDD
FT                   QKKDAIQFLEDHNNILFR"
FT   CDS_pept        complement(401103..401516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27142"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27142.1"
FT                   /translation="MARTQYRAEEDDDEKVVDVINEDEEDENKSDIDEDFDEDEDEDED
FT                   KQESVKAALEKERKRGEALTNLERQAKRLGVSFDAAKAIKSGMSVEKAKNVVLTAAVSK
FT                   SASLKLSTTAPHRDGTSKEKIHAKWETAWRAIK"
FT   CDS_pept        complement(401366..402475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp18"
FT                   /locus_tag="BH03320"
FT                   /product="Phage protein gp18"
FT                   /db_xref="EnsemblGenomes-Gn:BH03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27143"
FT                   /db_xref="GOA:A0A0H3M2C7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27143.1"
FT                   /translation="MIPQIQTLQRLMKATKAARHTKMVNNLDMPFLASRLFVVPHMLAS
FT                   TKLDIILNALAPRLFAGEKFPIEAYSQGNTEAFRPPETYVVQNNIAIIPVHGTLVRRSA
FT                   WLGALSGLTSYEGLRASFREAIAQPDVNAVLLDIDSGGGEAGGIFDLVEEFQTLSKQYA
FT                   KPIWAHANEFACSAAYAIACAASQIWIARTGVVGSIGVVCAHLDQSLADEKQGLKWTFV
FT                   FEGDHKTHGNSHEPLSDTAQIKMQADCALLYEMFVDWVAKNRPLSADAIRDTKAETFIG
FT                   IQALELGLADAQGTLAQALEALTDSISQTPTATKEGQNTWHAHNTAPKKMMMKKLSTSS
FT                   TKTKRTKTRATLMKTSTKTKMRTKINRKA"
FT   CDS_pept        complement(402399..403955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp17"
FT                   /locus_tag="BH03330"
FT                   /product="Phage protein gp17"
FT                   /db_xref="EnsemblGenomes-Gn:BH03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27144"
FT                   /db_xref="GOA:A0A0H3LXJ0"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27144.1"
FT                   /translation="MAGFFNKLTGFFTISRQHNPPFEAASKSRRMGGFDPAKKHINKAI
FT                   EECGDTIVARSRWLYDNESLYGSATEEWVSAAVSDGIKPYPRIEGFQEEKKKLLDLWWQ
FT                   WVDEADYDEDANFYGLQATIAREVFLTGECFVRLHYVDLYGRSGVPFQLQIYPTEMLDL
FT                   TYNGPAETEGNYIRMGIEFNASGKRVAYHFWEHHPYDDCPANRAFKSQDRIRVPAEMVL
FT                   HIKERRIAGQLRGSPKITRSMTKIFQLESYDDAELDRKRTAALFAVFITGKESHDAALE
FT                   ENREQTRLPKKPEEAADVDKIYPGSVNMVDGEKQITFSTPVEVGGSYEAFQFRNILKIC
FT                   SALNMPYAVVTGDVTRGNFSNVRTSIIQFRRHVKQWREHIIAFQFNRIVWERFVEMAVL
FT                   SGRVHLPGWEENPLPWLQCESFAPPLEMIDPNKDISAEKEEIRAGLKTRRMALAERGFD
FT                   IDSIHAELEEEHTDARARGLSFDTDMAASSGDNQIIDTTDSDPSETYESNQGSEAHKNG
FT                   E"
FT   CDS_pept        complement(403955..404203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03340"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27145.1"
FT                   /translation="MRTDLNQVNSKTDRLESLKRRREQIEEALYSGAQSVRHGDKQVSN
FT                   RSVEELRRALEMINTQIADLEGRKGSRVFYLNISRGY"
FT   CDS_pept        complement(404207..406135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp15"
FT                   /locus_tag="BH03350"
FT                   /product="Phage terminase large subunit (gp15)"
FT                   /db_xref="EnsemblGenomes-Gn:BH03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27146"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27146.1"
FT                   /translation="MDDNAVEEFFANANDARQPDPPYTVSQWADKNRYLSTVASAEPGL
FT                   WRTKRTPYLREIMDNLSSHKPIETTIVMKGAQVGMSEAGLNFCGYAIHYSPGPALYVMP
FT                   TVETAKKLSKTRLDPMIMASPVLSERIAPARARDSGNTMFSKEFDGGALMLTGANSAAG
FT                   LRSMPIRYLILDEVDAYPLSVDNEGDPVMIAEKRTSTFVQRKIFKLSTPTHRDTSRIAK
FT                   DFVLGDQRYYNVPCDACGVLQPIVWSQIKWPKGAPEKAVFVCTHCGHEHAEHRKTDLMC
FT                   EERGACWVPTSESSRPNLRSYHISALYSPWLTWGECAREFLNAKDDPALLQPFVNTVLG
FT                   EPWEDRTGEVVDPDSLYAKREEYPLAPEQAVVLTAGIDVQNDRLELEVVGWGRSEESWH
FT                   IDYQVILGDPSSFEVWDQLDEYLAKRWPHPGYKEGIRITAACIDTGGGHTQAVYNYVRP
FT                   REGRRIWGIKGQAGWRAVWPRRPSKNNKGQINLYIVGVDAAKDIITARFKKSGPEATGA
FT                   GATHFHKSLDQEYFDQLTAERKVIKYFKGFKRIEWQKSEKARNEALDCRVYAYAALQGL
FT                   ISAGINLNREVDILEERLEKLKIEGALEQPTSEHPPSPSPRRSQTTQPKKKPFRTVISP
FT                   YMRGDWR"
FT   CDS_pept        complement(406128..406709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp13"
FT                   /locus_tag="BH03360"
FT                   /product="Phage protein gp13"
FT                   /db_xref="EnsemblGenomes-Gn:BH03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27147.1"
FT                   /translation="MTKKHREGLSLRAFAKKMRVSPNAVVSRFKTGKFDQALFEDGSVN
FT                   EALATAIWNENPTKRPAPFLAPDGQPRTKIKQVSTEGANEYEIKLERMQVALESEKIAL
FT                   ERLRETTVDREEVKRAAREFGRAHRDAMLNFPHRFGASIAAQVGCDAASLIGAIDYYIR
FT                   KALLEAVHIPVPFHDPHSPELENLQETNNG"
FT   CDS_pept        406772..407086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03370"
FT                   /product="Killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27148"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27148.1"
FT                   /translation="MIHKRTNEGDLVIESFADKRCKDLLEGNPPKGFPTTLVRIVQRKL
FT                   FMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRINDQFRICFEWRSNGAYEVEIVDYH
FT                   "
FT   CDS_pept        407103..407399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapA1"
FT                   /locus_tag="BH03380"
FT                   /product="Virulence-associated protein a"
FT                   /db_xref="EnsemblGenomes-Gn:BH03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27149"
FT                   /db_xref="GOA:A0A0H3LXJ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27149.1"
FT                   /translation="MKNYIAIHPGEILREEYLKEYALSAYALAKALNVPRTRIERIVAE
FT                   NSRITPDTALRLASFFDTTAEFWLNMQAAYDVSVLQAEKADEFSKISKFECRV"
FT   CDS_pept        407511..407684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03390"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27150.1"
FT                   /translation="MVFKKNFETRCGYTKEDLEAVDSLPLTDEELARLKPAKEVLPPSF
FT                   FKYVIEERCKRG"
FT   CDS_pept        407809..408072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ2"
FT                   /locus_tag="BH03400"
FT                   /product="DNA-damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27151"
FT                   /db_xref="GOA:A0A0H3LWD6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27151.1"
FT                   /translation="MATSRMVQARVPEEIQNVASQVIQASGLTVSDVVRVLMTRIAQDK
FT                   AIPSVLFQPNAETIAAFAEVDEGNLKKFHSVDELFDDLYADD"
FT   CDS_pept        408059..408340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03410"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27152"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27152.1"
FT                   /translation="MRTIERTTIFKRDFKREMKGQHRHLLDTDLRKVIAALANDQPLEI
FT                   RYRDHALTGNWSNYRDCHIRPDLVLIYRLIGQDRLVLVRLGSHSQLDL"
FT   CDS_pept        complement(408383..408661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03420"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27153.1"
FT                   /translation="MKIDTNFLCDLWMALFQFSNDENINEKECTALVDIMSLVEKVLVL
FT                   KLQDDVPNIVKILAVLTDFGDSELPHSMDSLLRAYEPDLDNPIKKVA"
FT   CDS_pept        complement(408658..409416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03430"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27154"
FT                   /db_xref="GOA:A0A0H3M2H7"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27154.1"
FT                   /translation="MAQYLIDIHKTTIDGDIVQTVNARELHTFLEVGKDFSTWIKDRIN
FT                   KYNLLENQDYLVFTNFGENLQGGRPSKDYHLTLNVAKELSMVENNKKGREARLYFIECE
FT                   RRLKQAATLQIETPQVDYSKPEVLRGVLNHLQSQIEQKDHVIAELAPKAEALEGLKRSD
FT                   GLFGLIEAAKMLEVRPKDLTDYLRKHDWVYRRAPSGPLLPYQDKIKKGFMDCPAITIQR
FT                   PDGTEKVLPSTKITPKGLACLREQIHGGVQ"
FT   CDS_pept        complement(409476..409991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03440"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27155"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27155.1"
FT                   /translation="MNTLIPISEQTVGQETVQTVNARDLHAFLEVKTSFKDWIIRRIQD
FT                   CKFKEGYDFCSFLSESSGGRPSKEYHITLDMAKHLSMIERNDKGHEARQYFNFLFDNMS
FT                   VLCLLSNQVPQKHLKYTAGRLPKQSLLRTLKALTHYMLVAYKWLVGCGYAIQYPRGESV
FT                   TTDCVPCF"
FT   CDS_pept        complement(410008..410847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03450"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27156"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27156.1"
FT                   /translation="MAQYLIDIHKTTIDGDIVQTVNARELHTFLEVGKKFADWITERIH
FT                   KYNLLENQDFVCFPILGSKGRGGHNRKEYHLTLSVAKELSMVENNKKGREARLYFIECE
FT                   RRLKQAATLQIETPQVDYSKPEALLGVLNHLQSQIEQKDNTIAELTPKAEALEGLKRSD
FT                   GLFGLIEAAKMLEVRPKDLTDYLRRFAKFLFDNVLSVCLLSNQVPQKHLKSIADRLPTQ
FT                   SFFRALKALTHYTLHAYNRFVGCSYAIQYPLWGKCNDGLSTVFLSARHSFKVSIKNL"
FT   CDS_pept        complement(410879..411421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03460"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27157"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27157.1"
FT                   /translation="MTLIKISEQVIDQETVQTVNARDLHAFLGITSKFADWIKNRIKEC
FT                   KFLENINFITLSKNLENGGKVKEYHITLDMAKHLSMIERNDKGHEARQYFNFLFDNMSV
FT                   LCLLSNQVPKKHLEYTADRLPKQSLFRALKALTRCRLNAYNDFVGCGYAIQYPFGKSIT
FT                   TDCVPCFLAPGTLLECH"
FT   CDS_pept        complement(411438..411704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27158.1"
FT                   /translation="MLLDKIVTLCLLSNQVPEKRLKQLADGLPKQSFFRKFKILTHYMR
FT                   IAYKEVCRVWLHYTIPLWEKCNDGLVAVFFSTRHSFKVSMKNI"
FT   CDS_pept        complement(412018..412596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03480"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27159.1"
FT                   /translation="MKLIIHQKWYLQQVKDTFTNLQAPRLHWALRNALNTAAKQVERFT
FT                   EKQVADLSSAQIKRIRRGVYIKEKATARFLETDLIGSGTPLPLKFFKAKETKHGVTYTL
FT                   FGKKQILTHGFIKGGSFPKRVDLKMGGNVFQRDDGDQFPIAKQEGPSIAKVMSKPEIAS
FT                   AIAQYANERLTKNIQRQLARQEYAANKKG"
FT   CDS_pept        complement(412600..412920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03490"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27160"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27160.1"
FT                   /translation="MKAIITKPMCVVGDNKSTVRFETSTPNNPFVEISNQVYARLKRAN
FT                   AAKPFVDVKTKIKPDKAVEQIKQIEKEPNQISSETVTEETSLEKPKASKASKPSTPTPK
FT                   KA"
FT   CDS_pept        complement(413179..413355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03500"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27161.1"
FT                   /translation="MQKRIIAYDLQNINENQKVAGKQNAIVKNDITIIDIIYTASNISG
FT                   PVIPFLSYTAQYL"
FT   CDS_pept        complement(413393..413788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03510"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27162"
FT                   /db_xref="GOA:A0A0H3LWE2"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27162.1"
FT                   /translation="MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQ
FT                   LYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLIQVPFIENDSEVVRTNISIERGLLR
FT                   AIDNCAQERGLTRSAFLATAARHELNI"
FT   CDS_pept        complement(413785..413943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03520"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27163"
FT                   /db_xref="GOA:A0A0H3LVU1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27163.1"
FT                   /translation="MALKLVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIAQQAGW
FT                   FKKGEEE"
FT   CDS_pept        complement(414079..414618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03530"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27164.1"
FT                   /translation="MMASHSDGKNMAKRKKRTKRGRPRINGCIREPNGRISRTKMPLDP
FT                   IDKLAIEMRAKRFCLTLQEAKNPLSGTYIGRLYLQGNINQDQYDAAQKYLEVRNDYLCA
FT                   KTLPSAIYDKMPSSSDEAARKKWVEFATKQFLNMQEVIKETQHLYRQHNFYAALQYLVS
FT                   EDQELPYLVPSLADSP"
FT   CDS_pept        complement(414599..415045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb1"
FT                   /locus_tag="BH03540"
FT                   /product="Aingle-strand binding protein SSB"
FT                   /db_xref="EnsemblGenomes-Gn:BH03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27165"
FT                   /db_xref="GOA:A0A0R4J9K7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27165.1"
FT                   /translation="MLNKVMLIGYLGDDPESKTITSGAEVVNFRMATSESYMNKNTYQK
FT                   VEKTEWHSVVVFNPHFAKIALQYLHKGSKVYIEGKLQTRKWQDKNGHDRYTTEIVLPQY
FT                   KGELHLLDAKKEQSEHPSPITSQNYAIASGAQDHSTALNDGVPF"
FT   CDS_pept        415237..415517
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH03550"
FT                   /product="vapD"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        415540..415830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapA2"
FT                   /locus_tag="BH03560"
FT                   /product="Virulence-associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27167"
FT                   /db_xref="GOA:A0A0G2Q8L8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27167.1"
FT                   /translation="MYNPPHPGGILKEELLDERGLTITEAANRLGVARLTLSRVLNCHA
FT                   AISINLALRLEIAGLNDAEFWLKLQQKHDLWQARHNNPMPDISSLEQVSHP"
FT   CDS_pept        complement(415927..416199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03570"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03570"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27168.1"
FT                   /translation="MPILKHLLLKNRKQPMQKKFVATAVGYVPWGDGAAEYFYNLYEYE
FT                   DGTRECEKFDGGQYYKIPENADFSTKAQVKAWIYGGAVPKSVLKL"
FT   CDS_pept        complement(416364..416762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03580"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27169.1"
FT                   /translation="MLDEKASEEEIKAMFLMLSGGLKSQPGEDEKATAVAYLFSLDGLS
FT                   RWAIKTATRDVMKGKAEGLSTTFMPASADLLLYCEKLEDDIRTTVKGIFTSLDRPEIKP
FT                   KGEPISAEKWDKLMQMLEKPKIGLNPFQ"
FT   CDS_pept        complement(416776..417888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03590"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27170.1"
FT                   /translation="MSTKLAWTRLNTDQWLFKLSDLPPMEVNVYVKLRIRMLHMREPLL
FT                   NDARILSHFTCCTVKRFEKALDYLFRSGHIICLEDGRLWSSDVEEELNNSNENLNKFSE
FT                   RAKKAAQAKWEKYHKAKTMSDDQDAKNAKHDANGMLKDAKHDACGDFSNAQAMLNDAIN
FT                   NNNNIYNKKTKTIVLAKKEIGSENLQTTDLVEEPTEVDAVESQSDQIATSSDNQPPIHE
FT                   QENVPKKAKRSKANRGCRLPDDFEPDYDFAIEEGLPPERVKVEIAKFRDYWHSKAGANA
FT                   TKIDWQATWRNWVRNSKNYKQGENYGTQTNSQTGQQRGRAYRITQHMSDFKNADSPYKF
FT                   LFEDDAKPSIPLATGQKAITCRSEENYFVG"
FT   CDS_pept        complement(417878..418225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03600"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27171"
FT                   /db_xref="InterPro:IPR010781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27171.1"
FT                   /translation="MSNAMPWVRFYLYDWISGTNGMTSEQRGVYITLLVCMYEKKEPLK
FT                   TDFETLARVCHCSQKKFAAIVEYLMRNDKLIEIDGRLWNLDVEEELNNLSEELDNFTFN
FT                   NNEEKEVKYVN"
FT   CDS_pept        complement(418218..418694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gp11A"
FT                   /locus_tag="BH03610"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27172"
FT                   /db_xref="GOA:A0A0H3LXL4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27172.1"
FT                   /translation="MINNTRTILCLDLGSKTGWAICGADGHIFSGVMNFQPRRFEGGGM
FT                   RYLRFKQWLTEMKMTARRIDAVYFEEVRRHVGTDAAHVYGGLLATLTAWCEHHQIPYEG
FT                   IPVGTIKKETTGKGNASKEEMIKAVCAKGHAPKDDNEADALAILYLMKEGGTHV"
FT   CDS_pept        418822..419598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03620"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27173.1"
FT                   /translation="MQEWIVDKVVFLLHRINDSAVFLLHWISDNLTIAPIIATIVTGMV
FT                   TLFVQQRSLKKQLKIFQRQTIASETQTAILLEDKKARDLGPYLKLKAVFFPQKYEGTSR
FT                   VRVKLCIINLTKEDIMIRNIRISKKSPFKFVKNACPFVRWPSKTSAEHLVIKRTTPKLI
FT                   ALCPQNIKSNASSEYALNFFIIRAKCYTFLDFIISCRKPNSRNIANFTLDHTSIVNPEE
FT                   TFTVHFWASYPRSKDTYDEFGSEYSFLADNPHLWFF"
FT   CDS_pept        complement(419607..420059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03630"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27174.1"
FT                   /translation="MSNRILKKLYMQLCRLIGCNSKMKNGDRLVKEFRRIPDRDCSIED
FT                   LVKRHETHTTILKKREEWHKSKFDSWMRWHEATLAERDKSIEQQQVVLENLSTLIKQKN
FT                   KTLYEQRLKLASQMELIDKLNNKIICLINKKEEPRLIDFIFAGECF"
FT   CDS_pept        complement(420072..420437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03640"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27175.1"
FT                   /translation="MIMVNNFYVKNLIESWGSIGQFAKEIGCSYEAARKMRDRNSISPK
FT                   YWNIIIQLSESKGPPWVTLDWFLHMYENKSHGVSLLITEQGKSTISLTEKFTTSDGAIC
FT                   MNNSTDNNKHSQHNSQA"
FT   CDS_pept        420515..421132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03650"
FT                   /product="Phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27176"
FT                   /db_xref="GOA:A0A0H3M2K0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27176.1"
FT                   /translation="MSYLPKDRLKIARKNAGYATPSEAARAISALNQNTLISHENGNRP
FT                   VSRQKAELYGQVFNVDPGWILYGESPQENPSLNISIPLISWISAGELSGQDGIMDFSDY
FT                   PMTEAVNLPAGEWIALRVDGASMNKISPPDSIILVNMRDKKLVPNACYVIADETGQATY
FT                   KRYRPNDNPPFQPASYDKTIKAPKLEGAISIIGRVRRTILDM"
FT   CDS_pept        421374..421748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03660"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27177.1"
FT                   /translation="MEKPILIHSDEILLVVYDDDQHIGQSGPLDASQVQAIIDEAEDAT
FT                   QILRVNPSEKSCEDISEEIAEAYVEENIERLDADSEVHYFIRESDAYNRLLDDLAKEKY
FT                   NDEIYGTYEEQNKLRLSDVI"
FT   CDS_pept        421813..422205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03670"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27178"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27178.1"
FT                   /translation="MEKLIAIQQNTIKQETVQTMSSREIAELCGKRHGHVMRDIRKLFS
FT                   ELKIDLSNFAGLYKDSTGRTLPCYHLPKREALIVILGYNTVLRAKIIDYWKKLEEQAAN
FT                   PQIDFSSPEIRAAIMMHLKNKIKQTA"
FT   CDS_pept        422215..422682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03680"
FT                   /product="Anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27179"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27179.1"
FT                   /translation="MNTLIEIKEQVIGQDIVQTVNARDLHAFLEAKRDFSNWIKDRISK
FT                   YNFIEGQDFIKTQDLRSPNLANAKSRAVMAINYYLTLDRAKELSMLENNQKGREARLYF
FT                   IECEKRVKQAITPQIDYSSPKAMIGFLNYLQGQIDQKDTIIEDLTPKAIGS"
FT   CDS_pept        422672..422974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03690"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27180"
FT                   /db_xref="GOA:A0A0H3LVV3"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27180.1"
FT                   /translation="MALESLQRHDGLFGLTEAAKILEMQPKQFIQFLQQKGWVYRRAAG
FT                   GNLLPYQDKIQKQLMDCPTITLQTASGIEKVIPCAKITTKGIGVLSEEIKKQSMH"
FT   CDS_pept        422987..423370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03700"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27181"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27181.1"
FT                   /translation="MEKKYELTDETTDIVSCHTLYRIRALRDFDDVKAGDLGGFIENES
FT                   NLSHDGNCWVYDNACVTWGSKIYDNAKIYNNARVYGGGRIFENAQIYGNAIVYPNARIY
FT                   GDAKIYGDSEICGESRITTNEKK"
FT   CDS_pept        423374..423739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03710"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27182.1"
FT                   /translation="MYKYEIKPTLCAQLVVRNTHNLGELCITISGYKDEPYVDTIISED
FT                   IMHDFLGEDNFKTMMSSNGLLGFTYSYECIAFMCTGFKMVPPYANKILISLMYHNLRAH
FT                   TAILQTDDIIQPIKSKL"
FT   CDS_pept        complement(423736..423903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03720"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27183.1"
FT                   /translation="MVKMRSIAVALIAQSFVFSTNSVCVILSSLILISSIEAQFPRGVN
FT                   HASVKSWFGC"
FT   CDS_pept        423812..424591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03730"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27184"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27184.1"
FT                   /translation="MSELSITQTELVEKTKDCAIKATAMDRILTRALENDVDMDRLERL
FT                   IALREKEIERQNYQSFVADLSAMQREYQKIQKNATNTHTNSQYATLDQYIDAIKETLSK
FT                   YHFALFSRIKEQSSDSISVEMTLTHPSGNKIATEGKFPHDTKGCKSNIQAVGSAITYAR
FT                   RYLLGMLLNVVSADDDTDGNVPLTSAFPQQISEIRTLMAQTQTEETKILAYAKVNNLAD
FT                   MSDGQAQTVLHLLKDKRNKQIAKAEQSLSQQEQQTAV"
FT   CDS_pept        424593..425216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03740"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BH03740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27185"
FT                   /db_xref="GOA:A0A0H3M2K5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2K5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27185.1"
FT                   /translation="MEQRTAEWFQARLGKVTASNIYNVLSKTAKGTPTSKYEEYKIKLM
FT                   TERLTEEISQSYLTPAMQWGIEHEEDALKEYAIIYDTEVIKCGFIQHPTIEMAGASPDG
FT                   LIGEEGLVEVKCPHSTKHLRFYMDGTIKPEYKAQMQFQMACTGRQWCDFVSYDPHFVGR
FT                   SLRLRMKIKRIHRDEKQIEQINQAVEIFLEEIEQEMKHSQRNTY"
FT   CDS_pept        425245..425736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03750"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BH03750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27186"
FT                   /db_xref="GOA:A0A0H3LXM6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27186.1"
FT                   /translation="MTERLTEEISQSYLTPAMQWGIEHEEDALKEYAIIYDTEVIKCGF
FT                   IQHPTIEMAGASPDGLIGEEGLVEVKCPHSTKHLRFYMDGTIKPEYKAQMQFQMACTGR
FT                   QWCDFVSYDPHFVGRSLRLRMKIKRIHRDEKQIEQINQAVEIFLEEIEQEMKQILTQAA
FT                   "
FT   CDS_pept        425809..426012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03760"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27187"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27187.1"
FT                   /translation="MIFDDGDRYVTTRECAQLFSVSTTTIRNWVLQGVFPKPYKLGRAV
FT                   RWRKKEILAFTPEKNTEQIRTN"
FT   tRNA            complement(426113..426188)
FT                   /locus_tag="BH03770"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:426153..426155,aa:Phe)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        426588..427751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="BH03780"
FT                   /product="Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27188"
FT                   /db_xref="GOA:A0A0H3LWG0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27188.1"
FT                   /translation="MIMLEKPTCRPNNPNFSSGPCSKRPGWTLEVLKNALVGRSHRSRE
FT                   AALRLAEIVDLTREVLEVPSDYRIGIVPASDTGAVEMSLWSLLGERGVDMAAWESFGSG
FT                   WITDVVEKLKLSDVRRFEAPYGELPDLTQMDFDRDVVFTWNGTTSGVRIPNADFIPERR
FT                   AGLTICDATSAAFAQNLDFSKLDVVTFSWQKVLGGEAAHGMLILSPRAVERLESYVPTW
FT                   PMPQIFCLTKDGKLNENIFKGVTINTPSLLCIEDFLDALKWAKAQGGLHALMARVEKNF
FT                   AVLDAFVRKTPWLEYLAKDPQVRSNTSVCLDIVDPVVTALDTEKRVSFIKAIVNRLDEE
FT                   EAAYDIGSYRDAPPGLRIWTGITIEASDLEILTSWLEWAFQVEKAQL"
FT   CDS_pept        428140..429429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BH03790"
FT                   /product="Adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27189"
FT                   /db_xref="GOA:Q6G4G5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27189.1"
FT                   /translation="MANVVVVGTQWGDEGKGKIVDWLSERADIIVRYQGGHNAGHTLVV
FT                   NGVNYKLSLLPSGLVRGKLSIIGNGVVVDPHHFVVELKKLRDQGVKIVPEILRIAENAP
FT                   LILSLHRDLDAIRESGFSGLKIGTTKRGIGPAYEDKVGRRAIRVMDLAEANTLMAKIKR
FT                   LLRHHNALRRGMGVAEIDSQALYDELMQVADEILPFMDCTWRLLDESYRMGKHVLFEGA
FT                   QGALLDNDFGTYPYVTSSNTVAGQACTGSGMGPGAIHYVLGIAKAYTTRVGEGPFPTEQ
FT                   INDIGEFLGIRGHEFGVVTGRKRRCGWFDAVLVRQMVTICGVQGIALTKLDVLDGLDEI
FT                   KVCVGYELDGKRIDYLPSSMGAQSRVKPIYETLEGWKQATAHALKWEDLPVQAIKYIRY
FT                   IEELIGTQVALLSTSPEREDTILITDPFAN"
FT   CDS_pept        429671..431026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03800"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J794"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27190.1"
FT                   /translation="MVDFVGILKKAINAQNNVTPQLRKRIYKRALKTLEHQFVATTIPQ
FT                   AIAEEQRKILQSAIATVEAEYLAVEKELLSSVIGWNPKGITEADKHTQTSVLSQGHESS
FT                   ILGMSDAEPVNMKACFASQHADNTTLRVSPLASPLQGDNPHIVSHIFSQALRRANRSSM
FT                   QRRIVISTAIVTGFFTLIIGICFVGGRVFISNDHQLSGGNVKASHVLPQTLSVKRKLTQ
FT                   RLLEDGSEVDTSLDQTADSSNEEGISTAISSSLQSMEQLGEAVFYQARTDYDTEKVATG
FT                   SARWTLIKESRVKGAPEESAIQGDITIPDKGLSLRLILRRNTDVSFPAAYIMDLIFILS
FT                   DKFSGQAISSVQALTFKASEQSVGQALTRTVTAKICDDFFLVALSSKHPFLNRNLQLMR
FT                   ELDWMRLVLTDKNGRTNELTFAKGPIGESIFNKVIGKWLEEPEKLTVLGQKK"
FT   CDS_pept        complement(431186..432070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH2"
FT                   /locus_tag="BH03810"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH03810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27191"
FT                   /db_xref="GOA:A0A0R4J8Z6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8Z6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27191.1"
FT                   /translation="MAHMNLLSVTTGDGGLSRYLEEVRRFPMLEPQEEYMLAQRYRKHN
FT                   DLKAAHKLVTSHLRLVAKIAVGYRGYGLPIGEVISEGNVGLMKAVKRFEPERGFRLATY
FT                   AIWWIKASIQEYVLRSWSLVKMGTTANQKRLFFNLRKLKSRLQALDNGDLNAEQVKEIA
FT                   IQLNVTEDEVVSMNRRLGGDTSLNAPLRTKEGENSEWQDWLVDDSNNQEQTLIEQNELE
FT                   NRRSMLTNALDNLNEREKRIFKARRLSDIPLTLEELSSEFNISRERVRQIEMRAFEKIQ
FT                   NSIKASALSQNQV"
FT   CDS_pept        complement(432228..433232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="BH03820"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:BH03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27192"
FT                   /db_xref="GOA:A0A0R4J9F2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27192.1"
FT                   /translation="MVTQRITDENALGQRLDQWLAKQYHNVLSRSRLQALIREGYLKVD
FT                   GQLIKEPKTKLKSNQIIELTMPALRDAEPSGEAIALDILFEDDHVIVINKPAGLVVHPG
FT                   NGNWTGTLVNALIHHCGKSLSGIGGVKRPGIVHRLDKNTSGVMVVAKNDLAHKSLSAQF
FT                   FDHGRTSALDRRYHALIWGSPNRNVWTIDAPVGRSPHNRTKQAVVYNQCLHARHAVTHF
FT                   SLLEQYGTCADKTPFASLLECRLETGRTHQIRVHMAHIGHPLVGDTVYGNAFKTKSNTL
FT                   NSIIKNAIDQFNRQALHAANLTFEHPATGKIMSFSSPLPQDMAELIKHLKKIN"
FT   CDS_pept        complement(433266..434696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /locus_tag="BH03830"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27193"
FT                   /db_xref="GOA:A0A0H3M4W2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="PDB:3I44"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4W2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27193.1"
FT                   /translation="MLNKRKFYINGLWDDPSTPHDLYVIDPSTEEACAVISLGSTRDAD
FT                   KAINAAKKAFQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPIDMALNAQT
FT                   ATGSSHIRNFIKAYKEFSFQEALIEGNEQAILHYDAIGVVGLITPWNWPMNQVTLKVIP
FT                   ALLAGCTMVLKPSEIAPLSAMLFAEILDEAALPSGVFNLINGDGANVGSYLSAHPDLGM
FT                   ISFTGSTRAGKDISKNASNTLKRVCLELGGKGANIIFADADIDALQRGVRHCFYNSGQS
FT                   CNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNHIGPVVSKEQYDKIQDLIQSG
FT                   IDEGATLVTGGTGLPMGMERGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEA
FT                   VTLANDTEYGLTNYIQSQDRSKCRRIAAQVRSGMVEVNGHELPGGSYFGGVKFSGRARE
FT                   GGLWGIKEFLDTKAISYW"
FT   CDS_pept        435125..437650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03840"
FT                   /product="Cell division transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27194"
FT                   /db_xref="GOA:A0A0H3LWG6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27194.1"
FT                   /translation="MHNSKTKSISMSSLSNESTKGASEKVSSSKITEIFPYPEVWKKAF
FT                   TLGQNVRFTRTPEVEILRRRIETDPIFAKQFKIFAKQEQKNLTKTIHYNKKTTNLPSTK
FT                   KVMNSRSIENKASICHSTVLEQLSQQTVPMPLEKNAGKHKLQIENVVQKTQPIFYLSDD
FT                   AFFECEAFMLEQVDTKILEENPTSIDFTSDEALLNTATSFDESITALYRVLEYRFPQFY
FT                   NAITSESLEEECQGIEETSDLMHVKNDTVKEVQKCHSEMIVEDSTHTLNDTSATNKLKN
FT                   SNNIGSRIKESVEKNSEDLSLMNAKGKALRSISASLGSYNSVFMPNTQSFDYGNYEFPP
FT                   IDLLQEPVFHEGTVIPQETLERGAGLLESVLEDFGIKGEIIHVHPGPVVTMYEFEPAAG
FT                   VKSSRVINLSDDIARSMSAISTRVAVIPGRNVIGIELPNAVRETVYLRELIQTSSFRES
FT                   QFKLALALGKGINGEPVIAELAKMPHLLVAGTTGSGKSVAINTMILSILYRMTPKQCRL
FT                   IMVDPKMLELSVYDGIPHLLTPVVTDPKKAVTALKWAVREMEERYRKMAKLGVRNIDGF
FT                   NARVALAAQKGETITCTVQSGFDKESGEMLYHEEAMDLTQLPYIVVIVDEMADLMMVAG
FT                   KEIENAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTIL
FT                   GEQGAETLLGQGDMLHMVGGGRIVRVHGPFVSDEEVEAIVAHLKMQGKPDYLATVTDSE
FT                   NDNKEGETADSVAEVSTAENVGEDGEELYMQAVKIVMRDKKCSTSYIQRRLAIGYNKAA
FT                   SLVERMEEKGIVGAANHVGKREILINDLQ"
FT   CDS_pept        439084..440397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27195"
FT                   /db_xref="GOA:A0A0H3LVW2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27195.1"
FT                   /translation="MQEEVQEKRVEDLNTKTSSLSEVERSAFREIAERLRDELDSSVEG
FT                   MHLVEETADELPCAQTLSGNVIEKFLVKEPAAVLSLLDTATDGVLWLNEQGFIQAVSRS
FT                   ALALTGYEINELLAQPLSSLFTLQSRSLVEKYFELIRMKRKNQAFIRGDTADLVTKNYK
FT                   SITVSMTMVFLARQDSYAVILRNMTSVVLPLDKKAEENKMVGVVHEMRTPLNALIGFAE
FT                   IMRDGRFGAIDNERYRGYLRDIISSGRHILSLVNQLLECSKANYLSSNHQNNRSVIAET
FT                   FDVTSCLRASMAFLETQANYNGIIMRIVAPVYVPFICISQQIFRQIIWNLLSNAIRFTP
FT                   SGGQIIVHVSYSKKERVKISVSDNGVGMNDEEILRALQPYGQVERKDGRSGDSVFVGTG
FT                   LGLPMCKAMVEESGGQFLLFSKPNHGTTVEMFFPIFYA"
FT   CDS_pept        complement(440413..440826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BH03860"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:BH03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27196"
FT                   /db_xref="GOA:Q6G4F8"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27196.1"
FT                   /translation="MLKEFKEFALKGNMIDLAIGVIIGGAFGGLVNSIVNDIFMPIIGL
FT                   ITGGIDFSNMFIQLAGEKQATLSAAKAAGATISYGNFITLLINFLIIAWVLFLFVKSMN
FT                   KIRRKQEEEETSKKMSLEQQLLSEIRDLLAKKK"
FT   CDS_pept        441400..442488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="BH03870"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27197"
FT                   /db_xref="GOA:Q6G4F7"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27197.1"
FT                   /translation="MSFFRCIGRSALFMLDPEHAHRLAIMGLKSGLNSYQKVVDNRLCV
FT                   TIAGLKFENFIGLAAGFDKNAEVVNDVFHLGFGFTEIGTVTPRPQVGNPKPRLFRLRKD
FT                   EAIINRMGFNNDGRQIVYGRLHGYKRLGIVGINIGANKDTVDKIDDYITSIAYFYDVAD
FT                   YFTVNISSPNTPGLRDLQVRDSLHLLMNAISQARNEQKKKHGFFVPIFLKIAPDLSEKE
FT                   LDDVAEEMKLSDFDGLIVSNTTLSRQGLRECTLRNEEGGLSGRPLFERSTIVLAKMRQK
FT                   LGKKIAIIGVGGIRDAKTALEKVKAGADLVQLYSGMVYEGPDLAITILKEILQFMQKDG
FT                   VESIKAYRDQRVEYWAKHMLSS"
FT   tRNA            442621..442697
FT                   /locus_tag="BH03880"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:442655..442657,aa:His)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        442876..444303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA1"
FT                   /locus_tag="BH03890"
FT                   /product="Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27198"
FT                   /db_xref="GOA:A0A0R4J6R5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27198.1"
FT                   /translation="MVVKNGKQIKSKGSKLVSDFLKNLRGVDNWEQVSQWLAFRNVEDI
FT                   ECITPDQAGVPRGKMMLSKKFTSKTSLALPSAVFMATISGDYPEDGHGFEYPKTDGDLR
FT                   LEPDLSTLSIVPWEEAPTAQVICDLVYQNGEVVDYTPRNVLRTVIDFYTQMGLKPVVSP
FT                   EIEFYLVQKNPDPDYPLVPPVGRSGRSIGGGQGYSIAGVNEFDDLIDDIYHFSEAQGLE
FT                   IDTLIHEEGAGQFEINLRHGDPIELADQVFMFKRTIREAALKHNMYATFMAKPIQGQPG
FT                   SAMHIHQSVVDKKTGMNIFTQKDGKESVCFRHFIGGLQKHMAGVFVMLAPYVNSYRRLV
FT                   PDLSAPVNLRWGYDNRTTAFRVPRSAPKGRRVENRLPSSDANPYLALAASLVCGLIGLQ
FT                   QKLEPDEPTTKNVNADNIELPRGLIEAVNLFEQDTAVRAILGEVFVSTYAAIKRQEFET
FT                   FMEVISPWEREYLLLNV"
FT   CDS_pept        444315..445598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03900"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27199"
FT                   /db_xref="GOA:A0A0H3LXN2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27199.1"
FT                   /translation="MIEYNSISPEISWYEDTLEERPSYPFFDGQKQCDVVIIGGGFTGL
FT                   SAAYHLSKAGVNVVLCEASRFGDGASGRNGGQLGTGQRQWVETLEKQYGFERSKALFDL
FT                   AEEAKRDILSWCAMPDCQCDFMEGQLSVIHKKREVISYQRHVELMQRYGYYDLSFMDKD
FT                   ETAKRLGSSFYYGGLYDAHTGHINPLKLVVWLAKKAKNAGAKLYEKTKVTAVNRKGSHW
FT                   IVITERGKIMAEHVLLATNAYKLGFQRFVEKNIVSIRSYIGATEPLSKESPILLGGESV
FT                   DDSRFMVRYFRKSVDNRLLFGGVESYDNRHPADLEERIQRQIAEIYPHLKSINLTHCWG
FT                   ATVAITVERMPYVRQLLPGMIYCGGYSGHGVMLAPFMGKLYAEWLTGKHERFAYFQSLK
FT                   ISSFPGGKMLRYPLIFFAMHWFSLMDHF"
FT   CDS_pept        445715..447190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="BH03910"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27200"
FT                   /db_xref="GOA:A0A0R4J6L7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6L7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27200.1"
FT                   /translation="MVSKIIPVSPFDCIVFGGNGDLAARKLIPALYHCQCVGQLSEPTR
FT                   IIGVSRSSLSGEEYQNFVRASLEKYVHPKDLNRIELNRFLARLTYISVDITSNRGWRDL
FT                   ALPLSEDPSDIRVFYLAVGSSLFGDIAMRLGQNGLVTQKTRIIIEKPIGCNVKTAVQLN
FT                   DTFASVFDEDQIFRIDHYLGKETVQNLMALRFVNTLYEPLWNSNYIDHVQITVAESLGL
FT                   EGRIEYYESAGALRDMVQNHMLQLLCLVAMEVPFTNSANAVRDEKLKVLHSLMPLDVRN
FT                   VEQYTVRGQYLSGILDDVCVKSYLDDLGKEVSRSETFVALKIKVDNWRWADTPFYLRTG
FT                   KRMSTRMSEIVIVFKPIPHNIFETDSNEIFSNRLVIRLQPDEGVKQWLMIKDPGPGGIR
FT                   FRHIPLDMSFASTFSQRNPDAYERLLMDVIRGDQTLFMRRDEVEAAWRWIDPILEGWEA
FT                   IKQPVHGYSAGSWGPSASKLLMERDGRIWNNLV"
FT   CDS_pept        447201..447959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="BH03920"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27201"
FT                   /db_xref="GOA:A0A0R4J8A7"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27201.1"
FT                   /translation="MYGINIDHLDFATPTALALALADRVAAELSVSVLERKRAILAVSG
FT                   GKTPELFFHYLSKADIDWENIIITLVDERFVPVHHERSNEHVVRRYLLQNFAAKARFVG
FT                   LYQKAITVELAAFSAASRVNTLPRPFDVVVLGMGVDGHTASFFPDADRLKQALDLQTQA
FT                   LVLPLYAKSALEPRLTLTLPVIMQSRCIILHFEGFQKRDCFEVVCQNGSEMEMPVRAVL
FT                   RNAHHLVQVYWSPKENEISEAEHKTSKVDT"
FT   CDS_pept        448006..449829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="BH03930"
FT                   /product="Phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27202"
FT                   /db_xref="GOA:A0A0R4J8Y2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27202.1"
FT                   /translation="MALSKTIATVTRRICERSAPTREIYLDRIAKAQANHPKRSFLGCA
FT                   NQAHGFAACGSIDKKRLKRNIVGNIGIITAYNDILSAHQPFESFPHLIKETARMFGGVA
FT                   QVAGGVPAMCDGVTQGNTGMELSLFSRDVIAMATAIGLSHDMFDAALYLGVCDKIVPGL
FT                   VIGALTFGHLPGIFVPAGPMTSGQGNDEKAKIRQLYAENKIDRQTLLESEARSYHGPGT
FT                   CTFYGTANSNQVILEMMGLHMPGSSFINANTPLRDALTKEATKRVLEMIALGDSYSPIG
FT                   LIVDERSFVNAVVGLNATGGSTNHAIHLIAMAAAAGILLTWHDIAEISSVVPLLARIYP
FT                   NGLADINHFHAAGGMGFVIRELIEAGLVHEDVCTVFGKDLNAYAIEAKLCNDDNVVREP
FT                   ALNESANHKVLTGWRKPFQSDGGIRILLGDLGTAIMKVSSVKSEYWRIEAPVLVFNDQE
FT                   ELQEAFKAGVLNDKDFIAVIRYQGPKANGMPELHKLTTILGVLQDRGQKVALVTDGRMS
FT                   GASGKIPAAIHVTPEALDDGPIARLQNGDVVCLDAHVGKLAILEDKVEFNARKITLPDL
FT                   SKNEYGVGRELFRIFRHSVNRADQGASVLIA"
FT   CDS_pept        complement(449886..450785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BH03940"
FT                   /product="Methylenetetrahydrofolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27203"
FT                   /db_xref="GOA:Q6G4F1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27203.1"
FT                   /translation="MNNIIDGKKLAEKIIMKVKAETTKLRNNYKIQPGIAVIIVGNDPA
FT                   SQVYVTSKSKKAEECGFFSIKHMISKETQEKELLHLIATLNSDPQIHGILVQLPLPDHI
FT                   NTNRITQAIAFQKDVDGFHYINIGKLAANALEDAIIPCTPAGAMMMIEQQCGQDLSGLD
FT                   AVVVGRSNIVGKPMAALLTAANATVTIAHSRTRDLDDVCRSADILVTAIGRPQMIKKDW
FT                   VKNGAIIIDVGINRIAAPEKGVGKTRLVGDVDFEEIKEKAAAITPVPGGVGPMTIAMLM
FT                   VNTLKAAARLHNLPIPKF"
FT   CDS_pept        451106..452980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27204"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2M4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27204.1"
FT                   /translation="MRARIIKFLSGIFITIVVLFEVGILILPYLVSTDTIRIRLAQDLS
FT                   VWTGYNVELRDPPRLNIFPYPKAYLSGITLISKMNNAAPLMEAESIEVDLSLVDLLSGH
FT                   ISFSETRIVRPQFVMEKPVKTVADFFARFSRSRGALGLAIRNAREILKHNPDKPDTKRL
FT                   LKQPFGRIVIENGILVYHDSISGIAEKITGLNAVLDWPESTQEARFHADARWRGELTKL
FT                   SINADQALLLLAGGKSQVKASLNSVRGGITFIGQARFSEYYVFDGKVSMRSPGWNQTLA
FT                   WIGDNQFWGHQLKEPIVWESRFVAQPMHIQMDNVAFTMGTANARGALEVDFQDYVPIII
FT                   GSLAFDNLDFDLLRSVFSSVKEKNQFLDMADRIGVDVRLSAPQAKVGNVVLTDLAAAIQ
FT                   IKNGHGIFDLGHANVFGGALQSNIQITSVGQKMQLEGRVSGTSIDTKVAAEVLGIRPFA
FT                   QSKTNFIMTVKTLASSWSEIFAKMQGELTLNMFSGRLLGYDLNDLPTRLFKKEQFLLVN
FT                   HDSLSTIFNRWDIQTRFSDGTITVIESLMHTADWSLSIQGAIAASIAQDQQNELILQAQ
FT                   LRKNNISETLCRDVECLANSLAWPFSFSLSSKGQEHGNFWVKKDIDTD"
FT   CDS_pept        453436..454179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27205"
FT                   /db_xref="GOA:A0A0R4J925"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J925"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27205.1"
FT                   /translation="MRINYKLKRLFIRQPLVINEKIKIEGPQAFYIVHVLRMQEGAEIL
FT                   LFNGQDGEWLAKLITIKKKFVVVQLIHQERFQTALSNLIYCFAPLKTARLDYMVQKAVE
FT                   MGVSVLQPVITHHTQVTRINMARMESNVVEASEQCGILSLPECVPAVSLAELLARWDET
FT                   QPLFFCDETHKSHNPLPLFKKREMLAPGILIGPEGGFSQEERSFLKKHPFVISIPLGPR
FT                   ILRADTAAVAALALLNATIGDWSID"
FT   CDS_pept        454248..455621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="BH03970"
FT                   /product="Glutamate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BH03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27206"
FT                   /db_xref="GOA:A0A0H3M4X3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27206.1"
FT                   /translation="MALDITDESEIYNLDSLVSYSQGGCKAEHDWRIGTEHEKFPFYRG
FT                   DFRPVPYEGSRGIRALLEGMQKALGWEPILDEGNIIGLVGSVGQGAISLEPGGQFELSG
FT                   ALLKTIGDTYCEVIEHLALLKKISEPLGIGFLGIGASPKWTLTETPRMPKSRYRIMANY
FT                   MPKVGHSGLDMMYRTSTVQVNLDFSSETDMRRKMQVSMKLQSIATALFASSPFTEGRPN
FT                   GFLSWRSEIWCDTDNQRTGVLPFIFSERFGFADYVEWALDVPMYFVVRDGRYYDCTHIT
FT                   FRQFMNGALRGQVANATPNMGDWINHLSTLFPEVRLKRFLEMRGADCGSLKRICALSAF
FT                   WVGILYDSEALNEAEALTKDWCFEEVLDMRKRVPKEGLKTPFRQTIILEIARQAVAISH
FT                   KGLKNRRQYASNGLDETSFLAPLEEVIAMGQTDADKFLSLYHSIWDKSVEPVFLECVY"
FT   CDS_pept        456438..457793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03980"
FT                   /product="Sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH03980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27207"
FT                   /db_xref="GOA:A0A0H3LWH8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27207.1"
FT                   /translation="MAFNFFINLFLFVIFLLWLGQSKRMKWSLSLRVMLGLILGLIFGS
FT                   VLQVIYGEGEATLLKSIEWFNIVGNGYILLLQMIVMPLVFISIVSAIAHLHSVYAIGKM
FT                   SIMTISILLFTTALSALVGVLVVNAFGLTTSGLVNEGQDVSNILGDRISQLGDMNIPKM
FT                   ILSLIPKNPFAELSGAKRTSIISVVIFASFLGAAVLLLKKDEPDKGEKALLFIQVAQSW
FT                   IMRLVRIVIALTPYGIFALMTKVGASSHVADILNLLVFIIASYVGIILIFGIHGVLLGI
FT                   SGINPFRFFKKVLPVLTFAFSSRSSAASIPLNIEAQTQWIGVPQSIASFAASFGATIGQ
FT                   NGCAGLYPAMLATMIAPSMGINPFDPTWIAALVGVVTLSSIGVAGVGGGAIFAALIVLP
FT                   IMGLPVSLVAVLMSIEPFIDMGRTALNVNDSMLAGTITSQMLQTTDRSIFEK"
FT   CDS_pept        complement(457809..458594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27208"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27208.1"
FT                   /translation="MAEDLYKRLNTVDRLFTLALDLHSHTDLAAQTLMKSGKVHSIERV
FT                   ETDMLYQNHDKKFHLRSREFLDFPQNYCDLIVSLLSLQLTNDTPGVLSQIKNILKPDGL
FT                   FLAVMAGVGTLSELRECLLQAEIEIYGGASPRIYPFADIRAVGALLQRVGFALPVADIE
FT                   DVTIRYDTMFDLINDLRAMGMQNALINRSRRPVSKRFFLRAAEIYAKRFSDLDGRIRAH
FT                   FSFIWLSGWAPHPNQQKPIQPGSAQISLADVLVKQSKKT"
FT   CDS_pept        458876..459664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="BH04000"
FT                   /product="Competence protein comF"
FT                   /db_xref="EnsemblGenomes-Gn:BH04000"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27209"
FT                   /db_xref="GOA:A0A0R4J7Q8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27209.1"
FT                   /translation="MMLCFQEVALNGGNILSKFTERLLTILYPPICPGCKQRVSAYGTI
FT                   CSECWKDLQFITKPYCPVMGVPFVYDMGDGFLSGEALQNSLPFSRVRSVIVHKGVAQSL
FT                   VTRLKYGDHVELASFMANWMVSAGREIVDDCDIIISVPLHFRRFLKRRYNQSAELARYI
FT                   ARVQKKEFKPGWLVRCRHTRPQVNLSARERKLNVLNAFEVPRKVKKYLKGRSILLIDDV
FT                   FTTGATVTAAAATLKRAGARQVDVLTFSRVLKEASIFPNS"
FT   CDS_pept        459712..459969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BH04010"
FT                   /product="Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BH04010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27210"
FT                   /db_xref="GOA:A0A0H3LXP0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2KLX"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27210.1"
FT                   /translation="MKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQR
FT                   ANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSLLQDVH"
FT   CDS_pept        complement(459992..460735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="BH04020"
FT                   /product="3-demethylubiquinone-93-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27211"
FT                   /db_xref="GOA:Q6G5K3"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27211.1"
FT                   /translation="MINETRTTLDQSEVDHFSRIAAEWWNPHGKFRPLHQFNPTRLAYI
FT                   REKICLELHRDPVSLKPFENLKILDIGCGGGLLCEPMARLGAMVVGADASQTNIEVAKI
FT                   HAAQNGLSIDYRTTTAEALATEGEQFDIILNMEVVEHVADVNLFIEATAKMLKPQGLMF
FT                   ISTLNRTWKAWGLAIIGAEYILRWLPKGTHNYKKFLKPRELKNLLLQNALTVVDEIGVT
FT                   YNPLNDSWNRSKDMNVNYLLLAKKS"
FT   CDS_pept        460929..462185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="BH04030"
FT                   /product="Aspartokinase, alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BH04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27212"
FT                   /db_xref="GOA:A0A0H3M4X8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27212.1"
FT                   /translation="MARIVMKFGGTSVANIERIYNVAQHVKREVDAGNEVAVVVSAMAG
FT                   KTNELVQWTCDASPIHKDAYEYDVVVASGEQVTAGLLALTLQEMGVNARSWLGWQIPIH
FT                   TDSAHGSARITDIDGSFLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAMAA
FT                   AIQADRCDIYTDVDGVYTTDPRVEPKARRLPKVAFEEMLEMASLGAKVLQVRSVELAMV
FT                   HNVRTFVRSSFEDPNALGMGDPMNSSGTLICDEDEIVEQQNVTGIAFAKDEAQISLRRL
FT                   ADRPGISAAIFGPLAEARINVDMIVQNISEDGSKTDMTFTVPSADVDKAVALLEKNRKE
FT                   IGFDVIQSESGLAKISVIGVGMRSHAGVAATAFRALAEKGINIQAITTSEIKISILIDS
FT                   VYTELAVRTLHAVYGLDKG"
FT   CDS_pept        complement(463108..464469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="BH04040"
FT                   /product="Na+/H antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH04040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27213"
FT                   /db_xref="GOA:Q6G5K1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27213.1"
FT                   /translation="MSDLSSNRLPNRASRVTNQALSAIERFLHIEALSGVVLLLAAAAA
FT                   LMFANSEYASLYESFWHTPLGFNFGHFTLSWDLHFWVNDALMAVFFLVAGMEIRREIHE
FT                   GALADFKQAILPIVAAIGGVCLPAIIYFSFNFNSGQIHGWAVPTATDIAFALGILALLG
FT                   KKIPSNLHIILLSLAIIDDIIAVLIIAFFYSTNIDPSGLVIAIAGIALVLFFQWIGFAS
FT                   AWLYILPGAIIWWGLMVTGIHPSLAGVILGMMTPVLPTRTLIAPLTILSNAMQILQEKN
FT                   TKTDLHHISTALKKMRKGQRDIIAPVTRIQKALHPWVAYGVMPIFAFANAGVSFANFDL
FT                   SSDKSFLIVLGVVIGLFIGKPLGIITASYLAVKSGLCRLPPQMTWAGILLIGFLAGIGF
FT                   TMSIFVSMLAFKDIVLLDSAKIGVLCGSGLSALIGLGYGLIYIKRNKKASHSSQ"
FT   CDS_pept        complement(464624..466312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27214.1"
FT                   /translation="MINLNSGYRSNLKHWLTLIIGFFAILAIIFVGGFYMAKPYLDSFV
FT                   KQEIARRSIKAKTSEVSIIGKVNLTNVTLPVPAGISLKIGAISARPPLFFIPGTFTLYN
FT                   VDLKRHNIHLQIPKISFNSVSLKEKDKTITSRLLQQIMRLQFASMIAPDISLSVKNENK
FT                   LTGKFEIKGFQLSHFKNGRIGSVSIKNMGLATITANGTKQMLNVKSNTIKAQDIDINYA
FT                   HSIIFGKRNVLNQGKTIIGPISLENVMVNVFEEKEKNISFSLGKFKTSGLKMKPFKQTP
FT                   ERLVEAYLNARKENNQEAEKITENAIILNTLLATTSIDAKIDNVTIDIPQLKATLASFQ
FT                   FKPSQWEQPIPKKLLLSLDNLSIVPKKMNEKDLEFLQNMDVERLDLSGKLNISYDEKRH
FT                   TLLLNPMSFNIKNIGSGEISAKAIDVDTKLFSGQKEAITAVSQNFGITEIDVRYTDAGF
FT                   IDKLFSYLAQNLNDSKHDLKKELYDDFYIMMTQSPRIFLKNHEKAESIAKSFGDFAKNP
FT                   QTLIIKITAKDNKGLTIADLETALQNDLSTALSKVNLTVKNESSP"
FT   CDS_pept        466679..468451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27215"
FT                   /db_xref="GOA:A0A0H3LVX5"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27215.1"
FT                   /translation="MTENQIMAFPIIGLMMIFFIWDRFRYDLIAICTLLIACIVGLVSP
FT                   KEAFSGFSNDIVIIVGSVFVVSTAVSRSGIMEFIIQRIWPEVKSVRLQLAFLVISVVLL
FT                   SMFVKNIGALAIMLPIAFQFARRSQVSPSVFLMPMAFGSLLGGLMTQIGTSPNVVISAM
FT                   RERLSGAPFTMFDFTPVGAAVATAGVLYLVFFSWRLPVRVRSGVSFDDAIDIRNYVLEV
FT                   HIPANSPIVGKTIVDLVKPSGGDVMVVQIIRNKISISPLPDFVLSENDIVLLEGSHTGL
FT                   DSVMSAARLEFATDRTISTGDKDSDINIVEAVITHNSPLIGVSARGFSLFDRYNVNLLA
FT                   LSRQHERVRGRLGDIDFHLGDVIVLQGQDAVIPNLLRELKCLPLAKRNIVFGNLRHGFV
FT                   SLAILFIAIIFTAFQIVPVAFSFFSAAAAMVIFRVFPARDLYQALDGQILVLLAVLIPV
FT                   SEALEKTGCTDLIGQWLSQLAVFFPPSGALALMLITAMLVTPFLNNAATVMMVAPISSS
FT                   FAHSLHYKPEAFLMAVAIGAGCEFLTPIGHQSNMLVMAPGGYRFSDYPRFGAPLAVLII
FT                   IVAVPMLMWIWPLQ"
FT   CDS_pept        469115..469786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27216"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27216.1"
FT                   /translation="MSYDSFISEVNAEFRQEKALAFWRRYGLWVVFAAIIFVLMIVIYQ
FT                   IYHHVQMKKAGHIGDAFIEVLDFADTRHFDEAMKRLEDVKASNFGGYPFLARLREASLL
FT                   MEQGDAVKSVEVFDSIAADEKAPPILRAVAKIRAAYILVDTGSLDDVKKRVKDMANDLG
FT                   SMRMSAREALGLAAYKADKMDEAVDYFRKISKEGALGSKITERARIMLELMQAEGKANR
FT                   E"
FT   CDS_pept        469791..471218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04080"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27217"
FT                   /db_xref="GOA:Q6G5J7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27217.1"
FT                   /translation="MSLTIAIVGRPNVGKSTLFNRLVGQKLALVDDKPGVTRDRRVHAA
FT                   TLQDLRFDVIDTAGLEETGDHTLEGRMRAHTKAAIDEADLILFVFDAKSGITPSDLNFA
FT                   SLVRKSGKPIVLVANKSESKAAIGGEYEAWSLGLGEPCSISAEHGLGLSDLRDAIMKAS
FT                   GGERIFASKNQEEHIALQSASLDDYIDNLEEKGDVYDKSKPLRIAVAGRPNTGKSTLIN
FT                   RMLGQDRLLTGPEAGLTRDSISVDWEWRGRHIKLFDTAGLRRKSKIQEKLEKLSVADTL
FT                   RAIRFAEVVVIVFDATTPFEKQDLQIADLVIREGRVPLIAFNKWDLIENSQATLVDLHE
FT                   KCIRLLPQVRGLRAVPLSGQYGQGIDKLMENVMMMHRVWNRRISTGKLNRWLETIVAHH
FT                   PPPAVLGRRLKVKYVTQVKTRPPGFVFSCSRPKLMPQSYLRYLSNELRNTFDMPGIPIR
FT                   ISLRASDNPFATRSKKK"
FT   CDS_pept        472259..472571
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH04090"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        472793..473218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27219"
FT                   /db_xref="GOA:A0A0H3LXP2"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27219.1"
FT                   /translation="MAKDNEPVVPKEEADGKKQEDCFNSEDLECRSQNLGLALMRKKAL
FT                   KKRGYRKEGGEPQGTMARAIKLSSEFLASIIVGVVLGLGFDQLAGSLPWGLVFFLFLGF
FT                   AAGVLSILRSVGYIAFSQLGQKGASRQDKGADKRSDK"
FT   CDS_pept        473226..473984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ATPB"
FT                   /locus_tag="BH04110"
FT                   /product="ATP synthase A chain transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27220"
FT                   /db_xref="GOA:Q6G5L2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5L2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27220.1"
FT                   /translation="MTSHAPDPVHQFEVSRLINISIGNMDLSFTNVSFFIVATVVVSSV
FT                   FLFISSSSRGLVPTRMQSVSEMAYEFVASTLRESSGVQGMQFFPLVFSLFTFILVANFI
FT                   GLFPYFYTITSQIMITFSLAMLVIFTVISYGFYKHGVGFLKLFVPSGVPVLILPLVTMI
FT                   EVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAIT
FT                   ALEFLVAFLQAYVFTVLTCMYLNDAVHPGH"
FT   CDS_pept        474043..474273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ATPE"
FT                   /locus_tag="BH04120"
FT                   /product="ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BH04120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27221"
FT                   /db_xref="GOA:A0A0R4J7P1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27221.1"
FT                   /translation="MELVLAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAAD
FT                   SQFGRLVFGFAVTEALGIFSLLVALLLLFAV"
FT   CDS_pept        474416..474982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ATPF1"
FT                   /locus_tag="BH04130"
FT                   /product="ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27222"
FT                   /db_xref="GOA:Q6G5L0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27222.1"
FT                   /translation="MFISSAYAQNTETSLEHIKNVAERIDRVFPPFDFVHFGSHLFWLA
FT                   ISFGLFYLFISRVIVPRIGGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLAQARS
FT                   QAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQIAKIRDKAMKSVGSIAEEVAL
FT                   EIVKKLIDVEVSKESVRSAVKATGY"
FT   CDS_pept        474995..475489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ATPF2"
FT                   /locus_tag="BH04140"
FT                   /product="ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH04140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27223"
FT                   /db_xref="GOA:Q6G5K9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27223.1"
FT                   /translation="MTDTFWAFVGLVLFLALLVYFEVPEMVLRHLDTRAKRIKDELDEA
FT                   LRLREEAQEVLAEYQRKHAEAEKDAQEIIAAAKREVEAVISEARIKAEEYVKNRNKLAE
FT                   QKIAQAEADAIRMVSSSAIDLAVSAARVLIEKELDSHKANELIKESLVQESLTKMKTYL
FT                   N"
FT   CDS_pept        complement(476176..478398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BH04150"
FT                   /product="Glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH04150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27224"
FT                   /db_xref="GOA:A0A0H3LWI8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27224.1"
FT                   /translation="MSDLLLELFSEEIPARMQRKAAADLKKSVTDQLVNAGLTYKAAHE
FT                   YWTPRRLTLNIRGLSIRSKDTHEERKGPSTKSPQHVIDGFLRATGLSDISKAHIAHDHK
FT                   KGDFYIAKIVKKGRSAEEIIADILPDIIRNFPWPKSMRWGKDSEKSGALKWIRSLQNIL
FT                   CVFGPEIGETHVIPFTIGSLKSNNLTYGHRFLSDGKPLQVRRFDDYVTQLEIHKVILDA
FT                   ERRKNIILADAQNLCFANGLELVKDNALLEEVVGLIEWPVVLMGNFDKSFLNIPPEIIR
FT                   LTIRANQKCFVTRKQGEKIKLSHHFILVSNILASDEGKEISKGNSKVVCARLSDALYFW
FT                   QTDQHDLPDIKYLQSSAKKLDLDLKKPLDQRMAQLDHLNVTFHAKLGTQGARVERITIL
FT                   AQQIAPLVHADPFLAKRAAVLAKADLQTEIVGEFPELQGLMGRKYALLQGEDPRVAEAI
FT                   EDHYKPQGPADRIPQEPLAIAVALADKIDMLVGFWLINEKPSSSKDPYALRRAVLGVIR
FT                   LVLLRDWKINLMPLFNLTANLFLQQKTPYGTSRREATQSQNVLPEKTEHILSDLLSFFH
FT                   ERLKIYLKEEGARYDVLEAVLKKDADDLLLIARHVEALIAFINTSDGDSFLAAVKRTVN
FT                   ILEAESQKDSTIEDEINPELFIETEEKQLYQAITEIEKTVHHSINATNLPHLLNTLTPL
FT                   GKFIDTFFEKVLVNDKNPHVRTNRLALLKRIHTLTQKAADFSKLVV"
FT   CDS_pept        complement(478391..479344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="BH04160"
FT                   /product="Glycyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH04160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27225"
FT                   /db_xref="GOA:A0A0R4J833"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J833"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27225.1"
FT                   /translation="MKLPEYLNPTRSFQGLILTLQNYWAHYGCAILQPYDMEVGAGTFH
FT                   PATTLRSLGPRPWKVAYVQPSRRPTDGRYGQNPNRLQHYYQFQVLLKPSPPNLQDLYIK
FT                   SLQAIGLDTMLHDIRFVEDDWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECVPV
FT                   SGEITYGLERLAMYIQGVDNVYDLNFNGLEEENQISYRDIFLQAEQEYSHYNFEFADTK
FT                   LLHQHFIDAERECIALLGAGKPNKENSSHLCVFPAYDQCIKASHIFNLLQARGVISVTE
FT                   RQSYILRVRDLARRCGEAFLLTEAGKIHTNGEKTNV"
FT   CDS_pept        complement(479446..481140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27226"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27226.1"
FT                   /translation="MRSVTVSGFLTLIISGIMLIPSPAYSKIDTTLNTSSFIGAYLAGR
FT                   VANHENKTDLAIKYFKKALTYKPENIETQVEMLEAMLFSGAFKEAVKQAQKLKKQGITN
FT                   PFVSLTLSIESLIKKDYNKAKILLQLKTLPAANNPIPELIGAWATFGSGYQSQAITHLQ
FT                   KIQGPAWYKLFINYHLALMCDLAGHKQNAQKYFTQALNTQQATLIAPNTYEHIIIAYAS
FT                   FQLRSKMRIQALQTLKHGEQMLPGREIFKNIREKIEKGASLERLIKTPQQGTGEVLYNF
FT                   GTTLNHKNSQRIARIFTQLSLILSPENDAIMFHLANISAKVNDLNQAIKLYRSLPQSSP
FT                   YYRVGQLQLAFILANNNNHSEAIKLLTSLKKKNPNDRHILITLSALYMQDNKFTEATKT
FT                   LDRAIAQITNFQQDDWKLFYQRGIAFERLQQWSKAENDLRKALDFFPNQPQVLNYLGYS
FT                   LVERGEKLEESLHMLQKASTLQPQNSHILDSLGWAYYKLKQYNQAVQILGNAVRLQPED
FT                   PTLNDHLGDVYWRVGRKREAMFQWNHAIDGEAKNSKEIQEKLKFGLQ"
FT   CDS_pept        complement(481232..482302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="BH04180"
FT                   /product="Octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27227"
FT                   /db_xref="GOA:A0A0H3LXP6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27227.1"
FT                   /translation="MLWIKFIYVHYNTLGVKILRAAIKSDQIKNNPISLQSLVNLTKDD
FT                   MEHVNQCIFSMAKSDVEIIPEISNHLISSGGKRLRPMLTLASARMFGYQNDGHIKLATA
FT                   VEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASILVGDFLLGQAFKMMVDVGSIEA
FT                   LSVLANAAAIIAEGEVMQLSATKNIETSISDYLKIINAKTAALFSAAAEVGPIIAGYGH
FT                   EERLALREYGTFLGLAFQLIDDALDYGGTAKYLGKNIGDDFREGKITMPVILAYARSNA
FT                   VEKTFWKQALENGNSNDETFAHAQHLIEKYDSLTDTIEQARSYGKNATHALAAISESPI
FT                   HNALIETVDFCIARVN"
FT   CDS_pept        482501..483292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27228"
FT                   /db_xref="GOA:A0A0R4J6M0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27228.1"
FT                   /translation="MNKTKNYSDETIDAFHRGKFYLVQPRLCGHRSGMDAMLLASLVPN
FT                   NFKGKVVDLGAGAGAVGLAVAARCLDVHVTLVERSAFMVSYAQKTLMLKQNENLSKRVC
FT                   LLKADVTLKGRSRLEAGLVDNAFDFAIMNPPFNNPVDRKTPDEKKFEAHVMPESMFDDW
FT                   LRSAAAIVKPGGYLGLIARPQSLTDILCALEGRFGNICVIPIHARTEKAAIRVLFYAKR
FT                   GSRAALSLLRPLVIHEDGCHIFSPKIDAINNGHISLWELLK"
FT   CDS_pept        483450..484301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="BH04200"
FT                   /product="Protease sohB"
FT                   /db_xref="EnsemblGenomes-Gn:BH04200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27229"
FT                   /db_xref="GOA:A0A0R4J8I6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8I6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27229.1"
FT                   /translation="MVNFIKNFIPHRFYSSKTEIPVVRLHGAIIDSSSSIARTLSLGRC
FT                   ANLLDKAFAYKKAPAVAVIINSPGGSPVQSRLIFKRIRDLAEEKKKQVLMFIEDIAASG
FT                   GYMIACAGDEIFADPSSIVGSIGVVSASFGFPELLKKIGIERRVYTAGKNKVTLDPFQP
FT                   EKKTDIEHLKSLQLEVHKTFIDLVKERRAEKLSNDPNIFTGMFWSGKKSVELGLIDGLN
FT                   DVRSVIKERFGDDTKLRLIIPPKSLFGPKTPSGVTAHAVHTAIDSALMVAQERALWQYY
FT                   GL"
FT   CDS_pept        484560..485468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB1"
FT                   /locus_tag="BH04210"
FT                   /product="Isopentenyl monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27230"
FT                   /db_xref="GOA:Q6G4E4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27230.1"
FT                   /translation="MISNGQAFFQAPSYLFTPIKLNLALHVVGQRADGYHLIESLVYFS
FT                   LSGDCLSCTPFGSNRFVLTGPFADELVSDAENLVVRAHDFMCNTFPECAKPAFFQLVKL
FT                   LPVASGVGGGSGNAAGVLSLLRQQWALDCSCEKLAEMSLVLGADVPMCLFALEYQQPLF
FT                   VKGIGQDITRLKEACSLAMVLVNHGQQIATKTVFKALEKRDHPPLKIDSAALKTVDSLV
FT                   EALQETRNDLFVPALKIAPQLSEVLCALDESGALFSRMSGTGATCFGIFKDKQAAQQAA
FT                   LFIKAMYPDWFVKPIVTLAKL"
FT   CDS_pept        485675..486634
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH04220"
FT                   /product="integrase-recombinase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        487066..487737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BH04230"
FT                   /product="Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:BH04230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27232"
FT                   /db_xref="GOA:Q6G4E3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27232.1"
FT                   /translation="MSHRIDNLPNVFNLPFKPNFACELDLQKQGFLYIAGVDEVGRGPL
FT                   AGPVVTAAVILDKNRIPDGLNDSKKLSAQRRYELYHEILQSALAISIASLCARTIDQSD
FT                   IRKATLEAMRRCIRGLAVPAHYALVDGRDIPFQLPCPATALIKGDQRSVSIAAASIIAK
FT                   VTRDQMMECAGQVYKGYGLEKHVGYATLAHRAALEKYGPVVGLHRYSFAPLKKRYRDYM
FT                   S"
FT   CDS_pept        487734..488696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27233"
FT                   /db_xref="GOA:A0A0H3LVY4"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27233.1"
FT                   /translation="MTILPFNSASVKEAVALLEQGRLVALPTETVYGLAGDATNGNAIA
FT                   SIFLTKRRPKFNPLIAHVSSIFMAERYVEIDFLSRHLMEVFWPGPLTFVLPLKAQHNIH
FT                   PLTTSGLNTLAVRFPDSFFAEVVKCFGRPLAAPSANQSGHLSPTSAEAVWASLGESVPL
FT                   ILDGGFSKIGLESTIIKVSDENIYLLRPGGIAAEDIEEVAGKSLKRIDQRAAIEAPGML
FT                   KSHYAPNAAVRLNVQKVEHGEALLAFGIKRIMGVENAVSVLNLSESGQLEEAAFHLFQY
FT                   MRQLDSLKVRSIAVEPIPSYGLGEAINDRLIRAAAPKGK"
FT   CDS_pept        488699..490108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04250"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27234"
FT                   /db_xref="GOA:A0A0R4J9J4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27234.1"
FT                   /translation="MERELIERFRKIVGAAHAITDQALIAPYLLEERGLFHGRTPLLLR
FT                   PASTVEVSSIMKLASQTRTPIVPQGGNTGLVGGQQPDKNGCSVLLSMERLNKIRCINLE
FT                   GDFAVVEAGVILQTLQKKVDESGRFFPLSLASEGSCQIGGNLSSNAGGTAVLAYGNMRE
FT                   LCLGLEVVLPDGRILEDLRFVKKDNSGYDLKNLFIGAEGTLGVITAAVLKLFPKIKGKA
FT                   VAFVGLHSPGKALEFLSLAQCQGGGMLTGFELMGKLSLQMALKYKMCERHLFEHEHEWY
FT                   VLLNISSLQGNDEALSVLSTILEQSLKDAVIEDAIIAQSLKQQDFFWKLRESISYAQKL
FT                   AGGSIKHDIAVPLASIPDFISEAALIVEDIAPGARVVCFGHMGDGNLHYNVTQPVGSDT
FT                   ATFLQLWSPMNHRIHGLVMRYQGTFSAEHGIGQLKREELRTFKSPVALDIMQKIKKTLD
FT                   PLGIMNPGKIL"
FT   CDS_pept        490259..490783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9E7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27235.1"
FT                   /translation="MANQCFNQAKAVLEFRLDPCHLPQTTTYFSSKTGNQMICSLSERG
FT                   VFFKTDTFSSLSRLVPSYQFKGIAARTVITLSGEKAVALELLHANEESCVPLLVSRDLN
FT                   NVLLDWRLWADTYSLPMLMINEDNRLVVVKDRSDLRRFFSTTLHFRKKRFLLRYRNPLG
FT                   LRLMIANQVAL"
FT   CDS_pept        complement(491381..492664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BH04270"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27236"
FT                   /db_xref="GOA:A0A0H3M4Z7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M4Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27236.1"
FT                   /translation="MNILLIGSGGREHALAWKIAASPMLTKLYCAPGNPATIELGENID
FT                   LDINDHHLVIDFCKTHSIDLVIVGPEAPLVAGITDSLNNANICVFGPTQKAAQLEGSKA
FT                   FTKDLCRKNNIPTGTYQCFNDAEKAKAYIRQQGVPIVIKADGLAAGKGVVVAMTMEEAF
FT                   NAVDACFKSAFGDAGNKIVVESFLEGEEASFFCLCDGKIAIPFGSAQDHKRVGDGDTGA
FT                   NTGGMGAYSPAPIMTQEMVNRTLNEIVEPVLHSLNQMGSPFKGILFVGLMITKKGPELI
FT                   EFNVRFGDPECQVLMMRLQNDILPILLAAARGNLENTSLQWSKKTALTVVMAAKGYPDS
FT                   PQKGTVIRNVDKVNALPDVKVFQAATVLHNGELIANGGRVLNITATGETILQAQKRAYE
FT                   AVDFIDWPEGFVRRDIGWRAVARENSIL"
FT   CDS_pept        492756..493760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="BH04280"
FT                   /product="4-hydroxybenzoate-octaprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27237"
FT                   /db_xref="GOA:A0A0R4J7R5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27237.1"
FT                   /translation="MKKSKNITHIQSCENQGRVMDASSKQWVYHFLPCSLWFYAQLARW
FT                   DRPIGWQLLMWPCFWSTTMAFLSHEMQRVPLLPMLMNWLWYLFLFFLGSIAMRGAGCTW
FT                   NDLIDHKIDSQVERTRSRPLPTGHVSRFQAKVFILVQCLVGLGVLSQFNRFSFFLGISS
FT                   LVAVALYPFMKRVTYWPQFFLGVAFNWGALMGWAGICGSLSWAPILLYVGSILWTIGYD
FT                   TIYAHQDKEDDATVGVLSTALLFGKGTKCALVCLYSGFLVFVSLAFYLAQVPLISFFGL
FT                   FVASIHMFIQIKVIDIDDSSQCLKLFKSNSFIGFVIFVGLVCGGIGRIFYPIV"
FT   CDS_pept        complement(494469..495092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="BH04290"
FT                   /product="Pyridoxamine 5 prime-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27238"
FT                   /db_xref="GOA:Q6G4D7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27238.1"
FT                   /translation="MGNTVQTDNDFMQMQKPFALFAKWLEEATVSEINDPNAMALATVD
FT                   KTGFPNVRMVLLKDFSPQGFVFYTNYESPKGQEILKSMKASLVFHWKSLRRQVRIRGIV
FT                   EKVTPQEADAYFQSRPRDSRIGAWASKQSQPLESRFVLEKAIARYTTRYAVGNIPRPPY
FT                   WSGFRVKPLSIEFWCDRPFRLHDRLLFTRDSVEHVDWKRQKLYP"
FT   CDS_pept        495410..496312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ2"
FT                   /locus_tag="BH04300"
FT                   /product="heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BH04300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27239"
FT                   /db_xref="GOA:A0A0H3LVY8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27239.1"
FT                   /translation="MRDPYTILGVARTAKPQEIKSAFRKLAKKYHPDHNVDDAKAKEKF
FT                   SEINQAYEIIGNKDKKAQFDRGEIDMEGKPLYQTYGAGENFSNRHNPFSGGAKGFNFGS
FT                   SGGAGFDPNDIFRDLFGRGGGFSNSAHYNRPQQGAHIRANLTVTLEQMVGVEKVEAVFP
FT                   SGKKLKIKLPDYVEDGQTIRLKGQGEEVAYGQAGDALVTIHIQKHPRLRVEGRALHLDL
FT                   PVPLRHAVLGAKEEVETLEGRVVLTIPAWSSSDRVLRLKGKGLRLKNGNRDDLYVHVRI
FT                   MLPEGGDSALEQFLQMQKG"
FT   CDS_pept        496423..497241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI2"
FT                   /locus_tag="BH04310"
FT                   /product="Enoyl-[acyl-carrier-protein ] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27240"
FT                   /db_xref="GOA:A0A0H3M2Q2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4EIT"
FT                   /db_xref="PDB:5TF4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27240.1"
FT                   /translation="MAKGNGLLYGKRGLILGLANNRSIAWGIAKTASSAGAELAFTYQG
FT                   EAMKKRVEPLAEEVKGFVCGHCDVSDSASIDAVFNTIEKKWGKLDFLVHAIGFSDKEEL
FT                   SGRYVDISESNFMMTMNISVYSLTALTKRAEKLMSDGGSILTLTYYGAEKVVPNYNVMG
FT                   VAKAALEASVKYLAVDLGPKHIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRT
FT                   VTIEEVGDSALYLLSDLSRSVTGEVHHVDSGYNIIGMKAVDAPDISVVKE"
FT   CDS_pept        497369..498469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BH04320"
FT                   /product="Chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27241"
FT                   /db_xref="GOA:Q6G4D4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27241.1"
FT                   /translation="MSHNTFGHLFRVTTWGESHGEALGCVIDGCPPGITFTLSDIQSYL
FT                   NKRKPGQSKYTTQRRELDQVEILSGVIVQDDGITFVTTGTPISLLIRNMDQRSKDYSAI
FT                   VHQYRPGHADYTYDVKYGIRDFRGGGRASARETAARVAAGAVARKIIPGVIVRGAVIAI
FT                   GPHTINRNRWNWSEVDNNPFFTPDAEMVQVFSDYIDKVHKNGSSVGAVVEIVAENIPAG
FT                   LGAPIYAKLDQDIASLLMSINAVKGVEIGDGFAAARLTGEENADEMRMGSDGKPLFLSN
FT                   HAGGIVGGISSGQPIIARFAVKPTSSILIPRRSIDVDGNDVNVITKGRHDPCVGIRAVP
FT                   VGEAMVACALADHYLRHRGQVGCFKR"
FT   CDS_pept        498473..499579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="BH04330"
FT                   /product="GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:BH04330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27242"
FT                   /db_xref="GOA:A0A0H3LXQ3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27242.1"
FT                   /translation="MTYDQKKIVSALRAFERGEIVVVTDDDDRENEGDLIVAAVHCTEE
FT                   KMAFIIRHTTGIVCAPMPKEEAQRFNLTPMVLDNNSVHRTQFTVTVDFKHGTTTGISAH
FT                   DRTLAVRNLANSNAGANDFIRPGHIFPLIAHEGGVLMRSGHTEAAVDLCKLAGLPPVGV
FT                   IGELVNDDGSVKHGDEVTRFAQENQFHIITVADLIAYRQRKEMLIQHVGEMHIETLVGP
FT                   AVVQSYQLPWEAVQHVAIIFGDIRDGEDIPVRLHRENIVNDVFGQTSDILEIMRRMMKK
FT                   EKRGVFVYLREGSVGVKSAVSIQALAMRGGESHTQAIEREEEWRQIGLGSQILKHLGIS
FT                   SVILYASKERHYVGLEGFGIRISRTDIL"
FT   CDS_pept        499587..499841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BH04340"
FT                   /product="Exodeoxyribonuclease small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH04340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27243"
FT                   /db_xref="GOA:Q6G4D2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27243.1"
FT                   /translation="MKQEIQKGDVATLSFEQALKQLEVIVENLERGDVPLEQSIDIYER
FT                   GEALKKHCEKLLKAAEAKVEKIQLSEGGTPEGVEPLDSE"
FT   CDS_pept        500048..501970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BH04350"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27244"
FT                   /db_xref="GOA:Q6G4D1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27244.1"
FT                   /translation="MSRTLTPLLDRVCEPQDLRAFPESDLARLADELRAETIDVVSVTG
FT                   GHLGAGLGVIELTVALHYVFNTPEDRIIWDVGHQAYPHKILTGRREKIRTLRQEGGLSG
FT                   FTKRSESVYDPFGAGHSSTSISAGLGMAVASALKAEKRRNIVAVIGDGAMSAGMAYEAM
FT                   NNAGALNARLIVVLNDNDMSIAPPTGAMSAHLARLVSRPAYRSLRERVKVLGEKLPKFF
FT                   LDKARRSEEFARGFLVGGTLFEELGFYYVGPIDGHNLKHLLPVLKNVREYPTGPVLIHV
FT                   VTHKGKGYAPAEASLDKYHGVNRFDIITGKQVKASSNVLPYTKVFSKALREEASYDDKI
FT                   VAITAAMPTGTGLDFFAEKFPERMFDVGIAEQHAVTFAAGMACEGYKPFVAIYSTFLQR
FT                   AYDQIIHDVSIQKLPVRFAIDRAGFVGADGATHAGSFDIVFLTTLPEFVVMAPSDEVEL
FT                   MHMVRTAAAYDQGPISFRYPRGEGIGMDLPQRGEILEIGKGRILHEGNRIALVCFGTRI
FT                   SEVLVAADELSAEGLSTTVADARFAKPLDKDLMRRLAREHEVLVTIEEGAIGGFGAHLL
FT                   QFLAQEGLLEHGLKVRTLKLPDEYLNHGSQEKVLSRIGLDAVGIVNTVFSALGRKIRTV
FT                   QRVRV"
FT   CDS_pept        501972..502721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="BH04360"
FT                   /product="Hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27245"
FT                   /db_xref="GOA:A0A0H3M503"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M503"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27245.1"
FT                   /translation="MAVRKRLDILLVEKNFFTTRSRARDAIVRQTVKVNGEIILKAGQI
FT                   IPDDAEIVVFDPAQNYVSRAALKLMGALDAFPIVTDKVTAIDIGASTGGFTQVLLERGA
FT                   EHVIAVDVGHNQLDARLFGNSAITLLEGLNVRDLKQEHLGGREIDLIVSDVSFISLKLA
FT                   LPPVLSLAKQGAQAVLLVKPQFEIGREFLSKGGILKDLSRAKQTAEGLFDWLNTQRGWI
FT                   AKGLLPSSIAGADGNLEYLLFGEKKSE"
FT   CDS_pept        502714..503967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04370"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27246"
FT                   /db_xref="GOA:A0A0H3LWK4"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27246.1"
FT                   /translation="MSNRVVIDHIGASGHGISNISHDSLSVPFTLPGEVAIVALRGKYG
FT                   KLIALEKKSSERIDAICQHFENCGGCVLQHWHADAYRSWKRQLVIDALKRYGIDVFVSP
FT                   LIEGGYQNRRRITLTALATQKGHIVGFNRYLSHDVIALEECPVTRLEIMSKLNSIKLLC
FT                   ALVGNHTKRFQVTVTSVENGLDVAFNGCVVRDEHIRQQMIHTALAYGMTRLSVEGEILV
FT                   EREKPLVYFGDVCVEFPAGGFLQATFEAENIMGNIILAYLEKAKNAVDLFSGLGTFTLR
FT                   MAKKMNVHAVENNETALANLDRAARFATGLKTITCERRDLFRRPLSAKELSCFECVVFD
FT                   PPRAGAQEQVRELAKTTIPRVVTISCNPVTFARDLSLLVAGGYTIEKIIPIDQFLWSPH
FT                   VEIVALLSKRKIKANWKL"
FT   CDS_pept        complement(504031..505449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="BH04380"
FT                   /product="tldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27247"
FT                   /db_xref="GOA:A0A0H3LVZ3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LVZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27247.1"
FT                   /translation="MKSLIDHFDIASAKVQSLVQETLHHADDGELYLEYTESETLLFDN
FT                   RQLKNGSFHQDMGFGLRVVAGEATGYAHSSELSAAALKRASEAAKTVTYKNHAGPYSVA
FT                   PQQTNKKLYQPHNPLNAPSFEEKSALLQKIDDYLRAKNDKLHQVTVSLSGSLQHVEILR
FT                   ADGNLVRDIRPLVRLSISVVAAEGNRRENGFYGCGGRQAFSQFISEENWKKAADEALRM
FT                   ALINLEAEAAPAGTFDVVLANGWPGVMLHEAVGHGLEGDFNRKKTSAFSGLLGQQVAAK
FT                   GVTVVDDGTIPKCRGSLTIDDEGTPSGYNILIENGKLVGFMQDRLNARLMGVNPTGNGR
FT                   RESYAYAPMPRMTNTIMLGGDKTPEEILSSLKSGIYAVSFGGGQVDITSGKFVFECTEA
FT                   YRVENGKIVAPIKGATLIGNGPEAMKRITMIGNDSKLDNGIGTCGKAGQSVPVGVGQPH
FT                   LRINNMTIGGTELT"
FT   CDS_pept        complement(505537..506076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27248"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27248.1"
FT                   /translation="MVLYKLIKKNFLVGAVLYALYNSSITHAVAQTSDIQSVPPPQTYG
FT                   AWTKVCSLPPGTPNIQCEVVQNVHTQNRYDITLRVTFYKLPKNQGVLMRVFVPIRVELR
FT                   PGVGLKIDDKNMGRIEYRRCLGDNCVAEAVLKDDILKLFLKGKTATYFIFTTPEQGIGS
FT                   LIDLQGLNDAYTNLPM"
FT   CDS_pept        506504..507442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="BH04400"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27249"
FT                   /db_xref="GOA:Q6G4C6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27249.1"
FT                   /translation="MSIPRELSVASGSKSISPKPSVYDYITLLKPRVMLLVVFTALVGL
FT                   IVSPVSINPLYGFLAILCIAVGGGGAGALNMWYDADIDAVMERTKSRPIPAGKISSRKA
FT                   FIFGMVLSILSVLIMGSFVNWFAALFLAFTIFFYIVVYTIWLKRRTPQNIVIGGAAGAF
FT                   PPMIGWAAATGTVNIESFLLFLIIFMWTPPHFWSLSLFSSLDYDAAGIPMMPNVRGEHS
FT                   TKKQILFYTILMAICAAGPFIIGFAGVFYGIFSTVLSIIFIHFAYRLWKSNTYDATILM
FT                   AKKTFFFSLFYLAAIFGILLIEFFVWCFIIL"
FT   CDS_pept        507628..508659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="BH04410"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27250"
FT                   /db_xref="GOA:Q6G4C5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27250.1"
FT                   /translation="MSILSPLIIRLCNPRGFCAGVDRAIQIVLLALKKYGAPVYVRHEI
FT                   VHNRYVVEGLQQRGAIFVEELDEIPEEHRNQPVVFSAHGVPKSVPEQADCYNLFYLDAT
FT                   CPLVSKVHKQAMRHQRHRRHVILIGHAGHPEVIGTMGQLEKGGVTLIETVEDALHYQPD
FT                   DPDNLGFVTQTTLSVEDTAEILDVLQRRFPALEPPAAESICYATTNRQNAVKAAALGSD
FT                   LFLIVGAPNSSNSRRLVEVAERSGARQSILVQRADEIDFDHLGALSVVSLSAGASAPEI
FT                   IVDEIISAFRKRYNVTIELAETVVENETFLVNRELRDVVLTPQDMAFMNGRSEMLKNKN
FT                   QDM"
FT   CDS_pept        508683..509642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB2"
FT                   /locus_tag="BH04420"
FT                   /product="Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04420"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27251"
FT                   /db_xref="GOA:Q6G4C4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27251.1"
FT                   /translation="MAVHTDIHPNDLKAFLTRYSIGSLLSYQGIVEGIENSNFMLYTTE
FT                   GKFILTLYEQRISKDDLPFFCNLMQHLGRRGVPCPQPVIQNNGMMIGELAGRPAAIITF
FT                   LEGEWVRQSNIYHCCEVGCSLAQLHLAAQDFSLSRRNTLSLVDWKCLWKRCQVRKDPLL
FT                   REFGKKIDTELAFLEENWPSILPTGIIHADLFNDNVFFLNDRLSGIIDFYFACNDFWAY
FT                   DLAICLNAWCFEHDHSYNLIKARGLLESYQKIRPLVPLELNAIVLLARGAALRFLLTRL
FT                   YDWFNTPPGSVVVKKDPWEYWHKLCFFSNVGSLSELGF"
FT   CDS_pept        509648..510115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="BH04430"
FT                   /product="Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BH04430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27252"
FT                   /db_xref="GOA:Q6G4C3"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27252.1"
FT                   /translation="MLHQQKVVEIYTDGACSGNPGVGGWGAILRWNGHERELYGGEVQT
FT                   TNNQMELMAALCALKALKESCSVDLYTDSVYVRNGISLWLKGWKKNNWQTVSKKPVKNK
FT                   ELWQALEGVCSFHTIRWHWIKGHTGHPDNERADALARKAIAEYRENGCFSA"
FT   CDS_pept        complement(510162..511016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27253"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27253.1"
FT                   /translation="MKKIQIFIQLKNISILCYKELLVTLNLIFVFLGFLHSSVSAQTKQ
FT                   EVYLFTTPWYESDGGRVRLSITNSSLSKIRNGVIEIVLKPGWKTYWRNPGDSGMAPFFN
FT                   FKQQVSYEIFYPTPQLYETENDWSIGYKNEVLLPFTISHTSGNLTGSLTLGLCNKICLP
FT                   FTVNFNFSPSIQKNKRLPLSLLKKAQDALPHTIHHELKINVKKETNTLFIKIKNNKKII
FT                   PISLFLDGGEMQIGPAKKVSDTAEYTLFSAPIHFIPKTTNKTVFYTVSFKDYALSGTFI
FT                   VPL"
FT   CDS_pept        511089..511673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27254"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G4C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27254.1"
FT                   /translation="MKQRGGFLGGQLLIAMPGMNDKRFIRSVIYICAHSDAGAMGIILN
FT                   QLHHIGFPELLLHLGVINSGQKKDLSEPIKKFPVRYGGPVDPSRGFVLHSDDYACEETV
FT                   LVADKICFTATIDILKAISCEKGPQHALIALGYAGWKAGQLEAEISTNGWLISSTSPSF
FT                   LFESDLNRKYDESLIRMGINPTYLVSEMGHA"
FT   CDS_pept        complement(511721..514606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27255"
FT                   /db_xref="GOA:A0A0H3M534"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M534"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27255.1"
FT                   /translation="MKSLRKIINIIFVIVLSSFVHLTSVQAIEPVKISSQDAALDLSRA
FT                   IEIHHTDNSIFQTSTVPGPDGIVWRIEVQAKNEKFSGNWAVFSLANPTDEQIDRLIVAP
FT                   HYRMAHSGFLWPDLGSARIQSITPSEGFSLDRQSSANFDIFRITLNPGAIVTFVAELNS
FT                   ANLPQIYLWKPEAYKDAINSYTLYHGILLGISGFLALLLTVLFVVRGTVLFPATAAIAW
FT                   AVLFYIGIDFNFLNKFFAVTLTTQPIWRAGTEVALAATLFIFLFTYLCLNRWHYHFSYG
FT                   AIVWTITLCGLGAFAVYDPTRAAGIARLSFGLTAVLGIILISYFSIRNYDRAIMLIPTW
FT                   LLISCWCLGAYACIAGYLNNDIIQPALSGGLVLIVLLISFTVMQQTFSNDAFHEGIFSD
FT                   LEQQVLAAKGAGNIIWDWNVERDRIIVHPDMKSLFGTETHKLNGPMQNWISALHHDDRE
FT                   RFQAVLDIILKNKKGRIDQIFRLSSGGGYYHWFSLRARPAMQKDGKITRVIGTIVNITN
FT                   HKKAEERLLYDAIHDSLTGLPNQQIFFDRLQNYTSLAKANIKIRPTVFMIDFDNFRQIN
FT                   HKLGIAVGDTVLLIIARRLSRLINFQDTLSRLSADRFAIILLSETEPQKIAAFADRLHK
FT                   TISAPIALTEKKIMLSPSIGLVTWSENRSTAKDILNDSELAMIRAKQMGGNHIEPFRPN
FT                   FRTLGLEHNTMGQDVHYAIKRNEIKILYHPILNLSDGHIIGFETIVEWHHPNYGNLNIS
FT                   DFIQILENEQIVMDLAEFIIDNAVIDLINVQEKFFQQSFFISINLPSPEMVHPRFISQL
FT                   RSTLLRHPLNKGGLMIEISEFVLRKNPEQSAHFLEQIKALGLNLALDNFGTGYSSLAYL
FT                   VRYPFDMVKLDRSLISIDSPKKKLILKSIINMAIDLNLQIIAEGVENEKEAISLRQEGC
FT                   KYVQSTLVTKPIAIEELITLVQNHFPYKNKP"
FT   CDS_pept        complement(515052..516332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04470"
FT                   /product="Processing protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27256"
FT                   /db_xref="GOA:A0A0R4J8P7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27256.1"
FT                   /translation="MGVDISRLRNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGI
FT                   AHLLEHMAFKGTENRTAFQIASDIEDVGGEINATTSTETTAYFARVLKNDIPLAIDILA
FT                   DILMHSKFDEDELEREKQVVFQEIGAARDVPDDVVFDYFTETAFRHQSLGRSILGTPKT
FT                   VQSFTSADLHSFMNKHYSADRMIVVAAGAVQHENFLQEVESRLSTFRPHSTEPLTNLAN
FT                   YVGGDFREYRDLMDTQVVLGFEGRPYHARDFYAAQILSIILGGGMSSRLFQEVREKRGL
FT                   CYSIYAFHWGFSDIGLFGLHAATGQEKLKELLPVILDELSKVSKNIHTNELQRARAQYR
FT                   ATLTMAQENPSSQANFIARQILLYGREIPLSETIERLELITPARLTDLAGRLFINATPT
FT                   LAAVGPVGSLMNFDNLTSTLSSNIKQV"
FT   CDS_pept        complement(516419..517816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="BH04480"
FT                   /product="Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27257"
FT                   /db_xref="GOA:A0A0H3LW18"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27257.1"
FT                   /translation="MQYISTRGEAPALGFIETIMTGLASDGGLYLPEKFPQLSFDALRA
FT                   LRGQSYMTIAKTILWPFVNNEIEYTSFENMISESYATFHHPATCPLLQTGPNEFILELF
FT                   HGPTLAFKDVAMQFLSRLMDYVLIKKNKSATIIAATSGDTGGAAIQAFAGREYSDVFIL
FT                   FPKGRISPVQQRQMTTSQKTNVHAIAIEGSFDDCQALVKAMFNDHNFRQKKALSGVNSI
FT                   NWARIMAQIVYYFSSALSLGAPDRAVSFTVPTGNFGDIFAGYVAARMGLPIAQLVIATN
FT                   DNDILVRTLTNGTYETQPTTHTTSPSMDIQVSSNFERLLFESGDRDPVWIRNAMENLKK
FT                   SGYFNLNEKQLKNIRSLFSAGKSSIAETAKIIDSVYKESGYLVDPHTAVALKVARENRQ
FT                   PHIPMIVLSTAHPAKFPDAIKNACGLNAPWPSRLNDLIEREEHFIGLANDEKIVKDYIS
FT                   LKSRASY"
FT   CDS_pept        complement(518465..518833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27258.1"
FT                   /translation="MVKVLKNQVFSIFIATFFSLSQIISAHASPLRNSPQQENISVSVM
FT                   EQGKKIAINMAALYMPNFTYEAKNENTYEGKIEKVFEPITLGIFTTVGALAFGFLTGSI
FT                   MGIFTGILGWAVGKTKGK"
FT   CDS_pept        complement(519046..519408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27259.1"
FT                   /translation="MVKVLKNQVFSIFIVTFFSFSQIISVSAHASPLKNSPQQENISVS
FT                   VMEQGKKIAINMATFYMPNFTYEAKNEAALEGKVEKVVEPITIGIFGIGMAIGYATTAV
FT                   GLLFGWIINLIIYKTK"
FT   CDS_pept        complement(519590..519925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M536"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27260.1"
FT                   /translation="MKKVLRNQLLSILTISVFFLSQVANVHANHLENNSQPVAPISVVE
FT                   QGNKETINMAAFYIPSLNHGTENEVAFEGKVEKVVDIITLGVGIMSAGYIISTVINWIS
FT                   QIISFFK"
FT   CDS_pept        complement(520939..521640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04520"
FT                   /product="Phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27261"
FT                   /db_xref="GOA:A0A0R4J6W1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6W1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27261.1"
FT                   /translation="MPKIDLIIFDCDGVLVDSEYLAAQIGSQLLKKIGYEISPEELSAR
FT                   YAGLIFPDILKKVEQETGKPTSAHLIDQMSDLFRAQIKTELRAIDGIKEAIEAIQSHYP
FT                   YCICSNARSTEIKEMLTIVDLYDFFDNKDKIFSAPEVGTKKTKPAPDVFLFAAQQLRVK
FT                   PKNTIVIEDSIHGVHAATAAGMRVIGFTGGSHSYLGHSNALVEAGAETAIAKHAHLLEV
FT                   LEAMAVWQDLP"
FT   CDS_pept        521989..523125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrM"
FT                   /locus_tag="BH04530"
FT                   /product="Adenine DNA methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27262"
FT                   /db_xref="GOA:A0A0R4J6C8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27262.1"
FT                   /translation="MSVIQLQKDFVQTSAQMSWRNKILKGDCVAVLEKLPKHSVDMIFA
FT                   DPPYNLQLEGALYRPDHSLVDAVDDAWDQFENFAAYDAFTRAWLLACRRVLKPNGTLWV
FT                   IGSYHNIFRVGTALQDLGFWILNDIIWRKNNPMPNFRGRRFQNAHETLIWAVRDQKDKK
FT                   YTFNYDALKAANEDIQMRSDWLFPLCTGAERLKDEAGRKLHPTQKPQPLLARIIIASSK
FT                   PGDIILDPFFGSGTTGAVAKLLGRDFVGIEREQQYIDAAYERIAKIKPLNEPELAILDR
FT                   KKAEPRVAFNSLLEAGLICPGEVLYDRKKQVSAIVRADGTLMYGGEAGSIHAMGRKAQD
FT                   LQSCNGWTFWYYEEDGQLKSINELRMVIRSQMLKTGIL"
FT   CDS_pept        complement(523173..524279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BH04540"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27263"
FT                   /db_xref="GOA:A0A0H3M2U1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27263.1"
FT                   /translation="MLFSFAFYISLWLTKIMHEISLRLLSWYDQKHRHLPWRITPKEQM
FT                   QGIRPDPYRVWLSEIMLQQTTVEAVKPYFKKFLQLWPDLSSLAKASQDDIMKAWAGLGY
FT                   YSRARNLKNCAQQLVEDYGGQFPQSIKVLRSLSGIGDYTAAAIAAIAFNHPVAVVDSNV
FT                   ERVVTRLFAITSVLPKAKAEIKEKTQKITALNRPGDFAQAMMDLGATICIPRKPSCSLC
FT                   PLQGLCRAEKMQKAEFFPVKAPKKERLSKTGAAFVVLNEKRQIYLEKRQGKKLLGGMTQ
FT                   IPNNIGTKNPNGLQNAPFIANWQFKGQITHVFTHFSLKLDVYYISGIREIKHQNGWWCD
FT                   IHHLAEQALPTVMKKAIAVAIPHPFKLK"
FT   CDS_pept        524441..524941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27264"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27264.1"
FT                   /translation="MSKQFQKRHFYSLSEIIFKMLDPILRKRTGLNVALIENWSQIAGR
FT                   DIAEHTVPLKIIWKRRVDQDEIFQPGTLIVACEGFVALKLIHETAELIHRINVFFGYIA
FT                   LNRIKIEQRSVSVFSNQLPRKLSLSVKEKKCVEKMLEGVENESLRQSLYELGCCIFAEK
FT                   KNK"
FT   CDS_pept        525027..525683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27265"
FT                   /db_xref="GOA:A0A0H3M541"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M541"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27265.1"
FT                   /translation="MINYRSFLSFAVIFALMTTMQISVTTVLASGVKPVSTVDMAELLK
FT                   SGKAKDRFEGEENAPVTIVEYASLTCVHCAHFYNDVLPQIRKKYIKTGKVKLIFRDFAF
FT                   DSRATAGFMLARCAPEDRYFPLIEVLFQKQSEWVWARDAVTPLKKIGLMAGFTDESFNA
FT                   CLKNQSILDEVNASFERGKELGVNATPTFFINGNKYEGAMSVEAFFSVIDSFLKN"
FT   CDS_pept        525867..528542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="BH04570"
FT                   /product="Pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04570"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27266"
FT                   /db_xref="GOA:A0A0H3LWP3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27266.1"
FT                   /translation="MTKWVYSFGDGSAEGSASERNLLGGKGANLAEMSNLGLPVPPGFT
FT                   LTTEVCNFYYAYGKSYPKELREAVEQALKHIGEKTGREFCNEKRPLLLSVRSGARASMP
FT                   GMMDTVLNLGMNDETVKAIALQTKNERFAYDSYRRFIQMYSNVVLGLEHSYFEEILDDS
FT                   KMRKGYTIDTEMTAVDWQDVIVSYKAYIEEKLGKPFPQDPEQQLWGAIGAVFSSWMTAR
FT                   AVTYRRLHNIPESWGTAVNVQAMVFGNMGEDSATGVAFTRNPSTGEKELYGEFLVNAQG
FT                   EDVVAGIRTPQNITENARIVAGSNKPSLEKIMPEAFGKLYHIGQKLEKHYRDMQDLEFT
FT                   IEKGKLWMLQTRSGKRTARAALKMAIEMVEEGLISREEAVMRIDAKSLDQLLHPTLDPK
FT                   AGRFVVARGLPASPGAATGEIVFTSEEAETASVEGRKVILVRIETSPEDIHGMHAAEGI
FT                   LTTRGGMTSHAAVVARGMGKPCISGAGSVRIDYSTNTMFASGQSFKKGDVITIDGGSGE
FT                   IFKGKVAMLQPELCGDFAKLMEWADGMRRIKVRANAETPSDARMGHSFGAEGIGLCRTE
FT                   HMFFSGERIVAMREMILSDDENGRRKALDKLLPMQRSDFVQLFEIMCGLPVTIRLLDPP
FT                   LHEFLPKTDAEILDIATVMGVSKEALAERAQQLHEFNPMLGLRGCRLAITYPEIVEMQA
FT                   RAIFEAAAEAAQKSGSPVMLEIMVPLVALKSELDFVKTHIDQVACEVMKEKKSTIQYMV
FT                   GTMIELPRAALRADEIAETAEFFSFGTNDLTQTTFGISRDDAAPFLATYFQKGLLEQDP
FT                   FVSIDRDGVGELIAIAAKRGRSQRAKIKLGICGEHGGDPASIALCEENDLDYVSCSPFR
FT                   VPIARLAAAQSAIAKKRERF"
FT   CDS_pept        complement(528745..529593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27267"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27267.1"
FT                   /translation="MIKKRNSRRQKIKKSRIQRSIIITFFLINIRFIFFIIKKSYLYTQ
FT                   KNTLFFVGFIIFIVSFGFFSFNALFLQMKTHQNVFTQMKFMSGANTNIEKNSALFLKEE
FT                   KFQSNRHVTSLLPPNYLKKNSSSHSASQSILEMQKKLAKLGLYDGSLDGLEGPKTRRAI
FT                   ALWKQQTAEEMQNRILQKNTKDEIAILIKQSEMEMINEKTKTKDLPRSTEPVLEPTIAD
FT                   IIEVQKALRIFGNQEVIVTGVEDQKTVEALKQFQKMFDLPITGKINHTVLVKMHEIGLL
FT                   N"
FT   CDS_pept        530494..530868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27268"
FT                   /db_xref="InterPro:IPR035220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27268.1"
FT                   /translation="MIRFLIKLSFFLFFVFIIISFFAAKPSNNHSFNQREFETKTSDVM
FT                   MAFKETLNDLGKFCDRNREACKIGKSFLSSLSERARYGAKATYEYLGNILSNKNMAQFE
FT                   NISPNMDEKPTQKKNHPTFP"
FT   CDS_pept        530981..531391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27269"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27269.1"
FT                   /translation="MAETIDDIIENFSLLDNWEDRYRYVIELGHELPVFPKSARNDAHK
FT                   VPGCVSQVWLLSSRDNSENPILTFQGDSDAHIVRGLIYILLAFYSGKKASEIRDADAEG
FT                   LFETLGLNENLTPQRSNGLKSMIERIRNESYV"
FT   CDS_pept        complement(531495..531932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04610"
FT                   /product="Transcriptional regulatory protein, ros/mucR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BH04610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27270"
FT                   /db_xref="GOA:A0A0R4J8L1"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8L1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27270.1"
FT                   /translation="MEHRPVLETESNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHA
FT                   AFRKAGNADLTEVEVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEE
FT                   YREKWQLDSSYPMVAPNYAKARSALAKEMGLGRKSKRKKTK"
FT   CDS_pept        532836..534932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="BH04620"
FT                   /product="Protease II"
FT                   /db_xref="EnsemblGenomes-Gn:BH04620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27271"
FT                   /db_xref="GOA:A0A0H3LWP7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27271.1"
FT                   /translation="MTRSSVLPPKASKIIYKDVYHGICRDDPYHWLRASNWQDVLKDSS
FT                   CLDENIRHHLEKENAYQAAQMADTKLLQDLLFAEMKSRIPENDSSVPIKHGPFAYGFSY
FT                   VTGGQYPHYFRTSRNGEEKNVYLNGDALAEGKEYFNFGSVQESPDHKHVVWTYDDKGSE
FT                   FYTAKIRNLETLSDYTDTITDTSGQIIWDAKSEGFFYTKIDENHRPSELYYHRLNTDQS
FT                   QDKLIFREDNPGFFLNVSGSKLNDVIYINIHDHETSEIWLIPAKAPLTVPQCVRKRQKG
FT                   IEYSLTEGGDVFYILTNLDNAKDFKIMVAPYTSPQSENWSELVSHQLGCLIICHDAYQD
FT                   FLVWLERFEGLPRIKVMERTTKQIHSISITEEAYSLGLQGAAEYNSQTIRFTYSSMTTP
FT                   DQVFDYEMKSRKRTLLKTQIIPSGHNKDEYITRRIMAIADDGEKVPISLFYHRTTALDG
FT                   SAPCLLYGYGAYGISIPVNFNSTVLSLVNRGFVYAIAHIRGGKEKGVEWYEKGKHRFKY
FT                   NTFTDFITCGRYLVNNKFTSHDRLIAHGGSAGGMLMGVIANIAPQDFSGIVANVPFVDV
FT                   LTTMLDASLPLTPPEWPEWGNPLESQEDYNLIASYSPYDNVKAQKYPSILAIAGLTDPR
FT                   VTYWEPTKWVAKLRDLKTDDNAILLRINMDSGHAGAAGRFSKLEEIAYIYAYILKITGK
FT                   MLLT"
FT   CDS_pept        complement(535013..535615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="BH04630"
FT                   /product="Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27272"
FT                   /db_xref="GOA:A0A0R4J6J3"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27272.1"
FT                   /translation="MAFELAPLPYDYDSLSPYMSRETLEYHHDKHHLAYLTNTNNFVKD
FT                   LGLENESLENIVKKSFGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESD
FT                   LGGYDKFRADFIATAIAQFGSGWAWIAVKDGKLEIMKTPNGENPLVHNAQPILGVDVWE
FT                   HSYYIDYRNVRPKYLEAFVDHLINWDYVLKLYEDCGL"
FT   tRNA            536651..536725
FT                   /locus_tag="BH04650"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:536683..536685,aa:Gln)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(538316..539101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27274"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8N0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27274.1"
FT                   /translation="MKKTYVRLISRAAIWSPRFGTLAFFILLFSILLQRFSVIDIVDFM
FT                   ILIVISACCVVVSLFLALKALYSLWVHGALGGMKALQGIIYSLITATPLVLFFGFWFAL
FT                   PALYDVSTDTQKPPAFFRTIRPRDALPLKSVLIGQAALQMSQWPEMSGRRYDGSPDHIR
FT                   DSVLNVLDAYGWPIVAQREFKGEEDEIYIETIAKTFYLGFTSDIVIRLTNEGDTTFVDM
FT                   RSASRYLSRDLGSNAAFIINFMDALDTEIASLPLSQDDD"
FT   CDS_pept        complement(539742..540281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27275"
FT                   /db_xref="InterPro:IPR014456"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27275.1"
FT                   /translation="MIKFFHAALLAIIGAIIVHICVLFLIPYWAKNNIWTELKKSGASY
FT                   QFVDLDAHNSFQQTSDPFFRLKVCRFDLENGPVHLKALKTNQFWSLAAYTQNGIIFYSL
FT                   NNRTAPDATLDLIIGKPIQIIELKQSKPKNNANSVLIAKNLKKGFVILRIFSPSLLAKK
FT                   ESEAFFSSATCRILNE"
FT   CDS_pept        complement(540274..540870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04680"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27276"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR012038"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M547"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27276.1"
FT                   /translation="MFVKIIIPFSIFVSSILCGTLSVDYILNSFNHFGRFTIGEWSAYP
FT                   QMGTSNTDPYTRARAAKRGDISIGRTEGLIFQIWKDNHGRPLKPNCHYLLKGHIPETHL
FT                   FTLYTADRSLKPYTSSKEIPFELYTNNIIYENDGSLRINISPTPQSGNWLATVSQKEFG
FT                   LILTLYDTPIISATALQKLTMPSVEQIPSGQINCD"
FT   CDS_pept        complement(540890..543040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA1"
FT                   /locus_tag="BH04690"
FT                   /product="Penicillin-binding protein mrcA"
FT                   /db_xref="EnsemblGenomes-Gn:BH04690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27277"
FT                   /db_xref="GOA:A0A0H3LWQ1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27277.1"
FT                   /translation="MFDFFKKKKAQQNRTFHSPAFIELDALFDTALYRLRSTNSLFWKK
FT                   TKIISQYFHIRGWKRLIIEILDETLTLGLIGFTLFTIVGVSVFELIKKDWYLPKNFSIL
FT                   FLDRYGNPIGHRGALPTAFVPVEEMPDYVIKAVLATEDRRFFDHWGIDLQGLTRAISQN
FT                   MQAKSVVQGGSTLTQQLAKNLFLTNERTITRKIKEAYLALWLEANFSKKQILQLYLDRA
FT                   YMGGNNFGITAAAKFYFGKNIRNISLSESAMLAGLFKAPTKYAPHRHLFAAQTRANVVL
FT                   ANLVNSGFMTESQIINAHRHPARALSKIKNTQPDYFLDWVFDEVKKMADQLPSHTLIIQ
FT                   TTLDPNIQKAAEESIAYHLQQYGQQYRVTQAATVILDNNGAVCAIVGGVDYNKSQFNRA
FT                   TQGGRQPGSSFKPYVYAAAMEHGLSPSTIVLDAPINWGGWSPKNNSGRYLGKIDLATAL
FT                   AFSINTVPVYLTYQYLNRNTKPIIDLIKNMGIHAHILSHKTMVLGTSNMTPMDQATGFN
FT                   VFANGGMAGNRHGFTQIRTTNGHVLWDFEYNGNKLHRALSSQSAAYMNQMMVGVTTRGS
FT                   GKRAALPMTLVAGKTGTSQSYRDAWFVGFTGNYTGAVWMGNDDFSPMNRAFGGGIPAMI
FT                   WHTIMLSAHKNIMLKQLYGVKDSLLPYQPPTRPYNNDSEPALPIPYTLSPETLNIVRLI
FT                   NNDLKKLSVISLKRETIGASKL"
FT   CDS_pept        543334..543609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27278.1"
FT                   /translation="MFILYSPKRDYKISMKKVFLFLMIAVFLDTNSVRAAECAKIGKKL
FT                   ATQKKAVLVRSTPVVQEGRGICVVVFVVPARDGKKLHRVEISVPAD"
FT   CDS_pept        543628..544296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuP"
FT                   /locus_tag="BH04710"
FT                   /product="Two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27279"
FT                   /db_xref="GOA:A0A0R4J713"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J713"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27279.1"
FT                   /translation="MRILIVEDDRNLNRQLAEAVKNAGYVSDSAFNGEEAYFLGSTESY
FT                   DAVILDIGLPRLDGICVVEKWRKEGHLMPVLMLTARDRWSDKVLGIDAGADDYVVKPFH
FT                   LEELMARLRALIRRSTGHATSTLCCGKVLLDTKTSRVFFDGQLIKLTSYEFRLLSYLMH
FT                   HGDRIVSRTELTEHLYDQDFDKDSNTVEVFVGRLRKKLGMDLIETIRGMGYRVRMPGDQ
FT                   "
FT   CDS_pept        544293..545705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuQ"
FT                   /locus_tag="BH04720"
FT                   /product="Sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27280"
FT                   /db_xref="GOA:A0A0H3LXT4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27280.1"
FT                   /translation="MNVLKNNGRLKRVFFFVSRSLSLRVMILSTLWVIISLSLISAVSI
FT                   LFYQRSSEQSLERILSAQLYSLIATVTVSPEGELKGNLGINDIRYADPTSGWYWEVFAV
FT                   SPNLKGRLTSPSLGSGQIFSPSDADILFDNKFFRSYRIKGTNNQNLQVIESDVVLDNQD
FT                   HIARFRLIGNIDEAHAQVHEFKKVLQIFLWSFGIGSVLINIAIILFSFQPLKLIRQALN
FT                   DIREGRVNYVNTDLVSEVLPLAQEMNALIHNNQRIIERFRTQVGNLAHSLKTPLSVVMN
FT                   EADKIRGEQAILLKEQIKIMQDQINHYTQRARIAAQCDSVIYHTSVRKVVNRLVRVMEK
FT                   LNPEKQFRFVMDVNDIIFSGEKEDLEEVVGNLIENAAQWSRTKVLISCYLEKNIEEEKF
FT                   FSLLVEDDGSGLTEEQTDEAVKRGRRFDKSKPGTGLGLAIVSDMVNEYGGSLFLSRSDL
FT                   GGLYAKVLLPRR"
FT   CDS_pept        546010..546744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycH"
FT                   /locus_tag="BH04730"
FT                   /product="cytochrome c-type biogenesis protein cych"
FT                   /db_xref="EnsemblGenomes-Gn:BH04730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27281"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M551"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27281.1"
FT                   /translation="MLLLVLAVFFLTFLASILFLSLHNYGTKKELRAQDIESERSCMYS
FT                   VGFDKPYTYHKKRHTFVALSIFFVLLITWSIYSFTGNPEVKSYFFSELMDKDPKTLNKR
FT                   EQLVRLQVLFLRLPYDGKLADALAIRYLEEGYFQDAVNIYLEALRLNGESAPRLVGYGL
FT                   SLIGYEGGMITQEAQNAFQKAADLAPNDFYPRLLLAEALHQAGKSVQAVQFLKNFLETM
FT                   PEDFKGRSHIEAMIIQLRDASD"
FT   CDS_pept        546933..547412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycJ"
FT                   /locus_tag="BH04740"
FT                   /product="cytochrome c-type biogenesis protein cycj"
FT                   /db_xref="EnsemblGenomes-Gn:BH04740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27282"
FT                   /db_xref="GOA:Q6G494"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G494"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27282.1"
FT                   /translation="MSSQSFHNSPSLRVILKQRKKKRLLIVLFCCLIIAIATSLITYAL
FT                   RNTVSFFRMPSEVTKEDILMGRPLRLGGFVEKGTVEYVGDRGVIFFVTDNVKHEKVIFS
FT                   GAIPDLFREGQGVVVEGYFDKQGFFIGTRILAKHDETYMSRETADRLNKHHRVEK"
FT   CDS_pept        547420..549405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycK"
FT                   /locus_tag="BH04750"
FT                   /product="cytochrome c-type biogenesis protein cyck"
FT                   /db_xref="EnsemblGenomes-Gn:BH04750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27283"
FT                   /db_xref="GOA:A0A0H3LWQ4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27283.1"
FT                   /translation="MLIELGHLFLSAAFAVSLLGAFLPVLVFLWGERSLMQTAVPLTYI
FT                   TFTLLFLSFLIIVHAHIVSDFSVLNVVENSHSEKPMLYKIIGVWGNHEGSMLLWVLSLA
FT                   FFSTLVALFSQHLPEQLKALILVCQSWMTSAFLLFILFMSNPFLRVNPPALQGKDLNPL
FT                   LQDIALAIHPPLLYLGYVGFSLCFSFAVAALIMGYVDRLWARWVRPWLLLAWCFLTLGI
FT                   MVGSYWAYYELGWGGYWFWDPVENVSFMPWLSGTALLHSALALEKRGILKSWTLFLSIL
FT                   TFSLSLMGTFLVRSGLLISVHSFALDPARGRAILALLLFFTGGALSLFALRVPALTPGR
FT                   FFQPISREGFIILNNLLLTTITATVLIGTLYPYFIELLTGQKISVGADFFNLTCGPLMM
FT                   LLLLLVPFGSMIAWKRGDFLAVFERLWVVFALVAIVCFITFYVVSLRDIFAILGIGLST
FT                   FVFLGSLAGLWAKSGHRKIALLARFKRFIGLPWSVFGAAIAHMGLGVTLFGIIYVATFG
FT                   QERILIMHKGDMVTIADKTLHLNEVHDETGPNYSAIEFHFTIYENKNTVGNVTASKRFY
FT                   PSQNTSTTEVGIQNHGLSQLYIVPGRIDERGLVLHIWWKPYIICVWLGALMMAMGGCFS
FT                   LFSYWFRIRVHQRRVSRFKFSEKALR"
FT   CDS_pept        549402..549860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycL"
FT                   /locus_tag="BH04760"
FT                   /product="cytochrome c-type biogenesis protein cycl"
FT                   /db_xref="EnsemblGenomes-Gn:BH04760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27284"
FT                   /db_xref="GOA:A0A0R4J889"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J889"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27284.1"
FT                   /translation="MKKKLFCTLFFLIIVFSLSLAMAVEPDEVLKDTVLEARARDISLH
FT                   LRCPVCQNQSIDDSDALLARDLRLLIRERLKMGESNQQVIDFLVERYGDFILLKPPFNK
FT                   TTWFLWLSPLIIIIIGASAIFFQIKWYKNEKVITLNASEEKQSKIFFD"
FT   CDS_pept        550046..551557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA1"
FT                   /locus_tag="BH04770"
FT                   /product="Serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BH04770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27285"
FT                   /db_xref="GOA:P54925"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54925"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27285.1"
FT                   /translation="MVKKTFFTTLAAVSFSAALETALFFSGCGSSLWTTKAHANSVFSS
FT                   LMQQQGFADIVSQVKPAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQDF
FT                   YNRDKPSNKSLQRSHRLRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNA
FT                   KLIGTDPRTDLAVLKVNEKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSA
FT                   RGRDIGTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPA
FT                   ATAKQVVQQLIEKGLVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPLKGPAAKAGI
FT                   KAGDVIISVNGEKINDVRDLAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMPEDENM
FT                   KDGSKYSNEHGNSDETLEDYGLIVAPSDDGVGLVVTDVDPDSDAADKGIRPGDVIVTVN
FT                   NKSVKKVSDITDTIKNAQKLGRKAILLQVRTNDQNRFVALPIFKK"
FT   CDS_pept        551639..552325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04780"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH04780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27286"
FT                   /db_xref="GOA:A0A0H3M2W0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27286.1"
FT                   /translation="MKILVIEDDHETGRYLEKAFEEAGHSVDVAYDGETGYALAETENY
FT                   DVMVVDRMLLHRDGLSIIAELRAKGNETPALILSALGQVNDRVMGLRAGGDDYLTKPYA
FT                   FSELLARVEVLQRRKNPKEAETVYCVGNLELDRLAHTVKRGDRNIILQPREFRLLEYLM
FT                   RYAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRAKIEKDFDVPLLYTIRGAGYMLK
FT                   APDNKI"
FT   CDS_pept        552322..553704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04790"
FT                   /product="Sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27287"
FT                   /db_xref="GOA:A0A0H3LXT9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27287.1"
FT                   /translation="MNRLLNMMRTTALRLSALYILLFGLVATGLSIYITAFSVSLLTEQ
FT                   TEQALREELRRIENAYNYGGLPLVIRTIDYRSRQPGAFLYLITDSMGRILASNVARIEV
FT                   GLLNHNGFLSNSFLYSRFGEHGKTSEHRALAIIVNLPNAMKILVGRDLDEPERFAAVIR
FT                   KAVMIALAAMVGGALLIWFFVGRRALQRIDHVTAASQRLMKGDFSGRLPVSGVGDEFDR
FT                   LSANLNVMLDRIEELNIGLRQVSDNIAHDLKTPLTRLRNRAEAALSGQKTKFEYCQALD
FT                   GIIAESDQLIRTFNAILMISRIEASSAIEHLETMNMKLILEDAVEIYEPFAEESGVLLQ
FT                   LGETFDKELKLNRELIAQSIFNLIDNAIKYASEDGRRAKVCLSMEYRGEHLLVIVSDNG
FT                   PGIAADKRDKVTERFFRLEESRTRPGFGIGLSIAKAVMKLHGGELLLEDANPGLRAVLL
FT                   FP"
FT   CDS_pept        553801..556725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="BH04800"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04800"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27288"
FT                   /db_xref="GOA:Q6G488"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G488"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27288.1"
FT                   /translation="MKNAFLKTQLLPLRPLDESGSQWLKDITEQARKENLESLVSSLSN
FT                   QGKQINFLNAVMTLSPFLREVLIANPSYLSPLLYVDIETRLSEIIEDITLIDKNKSIHE
FT                   TTLMAALRRKKREAHVLIALADLGGVFTYEISCAWLTRLGEAALGVALRFLLREAHDHG
FT                   KINLSNREDPEKDCGLIILGMGKFGAGELNYSSDIDLIVFIDEMSPHVGNLSESIDVFS
FT                   KMVRRLIRIIQERTAEGYVFRLDFRLRPDPGSTPLALPVRTALRYYEGRGQNWERAAMI
FT                   KARPVAGDKSAGFNFLKELFPYVWRKYLDYAAIADIHSIKRQIHAYKNYDQISAYGHNI
FT                   KLGRGGIREIEFFVQTQQLIAGGRFPQLRGRQTVAMLAELHRLGWISEKTRDSLVKSYA
FT                   FLRNVEHRIQMLADEQTHILPIDVSQFTSVAYLMGYQETNSFICDLLKTLQVVEKHYAA
FT                   LFENEQELGLEIGNLVFTGEEDDPETLITLRRLGFERASDICRIMRTLHCGRYKSTQSA
FT                   EARERLTELTPALLKAFGATKRADEVMLRFDSFLQGLPSGIQLFSLLQSNPSLLDMLVL
FT                   IMGAAPRLAEIITHKPHVFDGMLDPTIFSELPTKTYLKNRLEYFLEGVISYEEILDHLR
FT                   VFADEQRFLIGIRILNGAITGKKAGFAFTALADLIIAKTFATVQEEFSRLHGNIKGGRV
FT                   GILGMGKLGSCELTAGSDVDLILLYEHDEDAEISDGGKPLYIFQYYTRLTQRLVAALST
FT                   LTSQGILYAVDLRLRPLGNKGPVAVSFEFFRKYYRKEAWIWEHLALTRARGIAGDLDFL
FT                   QKLENEVYEIIAFSRNKKDVIKAVCEMHVLIGKGKPPENRWDLKRMPGGIMHLEFIAQF
FT                   ALITHVIVFQIGATTADILTQLPNSFLNQSFISDLHHAYGLYTNLSQIIRLCLNDALDL
FT                   NNMPPGLSDLLLSSVGEPDLLRVEKLIEETGQLVYSIFKQVMKY"
FT   CDS_pept        557708..558532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbpD"
FT                   /locus_tag="BH04810"
FT                   /product="Hemin binding protein d"
FT                   /db_xref="EnsemblGenomes-Gn:BH04810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27289"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M554"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27289.1"
FT                   /translation="MTTKYLITTSIFSLISISIAQAADVIVPEQPVPVVAVPAFSWAGF
FT                   YLGGQVGNFSSKTALSYLGDEKTGKWTPVKKEFVPKLSGFVGGIYAGSNFDINNGFIIG
FT                   IDTDVMWSGKKNTKIITWPEVPPEVSSEKKVERVSVGTNQDTSAEVTNGALSHTLKQKW
FT                   FGATRVKVGFVVDRMMPYIAGGVAYTQLQNIFEKEADKTKKAIDISNVIHDEKKTMVGY
FT                   TLGGGIDFAMTDNVIVRAEYRYSDYGKKKFADEKIEMRYKTNDFRVGVAYKF"
FT   CDS_pept        558944..559468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04820"
FT                   /product="Methyltransferase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:BH04820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27290"
FT                   /db_xref="GOA:A0A0H3LWQ8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27290.1"
FT                   /translation="MLNISQQRIFCLKNVSIGGLLVAKSRKGICNIALGDTPEQLLQEF
FT                   TVRFGDVQQVDDDSTFKKEVTHIVAMIESPKFVRKHDFPLDIIGTVFQQKVWTGLCEVP
FT                   CGETISYEALAQHIGMPNAFRAVANACARNELALLIPCHRVVRKDGFISGYRWGIWRKK
FT                   ILLQREQKGEI"
FT   CDS_pept        complement(559465..561786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04830"
FT                   /product="Two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27291"
FT                   /db_xref="GOA:A0A0H3LW46"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27291.1"
FT                   /translation="MAKLDACNAPTEIYADSKSSAQNHKARTKHINPLFDSSYQKLLFI
FT                   EPWLRRSLPFVIVVFLVVLAAIRFVSIYDLRHTIDKNTRSTITLLAAHIANTIDRDLLA
FT                   ATQKGKAIALSHTYLQNILSNFQNQGLIKTGTVIAIVDQKGNILASSSPEIILGKPLQD
FT                   FISESIALRSLRKHAGIMKVTIGKDAPALASFHQTENGKYGVFISEKTQEIYREWRKIF
FT                   SLNITLLIGTGGVILALLYAYYNQIVRARKTDSISEKIQNRIDMAMMRGRCGLWDWNMA
FT                   SGRVYWSRAMYEMLGYIPQDALLSISQITAIINPNDANFFDLAQELMSGKKKHIDINVP
FT                   MRHADGHYVWMRIRAEVTDEEELHLVGIAFDISEQRQLAEETAQADLRIRDAIENISES
FT                   FVLWDSEGRLVMSNSKFCEYAAIPKQVLQPGIQRATVEAMARPAINEYPLKDDGTGNLT
FT                   SIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARG
FT                   NAQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIMLQST
FT                   FGPLGSQRYQEYMHDIYNSGNHLLTLINDILDMSKIEAGRFTLDRKNIDLEPIISEAVR
FT                   TLTPQAQEKNISVSTNIAPELHAEVDGRAMKQIFLNLISNAVKFTPSGGSINVCAFKKK
FT                   NNLVCRIKDTGVGIPQSAIKKLGQPFEQVENQLTKTHTGSGLGLAISRSLLELHKGKLE
FT                   IISKEMKGTTVTITMPIKQS"
FT   CDS_pept        complement(562071..564698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BH04840"
FT                   /product="Aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:BH04840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27292"
FT                   /db_xref="GOA:A0A0H3M2W5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2W5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27292.1"
FT                   /translation="MQQSSVPIYRLEEYQQTPYAIPKTQLHFRLAPTKTYVTATLFLEP
FT                   RHNTKELTPLVLSGDDLTLISVALNGEILPESAYKVTPSRLEITTPPATPFTLQLVTEV
FT                   NPESNRQLMGLYLSNGVYCTQCESEGFRRITYFYDRPDVLSTYTVKIEADSKTIPVLLS
FT                   NGNLIETGTLENNRHFALWEDPYPKPSYLFALVGGNLDKLEDHFTTLSGRRIKLAIYVE
FT                   KGKTKRATYAMDALKRSMHWDEQCFGREYDLDVFNIVAVSDFNMGAMENKGLNIFNDKY
FT                   ILADPETATDHDYRNIERIIAHEYFHNWTGNRITCRDWFQLCLKEGLTVYRDQEFSSDQ
FT                   NVRSLQRIENIKTLKTMQFTEDSGPLAHPVRPRQYSQINNFYTATVYEKGAEVVRMVHT
FT                   LLGPTLFRKGMDLYFQRHDGQACTIEDFIACFSEVSHQDFSQFMLWYEQAGTPNVEIDH
FT                   HYSDGVLTIHAKQHIPATPEQNTKKPMLIPIAFGLLGHNGESLTYEADADIQSGVMLLS
FT                   KKNQTFTLRGLSEKPILSLLRDYSAPINLQTPFNESEFIFLAQKDDNQFNRWQSLNQLI
FT                   TQALIKSIQDETQATVDMSSALLKLIENIITDENLEPEFRAFCLNLPSEIELAHIIGKN
FT                   VDPERIHYVRNQFLASLAHTHQELFIKIYMQMETNEPYSPNIAQAGKRALRNIVLDYLS
FT                   IAESQPNRAAKQYATANNMTDRMASIAILVQRFKESEQAQNALNDFENRYRHDPLVMDK
FT                   WFSIQAMVAGTSTLDHVRKLMQHPLFSQDNPNRVRALIGIFASHNLTGFNRVDGAPYHF
FT                   LCQIILEIDKKNPQLASWLLTRMRSWRQLEPVRKQKLETALKTIAEAPQLSSDVAEIIS
FT                   RILA"
FT   CDS_pept        complement(564775..565602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04850"
FT                   /product="DNA polymerase, bacteriophage type"
FT                   /db_xref="EnsemblGenomes-Gn:BH04850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27293"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27293.1"
FT                   /translation="MLNHTPCSITYEELLSFYKESGVDTALTDLPIDRFSQSASLEKKS
FT                   TQVVKISHNQQTSPSIKLDNHPLSNSTIIQGELSAIESAKNANTLDELKSALLAFNGCS
FT                   LKLTAKNTCFSDGTAGSPLMLIGEAPGREEDIQGIPFVGKAGMLLNKILASIGLTRNSV
FT                   YIANTIPWRPPGNRTPTPREVALCRPFIERQIYLANPRILIALGGVATQFLTGAQNGII
FT                   RTRGKWLTYKSENNIKIPVMPTFHPAYLLRTPSQKKLTWLDFLEVKNRLDSLL"
FT   CDS_pept        complement(566032..566790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="BH04860"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27294"
FT                   /db_xref="GOA:A0A0H3M558"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M558"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27294.1"
FT                   /translation="MALMPSILIVAGTDPTGGAGIVRDIETAAHFQIKANLAITCINVQ
FT                   DDNHVAEIVPMCEKLIAAQMRAALEANPISAIKIGMTGNQAIIAAICNVIEDYPHIPVI
FT                   LDPVLFASSGGKLTTEPIIEIMINKLLPYVDLLTPNREELALLSQTPLASCHKQAIQQA
FT                   KKLLSFGPRSILIKGGHADGPLATDSFIDKTEIIDISTVRLTRTMRGTGCILSSAIAAH
FT                   LALNESMIQAIKNAKEYIYRLLLNHNQKGD"
FT   CDS_pept        complement(566781..567386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE1"
FT                   /locus_tag="BH04870"
FT                   /product="Thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27295"
FT                   /db_xref="GOA:A0A0H3LWR3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27295.1"
FT                   /translation="MKLDPFYPIVDNADWVERLVPLGIKLIQLRMKNENLKTIREHIKR
FT                   AKNICDKLGAQLIINDHWTIAIDEKCHFIHLGQEDLRNADLPAIRKNAIRFGLSTHDEH
FT                   ELDIARSVDPDYIALGPIYPTILKEMKWMPQGLEKIKQWRKQIGALPLIGIGGLTPERA
FT                   IGVLKAGANSAAVVTDILLHKKPEKRVRQWIKVTQAWR"
FT   CDS_pept        complement(567383..568156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BH04880"
FT                   /product="Thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04880"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27296"
FT                   /db_xref="GOA:Q6G480"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G480"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27296.1"
FT                   /translation="MLNLYGHKFSSRLMLGTAQYPSPAILRDAIHKSNTEIVTVSLRRE
FT                   TAGGKQGGQFWQFLKELDITVLPNTAGCYTVKEAVTTAKLARDLFKTSWIKLEIIGNPD
FT                   TLQPNVFSLVEAAKILNSEGFKIFAYTTDDLIVAEKLLDVGCQVIMPWCAPIGSAKGPH
FT                   NTDGLRSIRAYLPDVTLVIDAGIGRPSHATVAMELGYDAVLLNTAVAKAADPVLMAEAF
FT                   SKAIQAGRMGYKAGILEARNVAVPSTPIIGKAVFS"
FT   CDS_pept        complement(568160..568357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG1"
FT                   /locus_tag="BH04890"
FT                   /product="Thiamin biosynthesis, thiG1"
FT                   /db_xref="EnsemblGenomes-Gn:BH04890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27297"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J806"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27297.1"
FT                   /translation="MQIFVNGETIETEVITLNLLLEELGYEGNWLATAVNAEVVPIDAR
FT                   SRCVLHEGDKIEILSPMQGG"
FT   CDS_pept        complement(568361..569311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BH04900"
FT                   /product="Thiamine biosynthesis oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH04900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27298"
FT                   /db_xref="GOA:A0A0H3M2W9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27298.1"
FT                   /translation="MKNILIKGAGVGGLTVAFMLQQKGVSVTISAPPHSPVGTASWYAG
FT                   GMLAPYCEKENAEQIVEDLGIQAIQWWHKTLPNLVIRKGTLVVAPTRDRGELERFSART
FT                   HHHKIINGEEIAHLEPDLAERFNHALFYENEAHLDPRQALITLKEDLIKNGVCFVDIET
FT                   SEKKFDLVIDATGIARLGKDKNIRGVRGEMLLVRSTDIKISRPIRLLHPRFPLYIVPRQ
FT                   DNIFMIGATMIESDFDGAISIRSMMELLNAAYTLHPAFAEAEIIESGVGIRPSYPDNFP
FT                   SVYKYGNHISINGFYRHGFLLSPEMATRAMKLALE"
FT   CDS_pept        complement(569308..571140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BH04910"
FT                   /product="Thiamine biosynthesis protein thiC"
FT                   /db_xref="EnsemblGenomes-Gn:BH04910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27299"
FT                   /db_xref="GOA:Q6G477"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G477"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27299.1"
FT                   /translation="MQKNIPSISCSPFPASRKIYQQSPLFSDVQVPLREISLTDGSAEK
FT                   SLNIYDTSGPYTDNDIIIDITNGLPAISLPWLSKRADTEPYPARPVKPEDNGLLYDKTP
FT                   PPAFKQKRPILRAKNGKAITQMAYARAGIITAEMEYVAIRENEGLTVKDQPKAQPDKIC
FT                   NGSIPEIYTAEFVRNEIACGRAIIPHNINHPECEPMIIGRNFRVKINANIGNSAVTSSM
FT                   AEEVDKMVWAIRWGADTVMDLSTGRNIHNIREWIIRNSPVPIGTVPLYQALEKVQGIAE
FT                   NLTWDIFRDTLIEQAEQGVDYFTIHAGLRLPFIPLTIDRITGIVSRGGSIMAKWCLHHH
FT                   KESFLYEHFDEICDIARTYDISLSLGDGLRPGSIADANDEAQFAELKTLGELTKVAWAK
FT                   DVQVMIEGPGHVPMHKIKENMEQQLDLCHEAPFYTLGPLTTDIAPGYDHITSAIGAAMI
FT                   GWFGTAMLCYVTPKEHLGLPDKNDVKTGVITYKIAAHAADLAKGLPRAQLRDNALSRAR
FT                   FDFRWYDQFNLSLDPETACAFHDETMPKEAHKLVHFCSMCGPKFCSMRISHDIRDTVHR
FT                   KIKDEGMVAMAEKYQKNGDLYIDVSPPQKKIVNH"
FT   CDS_pept        574225..575205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH04920"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27300"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27300.1"
FT                   /translation="MSNIYDWSLKADENAHSDNIINWAEGQPPSSVNDSARAMMQRVRE
FT                   YLADNGGSLDSTFIVNAEDKTTSIIVTTASPIEEYKNDIIIRFKAGGVNVGTTTVIVNN
FT                   IEEKLLYKATNAGVTPLEGGELQRDAIYEMVYNKDVSMEDHGGWYLLNPTPLPPPKIET
FT                   FPSGFIATFAMQEVPSGWLLCDGAVYERKDYPQLFKAIGDKWGKDSDTTFKVPDFRGMF
FT                   LRGFDDGRGLDAGRQFADQQHDSIRSHTHIGTIEEAGEHTHKFQYYGVGWDSGDIGRRN
FT                   PFYYRQSSTGVTQSAGAHTHDISLSPTGEAETRPVNTTVVYAIKS"
FT   CDS_pept        complement(576455..577255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="BH04930"
FT                   /product="hmuV protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04930"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27301"
FT                   /db_xref="GOA:Q6G475"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G475"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27301.1"
FT                   /translation="MIEAVDICVQRGKKQILKHVDLQAKNGAITVIIGPNGSGKSTFVK
FT                   ALSGEIPYSGKMTLNGHDVTQTKTSKMATMRAVLPQSTTLAFPFLVHEVVELGLSINKF
FT                   TIAKKQFQNLPQKTLERVGLADYGHRLYHQLSGGEQARVQLARVLCQIWEPICNKIPRW
FT                   MILDEPIASLDIQHQLVVMNIARNFAHRGGGVLAILHDLNLAAHYADKMILLKQGKVYC
FT                   EGSASTVLTTQNLRDVYSCSLNVSELPQADIPFILPQTAQPLMK"
FT   CDS_pept        complement(577252..578349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="BH04940"
FT                   /product="Hemin ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27302"
FT                   /db_xref="GOA:A0A0H3M563"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M563"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27302.1"
FT                   /translation="MLDTPSIVHTSETKENKRVSRANLAKILLLSLIVFLIFSIFGGLL
FT                   HGASKASFIDFLHVMLTQDFSMSSRTRDYLILIDIRLPRIILGVLVGAALAVSGVLMQG
FT                   LFRNPLADPGIVGVSAGAGLGAVLAIVVGIAFPSSLAPFLEPYKVIIGAFCGGLLSTIV
FT                   LYAIATRHSCTSIATMLLAGIALGALSSAVVGTLIFIANDQQLRDITFWNLGSLAGATW
FT                   LKVWLVFPFICIGLLFSPFLSRALNALALGEAVAGHIGFHIQRIKNIAIFLVALMCGSA
FT                   VAISGGIGFIGIVVPHILRQLIGPDHRYLIPCSALLGAALLIFADTFARLIVAPAELPI
FT                   GIVTALFGAPFFLWILICKRGINFS"
FT   CDS_pept        complement(578351..579256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutB"
FT                   /locus_tag="BH04950"
FT                   /product="Periplasmic hemin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27303"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27303.1"
FT                   /translation="MFTLLLHKRPKFFLICILLFFTFFSKQVVAEPVTHFPENARIVSI
FT                   GGSLTEIVYALGAQDQLVARDSTSVYPQQALKLPVLGYMRALSPEGVLSLAPEGILLVE
FT                   GSGPASTIDILKKTSIPIVIIPENYSRESVIEKIRLVGKALHREMQAATLIEKINRAFV
FT                   DNDALLAKVTKPKRVLFVLSVQNGRIMASGTGTAADGMIKLSGGINAITGYKGYKLLNS
FT                   EALLKANPDVILLVKHGENSTNIDKILALPAIQATTAAKNQAIKQMDAMYLLGFGPRTA
FT                   NASKELIDMLYGVGQNGKSL"
FT   CDS_pept        complement(579273..580316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemS"
FT                   /locus_tag="BH04960"
FT                   /product="Hemin degrading protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27304"
FT                   /db_xref="GOA:A0A0H3LW57"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27304.1"
FT                   /translation="MSYTAEMIIRLREEKKEMRNRDFAISIGISEAELIAAYCTIGKAK
FT                   RLKTDIAVLLENAPQLGTVMALTRNEHAVHEITGCFEKIVQNQHVLLTLGEIDLRIFAK
FT                   QWKFCFEYEAIVLGKPTKSLHFFDQNGVAIFKLYSKDTTNMAEWNKLVDKLLHEDQSPV
FT                   LDIPPKAIPNKRDIVELNVEEFRDRWRKMTDVHQLHGIISELKINRHDAVKYVGNEFAH
FT                   ELKREAIEIMLNQVAQQEVPIMCFVGNKGCIQIFSGQIKNIKQMGPWLNVLDKKFHLHL
FT                   LIPGIKNVWCVRKPTSDGHVTSLEVFDENDEMIIQFFGMRKEGQKEREDWRSLLNSLPQ
FT                   SHAVAVA"
FT   CDS_pept        complement(580571..582748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutA"
FT                   /locus_tag="BH04970"
FT                   /product="Heme receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH04970"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27305"
FT                   /db_xref="GOA:A0A0H3M2X2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2X2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27305.1"
FT                   /translation="MRIRQKNIYKGCAILSALSVSIPSFVFAQSNNLGSVTELKPIIIK
FT                   EKNIENVSDSITILTNRKTAKDIDEKQISDVHDVSRLNPSVNYNSRNNSFVIRGLDANR
FT                   VLTTMDGIALPWFDDIVRGRGGNTTFDFNALSTFDVIQGSDSSLYGSGALGGVVALRTL
FT                   NPEDLITENKNWGSLIKGGYHSVDNSWHIDQAIALRNKQTFVLFQGSHVEGHERKNMGT
FT                   VEGYEERTRKNPAQFDKNNLLFKIHQYFNGNHRFGLTAERFNYNINTHSLNASTRYAPG
FT                   SVYDQDNKRRERFSLSYNYNGNEDALFDAFSGQLYWQKQISRHIMNGFRVKAPEGDYLR
FT                   DNFLRDTSYGFNTHALKKMNIGTVSHTLKLATNVSSSQFHHYLLGKDNCHLKEYAQGCA
FT                   FLPANRSDSPDTNSYNFGFALENQIGFADDHFRVTPGVRYDWYKHIPQKTSSYEKALIS
FT                   DKYPPERNGSRFSPKLRMEWDVRDQVTFYVQWAQAFRAPRVSELYLSYVKPPLYYVKGN
FT                   PDLKSETSNGYDIGIRYGNANFGGSFNAFTNRYKNFITTEDKGSSEEFRFGRRHYVNLS
FT                   NVRIFGVETKMHWVLNNGFHSNFALAYSQGKDLDKNEYLNSIPALKAIIGVGYAKDTWG
FT                   ADVVVTSSAKRDKVAKGSDYQKIPGYKVVDVSGWWKPFDKKGLVVRAGIYNLFNEKYWN
FT                   VSDLPDGKSSTPKDYYSQPGRNFKVSFVQRF"
FT   CDS_pept        582990..583781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="BH04980"
FT                   /product="tonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH04980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27306"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27306.1"
FT                   /translation="MNFSDTRRLLALWIGAFFGAFFFHIALGAQFYFPSIGVRNGTLSS
FT                   TIMLTFAQETVYPDVDTNMPDLNADLSDLSTEPSIEPEMLQPDLSEQESEILEPEDEVQ
FT                   PEEPQWNGEKNDFSLLKPVKESLPPKVEHKVFNKKPIPILKTAVKHSIVEPRSSTTSQI
FT                   SRIAALEDALLMKWLAKVQAQLEKQKNYVIGQRTSGAKGTVKLEFRVHEQGNIFSSRVV
FT                   VSAGDPELDRLAMVALQRVGFFPPPPPSKVNKIIRVSLIFS"
FT   CDS_pept        complement(583909..586011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="BH04990"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH04990"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27307"
FT                   /db_xref="GOA:A0A0H3M567"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M567"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27307.1"
FT                   /translation="MYAFFIFSFVSTFTALILEATILFSSACAQTTLLHRQIPIPLVRP
FT                   TPFVIKKQATKPFRQIHTTPHNIPTFTNTSTLKKLKAGLDALSNNNIAKTISLRNSMEK
FT                   DSLDRHILTWAIGISSKTNVPSSEIFNAIKELKGWPGIAAMQRNAERAFINETNFAPVI
FT                   IQKFTHHLPLTAQGIATYAKALITTGQTARARQIIAPWWHKTKLNAQEEEFVLKNASAA
FT                   LQPIDHLKRMQFMLYAHRFDSAKRVAKLAHAQSLFKAFIAVEKSDPQAAQKLHSVERSW
FT                   QKSPLLQFAYIRHLRRTGQYSEAATRMMRTPKNILRLMNPHALWREQRALSREMLDLNK
FT                   PKIAYKLVATHTGMKASLTIDAEFHAGWYALRFLHNPQLAMQHFSRIPQLSSAPLSASR
FT                   GYYWMGRTAEILGEHKNAQHYFHRAAHFSATYYGQLAASRLNQKKLEISFPKPTTSERQ
FT                   RFSARKAIQAIQHLESAGYSDFAKIFYRELGEKIESPGELALLAVMAEKNGDYYTSLKI
FT                   GKTAVFQGKNVGALSHPLGAIPTSANISVAGKALIYAIARQESEFNPKAISKAGAQGIL
FT                   QLLPTTAKALAKKHSIAWSQKKFSSDASYNATLGAHFLREQLERFNGSYILALISYNAG
FT                   PRRVNEWIKRYGDPRGQPLDKVIDWIERIPYTETRNYVMRIMENYGVYKARLTGKTDIK
FT                   ADLLSG"
FT   CDS_pept        586259..587143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BH05000"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05000"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27308"
FT                   /db_xref="GOA:Q6G468"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="PDB:3SI9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G468"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27308.1"
FT                   /translation="MLKGAVTALITPFDDNGAIDEKAFCNFVEWQITQGINGVSPVGTT
FT                   GESPTLTHEEHKRIIELCVEQVAKRVPVVAGAGSNSTSEAVELAKHAEKAGADAVLVVT
FT                   PYYNRPNQRGLYTHFSSIAKAISIPIIIYNIPSRSVIDMAVETMRDLCRDFKNIIGVKD
FT                   ATGKIERASEQREKCGKDFVQLSGDDCTALGFNAHGGVGCISVSSNVAPKLCAQLHAAC
FT                   LCSDYKTALKLNDLLMPLNRAVFIEPSPAGIKYAAAKLGLCGTIVRSPIVPLSDTTKKI
FT                   IDEALYHAGLLKE"
FT   CDS_pept        587159..587635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BH05010"
FT                   /product="SSRA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27309"
FT                   /db_xref="GOA:Q6G467"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G467"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27309.1"
FT                   /translation="MNKKKNAPVRKIIADNRKARFNYEILDNLEAGLVLQGAEVKSLRS
FT                   NHANIAESYASFENGELWLVNSYIPEYTQANRFNHEPRRLRKLLISKREMARFFNATSR
FT                   EGMTLVPLKLYFNERGRAKLEIALARGKKLHDKRETEKKRDWGREKARLLKRYG"
FT   CDS_pept        complement(587682..588350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27310"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27310.1"
FT                   /translation="MNSQLKSLCPEPPQNCDLCPRLHKFISDWRIKEPSWYNAPVRPFF
FT                   PYKGADTTRLLIVGLAPGLRGANRTGRPFTGDYAGHLLYSTLKKFGFAQGTFEERADDT
FT                   LELIDAAIVNSVRCVPPENKPTGAEINTCRYFFSPLLTNLPKLKAVITLGTIAHHSTLR
FT                   ALNAKVLAHPFGHGQINNIGRLRIFSSYHCSRYNTNTGRLTDAMFHQIFEAAKTYLDQS
FT                   "
FT   CDS_pept        588900..589298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BH05030"
FT                   /product="DNA-directed RNA polymerase omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH05030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27311"
FT                   /db_xref="GOA:Q6G465"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G465"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27311.1"
FT                   /translation="MARVTVEDCIDKVDNRFELVLLAGHRARQISQGAQITVDRDNDKN
FT                   PVVALREIAEETLSPADLKEDLIHSLQKHVEVDEPEMASEFISHSSEAGGVLGTSSEEE
FT                   GSSFDHMSEEELLAGIEGLVVPEKSDDY"
FT   CDS_pept        589428..591653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="BH05040"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27312"
FT                   /db_xref="GOA:A0A0H3LW63"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27312.1"
FT                   /translation="MMRQCELVGRVQRYKSDVDEGLLNRAYDYAMRKHGHQKRASGDLY
FT                   FSHPLEVAAILTDMRLDEATIAVALLHDTIEDTSATRAEIDQLFGSEIGKLVEGLTKLN
FT                   KLDLVSKKAVQAENLRKLLIAISDDVRVLLVKLADRLHNMRTLGVMRDDKRRRIAEETM
FT                   DIYAPLAGRMGMQDMREELEDLSFFYLNPEGYRTITNRLSELSKRNRDLLSRIENELTK
FT                   LFFKNGIKADVKSRQKKSYSVFRKMESKALSFEQLSDIFGFRVIVETVNDCYRALGVIH
FT                   TTWPMVPGRFKDYISIPKQNDYRSIHTTIVGPSRQRVELQIRTADMDEIAEYGVAAHSI
FT                   YKDHGSNYSTSKLSNETNAYAWLRQTIQSLSDGDNPEEFLEHTKLELFQDQVFCFTPKG
FT                   RLIAFPKGATPIDFAYAVHTDIGDSCVGVKINGRIMPLMTKLKNGDEVDIIRSQAQIPP
FT                   AAWEFLVVTGKARSAIRRATRTAVRKQYSGLGYRILEHSFGYMGKQFSKDVLKQVLPRL
FT                   ARKDVEDVLAAVGRGELPSADVIKAVYPDYQDHRVVQKSSFKPGEEGWFNIENAQGMIF
FT                   KVPENEKDSTIEKHQSKALPIRGTRGDIPVRFSPEGAVPGDRIVGIMQPGAGIVIYPIQ
FT                   SSALMAYDDQPERWIDVRWDIDAQMSERFPARINILAVNSPGSLAEITQVISANDANIQ
FT                   NLSFIRTAPDFTEIMIDLEVWDLKHLNRIFSQLKKAGSVSTVRRGHG"
FT   CDS_pept        591671..592249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BH05050"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27313"
FT                   /db_xref="GOA:Q6G463"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G463"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27313.1"
FT                   /translation="MNTQDVIDIFKQADAILEGHFILTSGRHSATYMQKAKVFMHAHLT
FT                   EKLCRGLAEKIKKSVEEKIDYVVGPAIGGLIPSYETSRHLGIPSLWVERVNGRFELRRF
FT                   EIKKGARVVIVEDIVTTGLSIRETVEALVTAGANVLASACILDRSGGKVDVGVPLISLA
FT                   EYEIASYASDAVPAELAELPAIKPGSRNI"
FT   CDS_pept        592343..592945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27314"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27314.1"
FT                   /translation="MLFRSREPIDFVKRIRLWLWPRRSFSRSFCYIRKRILRISATPHK
FT                   VALGFSIGIFLACSPLFGMHIVLAIFFSWILRANFAAAIIGTIFSNPLTFFLIIMADYK
FT                   VGSFCLSLFSDVSEISLSQIRTLFDGLALSNTSLLFKGAWQSIMRPMILGGVLLGFIFG
FT                   GLSYIGAYRAITRFQQKRYQKITKKKRLWQRKSGDIL"
FT   CDS_pept        592942..593343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BH05070"
FT                   /product="Acyl carrier protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27315"
FT                   /db_xref="GOA:Q6G461"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G461"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27315.1"
FT                   /translation="MIVGLGSDLTDIRRIERMLARYGDRFVQRIFTDIERNRSESLQKK
FT                   SSSYAKRFAAKEACAKALGTGIACGINWKDMGVINLPSGKPIMKLTNRAQMQLQKLLPS
FT                   HHDAIIHLSMTDDFPWAQAFIIIEAFPRG"
FT   CDS_pept        593424..594236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lebB"
FT                   /locus_tag="BH05080"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BH05080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27316"
FT                   /db_xref="GOA:A0A0R4J753"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J753"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27316.1"
FT                   /translation="MIQKEKMHKNKEKSGILEFVFVLVQALLLAALIRTLFFQPFSIPS
FT                   GSMRPTLLVGDYLFVSKYAYGYSRFSMPFSPPLFSGRILASQPQRGDVVVFRLPSNPDI
FT                   DYIKRVVGLPGDRIQVRQSILYINDEPVSRHFMGKVENVDITEVNYPVKVYRETMPNGV
FT                   SYDTLDLAFIPQVDDTKVFEVPSGHYFMMGDNRDNSDDSRLDVGYVPEENLIGRASIIF
FT                   FSISNGSSAWQIWRWPFDVRWNRLFSFINTVHDLPLIKQGINDEASND"
FT   CDS_pept        594217..594924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BH05090"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BH05090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27317"
FT                   /db_xref="GOA:Q6G459"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G459"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27317.1"
FT                   /translation="MKLPMIDQLEKLTGHYFKDKKKLKKALTHSSVQGSEQGNYERLEF
FT                   LGDRVLGLLIAEMLYQLFPQASEGELSVRLNSLVNAQTCADIALEMELPVMIHVGFEMK
FT                   NLKGRRLTNMYADVIEALIAVIYLDGGLESVRPFIQRYWQSRAKQMDAGRRDAKTQLQE
FT                   WAHVQGGVQPHYRVVKRSGPDHDPVFMVEVSIPGFASEIGQGNSKRCAERMAAEKILRR
FT                   EGIWETMEKNNHE"
FT   CDS_pept        594917..595819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="BH05100"
FT                   /product="GTP-binding protein era homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BH05100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27318"
FT                   /db_xref="GOA:A0A0R4J6U9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6U9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27318.1"
FT                   /translation="MNDVMKTRSGFVVLIGMPNAGKSTLVNQLVGTKVSIVTHKVQTTR
FT                   TLIRGIVIHDNAQIVLIDTPGVFSPHKRLERAMVSAAWGGAKNADVLLVLIDAQNGLSD
FT                   EVCKMLDIVANIKQDKILVLNKIDTVAKSSLLALTAGINEHVKFLQTFMISALKGSGCK
FT                   DLLHALSTMMQEGPWYYPEDQISDMPMRQLAAEITREKLFLRLHDELPYSSTVETENWE
FT                   ERRDGSVRINQVIYVERDSQKKIVLGAKGDTIKAIGQAARKELMDIMGQKVHLFLFVKV
FT                   RDNWDTDPERYREMGLDFF"
FT   CDS_pept        595825..596595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="BH05110"
FT                   /product="DNA repair protein reco"
FT                   /db_xref="EnsemblGenomes-Gn:BH05110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27319"
FT                   /db_xref="GOA:Q6G457"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G457"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27319.1"
FT                   /translation="MKWKEQAIILGTRQYGETSVILEVMTRQHGRYMGVVKGGRSRRMA
FT                   VLLQPGNFVEAEWWARLDEHLGLFRLEALDLHAARLILFPEALYALQLIVFHLHLLPER
FT                   DPHPILYDILHLFMQSFDEPFINAELLVRFEMRFLEELGFGLDLSRCAATGRLEKLCYV
FT                   SPKSGRAVCEEAGHPWREKLLNLPQFLVQRTVRPVDFSDIKNGFILTGFFLMRHVWEPR
FT                   NIKQPSVRISLIQLFEQRFRMQASFVDLKTINRM"
FT   CDS_pept        596745..597605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="BH05120"
FT                   /product="Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27320"
FT                   /db_xref="GOA:Q6G456"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G456"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27320.1"
FT                   /translation="MKMRVLKTIPEVRQSITEERRLGFSIGLVPTMGALHNGHIALVRR
FT                   ARAMCDRVLVSIFVNPKQFGPDEDFDKYPRDLKGDCALLEEAGVEYLFTPSVEEMWPPG
FT                   NETIVNVEKLSRMLIGKLRPGHFCGVTSVVAKLFNIVQPDKAFFGEKDFQQILIVRRMV
FT                   EDLAFPIEVVGVPVLREADGVASSSRNQFLTLEDRKAAKIIPESGKAAENLYRQGERSV
FT                   DKLCKIVRDILQQESRAIIESIDLRDMETLSVVKGRLDKSAVLLLTVRFGEIRLIDQYI
FT                   LQEKG"
FT   CDS_pept        597609..598436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="BH05130"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27321"
FT                   /db_xref="GOA:Q6G5H3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27321.1"
FT                   /translation="MTIHKAVKRITASEIRSRKGQEPIVSLTAYQAYSARIADPYCDLL
FT                   LVGDSVGMVVHGFETTLPVSLDMMILHGQAVMRGSKRALVVVDMPFGSYEESPEQAFSN
FT                   ASRILAETGCSAVKLEGGVYIAETIDFLCKRGIPVMSHVGLTPQAVNRFGGFKTQGRNE
FT                   SNWQQIEADAAAIEKAGAFAVVVEGVVEPLAVKLTQMLSIPTIGIGASSQCDGQILVME
FT                   DMLGYGTWVPKFVRRYGVLEQEMEKAIKSYADDVKSRTFPSDEEIYKLKQKSG"
FT   CDS_pept        complement(599750..600370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27322.1"
FT                   /translation="MAKAQLSQNGEARAWQRMLSGRRLDLLNPSPFDIEIEDIAHGLAR
FT                   VARWNGQTQGEYAYSVAQHSLLVEQIFQKLFPQSQNNECLCALLHDAPEYVIGDIISPF
FT                   KAVIGKQYELIEKRIQDAIHMRFSLPVAPSQKLLKKIKQADRIAAFHESIILAGFNTEE
FT                   ALRYFGHPNNISPEGLNLQPCSTTKIENAFLKRFHDLDVERLH"
FT   CDS_pept        complement(600379..601236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27323"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27323.1"
FT                   /translation="MIEKPNAICLKNRKIIKVTGEEATHFLQALITTDVKKIGLQEIFP
FT                   GALLSPQGKVLADFLIGKREDGYFIDIFSSLSDLLYKRLLLYKMRTKVEIMQPLQEFVT
FT                   VSWENETDSLNFYSSFIDKRFPAKEKIIRIYGETPFLASECHDNWNRLRIRYAIPESDK
FT                   DYEIGKVFPHDINYDQINGLAFNKGCYIGQEVVSRMHHRRAARRRILLVKSQHELIPGA
FT                   NIVAGTKILGSLGTCAANEALALMRIDHIKDAMDHNTPFTVKDVPVTISIAENMNFTFP
FT                   ESTV"
FT   CDS_pept        601302..602630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC1"
FT                   /locus_tag="BH05160"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27324"
FT                   /db_xref="GOA:A0A0R4J6Q5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27324.1"
FT                   /translation="MFKTFDTIFKGATVVNHDGSGKRDIGITNGRIAEIGDLTRASAGE
FT                   VVDCIGLHILPGIIDSQVHFREPGNEHKEDLESGSRSAVLGGVTAVFEMPNTDPLTISE
FT                   ETLIDKIKRGFHRMHCDFAFWVGGTRENAHELVELERLFGVAGIKVFMGSSTGDLLVDD
FT                   DESVRLILKNIRRRAAFHSEDEARLRERKMLRIEEDASSHSVWRDEVAALKCTQRLVKI
FT                   AHETKARIHILHLSTAEEIDFLKNHKDVATIEVTQHHLTLTADDYQRLGTLIQMNPPIR
FT                   ESRHREALWYGVQQGIIDILGSDHAPHTLEEKFQPYPASPSGMTGVQTTAAIMLTHVNA
FT                   GKISLERFVDLTSHGPSRIFGISRKGRLAVGYDADLTIVDLKREEIITNVLIGSRAGWT
FT                   PYDGKKVKGWPVGTIIRGMRVMWEGEIVTPSQGEPVKFTEVLV"
FT   CDS_pept        complement(602859..603230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27325"
FT                   /db_xref="InterPro:IPR012645"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27325.1"
FT                   /translation="MSNILIKIAILTFCLTSTPTFAQQSPPYDTKLLRLAEILGALHSL
FT                   QNLCSTPTNHWYDYMNLLIEAEKPTPQRRAYFYEAFNETYRAFSENYHRCTKSAIESHQ
FT                   RYVKEGKFLSENLLMHLNN"
FT   CDS_pept        603757..605268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BH05180"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27326"
FT                   /db_xref="GOA:Q6G5G9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5G9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27326.1"
FT                   /translation="MRELRFYNTLTRKKENFIPIDATRVRLYVCGPTVYDYAHIGNARP
FT                   VIVFDILFRLLRHVYGNEHVIYARNITDVDDKINARAAYEYPELALNDAIRQLTQLTYT
FT                   QFQQDTMALGCLPPTIEPRATDHLEEMRSLIERLLEKGHAYKAENHVLFSVSSIRNDPH
FT                   YGSFAKRSLDEMRAGARVDVASYKREEMDFVLWKPSAEGEPGWTSPAGIPVLGRPGWHI
FT                   ECSAMSMAKLLAPYGGGLTCDDPTENVFDIHGGGLDLIFPHHENEIAQSCSAFGTERMA
FT                   NLWMHNGFLQVEGKKMSKSLSNFITIRSILESDFFEFNGVLTNEMKQNWAGLSARFSML
FT                   QTHYREPLNWTAQRLMQSSSELYRWYELLRCEKTEMEKKNEVIDDSLINALSDDLNTPK
FT                   ALTLLRKFYKRGNAVSLASGMNFFGLLRQEWVRDGKCPLFMRKTSLDEKFIDQRIAERL
FT                   RLIHNKEWTAADTIRDKLAAEGIVLKDIKDPQTGERTTMWEIKRF"
FT   CDS_pept        605311..605985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27327"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27327.1"
FT                   /translation="MEFLSYYGYVALKLIVGLVAFLFILRTMGRSSLSQMTPVDLVSNF
FT                   VMGSIIGGVIYNHNISIIQLLLVLFIWQTLITSLNLWGRHSVFFRHLVMGRSIALVLDG
FT                   VFQMDEIKKLGISVNDLITMLRIKGCNLHEAAFVRLETNGDYTVIKKEEGKKSTILVQS
FT                   GKILDDGLKEIGKSKKWLQAELKKKHVKVENLFAAEWYEKNTDQTNKSSQGLFLVPFSK
FT                   TV"
FT   CDS_pept        606108..607991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05200"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27328"
FT                   /db_xref="GOA:A0A0H3LWS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27328.1"
FT                   /translation="MKRNKIVKTVSSDTGQTLRTLYNLWPYMWPADRRDLKMRVIWATF
FT                   YLILAKLILISVPYFFKYATDALNVNLEFPVWFPSSWVVPLMLVLAYNVARIIQAGLNQ
FT                   LRDALFATVGQHAIRRLAYKTFVHVHELSLRFHLERRTGGLSRVIERGTKGIEAIVRFS
FT                   ILNTVPTILEFVLTAFVLYVSYGWHYFLIVVVTVVLYTWFTIKASDWRIRIRQEMNTAD
FT                   VEANTRTVDSLLNFETVKYFGNETLEACRFDSSMAGYEKAATKIWTSLGWLNFGQAFIF
FT                   GIGMTTLMLMSAYEIFYKTQTLGDFVFINALLIQFSIPLNFIGSIYRDVRQGLTDIEAM
FT                   FDLLDVQKEISDKLDAKSLVVNNGSIRFNQVKFSYDQNRQILKDINFEVPGGKTVAIVG
FT                   PSGAGKSTISRLLFRFYDVDAGSITIDGQDIRNVTQKSLREAIGMVPQDTVLFNDTIAY
FT                   NIYYGRPSATEEEMHKAAEMAQISKFIEMLPEGFQSMVGERGLKLSGGEKQRVAIARTL
FT                   LKAPPLLILDEATAALDTATEQEIQQALDIISRGRTTLIIAHRLSTVINADEILVLKNG
FT                   RIIENGTHTELLRKKGLYASMWNKQLEASQAEEKLRKMREEDELGVVNRKK"
FT   CDS_pept        608107..608805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psdA"
FT                   /locus_tag="BH05210"
FT                   /product="Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27329"
FT                   /db_xref="GOA:Q6G5G6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27329.1"
FT                   /translation="MSILQSVHNSFAPIHKEGYPFIIAFFVISLILGWVWSPLFWCGLV
FT                   LTVWCIYFFRDPERVIPLNPNWIISPADGRISFVGPCIPPEELGLGNAEMIRISVFMDI
FT                   FSCHINRVPISGKVESIIYHPGQFANAELDKASQFNERNGVVIDSKHGKIGVVQIAGAI
FT                   ARRIVCWSQEDDSVVTGQRFGLIRFGSRLDIYIPNEVKLRVTVGQTSIAGETVLGSFDD
FT                   KSATTEFRFD"
FT   CDS_pept        608814..609653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BH05220"
FT                   /product="Phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05220"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27330"
FT                   /db_xref="GOA:A0A0H3LW73"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27330.1"
FT                   /translation="MGNFSLFSSFNPEGQHDDVANRWRSPTPMRYIIPNIITILAICAG
FT                   MSSIRLAFEHRYEAAILMVLLAAILDGADGRIARLMDGSSSFGAQMDSLADVINFGVAP
FT                   SLIVYSFVLNQAHQVGWIAGLVYCVACCLRLARFNVMLDNTDIPKWQGNYFVGVPAPAG
FT                   ALLLLLPMYLGALGLVPSWSWALFFSLYTVIIAFLLVSRLPVWNGKTINQNLRRDIVVP
FT                   CMLGIVIYVGFLATYTWHTLLITAVSYMIFLPCSFVAYNKRAALEEKKANIKTLSSS"
FT   CDS_pept        complement(610229..610978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05230"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27331"
FT                   /db_xref="GOA:A0A0H3M2Y6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27331.1"
FT                   /translation="MKKLDFSLFGRVALVTGASRGIGYHLALELAERGAHIIALARTMS
FT                   GLTELDNQIQKKGARATLIPIDLHHMENIDALATSITQDWKKLDIMIANAGILGTLSPI
FT                   AHIENKVFEDIFQINLISQWRLMKAVEPLLRKSDAGRVILLSSSVAHVARAFWGPYAAS
FT                   KAALEIISRCWAEELKQTPIKINCVDPGATRTAMRAQAMPGEDPQTLPPPQEVAEKIAH
FT                   LLSPDLKETGKLFNVRKNRFMNYHAPN"
FT   CDS_pept        complement(610981..612507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BH05240"
FT                   /product="Amidophosphoribosyltransferase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BH05240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27332"
FT                   /db_xref="GOA:A0A0H3LXW3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27332.1"
FT                   /translation="MNRFSHHNRKNTMTKIDIPFQEFSLNDDTLHEECGVFGILGHEDA
FT                   ATLTALGLHALQHRGQEAAGIVSYHNKMFHQEKHLGLVGDHYTNPATLARLPGNRAIGH
FT                   TRYSTTGEIALRNVQPLFAELKAGGIAIAHNGNLTNGLTLRRELIASGAICQSTSDSEV
FT                   FLHLIARSRYESSSDRFVDAIRKVEGGYAMLALTRTKLIAARDPIGIRPLVMGELHGKP
FT                   IFCSETCALDIIGAKYIRDVKNGEVIVCEIQKNGEITTKIIKPENKKPEKLCLFEYVYF
FT                   ARPDSIVGGRSVYMTRKNMGIRLAQEAPCEGDIVVPVPDGGTPAAIGYAQEIGIPFELG
FT                   IIRNHYVGRTFIEPTQQIRAFGVKLKHSANRPVIEGKRVILVDDSIVRGTTSVKIVQML
FT                   RDAGAKEVHMRISSPMIFYPDFYGIDTPKVESLLANQYPDLKAMCNFVGADSLEFLSTN
FT                   GLYLAVIGEKRNNADPQFTDHYFTGDYPTHLVDQESIPKIYQSSVLKTRD"
FT   CDS_pept        complement(612550..613131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="BH05250"
FT                   /product="Colicin v production protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27333"
FT                   /db_xref="GOA:A0A0R4J6N2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27333.1"
FT                   /translation="MIITVLDGIVVAVILFSAFLAMLRGFSREVLSLISWAIAAVVTLF
FT                   LFKPVVPFFEQYISNKMVALITTLIVIFIIVLIITSIITMKISDFIIDSRIGIFDRTIG
FT                   FIFGALRGLLIMVIGMLLINALVKPEQQPDWLKNAKTKPIIDSLGQKVWNILPKNLDTV
FT                   LEKTEQLFKRNDANTNDQHSHENMSQQNGK"
FT   CDS_pept        complement(613276..614649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BH05260"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27334"
FT                   /db_xref="GOA:A0A0H3LWT3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27334.1"
FT                   /translation="MARIRVQFICQNCGTVHSRWAGKCNSCGEWNSLIEENANSGIGTG
FT                   PKQNVHKGRVVALTSLSGNIEDAPRIHSGIAELDRVTGGGFVRGSVLLVGGDPGIGKST
FT                   LLTQTAAALSRKGHHVIYVSGEEAVAQICLRAQRLDAANTKVKLAAETNVEDILATLSE
FT                   HKNLDMVIIDSIQTLWSDAADSAPGTVTQVRISAQAMIRFAKKTGAAVVLVGHVTKEGQ
FT                   IAGPRVVEHMVDAVLYFEGEGGHHYRILRTVKNRFGPTDEIGVFEMSDKGLREVINPSE
FT                   LFLGERNEKAPGAAVFAGMEGTRPILVEIQALVAPSSLGTPRRAVVGWDGNRLSMILAV
FT                   LEAHCGVRFGQHDVYLNVAGGYRISEPAADLAVAAALVSSLTNIPLPTEYVYFGEISLS
FT                   GAIRAVSHSAQRINEAQKLGFQGSVQPTTTTKMIKLPTFQQKTFSELSELIAALATGK"
FT   CDS_pept        complement(614655..616142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BH05270"
FT                   /product="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27335"
FT                   /db_xref="GOA:A0A0H3LW76"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27335.1"
FT                   /translation="MEETSVVNFSSSQKEEASFRELPHNIEAEQALLGALLINNDALDR
FT                   VSDFLKPEHFFEPLHQKIYDVVSHLIKNGKLANPVTIKPFIPAEEKIGDITVFNYVIRL
FT                   AKEAVTIINAEDYGRVIYDLFIRRSLINIGNQVVNTAFDAPLELTPSQQIETVENQLFE
FT                   LAEKGKYGGGFENFNEAIKKAIDMATAAKKRSSHLSGIATHIKTLDEKMGGLQPSDLII
FT                   LAGRPGMGKTSLATNIAFNIANACNHDANTQENEGGIVGFFSLEMSSEQLATRIISEQT
FT                   EVSSSDIRRGSILDEQFSKIIRAMNQLQKAPLYIDQTGGISIAQLAARARRLKRQHGLD
FT                   VLIIDYIQLMTSNSKRSSENRVQEITEITTGLKALAKELNIPIIALSQLSRQVENRTDK
FT                   RPQLSDLRESGSIEQDADIVLFVYREEYYLKNGEPKIGTLEYERWQETMDKAFGKAEVI
FT                   IAKQRHGPTGTVHLAFQSDFTRFSDLADSNYLPEQYG"
FT   CDS_pept        616662..617512
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH05280"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(617741..618361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BH05290"
FT                   /product="50S ribosomal protein l9"
FT                   /db_xref="EnsemblGenomes-Gn:BH05290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27337"
FT                   /db_xref="GOA:Q6G449"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G449"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27337.1"
FT                   /translation="MDIILLERIPRLGQMGDIVSVKDGYARNFLLPQGKALRANEANKK
FT                   HFEIQRAQLEARNLERKSEAEKIAEKLDGKSFIVVRSAGETGQLYGSVSTRDISEIITS
FT                   EGFSIGRNQVELNHPIKTIGLHTIMLSLHPEVQISVIINVARSASEAQRQAEGETLTSA
FT                   EAIYDVRKELLAENQEETFAENQQKALAKEMNDNDANSINEEA"
FT   CDS_pept        complement(618386..619366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27338"
FT                   /db_xref="GOA:A0A0H3M2Z0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M2Z0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27338.1"
FT                   /translation="MKNFRTYEIMTGILAGLFAVVIGMAIISVINIAPYFSFLLGCFLS
FT                   LPIFIVAFGQGTLASLVALISATVVLIIVTNIYIAFGFMLLFFLPAVYASWLLGLARPA
FT                   QKENSLIWYPLSSVIFHLTNFIALISSFIGLYVETHPSTSLIAKKITANIAQAMQQSQS
FT                   LKEADIIAFRELLMTHAATLTAIVLTVYSLIFLIGNLYFSMITAQHMKWLKRPRDDWSK
FT                   TLRLPISGLVIFIGVCIASMIELGLTLNLSARVFSTAYTVVISISGLAYLHNITKGING
FT                   RIIILSLVYIAILTVVFAPPISFMMLLMGIWAAIQYNFQSRNKLH"
FT   CDS_pept        complement(619510..619758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BH05310"
FT                   /product="30S ribosomal protein s18"
FT                   /db_xref="EnsemblGenomes-Gn:BH05310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27339"
FT                   /db_xref="GOA:Q6G447"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G447"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27339.1"
FT                   /translation="MTEMNQTAIRRPFHRRRKTCPFSGTNAPKIDYKDIKLLQRYISER
FT                   GKIVPSRITAISQKKQRELANAIKRARFLGLLPYVIK"
FT   CDS_pept        complement(619758..620165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BH05320"
FT                   /product="30S ribosomal protein s6"
FT                   /db_xref="EnsemblGenomes-Gn:BH05320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27340"
FT                   /db_xref="GOA:Q6G446"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G446"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27340.1"
FT                   /translation="MALYEHMFLARQDIAPQQVDELLNIYKGVIETYGGKVGRVENWGL
FT                   RPLAYRIRKNRKAYYVLVNIDAPATAIAEVERQMRINEDILRYMTIRVEKHEKEKSAMF
FT                   SRLDRNGHIGHDEKHPRSPSRQREDVIEGVE"
FT   CDS_pept        620516..621103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27341"
FT                   /db_xref="GOA:A0A0R4J6I9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27341.1"
FT                   /translation="MDFLNQIDVALFEMFASHHQSWSVLVLFSVFCAKFLIYIIPLHLC
FT                   ALWFCGGDRERRVVLSICVSICMALFIGYLISLVYLRPRPFVVGLTTPLIKHRATASFP
FT                   SNHALTISSYMACFYFYRYKIASRFAAIFLCLICWGRIFVGVHYPFDILAGTILGSLIS
FT                   WGVIQFMVPYFPQFLYQIPPLKYNFKRDIRSK"
FT   CDS_pept        621180..622124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="BH05340"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27342"
FT                   /db_xref="GOA:A0A0H3M584"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="PDB:3QAT"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M584"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27342.1"
FT                   /translation="MGAAFTFPGQGSQLIGMGKVLTEQFVAARMVFEEVDDALSEKLSD
FT                   IIFEGPADVLTLTANAQPALMAVSMAVIRVMEQLGLNVEKKVKFVAGHSLGEYSALCAA
FT                   GTFSLTDTARLLRIRGNAMQAAVAVGEGSMAALIGLDEKDVEEICEIVAEEGLCQIAND
FT                   NGGGQIVISGEAKAVETAVEVASQKGAKRAVLLPVSAPFHSALMQPAANAMKNALLTVN
FT                   KTAPIVPLIANVSVIPESDPERIVSLLVQQVTGRVRWRETIEWISANGVNTLFEIGSGK
FT                   VLTGLARRINKDIKALTVGTAEEIEAALRVLGV"
FT   CDS_pept        622144..622881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BH05350"
FT                   /product="3-oxoacyl-(acyl carrierprotein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27343"
FT                   /db_xref="GOA:A0A0H3LWT6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3GRP"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27343.1"
FT                   /translation="MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKE
FT                   IAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDW
FT                   DDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFS
FT                   KALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVY
FT                   LASDEAAYLTGQTLHINGGMAMI"
FT   CDS_pept        623143..623379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP1"
FT                   /locus_tag="BH05360"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27344"
FT                   /db_xref="GOA:Q6G442"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G442"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27344.1"
FT                   /translation="MSDTVERVKKIIVEHLGVNADKVVEDASFIDDLGADSLDTVELVM
FT                   AFEEEFGVEIPDEAAETIFTVGDAVKFIDKASA"
FT   CDS_pept        623490..624752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF1"
FT                   /locus_tag="BH05370"
FT                   /product="3-oxoacyl-[acyl-carrier-protein ] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:BH05370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27345"
FT                   /db_xref="GOA:A0A0H3LW83"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:3E60"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27345.1"
FT                   /translation="MRRVVITGLGLVSPLAGDVEYSWKRLLEGKSGVRRITEFDVSDLS
FT                   CQIAARIPVGDGTNGTYNADLHMESKEQRKVDAFIVYAIAAADQALADAEWFPKSDEDQ
FT                   ICTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGYVSIKYGLRGPN
FT                   HSVVTACSTGAHAIGDAARLIALGDADVMLAGGTESPINRISLAGFSACRALSTCRNDD
FT                   PERASRPYDVDRDGFVMGEGAAIVVLEELEHAKKRGARIYAEIIGYGLSGDAYHITAPS
FT                   ESGEGAQRSMMAALKRAQVNVSELDYINAHGTSTMADVIELAAVERVLGYYAPQVSMSS
FT                   TKSSIGHLLGAAGAAEAIFCVLAIRDNIAPATLNLENPSIETKIDLVPHKPRERKIDTV
FT                   LSNSFGFGGTNASLVMRRFSE"
FT   CDS_pept        624863..625969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27346"
FT                   /db_xref="GOA:A0A0R4J840"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J840"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27346.1"
FT                   /translation="MSDVNNQRLLKDVDDSSSNHIINNKFLLAKKRKKSFIVRNPLVIL
FT                   GHFFLMLIVVFILAISIPLYIGKSIFEGKGITEKEQVVLIYPGTGIREIASLLEKRGFI
FT                   RSSDVFVYGVGYHQKTTDLKAGEYLIPAYASMRDIMDILVKGKSIEYTFTVPEGLTVQQ
FT                   VFDRLAANEILIGDLPKVLPPEGSLMTDTVHFIRGTTRKEIINRLREGQTKLIHAIWAT
FT                   RSPDLPIKSIDEFVILASIVEKETGIAAERPKVAAVFYNRLAKHMRLQSDPTVIYGLFG
FT                   GKGLPSGRAIYRSDLEKETPYNTYKIKGLPPTAIANPGRDSLKAVAHSPSSDVLYFVAD
FT                   GSGGHVFSRTLEEHNINVRKWRALKATH"
FT   CDS_pept        626035..626703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="BH05390"
FT                   /product="Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27347"
FT                   /db_xref="GOA:Q6G439"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G439"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27347.1"
FT                   /translation="MVTFFENELSAKKRNQRRGFLFILSSPSGAGKSTLSRLLLKDGKL
FT                   ELSISMTTRQKRPSEVDGLHYHFISKKEFKRKRDGNEFIEWAEVHGNYYGTLRESVENV
FT                   LSTGRDMLFDIDYQGTKQLQKKMPGDTVSVFILPPSMKELISRLYRRAEDSQDIINLRL
FT                   KNARTEMQHWRSYDYVIINENLNQSVSLIKSIYLAETVKRERCFFLEPFINGLIAEKID
FT                   "
FT   CDS_pept        complement(626742..627572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BH05400"
FT                   /product="Dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27348"
FT                   /db_xref="GOA:Q6G438"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G438"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27348.1"
FT                   /translation="MPIDSLPPLREVINTYGLQAHKSLGQNFLFDLNLTSKIAHQAGNI
FT                   EGKPVIEVGPGPGGLTRALLAKGAIVTAIERDERCIPALLEIEKHYPQKLKIICNDALK
FT                   QDFSKLFEISPEKPRIIANLPYNIGTQLLLNWLLAEPWPPFYESMTLMFQREVAQRITA
FT                   KPQSAHYGRLSVLTGWRTIAKIAFDVPPQAFIPAPKITSSVVHIIPRTQPLTCSAQKLS
FT                   FVTKTAFGQRRKMLRQNLKTLGGEVLLEKAGIDETRRAETLEISEFVTLANLVI"
FT   CDS_pept        complement(627563..628576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BH05410"
FT                   /product="Pyridoxal phosphate biosynthetic protein pdxA"
FT                   /db_xref="EnsemblGenomes-Gn:BH05410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27349"
FT                   /db_xref="GOA:A0A0H3LXX1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27349.1"
FT                   /translation="MDVLVVSGGDPAGIGPEIALKAWNLRATRQIPPFVLIADPDVIRA
FT                   RAHFLQIDVKVEAVLTDNPVKNFQEALPVIPLKNRQSDQLGLPSHENAAGIIEAIKRGV
FT                   QLIQSGHACALVTCPIAKKSLYDAGFEFPGHTELLADLAHQASDKYYHPVMMLSGPRLK
FT                   TVPITVHIPFKKVPSHLTHHLIVQTALITEKDLRTRFKIISPRLAVAGLNPHAGEEGAI
FT                   GKEDIEIIIPAIETLKNKGLNIVGPLPADTMFHECARKAYDVALCMYHDQALIPVKTLD
FT                   FDTTVNITLGLPFIRTSPDHGTAFDIAAKGIASPESFISALKLAHQLAENSFTPCQ"
FT   CDS_pept        complement(628576..629544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05420"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27350"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27350.1"
FT                   /translation="MRKPNYMNKLKKHILTLFCIVPLSISNLLVSEIPSTFAQTVIVVT
FT                   VNGKPITNYDIQRRAAFLRLQQKQGNLSEQAKNELINEVLKNIEIKRRNIEVSNNEVES
FT                   AFKNFAAQNNMTVDQLNQILIDNDITVQHFKDYIRGQLGWGRLVNARYQAETGMISEQE
FT                   AVRRILKNGGVKPSTNEYTLQRIIFVIPAHRRSEIFERRQREANNFRAHFQGCANTSKQ
FT                   AKGILDVTVRNLGKFLEPQLPREWEQAIRITPAGKMTQLQETADGIEAIAVCKIKRVSD
FT                   DYVARLIFSLQDNKQKSPQELEILSEKYLKELRQVARIKSS"
FT   CDS_pept        complement(629628..631997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05430"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27351"
FT                   /db_xref="GOA:A0A0H3LWU1"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27351.1"
FT                   /translation="MKALISKRVILIKLHTLAFKSIIGCVLGIFLSCSTSAKNPTFLVQ
FT                   NHSPKPVSPLLLSADELIYNRDENTVSAQGNVQIEYNGNKVVAQKVTYNQKTGRIIAQG
FT                   NVEIVQKDGNKIYSNQIDMTKDFGEGFVNALRIDTATNIHFAATSATRRNNQITIFDNA
FT                   TYTACEPCSYKPERDVLWKIKARKIIWNSVTKKIQFENSRFEVFGVPIAQLPTFELYDP
FT                   TIRRASGFLAPHFFYADYLGMGIKNSYFWNLAPHYDLTLSSTLYSQQGLLTEGEWRQRF
FT                   QTGNYNIRFAHIYQLRPQNFDNDTIDAQHKNRYMLATKGDFRLNSRWTYGWDILAQSDR
FT                   HFSRAYKLENYRDPTQLSQLYLNGLAGKNHFDMRFYHFKVQDLILNDPGHERHSRQAWV
FT                   LPQIDYSFTPDESIYIGLLTFHSNMQSVYRHHTNFSSSNWNGHPLNTVRLSGIAGNSFR
FT                   LTNELEWKKRFTMHGGLILTPLLSLRADIMTTNTHDNKNAHITNDPLSTVRGSALRGMA
FT                   TAGLELRYPFLITFDSSTHIIEPTAQIFIRNNEQYIGQIPNEDAQSFVFDATTLFQRDK
FT                   FSGYDRVEGGTRANIGLRYSGNFNNDWSLYGVIGQSFHLAGKNSFAEKDFVNVGIHSSL
FT                   EATRSDYVAMFGANHKSGFFLEARGRFDKKTGEIHRSEIEASQKWQNFEAAVQYAYIAS
FT                   QPDYEYPQERQEISFQTGIKLTNSWSISSNASYDLISDTFVKRGISLRYADECFGLTFG
FT                   YQQVINLGKKTPLQNFNFSLSLRTIADIGKKTKSDL"
FT   CDS_pept        complement(631998..633095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05440"
FT                   /product="Hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27352"
FT                   /db_xref="GOA:A0A0R4J6S4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6S4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27352.1"
FT                   /translation="MIGWTLGQYFFIRYLKMTCYFLGGIFVLALLIDFTENSGRLSSLP
FT                   RYTAKDAFLISVLRIPFIMQQLIPFIALFSAMAMLISLNRKSELVVTRSIGISAWQFLM
FT                   PACFGAFLFGLFSILLVNPLAAWGFSQAERMMTEWRSKNNNVLTSLHNTRILWLTQRTH
FT                   SGRTTIGAKSITDQGLSLIDATFVQYNDNATIKNWINSRKATLINGAWLLTDGTIYKIG
FT                   HPPEKFSELQIQTTLKPEFLTERLVNPATIPFYQLPTKIMIARSFGYSANNFDMYLQSL
FT                   IALPALLIAMTLIAAVVSLNFTRFGQSKILILGGVIAGFSLYVISILVQAFGNAGYIPP
FT                   IIAAWTPVFIALFLGISFLLHKEDG"
FT   CDS_pept        complement(633092..634282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27353"
FT                   /db_xref="GOA:A0A0H3M300"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M300"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27353.1"
FT                   /translation="MRIIELYILKRILILFSAVMIAAIGISWTVQILARINFLTTSKQT
FT                   LLTILQFSISLVPSVIFLVIPFALLIAITSTLSAMNQDSELAIISASGFPKSTVWRPIL
FT                   LIAFVASCASFFIANFVIPQARLNMRQMLATTHYDLINLFISEGSFQKLANNLYIEIGQ
FT                   RNPDGTLAHLFIADQRDPKIDLFYYATKASVVSNKNGHFLVLNNGEIERINHQNDSVSI
FT                   VQFSSYTFSLGEFIPNDKTPTLYPKDRPLSYLRNPNPKDLYYQRKPLQYRAEFHRRLTE
FT                   WLYPIVFSLIALAAAGDTRSYRQVGNSANFSAIAFSFLVYWIGYFAAEKAKSDLAYVPL
FT                   LYIIPIGVSILVFFMLLTNRTIGTPIKLNEVIQIVFQKVISKFEYRKSQSPPDEVS"
FT   CDS_pept        634674..635138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27354"
FT                   /db_xref="GOA:A0A0H3LXX6"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27354.1"
FT                   /translation="MIRAKRVDILFYHLTQSTLEDILPTLVERALGRFSRVTIQCVSKE
FT                   RRDAIDTRLWVYADEAFIGHGTECDQYPNFQPVFLTTGQENPNDSKIRFLIEGAICSDI
FT                   NAYQRLVVLFDGQSDEQLHIVRAQWKKYKMENHNLTYWQQTEDRSWKKQV"
FT   CDS_pept        635327..635593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J722"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27355.1"
FT                   /translation="MIIDRILLILWAVMLAFFCVSWLGTTHILSQIVSIAYINNIADIL
FT                   FFFLSALFAGILWWNVPHPMPLKMKLAAFLPPAFILFFFFIVF"
FT   CDS_pept        complement(635590..636909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjE"
FT                   /locus_tag="BH05480"
FT                   /product="Transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27356"
FT                   /db_xref="GOA:A0A0H3LWU5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27356.1"
FT                   /translation="MSYTERDILFMSINSETQGISKQNSPRRILFASLIGPTIEFFDFY
FT                   VFATAAALIFPHVFFPTQNDQIAILQSFLIFGAAFFARPLGSIIFGHFGDKIGRKATLI
FT                   AALLTMGLSTVIIGFLPTYETAGWFAPFFLTLCRIGQGMGLGGEWGGAVLLATENAPPQ
FT                   KRGWYAMFPQLGVPIGLFLSIVVYLGLLHFLDHDELLAWGWRIPFIASVFLMLVGLWVR
FT                   LSINETVEFKKTLERKERVQVPIIDVFLKCPRILFLGTFAGMATFVLFYLVTAYLLSYS
FT                   TNHLQLSFYQALQVEVIGAIFCGIFTVLTGKLADRIKRRTLMICITIITGIYSFAIPYF
FT                   LSSGVIGVLAMSTIGLSIMGMVYSPLGAVLASPYPTAIRYTGSSITFNLAGIVGASLAP
FT                   YIAEYLVQHFDTSYIGYYLLLASFISLLCFVGFTDEEISN"
FT   CDS_pept        637585..641460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05490"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27357"
FT                   /db_xref="GOA:A0A0H3LW93"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LW93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27357.1"
FT                   /translation="MDKNIINGSFIIKEGEVESVGNGETSKGTLIDEYGLQSIEYGGQT
FT                   EEVKVYGGEQIILGEGSYAYSSKIQGKGETLGQQNVYDDGVALFTDVMSGGEQNLSTWL
FT                   GDIGGLAVDTRVFAAGVQNVFAGGRANTVTLEEGALQRVYAGGYVETLMINSGANSLVY
FT                   SGAILEGAVKINGSGKLHLYAGDGGHQTTAEEILLNGKEAQLYSIATEVNGSSSLIGKL
FT                   SGNGSVIFTSTATSPDSTKLNSYYSLLYVGDLSGSLHFNLRVNVKERYGDYLIIEEGAG
FT                   DHTVSVLDSGAEIANNSFQSVNLITDKSGNAHFSLKNRSGEKAATIDGGAYMYSLQQKK
FT                   GNDGEKKIWYLASAEKVSTSLTTSSNMGLPINGSLGKEEDVTVSQDPIVSSYASDFSFY
FT                   PDDFIMEKEEESLQSSIISEDSVHISDDGESDDPKWSINTMVEGAGTLYVEAGGFSKNT
FT                   TIEHGGSEIVAEQGISESTIVYEGGKQNVEGGGVTLKAQIYGGEQLIFGDGYVNGSIAG
FT                   SSAYNTTIYGQGEIPGYQSVYDDGMAVGTKIMEGGIQTLAKWFSEDDTFAQKSGGLAIN
FT                   TEVFAGGMQRILAGGEADTVTLYTGAVQVVHAGGYVKNLTIENRANSWVSAGAMLEGKI
FT                   TVKDSGQLHLDAGDNDHQTTVEDIDLSGENARLYSISDEFDDKSSYIQKLSGVGEIVFT
FT                   SAGNDLYYSRLYIDNLSGSMHFNFNVSLAEEKGDYLSIKNGSGYHTISIIDSGIEIANP
FT                   SSTELDLIVDQSGGAHFTLQNLSGAKVKPVDAGTYLYGLKQKNGDDGNKKIWYLSAVYI
FT                   DSVQRRGRFFRHLNQNQPISVLSTSLASEEQAAEILCQRGRCRSLRQKPLSSVHPFNAV
FT                   VGLRKNNIHQNLDQKPSGFDSSTVSISKNQFFEVSYRNHIHQNITKDPQFSSSTSSLEK
FT                   PASDTSSPTGHYHSSDEQQQSVVSTDGQSLADQMILRPGQQGSSSPQSSQKLSVSHFLT
FT                   TPSTDAVLSMSVTPALVFHNELQAVRAGRGILDRGKKNTAFWAHAIKSKEHIVADHKDF
FT                   KLDQTGIVLGVSGVSELMGGEFYIGGFGSYDQARVAHARGGVSGINTYSIGAYATYFDK
FT                   SGWYLDSILKYNQYQNNLKAVSTNGIAIEGNYNQWGLGTSFEAGYRFETTKSSWMQPYA
FT                   QLSWLQVEGKEIKLSNEMTGDINAFTSLRSEVGLSAGYEFCLGGDVTSMAYITAAWLRE
FT                   NRDSNRTTINKLHQFVTDLSGNFGKLGIGLSSLVSKKFKLYAEAQYVKGDKVKQSFQGI
FT                   LGVRYSF"
FT   CDS_pept        641841..644411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27358"
FT                   /db_xref="GOA:A0A0H3M305"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M305"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27358.1"
FT                   /translation="MRYKWKRSYWVLIVSSCFVQVAVAGEEGRSWLLCQPSSYNENEKT
FT                   LHTQYNEDVRTGNCILGTPDKNILFGMNKGVDALEMLSGLTMKNSSGTLVRKIQGLESK
FT                   SGGNAVQNAQRRSIPVLKSPELIFVKNGARLENFVLDHNGKAYISNDGEIDSPGQSINN
FT                   TVRNGAEIYVYAGGLSENSKIEQGGTENVQALKGKQGFSKNAVVKEGGQQSVGNGGKVE
FT                   GTKIYGGEQLVFGEGDVGGQIKGSSASNTVIYGQGETLGQQKIYDGGITWNTKVMRGGV
FT                   QEIAKKTQSAKNGGSAFDTQVFGGGKQRILKEGKAIGVTLNETALQEIYADGSVKNLTI
FT                   NDEAKSLVYAGGTLEGKTLVSHSGQLHLYAGKEQHRTTVEEVILNGKETKLYSITDEFD
FT                   GKSSLIQKLSGEGSVLFAFTGSDPYYSQLHVNNLSGSLHFEFNTTLAQNRGDYLFIENG
FT                   KGNHTLSVADSGVEITDPFSNKRDLITDRSGEAYFTLTDLSGEKIHAIDGGTYMYDLKQ
FT                   RKGENGKIWFLSADRISGPESSLPDPKDPLVSGGLSTTPSVDAVLSTGVAPGLIFNNEL
FT                   EIVRTGRGVLDKNKKDIGLWTYAIKSRDRIATGHMHFKLEQTGIVVGADQLNELMHGKL
FT                   YVGGFGSYDQGRVAHARGGDSDLNTYSVGAYATYFDRRGWYLDGVLKYNYYRDNLKALS
FT                   TNGLVVQSNYNQWAIGGSFEMGCRFEPAQSTWMQPYVKLTGLQVAGKKIILSNGMTADI
FT                   SSLTSLRSEVGLTAGHEFIMNAETLLTAYITAAWLRENINNNHTTINNRHKFITDLSGN
FT                   AGKLGIGLNSFVNDNLTLYAEAHYLKGHKIKQALQGILGLRYIF"
FT   CDS_pept        644803..647427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27359"
FT                   /db_xref="GOA:A0A0H3LXX9"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27359.1"
FT                   /translation="MRHKYKLSFSIFIISSCFVQVASASENKNRALKKITSVTSGGKIA
FT                   KSSALVTQSLIPSSNIMIQDGGVEIVENGKTSIGATVEEGGKQIVTRGGKAIDTKISGG
FT                   KQFVFEESPANFDDLQRQSSAYDAIVSGGNGVVGQQNVYDDAKAWNTKVTQGGEQNLYM
FT                   GNKKIGGGFAENTVVSGNGRQHILAEGMATNTILKDKAVQVVYPGGIIDRLTVNGSASS
FT                   WLYVGADLQGEIKVNDKGHLYLFAGDRTDHIIREKLFVEGRVAEWLFGVGERNNNETPQ
FT                   IEIDSLSGDGGTIIFSSVPYDRRHISLHVEFLSGTLHFNLNISTKDENRDYLSIGSNSA
FT                   GNHTISITDSGAEITSSFSRNSSIIAELNLITDRSQGEGANFALANYFGKKITAVDGGA
FT                   YMYTLQKRNRCADSSGDYTVWYLGVGTERADRSNNYSQCVKNKSKTRVPLVASSSDVGV
FT                   DAQSHQNFSSSQRQDSNSQTTRRKNNEQTSKPRPPRHLRDAQHPPIPPTIPFLEKPASD
FT                   TSSPTGHYHFSDEQQQSVVSTDGQSLADQMILRPGQQGSSSPQSSQKLSVSHFLTTPST
FT                   DAVLSMSVIPALVFHNELQAVRAGRGILDRGKKNTAFWAHAIKSKEHIVADHKDFKLDQ
FT                   TGIVLGVSGVSELMGGEFYIGGFGSYDQARVAHARGGVSGINTYSIGAYATYFDKSGWY
FT                   LDSILKYNQYQNNLKAVSTNGIAIEGNYNQWGLGTSFEAGYRFETTKSSWMQPYAQLSW
FT                   LQVEGKEIKLSNEMTGDINAFTSLRSEVGLSAGYEFCLGGDVTSMAYITAAWLRENRDS
FT                   NHTTINKLHQFVTDLSGNFGKLGIGLSSLVSKKFKLYAEAQYVKGDKVKQSFQGILGVR
FT                   YSF"
FT   CDS_pept        complement(647705..649582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05520"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27360"
FT                   /db_xref="GOA:A0A0H3M592"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M592"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27360.1"
FT                   /translation="MLVLNDITIRIAGRLLISRANIALPTGSKTGFVGYNGTGKSTLFR
FT                   AITGEISPENGDIIMPKSTKIGHVAQEAPATEHSLLATVLAANTEHANLLHEAESATDP
FT                   LRIAAIYARLADIDAHAAEARAGKILSGLGFDSHTQQRPLSSFSGGWRMRIALAAILFT
FT                   EPDLLLLDEPTNYLDIEGTLWLTEYVRQYPHTVIIISHDRDFLNNTVNSIMHLENNQLT
FT                   FWRGNYDQFEQQKAEVVKVQQKQIEKQEVQQKHMEDFIVRFRAKASKARQAQSRLKALE
FT                   KLKPLTTWKIQHVQPFIFPKVEKPVASPIIALSNVSVGYETGKPILKELNLRIDNDDRI
FT                   TLLGSNGNGKSTLAKLLAGRLKAEKGTITLAPHLKIAFFSQHQLDDLKPEENAIDHMRH
FT                   LMPGKADAKIRAAVARMGISTEKMMTKAKELSGGEKVRLLMGLTVFEGPHLLILDEPTN
FT                   HLDIDSRQELIHALNHFNGAVILIAHDRHLIEATMDRLWLVKNKTVLPYEGDMHTYRKE
FT                   ILGLSSKKETNVSLKKQLSLSKNDQRKSNAQKRSSLAPLRKKIVETEALIEYLHKQIAQ
FT                   LDEELISASFHNKIPEKIKERAQKAKKLQEAETLWFTLSDQYETQMMQK"
FT   CDS_pept        650093..650515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BH05530"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05530"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27361"
FT                   /db_xref="GOA:Q6G426"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G426"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27361.1"
FT                   /translation="MAVERTFSMIKPDATRRNLTGAITKMLEDAGLRVIASKRVWMSQR
FT                   EAEKFYAVHKERAFFSELVELMSSGPTIVQVLEGENAIAKNREVMGATNPEDAQEGTIR
FT                   KVHALSIGENSVHGSDSAETAKTEIAFWFSEVEIVG"
FT   CDS_pept        complement(650619..651200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="BH05540"
FT                   /product="CDP-diacylglycerol-glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27362"
FT                   /db_xref="GOA:A0A0R4J912"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J912"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27362.1"
FT                   /translation="MKNHTFSFPNILTYARIVAVPMVVACFFLEGRLQSSDIARWAAVS
FT                   IFVVASITDFLDGYLARIWEQTSNIGRMLDPIADKLLVSACLLLLAADSTIAGWTLWAA
FT                   IIILCREILVSGLREYLAELKVSVPVSRLAKWKTFVQMIAIIFLLAGPAGNKIIPYTLE
FT                   FGITMLWISALLTLWTGWDYFRAGLKHVII"
FT   CDS_pept        complement(651275..653260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BH05550"
FT                   /product="Excinuclease ABC subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:BH05550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27363"
FT                   /db_xref="GOA:Q6G424"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G424"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27363.1"
FT                   /translation="MILKNNIAYAENEQEKLSFLSHITWDDAHQRNDKNQFKGAKLIQE
FT                   FVKHLPHKPGVYRMVDENGKVLYVGKARNLKKRVSNYTREQGHNNRITRMIRATSHMEF
FT                   VVTHTEIEALLLEANLIKRLHPRFNVLLRDDKSFPYIIITDDHRAPALYKHRGARTRKA
FT                   HYFGPFASSSAVTQTINVLQRAFLLRTCTDSVLENRTRPCLLYQIKRCSAPCTHEISDR
FT                   DYRELVKGAKSFLSGKSQSIKNDMVQAMHKAAKNFDFEQAAAYRDRLSALSHIQSHQGI
FT                   NPQTIEEADVFAIAQKEGISCIQVFFFRMGQNWGNRAYFPKADPSFSSSEILASFLSQF
FT                   YDDKPLPKLILLSESIEDKTLLAEAFSLKANRKISLSLPKQGERKTLVNYAYINAHETL
FT                   GHKLAETATHTKLFQGIAEIFQLPHTPCRIEIYDNSHIMGTNAVGAMIVAGKNGFIKNQ
FT                   YRKFNIRSTDITPGDDFGMMKEVIKRRFSRLIKEHGLPHESKNIQSKDDASFPIWPDLI
FT                   LIDGGKGQINSVHTILSELGLDNFMTVVGIAKGADRRAGRERFFIKGKTPFTLPPCDPI
FT                   LYFLQRLRDEAHRFAIGTHRAKRKKETLKNPLDEIENIGPTRKRALLHHFGSAKAIASA
FT                   SLEDLTKVIGISTTIAQKIYNHFNEK"
FT   CDS_pept        complement(653651..654514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27364"
FT                   /db_xref="GOA:A0A0R4J9J2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27364.1"
FT                   /translation="MNYRHIYHAGNFADVFKHIIVTRIIEYLKRKEKAFRVIDTHAGIG
FT                   IYDLSSLEAHKTGEWREGVYQLLSTPIPEDLKALLYPWCNIIETLNKGKKDILFYPGSP
FT                   VLIRQLLRKQDRLTAIELHREDYHILAKNFAGDYQTKVLHLNGWLSLNAHLPPKEKRGF
FT                   ILVDPPFEKPGEFSRLIEGLMKAYRRFSGGIYALWYPVKYDKEIENFLHALHQTGIPKI
FT                   LQLEMRIRKSSIPPTMNGSGMILINPPYLLEEEIKKLSPFLIARLGQDKNAQITHKWIQ
FT                   KEQLLC"
FT   CDS_pept        655208..656175
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH05570"
FT                   /product="probable sugar hydrolase"
FT                   /note="Identified by comparison to Agrobacterium
FT                   tumefaciens"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        656443..656754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="BH05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27366"
FT                   /db_xref="GOA:Q6G422"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G422"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27366.1"
FT                   /translation="MGNIFSPTHLIVILLIIIVLFGRGKVSELMGDVAKGIKAFKKNMK
FT                   DEEDILEDKLERAHHSETVDVEPQKFQSLSVKRATTRVKGSSSSRKGKTSVVKKQRVK"
FT   CDS_pept        656802..657242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="BH05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27367"
FT                   /db_xref="GOA:A0A0H3M307"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M307"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27367.1"
FT                   /translation="MFGIDGLEFLVILLVLIVVVGPKDLPKMLKTMARAIAYVRSTANE
FT                   FRHQFDDAIKQAELDDLQKTLSDMNDFNPDKKLTGILNPMQDIRGDILNNFDVNTTHHK
FT                   LEKDQENFECNENKTNEDLDVPVDAHSSGSVFVTSKDKESAS"
FT   CDS_pept        657239..658033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="BH05600"
FT                   /product="Sec-independent protein translocase component"
FT                   /db_xref="EnsemblGenomes-Gn:BH05600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27368"
FT                   /db_xref="GOA:A0A0H3LXY3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27368.1"
FT                   /translation="MNVKKDEVDANMAPLLEHLIELRQRIIAALIACFIAFIICFLVKD
FT                   YILNFLILPYQWAMKISGGNPEGIRLQSTQVWETFLTKMKLAAFGATILSFPYTAFQFY
FT                   SFIAPGLYKNERMAFLPFLIGGPILFCVGGAFVYALLAPIMLWFSLSQQFLPDVHLRIE
FT                   FIVRISDYLSFMTSFILIFGLIFQLPLVTSLLMKVGLLTSHSLASKRKWAILISFIIAA
FT                   IVTPSDFFTMFAVALPTIALYEISILIAYYMEKKKNSFKRSL"
FT   CDS_pept        658082..659359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BH05610"
FT                   /product="Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05610"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27369"
FT                   /db_xref="GOA:Q6G419"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G419"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27369.1"
FT                   /translation="MLDIKWIREHPEKLDEALAKRGIEPQAERLIKLDLERRSHVAKVQ
FT                   SAQERRNTASKKIGQALAVCDQKMAERFRAEVEEIKVFLSSATAEEKRLTESLENALSA
FT                   LPNIPLDDVPEGKDESDNVVLRHFSVPTTFDFTPKEHFDLGQNLKQMDFERASRLSGTR
FT                   FTVLSGALARLERALGQFMLDVHVYEHGYTEVSVPLLVRDESVYGAAQLPKFADDLFRT
FT                   TDGRWLISTAEVPLTNLVNNEILEISDLPLRFSSLTPCFRSEAGSAGRDTRGMLRQHQF
FT                   WKVEMVSITTAEQSLIELERMTECAEDVLKRLDLPFRTMVLSTGDMGFAARKTYDIEVW
FT                   LPGQGCYREISSCSVCGDFQGRRMNARYRKEGEKTLHFVHSLNGSGTAVGRCLIAVLEN
FT                   YQQADGSIIIPDVLQPYMRGMRCITA"
FT   CDS_pept        659495..660154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm1"
FT                   /locus_tag="BH05620"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27370"
FT                   /db_xref="GOA:A0A0R4J7D4"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27370.1"
FT                   /translation="MDQKGILRFHEELASLVLKMRSKGIDDVRFFTALEKIPRQQFVSS
FT                   PWFKSAYDNKVIPIECGEYIERLEEQLLILYALSLKKKHRVLEIGTGSGFCTAFMACLS
FT                   DRVITVDRYKTLVDLARQKFQTLGIENIVVRQIDGSRIITGFGSFDRILIWPSRSDEPK
FT                   EFLELLTENGILIQAIGPDEGVQTITRYTKIASRFECLEMFQVRYQPFIEGIAETL"
FT   CDS_pept        660322..661500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05630"
FT                   /product="Antigen (virulence determinant) (lipoptrotein)"
FT                   /db_xref="EnsemblGenomes-Gn:BH05630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27371"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27371.1"
FT                   /translation="MCLKVLGNVVRCNQGIALLAMIMVLVGCSSGMQRFANPFSYPTIS
FT                   NQPNISTTMSTYTDSPTLSYGAGMIQSTELPPVEPVNDLSTYDNTAYNSPPQDGTSSPN
FT                   SRIMGTPPRNLGTLSRSQMRNDPLFRQNSYIVQTGDTLLSIARQRGVSVEALKLVNGIR
FT                   SNSIYIGQVLMIPSGRTAETSNVRNNDWGASKQSLSQSQSASSIRHKKYSSTEKAPITP
FT                   KPSAQINRSNGEQNSSAQMSSLNYEKGVLDTVMNKDNGVTPQATGISKMRWPVRGRLLS
FT                   QFGQKRGTTMSRGIDIAVPEGSSVKAAENGIVIYASDGLKELGNVVMIRHENNIITIYG
FT                   CNSKLVVTRGQRIRRGDEIAKSGVSGDVKTPRVYFEVRENSLPVDPIKYLEN"
FT   CDS_pept        661868..662314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05640"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27372"
FT                   /db_xref="GOA:A0A0R4J945"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J945"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27372.1"
FT                   /translation="MFITNAYAQVAGGVSNGPSLVTFVPFILIFGIMYFFIIRPQRAQM
FT                   KKRQEMLNAVRRGDTVITGGGVIGKVTKVYDESGELEVEICDGMRIRVIRSTLSDVRVK
FT                   GEPISEEKSKLNTKVKAPSKAKAVKKENMSASKEKKAVSKEEHS"
FT   CDS_pept        662795..663181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05650"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27373"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8M6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27373.1"
FT                   /translation="MSHAIQIREAHFPGRAPIDAYGNGGFRFADMSHRGSIICIPSGIY
FT                   GIDMTGPVPTQEDISRVLEESDQIEVLLIGTGVELLRLPEELRVLLWEKRISSDTMSTG
FT                   AAVRTFNVLLAEDRAVAALLFAVE"
FT   CDS_pept        663178..664038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27374"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27374.1"
FT                   /translation="MINFLPYSLDILRAADRDRYISVLFAPKKKRRALAALYAFNAEIA
FT                   RIRENVHNPLIGEIRLRWWYDSIAKSEMEKSESNPILSDLFMAMTLFNLPKTAFLRYCD
FT                   AQILDLYHNPIATLYDLEFYCGETASIILQLSCQILDPDMAQNFTDAYQHAGIAQGLSG
FT                   VLRLLSFMQSRYQYYLPADMLKALGIKREELESNRISKEQKCHVIEAMVALSRDHYNRF
FT                   YEYFNMMPKTLKPAFLPLAIIPASLQKAIQLGAAVFQENAALPLLHRYWFITKAAISSN
FT                   LPKIL"
FT   CDS_pept        complement(665573..667462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="BH05670"
FT                   /product="Peptidyl-prolyl cis-trans isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27375"
FT                   /db_xref="GOA:A0A0H3M598"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M598"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27375.1"
FT                   /translation="MLDIIRNATNSWIARIFLAILLLCFILLWGIPQLHTKSERDLISS
FT                   GESIITIDDYRLALADQSARLALASRLGRMFTPNEMQQYQIPAFVFNQLQQDVLFDEQT
FT                   RQMKINLSKDAIARKIGADNMFQINGVFKHDLFRNYLQQLHISESNFLDYYTKKEKRNQ
FT                   LISASLSGMKAPDLFYKALAFYQRETRIADYLVLDLKEKEIISEPHQETLQKWFETHRN
FT                   KFRVPEYRTISFLSMELADFIKPKDISEDEVKNYYTQNSSRFITPEKRTIEELRFPTRE
FT                   AADNAVKKIADGLSFDDLVKAENKTLNDIKKGPFTENELPSYLSSEIFELKQGQISAVI
FT                   NDLQGPVIIRVTDITPAGPIPFEKVEDNIRQTLAQNRAADDIRNSYTEIENARFEGASF
FT                   KELADQYKLPLRTITLDKTGKTIEGTILTDLPQKDLLLNSIYQSNEGADLDPLSLPNGG
FT                   YLWYKINTIIPARDKTFEEAKQEVIAQWKKEEIQRLLDEKAKDALKQLTEGKSLVSLAH
FT                   ILGVTKQTTQPLRRQDSSEILGFEGVKALFSGPKGHYGIVKGPIAKNRILYQIKEVTTP
FT                   KDISPHTLSSDIRSNIDMMIREDLKLEMLHVANKEHPLKINSANYNQIFQALQ"
FT   CDS_pept        667614..668378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="BH05680"
FT                   /product="Triose-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05680"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27376"
FT                   /db_xref="GOA:Q8L1Z5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="PDB:3KXQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L1Z5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27376.1"
FT                   /translation="MSPNIRPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALIC
FT                   VPATLLSRAFDILGGENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRT
FT                   VYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAEN
FT                   IIIAYEPVWAVGTGNTATSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFE
FT                   LLSTAHVNGALIGGASLKAIDFLTICDVYRKL"
FT   CDS_pept        668460..668918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05690"
FT                   /product="Protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27377"
FT                   /db_xref="GOA:A0A0R4J838"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J838"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27377.1"
FT                   /translation="MQTVLIVIHFLVVITLVGVILIQHSEGGGLGVSSGSGLMKTRGSK
FT                   NALSRLTAILACCFFAVSIGLTVVGSISNSSSDILKRIPVHSEQNSTNKGTSEVAPSSK
FT                   SEAEPSILEELGGGSVPPQEQNQSKDHPATENPVPPILENPVPGNDAK"
FT   CDS_pept        669046..670674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="BH05700"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27378"
FT                   /db_xref="GOA:Q6G410"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G410"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27378.1"
FT                   /translation="MARYVFITGGVVSSLGKGIAAAALAALLQARGYSVRLRKLDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTGRSANSQDNITTGRIYRNIIERERR
FT                   GDYLGATVQVIPHVTDEIKRFITTGNEEFDFVLCEIGGTVGDIEAMPFLEAIRQLHNEL
FT                   PRQNVIYVHLTLMPYISSAGELKTKPTQHSVKELQSVGIAPDILLVRADRPIPETERSK
FT                   LSLFCNVRPTAVIQALDMPTIYDVPIAYHKEGLDSEVLSAFGMHPAHKPNMDRWEDITH
FT                   RIHHPEGEVTIAVVGKYTGLKDAYKSLTEAIAHGGLANKVKVNIEWIDAELFEREDPTS
FT                   TLRKVHGILVPGAFGVRGAEGKMRAIQFARERRVPFFGICFGMQLACIEAARNIAQIEN
FT                   ASSSEFCETKNPIVGLMTEWLKGDVLEKRTKCGNFGGTMRLGAFAAELKENSHIAQIYG
FT                   MTRIYERHRHRYEVNIDYKDKLEQCGLVFSGMSPDGVLPETIEYADHPWFIGVQYHPEL
FT                   KSRPFDPHPLFSSFIEATVEQSRLV"
FT   CDS_pept        670711..671550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="BH05710"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27379"
FT                   /db_xref="GOA:Q6G409"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G409"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27379.1"
FT                   /translation="MSEPNAIVKVGNIIFSNEAPFSLIAGPCQIESRDHAFEMAGRIKT
FT                   ITDQVGIGFVYKSSYDKANRTSLSAVRGVGLENAMAIFSDLKKEFGCPILTDVHTEEQC
FT                   TVVASTVDILQIPAFLCRQTDLLVAAAKTGRVINIKKGQFLAPWDMKNVLRKVTQSGNR
FT                   NVMLCERGTSFGYNRLISDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVE
FT                   ILARAAVSVGVAGIFLETHQDPDNAPSDGPNMIKIDHLQRLLETLMEFDYLSKKTIE"
FT   CDS_pept        671610..672878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BH05720"
FT                   /product="Enolase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27380"
FT                   /db_xref="GOA:Q8L202"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L202"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27380.1"
FT                   /translation="MTIIVDIIGREVLDSRGNPTVEVEVHLENGALGRALVPSGASTGA
FT                   HEAVELRDGGTRYQGKGVKKAIAAINGEILEELGGRDARNQIGIDQAMIALDGTPNKAR
FT                   LGANALLGVSLAVAKAAAESLSLPLYRYIGGTQAHILPTPMMNIINGGVHADNPIDFQE
FT                   FMIIPVGASTLKEAIRYGAEIFHTLKKRLKDAGYNTNVGDEGGFAPQFKSAEQAIDFIM
FT                   ESIIACGYKPGEQIALGLDCAATEFYKNGSYFYEGEGKYRDVGEQVDYLAQLIKTYPII
FT                   TIEDGMAEDDWEGWKLLTDSIGKKCQLVGDDLFVTNSARLRDGIKMGAANSILIKVNQI
FT                   GTLSETLDAVETAHKAGYRAIISHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAK
FT                   YNQLIRIEEMLGLQACYAGNWYC"
FT   CDS_pept        672974..673378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27381"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27381.1"
FT                   /translation="MRGIIISQDQGTYLVSGDDGKRYQFATWDWSGKNPPKIGDTVDFV
FT                   CEGDVVNSVFPLLKKQSEHLKVMLALVCWVAGIFGVHRFMVGKVWTGALMLILSLTLVG
FT                   LMITGIWTIVDFIVIMAGKFTDKNGNQIIH"
FT   CDS_pept        674344..674673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27382"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M315"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27382.1"
FT                   /translation="MWTKQKRRSIKMRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVN
FT                   QYIVELEEELQKLEAERIFIEKRISLLRNGHIEKDMLDEYVRRNLNFSKPNELTILTPL
FT                   NEIKS"
FT   CDS_pept        674802..675842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="BH05750"
FT                   /product="Pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH05750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27383"
FT                   /db_xref="GOA:A0A0R4J6Y3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27383.1"
FT                   /translation="MAERLKKNSASVVHNALSNTTKKAKIANFTKEEEIDAYREMLLIR
FT                   RFEEKAGQLYGMGLIGGFCHLYIGQEAVVIGTLKAAKEGDQVITSYRDHGHMLAVGMSP
FT                   RGVMAELTGRQGGFSKGKGGSMHMFSKEKNFYGGHGIVGAQVPIGSGLAFSNQYLGKDN
FT                   VTLVYFGDGAANQGQVYESFNMASLWKLPVVYIIENNQYAMGTSVARASAETDFSRRGL
FT                   SFEIPGIVVDGMDVRAVKGAADEAITWTRSGKGPIILDMQTYRYRGHSMSDPAKYRSKE
FT                   EVQKIKEEQDPIDQVRNRILQQGFASEDDLKSIDKEVRAIVADAVDFAQSDQEPDASEL
FT                   YTDILV"
FT   CDS_pept        675859..677232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="BH05760"
FT                   /product="Pyruvate dehydrogenase E1 component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH05760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27384"
FT                   /db_xref="GOA:A0A0H3M5A1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27384.1"
FT                   /translation="MSIDILMPALSPTMEEGKLSKWLKKEGDKVSSGDIIAEIETDKAM
FT                   MEVEAVDEGTLGRICVLEGSEGVKVNTVIAVLLEEGETVEDISQSTNSLNTHQKNGGAS
FT                   SSFSSSVPQLPILDTLPDSDIPAGTKMVTMTVREALNQAMAEEMRRDEMVFLLGEEVAQ
FT                   YQGAYKVSQGLLEEFGTRRVIDTPITEHGFAGLAVGAAFGGLRPIVEFMTFNFAMQAMD
FT                   QIINSAAKTRYMSGGQMTAPMVFRGPNGAAARVGAQHSQCYAAWYSHVPGLKVVMPYSA
FT                   ADAKGLLKAAIRDDNPIIFLENEILYGHQFDVPQIDDFVLPIGKARIHKSGQDVTVVAC
FT                   GIGMHYAVQALPEIEKLGVDVELIDLRTIRPMDLPTIVSSVKKTGRLITIEEGYPQSSV
FT                   GTEIATRVMQQAFDYLDAPVATVAGKDVPMPYAANLEKLALPNTAEIVEAVKAVTYKA"
FT   CDS_pept        677247..678575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="BH05770"
FT                   /product="Dihydrolipoamide acetyltransferase (E2)"
FT                   /db_xref="EnsemblGenomes-Gn:BH05770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27385"
FT                   /db_xref="GOA:A0A0H3LWW2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27385.1"
FT                   /translation="MPIKITMPALSPTMEEGNLSKWNIKEGDQVSSGDIIAEIETDKAT
FT                   MEVEAVDEGTVAKIVVPAGTQGVKVNSLIVVLAEEGEDLAEVAKVAEDSPSSFAIKESE
FT                   GEKQRDSKVAQISHISSVQQVMQQGKKGMRFFASPLARRLATQVGLDLSLVSGSGPHGR
FT                   IIKRDVEKAMKGGVSKASYSSQIEQPVTANTSDKQILQLFKEDEYTFTPHNNMRKTIAK
FT                   RLVESKQKVPHFYVTLDCELDALLQLRTQLNAAAPIIKMQEGSKPAYKLSVNDMIIKAV
FT                   ALSLMAVPDANVSWLEGGILHHKHCDVGVAVSVENGLITPIVRHAEKKSLSIISNEMKD
FT                   FVKRARELKLKMEEYQGGTTAVSNMGMYGVKSFSAILNPPHATIFAIGAGEQRAVVKNG
FT                   ALAAATVMSVTLSADHRAVDGALAAELARTFKKMIENPLTMLI"
FT   CDS_pept        678800..680260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhD1"
FT                   /locus_tag="BH05780"
FT                   /product="Dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27386"
FT                   /db_xref="GOA:A0A0H3LWB2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27386.1"
FT                   /translation="MANLYDVIVIGSGPGGYVTAIRAAQCGFKTAIVEREHLGGICLNW
FT                   GCIPTKALLRSAEIKHFSEHLKDYGLKLNGSIEADIKDVVARSRAVSARLNAGVGFLMK
FT                   KNKIDIIWGEAKFTKKAKGSQLVEITVSSSSKPIMQPQNPVPKGTLGEGIYQAKHIIIA
FT                   TGARPRILPGIEPDGKLIWTYFEAMIPHVMPKSLLVMGSGAIGIEFASFYHDMGASVTV
FT                   VEMMPHIMPAEDIEISTFARKRLEKKGIRILSQAKVTKVEKAVDSITAHIDVKGKRETI
FT                   TADRLISAVGVQGNIENLGLEALGIKTDRGCIVTDEWSWTGVEGIYAIGDVAGPPMLAH
FT                   KAEEEGVICIERLARLENIHPLDKRKIPGCTYCTPQVASVGLSEAAAKEAGYDIRVGRY
FT                   SFSANGKAIALGEDQGLVKTIFDKKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEEL
FT                   MHTVFPHPTLSEMMKESVLDAYGQVLNA"
FT   CDS_pept        680333..681295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="BH05790"
FT                   /product="Lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27387"
FT                   /db_xref="GOA:Q6G401"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G401"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27387.1"
FT                   /translation="MVTVVDRVTDRRLRHPEKAHRPDTSVQKKPDWIRVKAPTSQVYKE
FT                   THGIVRAHKLVTVCEEAGCPNIGECWSQRHASFMILGEICTRACAFCNVATGIPFAVDE
FT                   NEPERVADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTIEVLTPDF
FT                   RHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKS
FT                   GIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFESFAKIG
FT                   KVKGFLHMASNPLTRSSHHAGDDFAILQKARDEKFALQR"
FT   CDS_pept        681298..681759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05800"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27388"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27388.1"
FT                   /translation="MPTFTTHRQIAHSAREMFDLVADIECYPEFLPMCEALIVRSRKKC
FT                   EEKTLLLADMTVGYKLVRETFTTQVFLQPKEKRIEVKYIDGPFKYLENRWAFHHTEKSN
FT                   ICNIEFFIDYEFKSKMLGLVMGSMFDIAFHKFTDAFERRAHRIYGSPVI"
FT   CDS_pept        complement(681847..682335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="BH05810"
FT                   /product="Competence /damage-inducible protein cinA"
FT                   /db_xref="EnsemblGenomes-Gn:BH05810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27389"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LXZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27389.1"
FT                   /translation="MTCFCEKQAREVLTACRQKSLLLTTVESCTGGLIAANLTNIAGSS
FT                   DVLDCGFVVYSNEAKTRLVGVRAELIKTYGAVSKEVVLAMAEGGLKYSRAEIAVSVTGI
FT                   AGPGGACFDKPVGLVHFAVAYKNHKTLYTEMRFGNLDRKAIRHATVKNALKLILESLQ"
FT   CDS_pept        complement(682332..683411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27390"
FT                   /db_xref="GOA:Q6G3Z8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Z8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27390.1"
FT                   /translation="MRCFCQNPAITTIILVIHPEDRQICEQAIADFKEQLIIVEGGNTR
FT                   QKSTLRGLQALRKFKPKYVHIHDGARPFVENKLLEQIHTTVTPQEGVLPVLAVCDTLKR
FT                   INSTHHVLETIPRTHLYSAQTPQCFPFERILAAHEKAIKTCKKEFTDDSAIAEWFGISM
FT                   RTIPGSPHNIKITWHEDLNTAHLYLQKKMQMFPDIRTGNGYDVHSFEEGNSLILCGIKI
FT                   PFHKKLNGHSDADVALHALTDALLATRGAGDIGTHFPPSDPQWQNVSSEIFLRHALDIV
FT                   KQAGGRIANVDITLIAEEPKIGPYRHAMVGNLMNMLTILPDRISIKATTNEKLGFIGRG
FT                   EGIAAFATANVLYPGEIPK"
FT   CDS_pept        complement(683549..684016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27391"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27391.1"
FT                   /translation="MRLTKQTNYALRILMYCADNQESLSRIPEIAKAYAVSELFLFKIL
FT                   QPLVEAGFVKTVRGRNGGVKLAKPAAEISVADVVKVTEDNFSMAECFDNAKSNCPLIDF
FT                   CSLNTALQKALNAFFDVLSVISLADLQRPSFRNQLKIDNREIINSNHVKGN"
FT   CDS_pept        684176..686440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="BH05840"
FT                   /product="Nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27392"
FT                   /db_xref="GOA:A0A0R4J6T6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27392.1"
FT                   /translation="MNTTSITNLQDIEQSTYNDELYRLSKVYIFLGITIIVLALLTASV
FT                   SFIILIGLTPVVPSRAVTLILIGINSVWVLGLVIIVFYEMTPIIRAWRSRRAGSRLHVR
FT                   LISLFALVATMPAVAVALVSGPALNLGLDRWFDTTTRQIVGSSINLANAYADEMLQNLK
FT                   NLSYAMAFALDNKKLLGRNPAEYRMQLTRHAIGRNLRGAFLLSSSGTVFISSDLGDEDK
FT                   LPIPPSNLIERATSTRPFSFQPGVHDYFGIILKFTNIPNTFLYLVRDVDKDVLSALRLT
FT                   EVNTDRYRDLNENRLLTQIAFGMLYLCLFFSLFLSAIWAGIAVADRLVRPIRLLISAAD
FT                   DVASGNMEVFVPVRAKDGDIGQLSKTFNYMVSELKSRRNELIAVRDQIDERRRFSEAVL
FT                   SGVTAGVAGIDDNGNITIINRSIETMFDIRSEHVIGHSLLSLSAEIDQVFQFARSLGRK
FT                   NHREQVTLSVAGQERVCNVQITMEKDDGQGQSWVLTIDDITDLVEAQRSSAWADIARRI
FT                   AHEIKNPLTPIQLSAERIRKRYDRVITQDREVFERCIDTIIRQVGDIGRMVDEFSSFAR
FT                   MPKPQMNILDIRGLLREACFLIEVTRHDIHFEQDLGSAPLIGAFDNRLIVQAFCNVIKN
FT                   ASESIDLVMREESIHGHILVRSYYQEGSVVVDVIDNGKGLPKEQRQKLLEPYITTREKG
FT                   TGLGLAIVRKVIEDHGGYMELHDAPKSFYEGRGAMIRLIFPADGAKQSNVAQAINHKIG
FT                   E"
FT   CDS_pept        686442..687800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrX"
FT                   /locus_tag="BH05850"
FT                   /product="Nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27393"
FT                   /db_xref="GOA:A0A0R4J911"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J911"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27393.1"
FT                   /translation="MVSDILIVDDEADIRELIAGILDDEGYETRVACNSDEALAQISER
FT                   IPKLIFLDIWLQGSRLDGLALLDEIKTRYPNLPVVMISGHGTIETAVSAIKRGAYDFIE
FT                   KPFKADRLVLVAERTLENSNLKRELLELRKRSNETLELLGTSTAIKHLRQIIEKVAPTN
FT                   SRIMITGPSGAGKEMVARAIHALSTRSNGPFVTINAATITPERMEIELFGSEMEGRERK
FT                   IGALEEAHGGILYLDEIADMPRETQGKILRVLTGQAFERVGGTKRVKVDVRIISSTAQN
FT                   LENLISDGRFREDLFHRLSVVPIAVPPLSARREDIPELVRHFVKTISQQVGIKPREISD
FT                   DVMAILQTHAWPGNVRQLRNNIERLLILVRDGDDPITTEFLPSEVSDSLPRLQMDTDES
FT                   IMDLPLREARELFEKKYLEAQIGRLGGNISRTAEFIGMERSALHRKLKALGVS"
FT   CDS_pept        687804..689180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="BH05860"
FT                   /product="Potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27394"
FT                   /db_xref="GOA:A0A0R4J6A3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27394.1"
FT                   /translation="MRVIICGAGQVGYGIAERLAAENHDVTVIDIEARLIEKIRDTLDV
FT                   RGFVGHGSRPEVLLAADADKADMLIAVTLFDEVNMVTCQVAHSLFNVPTKIARIRSQSY
FT                   LEPRYKTLFARENIPIDVVISPEIEVGEMVLRRIALPGAIDVLYFCNDDIVALALECME
FT                   DCPVINTPLRQLTELFPDLRTTVTAIKRGSELLVAHSETQLQVGDITYLVAARDQMRRA
FT                   VGLFGHKEQDAHRMIIAGGGHIGLYVAQAIEKRLHKLRLKIIESQRERALTIADQLEKT
FT                   TVLYGNVLDPVILQEAGIGQADLMITLTNQDQVNLLSAIIAKRLGCKANMVLINNVAYQ
FT                   EFSRAVGVDAYLNPHSVTISRILQQMRRGRIRAVHSVFNGQAEIIEAEVMQTSSLVGKS
FT                   LSELGLSDGLRIGAIYRNKTIIQLSADTRILPGDRVVIFALAECVHDVEQLFRVSLEYF
FT                   "
FT   CDS_pept        689258..689970
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH05870"
FT                   /product="hypothetical protein"
FT                   /note="Identified by comparison to Agrobacterium
FT                   tumefaciens"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        690143..690775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BH05880"
FT                   /product="ATP-dependent clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH05880"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27396"
FT                   /db_xref="GOA:Q6G3Z3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27396.1"
FT                   /translation="MSDPIKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVE
FT                   DGMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQA
FT                   ASMGSLLLTAGAKGHRFTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKQRLNEIYV
FT                   QHTGQNYDVIERTLDRDHFMTAEEAKQFGLVDDVIQYRAETEKEEKD"
FT   CDS_pept        690960..692234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="BH05890"
FT                   /product="ATP-dependent clp protease ATP-binding subunit
FT                   clpX"
FT                   /db_xref="EnsemblGenomes-Gn:BH05890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27397"
FT                   /db_xref="GOA:Q6G3Z2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Z2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27397.1"
FT                   /translation="MSKLSNSGNESKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVEL
FT                   CMDIIREENKSSGIKARDGVPTPQEIITVLDDYVIGQQHAKRVLSVAVHNHYKRLAHQS
FT                   KSNDIELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENII
FT                   LKLLQAADYNVERAQRGIVYIDEVDKISRKADNPSITRDVSGEGVQQALLKIMEGTIAS
FT                   VPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLERIISGRGEKTSIGFSATVKAPDERC
FT                   VGEIFRDLEPEDLIKFGLIPEFIGRLPIVATLEDLDVNALVQILSKPKNALVKQYQRLF
FT                   EMENVELAFHEDALRVIAKKAIERKTGARGLRSIMEKILLETMFELPALEGVQKVVISS
FT                   DVVDGKAHPLYIYSERTEDKENVSA"
FT   CDS_pept        692416..694839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon1"
FT                   /locus_tag="BH05900"
FT                   /product="ATP-dependent protease lon"
FT                   /db_xref="EnsemblGenomes-Gn:BH05900"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27398"
FT                   /db_xref="GOA:A0A0R4J7V0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27398.1"
FT                   /translation="MQYIDEKTDGVRGEVYAVLPLRDIVVFPHMIVPLFVGREKSIRAL
FT                   EETMAVDKQILLVTQKNASDDDPKSEDIYDIGTFANILQLLKLPDGTVKVLVEGIARAR
FT                   ISQFTTNENYHQALATLTEEPRENDVEIEALSRSVIAYFENYVKLNKKISPEVVNAIGQ
FT                   IDNPSKLADTIASHLMIKLSEKQEILALLPVRDRLERVLSFMEGEISVLQVEKRIRSHV
FT                   KRQMEKNQREYYLNEQMKAIQKELGASDDSRDELSELEERITKTKLSKEAREKAGAELR
FT                   KLRNMSPMSAEATVVRNYLDWLLAMPWGKKSKIKNNLDFAEKVMNNEHFGLEKVKERII
FT                   EYLAVQSRASKIKGPIICLLGPPGVGKTSLARSIAKATGREYVRISLGGVRDEAEIRGH
FT                   RRTYIGSMPGKIIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSSALLEVLDPEQNGTFI
FT                   DHYLEVEYDLSDVMFITTANTLNIPGPLMDRMEIIRIAGYTECEKMEIVKQHLLPKALK
FT                   DHCLTRKEFSVSDGAIRSMIQFYTREAGVRNLERELMKVARKSVTKILKTQQKSVKVTE
FT                   NNINDFLGVKRYRYNQIEGENQIGIVTGLAWTEVGGELLTIEGVMMSGKGKMTVTGNLR
FT                   DIMKESISAAASYVRFRAIDFGIEPPLFDKRDIHVHVPEGATPKDGPSAGIAMVTAIVS
FT                   VLTGIAVHKDIAMTGEITLRGRVLPIGGLKEKLLAALRGGIKKVLIPEENAKDLIDIPD
FT                   DVKNNMEIIPVSHVSEVLRHALVRFPDPIGWTEPSTVSVPIRTENESEGIQIAH"
FT   CDS_pept        695069..695344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="BH05910"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05910"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27399"
FT                   /db_xref="GOA:A0A0R4J684"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J684"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27399.1"
FT                   /translation="MNKSELVSSVAEKAGVSKAQAGSVVDAFIASVTEALASGGDVRLP
FT                   GFGSFEVSHRAATKGRNPSTGAEINIPARSVPKFSAGKSLKEAVNK"
FT   CDS_pept        complement(695879..697285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA1"
FT                   /locus_tag="BH05920"
FT                   /product="Glucose inhibited division protein a"
FT                   /db_xref="EnsemblGenomes-Gn:BH05920"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27400"
FT                   /db_xref="GOA:Q6G3Y9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Y9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27400.1"
FT                   /translation="MFNKLSTPIHIIGGGLAGCEASWQIAQSGIPVILHEMRPQKKSEA
FT                   HKTGQLAELVCSNSFRSDDSSTNAVGLLHTEMRLAKSLIMKAADANKVPAGSALAVDRD
FT                   GFSKTVTAALENHPLITIKREEIQEIPENWPHIIIATGPLTSPKLAKAIQTITGTEALS
FT                   FFDAIAPIIYTDSINMDICWYQSRYDKIGPEGTGKDYLNCPLNKEQYEAFVQALKNAEK
FT                   TEFRDFEKTPYFDGCLPIEVMAERGLETLRHGPMKPMGLTNAHNPTVKAYAVVQLRQDN
FT                   KLGTLYNMVGFQTKLKYGEQVRIFRMIPGLENAEFARLGGLHRNTYLNSPIILDQTLRL
FT                   KQRPGLRFAGQITGCEGYVESSAIGLLAGRFAAAEYHYNCPCLPPLTTALGALLNHITG
FT                   GHIVDEKTGRKSFQPMNINFGLFPPIASASYSGKRLPSKEKKLAKKQAITARALNTCIQ
FT                   WLINEEKNKL"
FT   tRNA            697452..697534
FT                   /locus_tag="BH05930"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:697486..697488,aa:Leu)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        697668..699077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="BH05940"
FT                   /product="Trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH05940"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27401"
FT                   /db_xref="GOA:Q6G3Y8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27401.1"
FT                   /translation="MQVTETLNEGLKREIKIVVPARNLEEKLNERLDNTKDKIKLNGFR
FT                   PGKVPAGYLRKMYGKSFMAEILNEIVSDASRSILAERGERSAMQPKIDVEEDKKILDGK
FT                   ADFIFSLKYEVLPKFEIKDFEHIEIIREIAVIPEQEIDDQVKRVLSSACNYSLKDGPSE
FT                   EGDRVTIDYIGKLEGVPFEGGAESDAQLILGSKQFIPGFEEQLVGVKAGDMKTISVKFP
FT                   DNYSAVHLAGKNAEFDITVKAVCKSDELKIDDEAAQKVGLESLERLREVVRGQIESQYG
FT                   SMTRQKIKRQILDALDADYNFEIPEGLLEIEFNNIWAQVNDDLKKAGRSFEDEGVTEEQ
FT                   AREEYRVLAQRRVRLGLVLSEIGMNIGVKVSEDELKAAVFDQVRQYPGQEKEIMDFFRN
FT                   TPEAVANLRAPIFEEKVIDHLLARIKVTDKEVTVEELMKEYDETDLTEKKPLKKKTAEK
FT                   VSTKKKAPKKS"
FT   CDS_pept        699206..700705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BH05950"
FT                   /product="Glutamyl-tRNA amidotransferase subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:BH05950"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27402"
FT                   /db_xref="GOA:Q6G3Y7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27402.1"
FT                   /translation="MEIVDTRTPNSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGAS
FT                   TKFGAEPNNHVSLIDAAMPGMLPVLNQECVRQAVRTGLGLKARINLRSVFDRKNYFYPD
FT                   LPQGYQISQFRYPIVGEGKIIISIGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTM
FT                   SFVDLNRSGVALMEIVSKPDMRSADEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNV
FT                   SVRRPGESFGTRCEIKNVNSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGET
FT                   RSMRSKEEAHDYRYFPDPDLLPLEFDQAFVDALAAELPELPDDIKIRFINEMGLTAYDA
FT                   SILVTEKAIANYFEKVAHGRDGKTVANWVINDLLGALNKDNREIEETPVSPDQLGSIID
FT                   LIKEGTISGKIAKDLFEIIWHEGGDPRQIVEERNMKQVTDTKAIERAVDEIMANNSDKV
FT                   AQAKQKPALAGWFVGQVMKTTGGKANPQTVNELVKLKLGID"
FT   CDS_pept        700897..701295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05960"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27403"
FT                   /db_xref="GOA:A0A0R4J8Q1"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27403.1"
FT                   /translation="MASFFKQVFTWWSGNTVNTRFFTWCKGKRVGEDQFGNIYYEGGYH
FT                   KDGYQRRWVIYKDYSEASTIPPGWHGWIHHRCDIPPTQENYQPYEWEKPHVANMTGTSA
FT                   AYRPKGSIFHKDERSSTHEDYDAWSPKK"
FT   CDS_pept        701381..701806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05970"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27404"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27404.1"
FT                   /translation="MIFFLLPRLRHIFCACFMGIVGTLSSMDGVQAERVSNGIAVFAGL
FT                   DKITGRTTRFEVSLGEVYQYGALQVTPRVCYTSSKDEPTRTTGFVEVNEVTLDKKVRRI
FT                   FTGWMFADSPGLNAVEHPIYDVWLKDCKQSSQNLLLQ"
FT   CDS_pept        702405..703145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH05980"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27405"
FT                   /db_xref="GOA:A0A0H3M321"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M321"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27405.1"
FT                   /translation="MKDADRQFNNAFLLPKQPRESFLNIPLTIVILIALCFCIYCVTQY
FT                   FFSDELYIESLEFFSFTPVLFKAAPLAFAHTIMSYSFMHGSFEHTTINMAWLLVFGSPL
FT                   VRHFGSLRFLVFWVLTAAISALTYFAFHQNSIASLVGASGAVSGMMGAIARYGFSPVYF
FT                   GISTQNGRFFGPLWSIKKTLCSKTVLVYVGVWLIINFIIGISSSLFERDDISIAWEAHI
FT                   GGLVSGFLLVGIFDVSPGKVKIIL"
FT   CDS_pept        complement(703135..703959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH05990"
FT                   /product="tRNA /rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH05990"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27406"
FT                   /db_xref="GOA:A0A0H3LY05"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27406.1"
FT                   /translation="MREKISKSFHYNRLQRRSHDKKGFLPAARMKQKSVPMRHGTIYLY
FT                   GLHSVHAALKNPKRVFEHLYITPNALKRLNIPESDLPCPITLCLPKQLDSFVGNDAVHQ
FT                   GIVLETEPLKPCQLSELTNTDLVIVMDQITDPHNVGAIMRSAVAFKAEALITTYRHSPQ
FT                   ESGVLAKAASGALEMIHYITVQNLAETLQELHKAGFISFGLDSEGNHPLETTLTGEKIA
FT                   LVLGAEGKGLRKKTRENVCALTRLDMPGNIKSLNVSNAATIALYAAHKYLRG"
FT   tRNA            704163..704246
FT                   /locus_tag="BH06000"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:704197..704199,aa:Tyr)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            704276..704349
FT                   /locus_tag="BH06010"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:704308..704310,aa:Gly)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        704515..705690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf1"
FT                   /locus_tag="BH06020"
FT                   /product="Elongation factor Tu (EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:BH06020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27407"
FT                   /db_xref="GOA:Q8KHX9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KHX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27407.1"
FT                   /translation="MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQI
FT                   DAAPEERARGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAA
FT                   DGPMPQTREHILLARQVGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDI
FT                   PIVKGSALAALEDKDKSIGEDAVRLLMSEVDNYIPTPERPVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVIKVGEEVEIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGIDR
FT                   EGIERGQVLAKPASVTPHTRFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVT
FT                   LPEGTEMVMPGDNVAMDVSLIVPIAMEEKLRFAIREGGRTVGAGIVSKIIE"
FT   tRNA            705746..705821
FT                   /locus_tag="BH06030"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:705779..705781,aa:Trp)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        706032..706244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BH06040"
FT                   /product="Preprotein translocase secE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BH06040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27408"
FT                   /db_xref="GOA:A0A0R4J699"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J699"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27408.1"
FT                   /translation="MPSKTNPITFLKQVYAETVKVKWPTRRETVISTFMVLLVTSLASA
FT                   FFFIVDQVMHFSVWRFIDLLKYLFS"
FT   CDS_pept        706265..706795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BH06050"
FT                   /product="Transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27409"
FT                   /db_xref="GOA:A0A0R4J8U5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27409.1"
FT                   /translation="MAARWYIVQAYSNFEKKVAEAIDKEAKQKGLDHLFEKIFVPTERV
FT                   IEVRRGRKVDAERKFFPGYVLVCAELTDEVYHLIKNTPKVTGFLGSDSRPVPISDREAE
FT                   QILKQVQERVESPKASVLFEVGEQVRVADGPFVSFNGVVQEVEEERSRLKVEVLIFGRP
FT                   TPVDLEFNQVEKL"
FT   CDS_pept        706945..707373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BH06060"
FT                   /product="50S ribosomal protein l11"
FT                   /db_xref="EnsemblGenomes-Gn:BH06060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27410"
FT                   /db_xref="GOA:Q6G3X9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3X9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27410.1"
FT                   /translation="MAKKSIGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAA
FT                   TQEMEKGAPIPVIITYYQDKSFTFSLKTPPVSFFLKKEANLKSGSKEPGKVSVGSISRD
FT                   KIRSIAQAKMKDLNANDIEAAMRMVEGSARSMGLEVVG"
FT   CDS_pept        707378..708076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BH06070"
FT                   /product="50S ribosomal protein l1"
FT                   /db_xref="EnsemblGenomes-Gn:BH06070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27411"
FT                   /db_xref="GOA:Q6G3X8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27411.1"
FT                   /translation="MGKVAKRIKNIRKDINFNELYALKDAVSMVKERAIAKFDETIEIS
FT                   MNLGVDPRHADQMVRGVVHLPNGTGRNVRVAVFARGDKAEEAKTAGADIVGAEDLFESI
FT                   NGGAIDFDRCIATPDMMPLVGRLGKILGPRNLMPNPKVGTVTLDVANAVKASKGGAVEF
FT                   RVEKAGIVHAGIGKASFGVEKIVENIKAFASAVIKAKPQGAKGEYIKRVAVSSTMGVGI
FT                   KVDPATVRSE"
FT   CDS_pept        708441..708959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BH06080"
FT                   /product="50S ribosomal protein l10"
FT                   /db_xref="EnsemblGenomes-Gn:BH06080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27412"
FT                   /db_xref="GOA:Q6G3X7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27412.1"
FT                   /translation="MNRAEKREFVTWLNEAFRKSGSVIVAHYSGLTVSQMNDLRSKMSE
FT                   AGGAIKVAKNRLAKIALQGTESESIVDLFSGQTLIAYSEDPITAPKVAVDFAKTNDKFV
FT                   ILGGSMGATSLSVDAVKSLASLPSLNELRAKLVGMISTPATRIAQVVNAPAGQVVRVIG
FT                   AYAQEGKAA"
FT   CDS_pept        709062..709433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BH06090"
FT                   /product="50S ribosomal protein l7 /l12"
FT                   /db_xref="EnsemblGenomes-Gn:BH06090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27413"
FT                   /db_xref="GOA:Q6G3X6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3X6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27413.1"
FT                   /translation="MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVAG
FT                   AAAPVAEEKTEFDVILVEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKD
FT                   EAEKIKSQLEAAGAKVELK"
FT   CDS_pept        709722..713873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BH06100"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH06100"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27414"
FT                   /db_xref="GOA:Q9KJG4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KJG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27414.1"
FT                   /translation="MAQTLAMTSQFNGRKRVRKFFGKIPEVAEMPNLIEVQKASYDQFL
FT                   MIEEPKGGRPDEGLQAVFKSVFPISDFSGTAMLEFVGYQFDSPKFDVEECRQRDLTYAA
FT                   PLKVILRLIVFDVDEDTGSKDIKDIKEQGVYMGDMPLMTTNGTFIVNGTERVIVSQMHR
FT                   SPGVFFDHDKGKSHSSGKFLFAARVIPYRGSWLDIEFDAKDIIYARIDRRRKIPVTSLL
FT                   MALGMDASDILSTFYNKVTYERDGDGWRIPYSVDRFKGMKLVSDLIDADSGEVVAEAGK
FT                   KLTVRAAKALAEKGLKAVKVSEDDLLGSYLAEDIVNYQTGEIYLEAGDEIDEKTLRVLF
FT                   DVNADQIDILDIDHMNIGAYIRNTLKVDKNESRQDALFDIYRVMRPGEPPTMDTAEAMF
FT                   HSLFFDPERYDLSAVGRVKMNLRMDLDCPDTVRVLRQEDILAVVKMLVELRDGRGEIDD
FT                   IDNLGNRRVRSVGELMENQYRIGLLRMERAIKERMSSVEIDTVMPQDLINAKPAAAAVR
FT                   EFFGSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIE
FT                   TPEGPNIGLINSLATFARVNKYGFIESPYRKIIDGKVTTEVIYLSAMEESKHYVAQANS
FT                   SLDAEGRLSEEFVVCRHAGEVLMAPRDHVDLMDVSPKQLVSVAAALIPFLENDDANRAL
FT                   MGSNMQRQAVPLVRAEAPFVGTGMESIVARDSGAAVAARRSGIVDQVDATRIVIRATED
FT                   LDPSKSGVDIYRLQKFQRSNQSTCINQRPLVHVGDRVEKGNIIADGPSTDLGDLALGRN
FT                   VLVAFMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVAARDTKLGPEEITRDIPNVA
FT                   EEALRNLDEAGIIYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKASDVRDTS
FT                   MRMPPGAFGTVVEVRVFNRHGVEKDERAMAIEREEIERLAKDRDDEQSILDRNVYARLT
FT                   DMLVGKVAVEGPKGFSKNKKLDTTIMGHYPRSQWWQFTVEDEKLQNEIEALRNQYDESK
FT                   EALQRRFMDKVEKVQRGDEMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRILP
FT                   IEDMPFLEDGTHADIVLNPLGVPSRMNVGQILETHLGWACAGMGKKIGDLVDLYQETGD
FT                   ILPLRQRIENLMPDDDHNEPVRQYDNESLYKLALQMRKGVSIATPVFDGAHEADINMML
FT                   EDAGLDSSGQVTLYDGRTGEPFDRPVTVGYIYMLKLHHLVDDKIHARSIGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYEAIVRGDDTFEA
FT                   GIPESFNVLVKEMRSLALNVELDDARELIAQRALSDTTEQ"
FT   CDS_pept        714049..718257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BH06110"
FT                   /product="DNA-directed RNA polymerase beta prime chain"
FT                   /db_xref="EnsemblGenomes-Gn:BH06110"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27415"
FT                   /db_xref="GOA:Q6G3X4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3X4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27415.1"
FT                   /translation="MNHEVMNLFNPQSPAQTFDSIRISIASPEKILSWSYGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYKGIICEKCGVEVTLSRVRRERMG
FT                   HIELAAPVAHIWFLKSLPGRISTLLDLTLKDIERVLYFENYIVTEPGLTSLKLHQLLSE
FT                   EEYMLAIDEFGEDQFTAMIGAEAIYELLASMELEKIANDLRAELSETTSELKQKKLIKR
FT                   LKIVENFLESGNRPEWMIMKTIPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLIELRAPGIIVRNEKRMVQEAVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRF
FT                   RQNLLGKRVDYSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYARLDAKGYSSTVKQA
FT                   KKLVEKEHPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTA
FT                   FNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILHPANGAPIIVPSQDMVLGLYYLSI
FT                   VSEKEPGEGMVFSDIGELHHALENKVVTLHTKIKGRVKNIDKDGKEVAKLYDTTPGRLI
FT                   IGELLPKNPSISFDIVNQEMTKKNISKMIDQVYRHCGQKETVIFCDRIMQLGFSHACRA
FT                   GISFGKDDMLIPDSKLRLVAETEALAKEYEQQYNDGLITQGEKYNKVVDAWGKCTDRVA
FT                   DEMMKRIQAVEFDPKTGRQRPMNSIYMMSHSGARGSANQMKQLAGMRGLMAKPSGEIIE
FT                   TPIISNFKEGLTVNEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDAIISAVDCG
FT                   TAKGLTMQPIVDAGQIVASLGQRILGRTALVDILHPVSGEVILEGGAMIEEADVAKIEE
FT                   AGIQSVQIRSALTCETRLGVCAKCYGRDLARGTPVNQGEAVGVIAAQSIGEPGTQLTMR
FT                   TFHLGGTAQVVDSSHLEASYEGTVEIRNRNVVRNSEGHLVVMGRNMAILIKDGSGKERV
FT                   VHRISYGAHIFVDDGDVVKCGQRIAEWDPYTRPILTEVEGYVGFEDMIDGLSVTETADE
FT                   STGITKRLVIDWRANPRGADLKPAIIIHADKKGEAIAKYKGAEARYMMSVETILSVEPG
FT                   SHVKAGDVIARLPMESAKTKDITGGLPRVAELFEARRPKDHAIIAEVSGTIRFGRGYKN
FT                   KRRIIIEPNDETLEPVEYLIPKGKLFHFQEGDQIEKGDYILDGNPAPHDILAIKGVEAL
FT                   ASYLVNEIQEVYRLQGVLINDKHIEVIVRQMLQKVEITESGDSGYIPGDHVDRIELDEI
FT                   NDNLLAEGKRPASGNPILLGITKASLQTPSFISAASFQETTRVLTEAAVSGKIDTLQGL
FT                   KENVIVGRLIPAGTGGTIAQIRRIAAVRDDLIVDEQRKSGNNEVAKAMLTNMTTVTTVE
FT                   "
FT   CDS_pept        718857..719243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06120"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BH06120"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27416"
FT                   /db_xref="GOA:A0A0R4J8D8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27416.1"
FT                   /translation="MYGYYSIGELTKEFSITARTLRYYEEEGLLVPCRHGSARFYTQTD
FT                   RHKLKQILRAKRVKFSLSEISEMLSMVGKPPTDEKKLKELIAGVNKKRADLQQMQRDID
FT                   DFLHDLERIEETLFESLAELGVNR"
FT   CDS_pept        719467..720156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnbA"
FT                   /locus_tag="BH06130"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06130"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27417"
FT                   /db_xref="GOA:A0A0H3M323"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:3GR3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M323"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27417.1"
FT                   /translation="MADAPIDIFQSILSRKSIRAFTDQPVTQETIREILKLAARAPSGT
FT                   NLQPWQVIVLTGKILQKVGQELSQLVLSGIKGEREYHYYPRQWREPYLSRRRKVGLDLY
FT                   KSLGIQKGDQEKMLHQKAKNFLFYGAPVGLLFTIDHDMEMGSWLDLGMFMQTIMLAARG
FT                   FGLDTCAQAAFADYHKQIRSLLSVPSDRHIICGMALGYRDMNAPENNFETEREPIDNFV
FT                   HFIKSYP"
FT   CDS_pept        720510..721907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="BH06140"
FT                   /product="L-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06140"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27418"
FT                   /db_xref="GOA:A0A0H3LY08"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27418.1"
FT                   /translation="MFLSVFELFKIGIGPSSSHTMGPMTAANMFLREIMRCNFLRSSHT
FT                   GISHIRVYLYGSLAFTGVGHATDRAVILGLLGEEAATVNPDNIDILLEKVTREKKVQPD
FT                   GHPAYWFNLQSDLIFKRKEVLPGHTNGLAFEGLDADGNVLLRQTYYSIGGGFVVTEDEL
FT                   NCINGNTQSKTSKVPYPFDSARKMLSMAEKSGLSIAEMKRLNEETKMERSALNTGLDNI
FT                   FSAITKCIDRGLSQEGELPGGLRVSRRAKKLYETLLENQKKNRNYPLLANDWLSVYAIA
FT                   VNEENAAGGRVVTAPTNGAAGVVPAVLRYYLQFNDNSDQEGIHNFLLTAAAIGGVIKHN
FT                   ASISGAEVGCQGEVGTASSMAAAGLTAVLGGTPAQIENAAEIALEHHLGMTCDPVAGLV
FT                   QIPCIERNAMGAVKAVTASSLALHGNGKHFVSLDACIETMRQTGHDMSERYKETSKAGL
FT                   AVNAISC"
FT   CDS_pept        complement(722414..722692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06150"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J989"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27419.1"
FT                   /translation="MTHNALASSTEKEKLLKQSFLLSLRSLQDAATKLAGLKHTPAPLN
FT                   TQSLVNLFICQTTRNRRLIMPPVRIHLRVASQTHSVPIKIRLGATNV"
FT   CDS_pept        complement(722725..724074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA1"
FT                   /locus_tag="BH06160"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06160"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27420"
FT                   /db_xref="GOA:A0A0H3LWX7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27420.1"
FT                   /translation="MYIDCQKIVRCYKKIAIAFVVLALSYSWAFATPQEAYPDKYAAIV
FT                   IDANTGKTLFQANATLKRYPASLTKMMTLYLLFEAMHMRRVTPNTPILVSRNAATRPPT
FT                   KLGLKTGQTISAQEAAKALITRSANDVATAIAEYLGGNEKKFARMMTAKARKLGMINTH
FT                   FANASGLPDVRNYSTARDMATLSLALRKHFPQQYKLFKIKSFIFHGHTVNTHNKLVKTM
FT                   KGVDGIKTGYTQMSGSNLATSMRIEGRSIVAVVMGGKSSTARDKHMASLLSQYLPKASR
FT                   MKNDGRLMASAHYNLPNGAQTPIPPVKADPTDSDDEISTLLTAFAEQSRNSNTAIAAVN
FT                   QAIIPIPNPQKAISVKINEIVTASLSTNAGWAIQIGSLPSKKQAETLLLKAKNKAYSAL
FT                   KNASSHMQLFEKNKRRYYRARFVGFQSKKAAFNACSLLKKANFNCYTVAY"
FT   CDS_pept        724319..724690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06170"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27421"
FT                   /db_xref="GOA:Q6G5D4"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27421.1"
FT                   /translation="MAQNLIKNSITHFMHNEKGKNGDEYRHDAFIMPKMRSKLQKPKLY
FT                   RVLLLDDDYTPMDFVIFVLKSFFKKNFEEAMHIMLSVHQNGVGECGIYNYEVAEMKIIQ
FT                   VRECARQNEHPLQCVMEWK"
FT   CDS_pept        724697..727048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="BH06180"
FT                   /product="Endopeptidase clp ATP-binding chain a"
FT                   /db_xref="EnsemblGenomes-Gn:BH06180"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27422"
FT                   /db_xref="GOA:A0A0H3LWC8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27422.1"
FT                   /translation="MPSFTPSLEEVLHRALTIANQARHEYATLEHLLLALLDDADASSV
FT                   IRACQVDVEELRERLTNYIQSELDAQMRNDEDTKPTTFFQRVIQRAVIHAQSAGKDEVS
FT                   GANVLVAIFSERESYAAYFLQEMGMTRYDVVRFISHGITRDDGLSMLLEDLEDQLDQQI
FT                   SDNSIKVTSALTAYCIDLNCKARNGKVDLLIGREVEISRMIQVLCRRSKNNPLLVGDPG
FT                   VGKTAIIEGLAKRIVDGEVPEVLSNATIFSLDMGGLVAGTRYRGDFEERLKQLIKEFEQ
FT                   YSNAVLFIDEIHTLIGAGATLGGNMDAANLLKPALSSGTIRCIGSTTYKEYRKIFEQDR
FT                   ALERRFQKIDVNEPSVADAIKILQGLKPYFEDFHQIKYTDEAMKASVELSSRYMIDRRL
FT                   PDKAIDVIDESGAAQRLLPKKQRKKSIGVKEIEATVATMARIPPKTVSGDDQKMLSKLE
FT                   RELKHVVYGQDQAISVLVSSIKLARAGLRDADKPIGSYLFSGPTGVGKTEVTKQLASSL
FT                   GIELLRFDMSEYMERHTVARLIGAPPGYIGFDQGGLLTDAVDQKPHAVLLLDEIEKAHS
FT                   ELFNILLQVMDYGKLTDHNGKKIDFRNIILIMTTNAGASDMAKSAIGFGKVHRDGDDIE
FT                   AINRLFTPEFRNRLDAIIPFSPLSQLIINQIVQKFIFQLEAQLADRGICFELSPSAMVW
FT                   LANKGYDFQMGARPLGRIIQEYIKKPLADEILFGQLRNGGMVRVLTHRPNGGKEKLQLK
FT                   ISSSDGSVGLKNRKTARFSKKRVGRKSSAT"
FT   CDS_pept        complement(727056..727478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06190"
FT                   /product="Hit-like protein involved in cell-cycle
FT                   regulation"
FT                   /db_xref="EnsemblGenomes-Gn:BH06190"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27423"
FT                   /db_xref="GOA:A0A0H3M325"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="PDB:3LB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M325"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27423.1"
FT                   /translation="MKQAYDNNNIFAKLIRNEIPSVRVYEDDDVIAFMDIMPQAPGHTL
FT                   VIPKKGSRNLLDADTETLFPVIKAVQKIAKAVKKAFQADGITVMQFNEAASQQTVYHLH
FT                   FHIIPRMEGIELTPHNNIITPTEILEENAKKIRAAL"
FT   CDS_pept        complement(727614..728075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06200"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27424"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J723"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27424.1"
FT                   /translation="MTNAIENHLKNFGMTLPEATQPIANYVTASQSSNQLFISGQLPLF
FT                   DGKPVATGKVGATVSTEQAKKSAEVCALNILAQIKAALGDLNKIKRVVKITVFVAVDPH
FT                   FTDIPLVANGASDLLVNILGDAGKHARSAIGVASLPMDVPVEVEAIIEI"
FT   CDS_pept        728220..729044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06210"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27425"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27425.1"
FT                   /translation="MSRLLFVIVLYIAFLCAARAEESIFVAPHRAVYDFQLDSASHDMA
FT                   ILGMTGRMVYELTGSVCQGYTTRFRFISRIHIEDMPVRLTDQQTTSYETGDSQTFHFSV
FT                   KDQVGQEVAHNVEGLAERTQDGIIIKLKKPKDKEYKLALAEFPIMQLKSIIRHAKAGRH
FT                   FYNTTVFDGTDKADKVIKESIIIGEKKTQLSDDETEKLGKLDEEGYWPVTISYFDDIEK
FT                   KDGLPVYRTSFLLHENGVMRDLHIDYGAFAVRAKLNSLEFLDGEKSLDQCKH"
FT   CDS_pept        729223..729996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BH06220"
FT                   /product="30S ribosomal protein s2"
FT                   /db_xref="EnsemblGenomes-Gn:BH06220"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27426"
FT                   /db_xref="GOA:Q6G5C9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27426.1"
FT                   /translation="MALPDFTMHQLLEAGVHFGHQTHRWNPKMTPYIYGQRNNIHIIDL
FT                   AQTVPLLHQALKLVSDTVARGGRILFVGTKRQASDIIADAANRSAQYYVNARWLGGMLT
FT                   NWKTISNSIQRLRKLDKILAAEAQGFTKKERLNLERDREKLNRALGGIKDMGSVPDLIF
FT                   IIDTNKENIAIQEAKRLGIPVIAIIDTNCDPDNVDHPIPGNDDASRAISLYCDLFARAA
FT                   LDGIARQQGAMGIDLGAQADAPVDPVLENTAPVSE"
FT   CDS_pept        730110..731033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BH06230"
FT                   /product="Elongation factor ts (EF-ts)"
FT                   /db_xref="EnsemblGenomes-Gn:BH06230"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27427"
FT                   /db_xref="GOA:Q6G5C8"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27427.1"
FT                   /translation="MSITAAQVKELRELSGAGMMDCKAALAETNGDMEAAVDWLRKKGI
FT                   AKADKKAGRTAAEGLIGVVSQDLSAVLVEINSETDFVARNDVFQDIVRNVATAALGTEG
FT                   SIDAVCASFYPGSEKTVEATIKDAIATIGENMTFRRSAKLSVEDGVVATYIHNSVAEGL
FT                   GKLGVLVAIETTGNKKAAAAFGRQVAMHIAATNPLALTAEDVDSSAIEREKAIFSEQAR
FT                   QSGKPENIIEKMVEGRMRKFFEEVVLLSQAFVMNPDITVDAALKDAEKSIGAPAKITAF
FT                   IRFALGEGVEKEESDFAAEVAAAAKG"
FT   CDS_pept        731195..731914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="BH06240"
FT                   /product="Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06240"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27428"
FT                   /db_xref="GOA:Q6G5C7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5C7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27428.1"
FT                   /translation="MTLALQYKRILLKVSGEALMGGQSFGIDVSVADRIAADIAEVRAI
FT                   GVEVAIVIGGGNIFRGVAVASHGGDRVTGDHMGMLATAINSLALRTSLTKLGVETVVLS
FT                   AIAMPQICESFSQRKAIGYMNQGRVVIFAGGTGNPFFTTDSAATLRAAEIGADVLLKGT
FT                   QVDGIYSADPKTDPTAKRFDRLTHVEILQRGLSVMDTTAVTLARENNVPIIVYSIHEKS
FT                   GLAKVLNGTGRFTIVSE"
FT   CDS_pept        731952..732512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="BH06250"
FT                   /product="Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BH06250"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27429"
FT                   /db_xref="GOA:Q6G5C6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G5C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27429.1"
FT                   /translation="MSVTSIMDDLKRRMHGAISAFKHELGGLRTGRASASLLEPLTVEA
FT                   YGSVVHINQVANISVPEPRMLSVSVWDKTMVGAVERAIRDSGLGLNPITDGMNLRIPLP
FT                   ELNEERRKELVKIAHQYAEQARVATRHVRRDGMDNLKKLEKEGEIGQDEAHGLSEKVQK
FT                   LTDETIADIDKILAVKESEIMHV"
FT   CDS_pept        733282..734097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA1"
FT                   /locus_tag="BH06260"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06260"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27430"
FT                   /db_xref="GOA:A0A0H3LWY1"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27430.1"
FT                   /translation="MSNLISRILTALIFGFITLCLTWVGGTLFFLFVWVIGGFILYEWM
FT                   SITKEKWHVLQKILASVFYLVFGAFLISNASASLIFCILIALAALLAIGPMRKSVWVFF
FT                   GFLYVCFPVVALSFLRGHEPLGFWVVIFLFTIVWGTDIAGYFSGRAFGGPKLAPQFSPN
FT                   KTWMGAIGGTFVGVSGGILIAFQFFDLNSAVFFVLLLALILSIVSQMSDLGQSWLKRQF
FT                   SVKDSGSLLPGHGGFMDRMDGLVGAAFLLYLIGSFMSNMDTPFNLFCMV"
FT   CDS_pept        734113..735261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06270"
FT                   /product="Membrane-associated zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BH06270"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27431"
FT                   /db_xref="GOA:Q8VQ25"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VQ25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27431.1"
FT                   /translation="MDFLNHIIALGDVLLRSLSVLFVIMIIIFVHEAGHYLIGRWCGIK
FT                   ASVFSLGFGPQIVGYTDKRGTQWRLALIPLGGYVKFIGDEEGLHGTSSQSLPIVDGSFG
FT                   SAHAWKKAATVFAGPLFNVLFTVVILTFFFFTYGRVAIEPVVGSFVKDSPAVQAGLQLG
FT                   DRFIEMDGQQVESFEDLMNYVTFHGGDPIEFKMERSGQVFTTVITPKVVERDDGFGNRV
FT                   RSGLMGVGVPVDPDNPARLDPAYVKHIRYSFGRALREASKRATFIVTQTVFFMGRLLGG
FT                   KEDHCRLSGPSKTVKIAWQVSETGFLSLLNFTAFLSIGVGLINLFPIPPLDGGYLLFHV
FT                   VEIITGRPISAKIREIIFRLGLCFVLLFMFFALFNDYFCWFS"
FT   CDS_pept        735467..737863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp89"
FT                   /locus_tag="BH06280"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06280"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27432"
FT                   /db_xref="GOA:A0A0R4J719"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J719"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27432.1"
FT                   /translation="MTMNSRFLNAASVLVLGMRVIAPTTAFVSIAMVEEVQASVVRSIE
FT                   VHGNKFVSAQVVRDNIDIKVGKSFSSGDVDFAVKRLFALGLFYDVKINQVGDRLVVLVK
FT                   EYEVVNQVLFQGNKSLKDPDLKRFISLKPNEPFNSAKLSADVNVIREAYKTVGRNDIAV
FT                   TIQTINLGKGRVNVVFNIVEGRRTKISNITFKGNHAFGSSRLRDVISTKPSGILSLLLR
FT                   GDVYSEERLAADEEALRRFYYNRGYADFRVISSKAVFDEARNAYEIDFVLDEGVRYKIG
FT                   DVQIESDIDGIDVQSMKGILKTRSGDVYSAENIEQSVAIINNKAADSGYAFAKVEPRGN
FT                   RDLANHTISILYNIEQGPRAYVQRIEIRGNEKTRDYVIRREIDLNEGDAYNQTLVQRAK
FT                   RRLESLGFFKAVNISMVPTDQPDQIILVVDVLEAPTGDLSFSGGYTTGGTSPGVSLEVS
FT                   VTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPYFLGYRLSAGVDIFRSTYRADKAYD
FT                   VRQTGGSLRFAVPINDQLSANLAYSYIQEEYDFGKKYDLSKETDIRELYGKYSGAIVQA
FT                   AQHSPWKRSSISYGLTYNTIDDMKNPHDGWYVRVLQEYAGLGGNAKFLKTTGKAMMYKT
FT                   LSDRMDLVGLLSFGGGYIHEIGREGVRIFDMFKINTDMIRGFKYNGIGPRQVSNKGEVY
FT                   FLGGTTYMNATAEVQFPIPVVPEGLGFRGALFADVATLYGSNYKPVFQGETPVTNIKSA
FT                   WRSSAGVSLMWDSPFGPLRFDYAWPIKKQEGDRLQQLNFGISTKF"
FT   CDS_pept        737930..738976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="BH06290"
FT                   /product="UDP-3-o-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06290"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27433"
FT                   /db_xref="GOA:Q8VQ23"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VQ23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27433.1"
FT                   /translation="MADTFFFTPSRRLTVANVAELTGAKLLNPEFSNTVINTLSSLESA
FT                   GKGSLVFVEHRKFSDALVGSSAVAVFCTNEIVFKVPESMAILVTSTPQRDFAQIGRILF
FT                   PDSVKPMPWFGQREISPHAHIHPSAKLAGDVCIEAGAVIGRNVEIGSGSLIASTAVIGE
FT                   NCRIGCDCYIAPKVTVQYSLIGDKVHLYPGACIGQDGFGYIGGASGIEKVPQLGRVIIE
FT                   DGVEIGANTTIDRGTFEDTIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGD
FT                   MSQLGGSVGVADHIVIGKYVQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSI
FT                   GKVKKEKR"
FT   CDS_pept        738978..739445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="BH06300"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06300"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27434"
FT                   /db_xref="GOA:Q8VQ22"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VQ22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27434.1"
FT                   /translation="MITTEGTRSLETLDIEKLLSILPHRYPFLLIDRIVEIDGEQEAIG
FT                   IKNITINEPHFVGHFPAKPVMPGVLILEAMAQTAGAISLLRLGNKQTNLVYLMTVDNAK
FT                   FRKPVIPGDQLKIHVRLLKKRSGMRRFSCIAEVKGVRVAEAEIAAMILEKE"
FT   CDS_pept        739469..740293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BH06310"
FT                   /product="Acyl-carrier-protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06310"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27435"
FT                   /db_xref="GOA:Q8VQ21"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VQ21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27435.1"
FT                   /translation="MSGTKIHPTALVEKGAQLGENVFVGPFCHISSEAVIGDGCSLMSH
FT                   VVIMGKTTLGADSKVFSHAILGAEPQDNKHKGGYTTLSIGKNCTIREGVTMHRGSDSSV
FT                   GMTIVGDNCQFFCYAHIAHDCRVGNNVTFANNVMIAGHVTVGDYVIIGGGAAVHQFVRV
FT                   GHHAFIGGVSALVGDLIPYGTAVGVQAKLAGLNIIGMKRAGLERKDIHALRHAVAMLFD
FT                   HSKPFKERVSDVASFYPASQSVVDVVNFIKEKGKRFYCTPKFEGDRIKENKD"
FT   CDS_pept        740296..741168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA2"
FT                   /locus_tag="BH06320"
FT                   /product="Phosphatidate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06320"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27436"
FT                   /db_xref="GOA:A0A0H3M328"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M328"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27436.1"
FT                   /translation="MSVSGARNFLSGRTAIIAGNGVLPITIAQELEKNGQNPFLVLLRD
FT                   EADALLYRYEHCELSIVELARLVKILKAAEICNIVLAGGVKRRPLLKQLQFDWTTFLAL
FT                   PKLIGALKGGDDVLLKAFVRIIEAHGFCIIGAHEIVPNLLAPREFDLTLRRATRKEKKD
FT                   ILLAAEAAKLLGRLDIGQAAVVINGRVIAVEGAEGTDNMLWRVCEMRERGQIPPKGGVL
FT                   VKCAKPQQDHRVDLPSIGPMTIMNIAKSGLSGIAVEANRSLILSVKTTIEKANKYSLFI
FT                   ETFEKFDHE"
FT   CDS_pept        741161..742366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="BH06330"
FT                   /product="Lipid-a-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06330"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27437"
FT                   /db_xref="GOA:A0A0H3LY16"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27437.1"
FT                   /translation="MNKCFLKIAIVAGEESGDLLGADLISCLSQQTGCKIDLIGVGGRH
FT                   LKALGLKSFFDFQDIALIGLGTVLKKLPLLLIHIHNLSKFIAKEQPDCLIIIDSPDFTH
FT                   RVAKKVHVLAPSIPIIKYIAPTVWAWRPERAKAMRKFVDHVLAVFPFEKKIMQDLGGPP
FT                   TTYVGHRLLTYPPLLTIQSKKRHQSEKKHVFAKQTSSPTLVILPGSRNLEIRYLMPIFR
FT                   EAVEILIQRIPHLHIILPTLPHFVDEIRAFVQSWKNKVEILVDEDAKWHAFSKADVALA
FT                   ALGTVSLELALAKIPMVLCYKLDRFSKLFIFPKIMLWSAALPNIISDKPIVPEYFNEFL
FT                   RPGMLARQIEELLYNPLLRQAQLDVFEMVEQKMKTEVPSGVIAAQTIVTLLKKRSGSLK
FT                   FS"
FT   CDS_pept        complement(742385..743158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06340"
FT                   /product="Amino-acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BH06340"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27438"
FT                   /db_xref="GOA:A0A0H3M5C8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27438.1"
FT                   /translation="MNLKNNKLVHTTKSPVISIRNLNKWYGNFHVLHDINLDVEIGQRI
FT                   VICGPSGSGKSTLIRCINQLEQTHKGSICIHNINIHTAPIHQQKTVLRKIGMVFQHFNL
FT                   FPHMTVMQNCILAPMTVQGLSKQQAKKRAMHYLTQVGIEKHCEKYPLQLSGGQQQRVAI
FT                   ARALCMKPEVMLFDEPTSALDPESVGEVLEVMVQLANTGITMLCVTHEMGFARKVSERI
FT                   LFLENGKIIEDTASDEFFINPKSQRARDFLAKIKH"
FT   CDS_pept        complement(743236..743943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06350"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06350"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27439"
FT                   /db_xref="GOA:A0A0H3LWY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27439.1"
FT                   /translation="MIPEWLYFLFNPALLNRYGLKFIDGFLVTFELVFIACSLGFFLGM
FT                   FITFVRLSNNKLLRYFAHAYVYFFRGSPLLAQLFLFYYGLGSMNSFWQQVGLWWFFQNA
FT                   WYCCIFIFALNSAAYQSEIFKGSFLSVKAGQIEASKALGLSSSTTFFKIILPQAMVVAL
FT                   RPLGNEFILMIKSSAIASLITIYDLMGIAKLTYSRTFDFQVYIWVALIYLLVVALVHRF
FT                   IIAIERHLTRYLR"
FT   CDS_pept        complement(743945..744664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06360"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06360"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27440"
FT                   /db_xref="GOA:A0A0R4J8M9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27440.1"
FT                   /translation="MAQNLALLSFSNGGWGVVILSSAGITLSLALCCGILGLPLGLLSA
FT                   LMIRSNIKTAKAIATLFSSVFRSLPELLTLFLVYYGLQSVIQAVLDYFNIEIIFSINAF
FT                   IAGVLALSMVLAAFSCEVWLGAFNIFDKGQYEAAKALGLSRSTTFFRVVFPQLIRNALP
FT                   GLSNNWLTLLKDTSLVSTISLVDLMQQTNLAVAATNEPMLFYLVACLLYLLFSAFFSAI
FT                   LHYLETRTQLGYQKVLV"
FT   CDS_pept        complement(744744..745496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06370"
FT                   /product="ABC transporter, periplasmic amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06370"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27441"
FT                   /db_xref="GOA:A0A0H3M330"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M330"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27441.1"
FT                   /translation="MKLLAVALITNLVLFTQLANAKTLKIASDASYPPFSYVNSNNELQ
FT                   GFDIDISYALCKKMNVECTIVTQDFEGMIPGLLAKKYDAIISSLAPTEERLQKIDFTDA
FT                   YYSTELVVIVHKDSGIKEISAEAFKDKNLGVQSNTTQAVYAEDHYAAEGVNIKLYPTAI
FT                   EVKRDLLSHRLDIVISDKLAAVNWLENEEKDCCQLLGSLKKTKLPIAIAIRKNNNDLKN
FT                   KFNEAIKEIREDGTYDKIMKKYFTFDIY"
FT   CDS_pept        complement(746366..747661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="BH06380"
FT                   /product="Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06380"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27442"
FT                   /db_xref="GOA:P51033"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27442.1"
FT                   /translation="MSKNKAHITVNDKKIELSVRKGTLGPDVIEIASLYKETDTFTYDP
FT                   GFTSTASCESKITYIDGNEGILLYRGYPIDQLAEKGDFLESCYLLLYGELPTKQEKIDF
FT                   DRCIMQHTMVHEQFARFFHGFRRDSHPMAVMIACLGAMSAFYHDSIDITDPQQRMIASI
FT                   RLISKVPTLAAMAYKYSIGQAFVYPRNDLSYAANFLRMCFSVPCEEYKINPVLTRAMDR
FT                   IFTLHADHEQNASTSTVRLAGSSGANPFACIAAGVACLWGPAHGGANEACLKMLQEIGS
FT                   VERIPEFIARAKDKNDSFRLMGFGHRVYKNYDPRAKIMQQTCHEVLKELNIQNDPLLDI
FT                   AITLENIALNDEYFIEKKLYPNVDFYSGITLKALGFPTEMFTVLFALARSVGWVAQWKE
FT                   MIEDPAQKISRPRQLYTGYAAREYIPIDKRVN"
FT   CDS_pept        complement(747916..749367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="BH06390"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06390"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27443"
FT                   /db_xref="GOA:Q6G3V8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27443.1"
FT                   /translation="MPVITRFAPSPTGFLHIGGARTALFNWLYAKHTGGKMLLRIEDTD
FT                   RERSTEAAVKAIIDGLHWMGLSYDGDPISQFERAERHRQVAEQLVKDGKAYYCYASPEE
FT                   LAEIRENARAEGRPPRYDGRWRERDISKAPKDIKPVIRIKAPQDGETIVHDRVQGDVRF
FT                   PNKDLDDFIILRSDGSPTYMHAVVVDDHDMGVTHIIRGDDHLTNAARQTIIFNAMGWDI
FT                   PVMAHIPLIHGENGAKLSKRHGALGVAAYRKMGYLPAALRNYLVRLGWSHGDDELMSIE
FT                   DMISWFDIDDINKGAARFDLKKLDAINGHYIRMSNNQDLFDAALHILKEIEGGLQIMER
FT                   LDEQRRAQFLKAIPNLKERSKTLCELIDNASFIFTKRPLQLDEKAQTLLDKNGLAILKV
FT                   IYLALKACPSWDVKSLDETLRSYAQTQDLKFGSIAQPLRAALTGRLTSPGVFDVLVLLG
FT                   RDESLNRINDQLVTTACSLHTNQCI"
FT   CDS_pept        749489..751807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06400"
FT                   /product="DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06400"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27444"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27444.1"
FT                   /translation="MFHRGEVKDGLSIRNVSERKKLRLILHDILSTFYDVKNDNCNKQK
FT                   IFLFTPLKKAITFFGRWLIDCINKEISSGLLFSLILVFFSIGIIFYFRLEREPSWEQLG
FT                   VLVGILLGILYILRFYRRIWITTGYLFCIVLGTLAAKIETWRISTPMLSGDIVTTLTGR
FT                   IVSIEKRKREQFRLVLDVLSTEKPVLHHEPHRVRLSARRLPHGLAIGDGLYGKVKIRAL
FT                   SGPVHPGGYDFSFHNYFKGIGAQGIYLGKPIKISVSQPDSILAIVLQKIENLRTNMTQR
FT                   IRMTIDGEKGSVAAALITGQRGGISNDINEALRTAGLAHILSISGLHMTLLSGIVFMII
FT                   RSFLALFPVFSSYYSAKKFAAIIALMITAFYLLLSGIAVSAQRSFVMIAVMLIAVLFNR
FT                   SAVTMRNFSIAGLITLAIMPHEILGPSFQMSFSATAALIAFFDWWNGRSFFRKRKTTSS
FT                   YVGAGVIYFAFLSILSICASSFVAGIASGIYAVYHFSNIAFFSIISNALALPIVSILII
FT                   PFGLIAAFAMCWGLEWFPLQIMGFGVGFVIKIAHAVTSISPDLNPGFMPLSALVLFSIG
FT                   LVGLIFCKTSLRFFFSFFILVGIYVCLVYSPVQLIIAENMRVVGVISERKLYIDHYRIS
FT                   KFTTSIWKKSFRVNEIIKPTKYGPSFNEQFVCDNHACVSLLANGLKVIVLRGEIDQCVE
FT                   ADIIIKTFSMSDPTCNKKMKIIFTPQQLLSRGSVMMTKSGEIIWSSVGFYRPWNNHRQY
FT                   SQKSYNLLHSPSFLTSRKK"
FT   CDS_pept        752210..752914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="BH06410"
FT                   /product="Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06410"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27445"
FT                   /db_xref="GOA:Q6G3V6"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:3HHE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27445.1"
FT                   /translation="MNVQQLKKMAALKALEFVEDDMRLGIGSGSTVNEFIPLLGERVAN
FT                   GLRVTCVATSQYSEQLCHKFGVPISTLEKIPELDLDIDGADEIGPEMTLIKGGGGALLH
FT                   EKIVASASRAMFVIADETKMVKTLGAFALPIEVNPFGIHATRIAIEKAADNLGLSGEIT
FT                   LRMNGDDPFKTDGGHFIFDAFWGRILQPKLLSEALLAIPGVVEHGLFLGLASRAIVAMA
FT                   DSQIKVLEPFDF"
FT   CDS_pept        753022..753579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06420"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27446"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27446.1"
FT                   /translation="MEKIFSFQRFIGYFGAVAIMFMNIGIVHAQGVSAKHLISARKAIN
FT                   AIHATDQFDSFLPTAARDLKNELIGDDPNLATAISEIVDKQALALVKRRSDLEKEIAQV
FT                   YAKYFTQEELDAITAFYSSDTGKKFLTEVPSIARDAYSTFDAWRSSIMQDLVKNVKKEM
FT                   SETLHLENSITPTKSSSSVNPK"
FT   CDS_pept        753781..755172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BH06430"
FT                   /product="Glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06430"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27447"
FT                   /db_xref="GOA:A0A0H3LWY9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:3O0H"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27447.1"
FT                   /translation="MGSFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVI
FT                   RGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFNWEKLVAAKNKEISRLEGLYREGLQ
FT                   NSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNSAIKGSDLCLTSNEI
FT                   FDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMV
FT                   AKGISIIYEATVSQVQSTENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKV
FT                   NEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDAMCFVKNAFENTSTTPDYDLI
FT                   TTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESR
FT                   IVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENG
FT                   EKLDN"
FT   CDS_pept        755251..756630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06440"
FT                   /product="2-dehydro-3-deoxyphosphoheptonatealdolase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06440"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27448"
FT                   /db_xref="GOA:A0A0H3LWD7"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27448.1"
FT                   /translation="MIKKWTPDSWRARPVKQVPTYPDKSVLADVERKLRSYPPLVFAGE
FT                   ARDLKNELATVARGQAFLLQGGDCAESFAEHEADNIRDFFRVFLQMAIVLTFGSSKPVV
FT                   KIGRIAGQFAKPRSSEMESKEGVELPSYRGDIINDIEFDMNSRIPDPQRMSMAYRQSAA
FT                   TLNLLRAFSQGGYANLENVHAWMLSFVFNSPQGERYEMLAERISEAIDFMRSIGISSKT
FT                   NSSLRETSFYTSHEALLLSYEEALTRIDSTSGDWYATSGHMLWIGDRTRQIDHAHVEYC
FT                   RGIKNPLGLKCGPSIESDELLRLIDILNPENEPGRLTLITRFGYDKVENYLPKLIRAVE
FT                   REKRKVIWSCDPMHGNTVTVNGYKTRPFDYVLKEVESFFSVHYGEGTYPGGIHIEMTGR
FT                   DVTECTGGARAISVEDLSDRYHTQCDPRLNADQALELAFLVAELLKKNRDTEPLVFAAN
FT                   G"
FT   CDS_pept        756740..758419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BH06450"
FT                   /product="NH3-dependent NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06450"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27449"
FT                   /db_xref="GOA:A0A0H3M333"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M333"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27449.1"
FT                   /translation="MVQRLMKNDFRVAVAQLNPIVGDIEGNFSLAVMAHQKAKEEGANL
FT                   VLFTELFISAYPPEDLVLKPAFTKACEDAVKKLAKLTKGGPGIVIGLPLRHSDNIYNGV
FT                   VLLDEGRIVTESLKFDLPNYAEFDEKRVFSSGPRPEPIVYHGLKLGIVICEDIWNDFSL
FT                   CAELANKGAEIILVLNGSPYHRNKILKRIEVVRAQALQSGLSIVYANQVGGQDELVFDG
FT                   GSFALNGQGKMVFQMKHFENHIALSHWQKKTAGWQCVSGPNETLLNGLAADYQACVLGL
FT                   RDYVNKNRFQNVILGLSGGIDSALCTTMAVDALGAEKVRTVMMPYHYTSQESLKDAKEC
FT                   AHLLGCRYEIIPIVQPVEVFLKTMAPVFLGLPSDVTEENLQSRVRGVILMALSNKFGSM
FT                   VVTTGNKSEMAVGYATLYGDMNGGFNPLKDVYKTQVYALAQWRNQNHLQNLKGPEGVVI
FT                   PPNIIAKAPSAELRENQKDEDSLPPYPILDDILQSLIEDDMSVCDIIKRGYLRETVEKI
FT                   EHLIYGAEYKRRQSAPGVKISYKNFGRDRRYPIVNRFRNNKN"
FT   CDS_pept        758428..759807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX2"
FT                   /locus_tag="BH06460"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06460"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27450"
FT                   /db_xref="GOA:Q6G3V1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27450.1"
FT                   /translation="MIKVRFAPSPTGYIHIGNIRIALFNWLYAQAHNGTFILRYDNTDV
FT                   ERSKQEYIDAIAVDLEWLGIQPDEIYYQSKRFNRYDEVAEILKQRGLLYPCYETAEELD
FT                   RRRKIQLSRKLPPVYDRAALKLTPEKKREFETQGRKPHWRFLLPNFENDPLQKKRTEVC
FT                   WNDAVKGKQTIDLASLSDPVLIREDGSYLYTLPSVVDDIDMAITHIIRGDDHITNTGAQ
FT                   IALFEALNAKLPTFGHINLLTTLLGKGLSKRNNDLSIHSLRADGFESIAVQCLAVLIGT
FT                   SQNVHPYPNQAVLLEHFNLQDTSRSVAKFDIADLLTLNSHFVHELTYEEVKKRLENLSI
FT                   NGEKVECFWNAIRSNINKVNDAVLWWKMLHDEQNFDTVALEDRAFVRQSLNLLPEGTLN
FT                   EESWKVWTVALKEKTGRRGKALFMPLRQALTGMDHGPEMGKILQLLGREKVIERLIIQG
FT                   E"
FT   CDS_pept        complement(759884..761287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06470"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06470"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27451"
FT                   /db_xref="GOA:A0A0H3LY24"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27451.1"
FT                   /translation="MTPPLNNFDDLGLSAKVIKAVKSVGYTVPTPIQSGTIPHVLQRRD
FT                   VLGIAQTGTGKTASFVLPMLTLLEKGRARARMPRTLILEPTRELAAQVEENFDKYGINH
FT                   RLNVALLIGGVSFEQQDRKLERGVDVLIATPGRLLDHFERGKLLLMGVEILVIDEADRM
FT                   LDMGFIPEIERICKLTPFTRQTLFFSATMAPEITKLTKQFLHSPVTVEVTKASSTASTI
FT                   TQRLVKSGNKAWDKRAVLRELIHNEGDKLKNAIIFCNRKRDISELLRSLIRHNFSVGAL
FT                   HGDMDQYSRMSTLADFKDNKITLLVASDVAARGLDIPAVSHVFNYDVPTHAEDYIHRIG
FT                   RTGRANRSGKAFTIVTKTDQKYINAIEEISNEKIEWLTGDLSTLTTTDQKDDIILKRKS
FT                   PTSSKKTAQKERSVHTQKSLKDDKVGYMKATNNKVNLLQKCHSRKNKNHTPSGFGDDIP
FT                   AFMLIKIRT"
FT   CDS_pept        complement(761433..762206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06480"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27452"
FT                   /db_xref="GOA:A0A0R4J8S7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27452.1"
FT                   /translation="MTQLPSRFHFISAETENAIKATNKLISVYGHYSLEETDVVVAIGG
FT                   DGTMLQTVHNVMNTGKPIYGMNQGAVGFLMNEFHEEKLPNRIAVAHKKEIHPLRMIAKA
FT                   ECQGTIEALAINEVSLFRQSYQAAKIRISIDNNVRMEQLSCDGILVATPAGSTAYNLSA
FT                   QGPILPLMAPLMALTPVSPFRPRRWHGALLPNTAIVRFDMLESDKRPVNAAADNVEVKS
FT                   VYSVTISTAKEVTVSILFDSNHSWDERILSEQFLY"
FT   tRNA            762476..762552
FT                   /locus_tag="BH06490"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:762510..762512,aa:Arg)"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        763143..764681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="BH06500"
FT                   /product="Histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06500"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27453"
FT                   /db_xref="GOA:Q6G3U8"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6G3U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27453.1"
FT                   /translation="MTIVLNPGKVTLSQLEAVYWNGEVSKLHHDTHFAIKKGAERIAKI
FT                   AAGSEPVYGINTGFGKLASIKIDADNVVVLQRNLILSHCCGVGVPLAENIVRLMMTLKL
FT                   ISLGRGASGVRLELVQLLENMLANGVIPVIPEKGSVGASGDLAPLAHMAAVMMGEGEAF
FT                   FQNIRMSGIAALEKAGLCPITLEAKEGLALINGTQTSTALALAGLFRGYRALCGGLLAG
FT                   ALTTDALMGSTAPFHPDIHILRGHYGQIVVSETLEKLVKDSGIRAAHLRDDDRVQDPYC
FT                   IRCQPQVMGACFDLLIAAAKTLIIEANAVTDNPLILSDDTVVSGGNFHAEPVAFAADQI
FT                   ALALCEIGSISQRRIALMVDPAVSYGLPAFLAKNAGLNSGFMIAEVTAAALMSENKQMA
FT                   HPASVDSTPTSANQEDHVSMACHGARRLLAMSENLFTIIGIETLVAAQGIEYRAPLKTS
FT                   SLLQSVMEYLRKNIDTLKGDRYLASDLHKAHILVSEGRLLSVLSETIFPQLKPK"
FT   CDS_pept        765122..765484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06510"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27454.1"
FT                   /translation="MFMNSILRILMAVIFCFSQIVEVNANLWRCRSQESTFMIMVAQEK
FT                   DILVQATNRVFIGISSQNARENDRSIIKQKAEKVIFTAIAIFLGTLALKMVGVFKRWVG
FT                   TRFSQAFEDWRDSLYY"
FT   CDS_pept        765960..767354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06520"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BH06520"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27455"
FT                   /db_xref="GOA:A0A0R4J8C6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27455.1"
FT                   /translation="MVTNELKRGMSKRQVIFLALGSAIGTGLFYGSAQAIKLAGPSVLI
FT                   AYCIAGLAVFMVMRALGEMIIHNPLPGSFARYAANYISPLAGFLTGWTYVFEMILVGLA
FT                   DITAFATYMAFWYPDVAPWIWALSITLIITGINLAAVEVYGELEFWLSSIKIIAIIAII
FT                   ILGIAIIFCGLGTSTISSAVSVDNLWKNGGIFPNGWFGFFACFSVVIFAFGGIEIIGMA
FT                   VMEVQNPHQTISKAINSTPIRILLFYIMTLTILMALYPWNAIGLMESPFVSIFESLGIS
FT                   SAANILNVVVVTAAISAMNSGMYGAGRMIYGLSQESYALKKFQYLSKNGIPIFVILLIF
FT                   IIFLLGVILNYFYHDRLFFLIAAMATFATVFVWVMILLSQIFMRLKMSKEMQCSLKFPI
FT                   PFWPIGSIFSILFMVFIFILLWFFDDTRPILIVGASWISWLIICFYALKLFNFWKKKQY
FT                   QSMNKD"
FT   CDS_pept        767487..767863
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH06530"
FT                   /product="Prophage integrase"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        769173..770948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06540"
FT                   /product="Hemolysin activator protein hec"
FT                   /db_xref="EnsemblGenomes-Gn:BH06540"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27457"
FT                   /db_xref="GOA:A0A0H3M339"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M339"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27457.1"
FT                   /translation="MMFFLSLGQKWVLRILFSILVLFDLFHGVMVYGRSFSVLSPHSPT
FT                   ENFSRGYSEKQQLESIENLRALTPKGMTRPFEGKPRALWGSGYCFPIHDIIVDGVYHLK
FT                   KSSIAAVTGPYVGRCIGLSDIQFLIKQLTKIYLDQGYITARFYIPDQDIKSSKALKLVV
FT                   VEGKLSDIYYNGLPASSHNYVVWSAFPGLEEHILNMRDIEQGLDQINRLFSGHAQSELL
FT                   PGREDGSTIVNINNRPSKAFKVGVSHDNMGQSSTGYARYKAGLTLENILGFNDAWNFSY
FT                   QRSQSDYWGGSTQEGHSNNISASVSIPYGYWSFGLNGYAYNYQSILPGNFTDIETTGDS
FT                   SELHASTSRVFHRDSVSLTILNVGLSYKRSNNYLLGNKIEVGSRQYSVANFGILHTRQM
FT                   FGGTWSFDVSYLQGLPLFQSVKKHVPGAGDAEPQFAKFTGTLSVMTPFKVGEWNFLLSN
FT                   LLSGQYSPHNLLGAEQISLGGASNVRGTRESLIFGNNGFFIRNELFLRTIWWSNNATLK
FT                   KVFGELRPFVGLDYGRVFSQALYGLTGEQLAGWTAGVKLSGGMVSLDASYSSIFWSTIK
FT                   HKKSGTFLMTLTMDL"
FT   CDS_pept        771032..778957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaB1"
FT                   /locus_tag="BH06550"
FT                   /product="Filamentous hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:BH06550"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27458"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27458.1"
FT                   /translation="MLKKVLFWGLGFSCLLAPSALQAQISVDAKANSAHRPDIVAAPNG
FT                   VPSIDIVTPNSSGLSHNKYDDFNIGHVGVIWNNHAQEVGQSQLGGIIPGNPHLRFSGSA
FT                   KVILNEVTSGKRSALNGPGEVFGKQADVIIANPNGISCDGCGFINTPHATLTTGVPEID
FT                   VSGFLKGFVVKGGEITFGARGANFFSGKGVVDVVDIVSRTVHFEGPVAGREIGVAAGTG
FT                   NFDYASRQMKALTDITGKPEYAIDGSALGALQADQIKLVATEKGVGVRMRHDMAANAGQ
FT                   LHLSADGKISLQNAFGHRGVVLKSKSQSVLAKHIASKKHIEIAAKKDVTLETIGADGHF
FT                   IAEAQEGLLTIAGQATSGGNMQLSSREAIKVSGLGAGADIAFATGGDLTIGGTILSGGN
FT                   LKAHAGGDIRAHLLAGGVDMAATGAAGKLVLGSHGGVDLQSVGGAIAAESIYGAGEITL
FT                   VSHNGVSVSQFLQSHDNVAIHTQPDAGVHFGQLIAYGRADIDGGAVDFSSLMTGEDAVL
FT                   KVRNLEAGTLMTGGDFVQSSVFGKLILHEKGSLSIRAQRGIKVGHIISGENIALFAGND
FT                   IYYDQIIGYGSTTLTSGSGGISVENVLSAMGDVRLTANTLDLSKNCSHIYTPQTLYLKG
FT                   DHIDVSGSELTYGGLDFQSTNALDIQHARLQSVTDKGGSGDIIFRAPGIMTDKETSVLA
FT                   ARDFTIKTGKLHNSGQLAAGQNLAFSVTGDATNSKTGLIYVKGNGALKVDGALLNDLGA
FT                   IVAEGDLSFTNLGGTGKSLSLVNKAGLIQAGGNLSIQTKTLQNEADSIPEMKEKKEYSD
FT                   LSFQRPDNYDLLYKEGLLNKITSNRWSKGYIDTPFLEHREFILEKELWDSKEKTYGKIT
FT                   LNSGIVYKAFTWQIAAENGKDRTQTYIWNDQSYMTEKTVTQAFSYKPAVQGMIQSTGDL
FT                   IIHADNIENHYSIMRAGGNADIYASVLTNVGATAYKNTYLSCKAGTDNCYAYNSDGSRD
FT                   VSLDIANGTFRQTGSEVLDTVSGLVQAGGTLNLVVNTLNNTAAEGSITGGAHFGAKAIG
FT                   GNPLDILNGLTGAGSLFSQKVDINGAGELSEGSALPLSKPQLDSVGDILPKQNFLYKTR
FT                   AEFLDVGKFYGSAYFLNRIGYNPDREIFFLGDAYFEKQLVEEQLRDLVGQGLGKGGVLI
FT                   PGKDAVEQMKTLLDVGADYVKANNLPFGEALSEQKLASLETPMVIYVRQSVKGMDVYAP
FT                   VLYIPEKDRASFVFASALIMGENVNITAKNITNSGRINATHHLQMKSSQLLGQGGHFVA
FT                   GNDAVLLADNNICFESGRTSVEGVETVLNTHALSVGGNAAVIAKQDVIASGVRITTGRA
FT                   LVLSAVEGILSIVSAANTNSMGQNIFVIQHQSEVHSGGSITFSAAKDLNVAGSRVQAHD
FT                   NLYLKTERNVSIDATYNSINHYTHGQTSRFMLHKCSHLSAGKGMAITSGRDIRVSASDM
FT                   EAKGNIALGAQGAINVIAKADKVEYHLQSKGTQIDRHVSVSVGASIKGEGDFIAFAGQD
FT                   GKPHNLSILGSSITVDGKVGMKASNDILITNIENSLRIKISGHTKGGFFGSDKSVHNNI
FT                   EVSDVMGSNISGGEGVALESGKNIQIVESTLLANIAHETKDQVKANIFLKSGDNIIIKG
FT                   AEEKFNQQQQWIKKAFLNKKRSHKSDVHKTPISSTFEAEGDIVIESQGNIVISGSQLFT
FT                   KKGVSVIGESVSIDGMSEHHNSHSQEHESGFGVGSTSNFMFIGGKESKTKSDEIIEYKG
FT                   SSLNADGNIKIAAKKSNVHVMGSDLTAREELHLSASHNVNVKDGRNNHSSNSQEKRFGL
FT                   AIQLTKKHNDPTLGIVYAKDKKNQGENSTVQSHLMGGRDVQISADHDVRVQAADVLAEH
FT                   DVNIHAGHDVKISESHDVSKADEMHQKSFANVKTSFDVGTVENVNDATKCFTNGDRKHK
FT                   VSNSIVAEKKTYDLDNKGKDSYNGVKGGATKDALLQGADVSTSITAVFNSKKAEASSHT
FT                   STAVTDTIKAGRAVNMQADKGSIYGIGADIIAGSNPVYQLSNNEQSENITLKAGQDIKL
FT                   ESAQNTKKTQRNSQNSSVSVGYNFSSNDSGWIGNASVRKGKGSSDEVKQKNSHVVSTSD
FT                   VQISSGANTALEGAVISGKHAKMDVGSDLTIASRSDREQISSKQQSLSIGYNGEEKTDA
FT                   ATNNMSFQKNKSSSDYKSVVEQSGIKADEQGFEITVKDKTTLTDGIIESSALAEKNSLT
FT                   TGTITTSDIVNNAKAQASSQGLSLATGGPMYQGKYGLAKNIAKNVLDHAKEQDSAEGQT
FT                   KAAISNGTIILTDEVGQKALTGQDVEQTIASLNRDTATAHHAVSKIDIEKLERIVHENR
FT                   EMATQLLEEGFKYSDEAYKTMFIKEHPIAVVERDEKGNIIYLKDENGNLIRDSRGQKIP
FT                   KSHSLTAEEKEHLQAGSDGKVHVSFNGIFTPPEEAAVYAEQHAVNKNEPLYFVVFPQAD
FT                   TALSELLVAGYQKLLENNFWGLTNSTQEAKDLMSRYGNTGLHIDAHSRGSMTGFNALNS
FT                   FKQQGVHGVAKNTNIKFFGPAANASATAGLLGYASDGKQTTIELENHADDFVGIMIGGN
FT                   PATFYKRPPGSNAWKEAWKMFLSYPNVHACYGHADLACQNDYGLPHSIQIPSSKSWSKK
FT                   "
FT   CDS_pept        778954..779355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06560"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06560"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J718"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27459.1"
FT                   /translation="MKQILKLLSGFVLLSMVGCNLGKPPPGYIAMWEKNSVTDFTEVGK
FT                   ALLECGMPTPYDVDPENQKLSPNDMVSIDACMVQAGFRYKGRSNWCYTFKEDNLPNCRP
FT                   GVVFPQRSVKKRLNSPFCKKYKNSRKCQP"
FT   CDS_pept        779366..779975
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH06570"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(780816..781040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06580"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27461.1"
FT                   /translation="MLSSHESDTDERERASTSMFDKKEKIAAVKTHEYKQFLNNLTTLL
FT                   LQIFFFSAKTKYNLKNNKYKINRNKSLLI"
FT   CDS_pept        780922..783666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06590"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06590"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27462"
FT                   /db_xref="GOA:A0A0H3LWE3"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27462.1"
FT                   /translation="MFKNCLYSWVFTAAIFSFLSNIDVEARSRSSVSLSCDESKLPYKC
FT                   SDGAKHTISDKVYQLVKSSKEENGQDISLTSSAVIVAQQSNTIIQANRVQISGIEGVED
FT                   TYGVIASQGGKVVLSDSTLKDVSTGLRAESGTIEVNRGLVKATQVGIYAEKQGTSVLLT
FT                   NAEIKVESQDIGQKAALFSGNDAVIKMKGGSIDVTDAAALYLGVRGSATLDGVTITSKS
FT                   QQEMDKENANKEDGVAYAVLNVNQHGAISLKNTNVIATGVRALWIGLDANAQSSMGQEA
FT                   NISVSRVNIEDSKIIVSGNKHGMHFDMDKEDNEYQKGFVFLKKTTFEVPDGTAIHSYKS
FT                   SGYIGVTEGTKISGDLLLTAEKESSVAILVDSSSLTGGTRVADDSIAELYLTGGSKWVL
FT                   TKSKEINQQVSNLVSSISFVKLSDSSLIFETPTLQEYQTLYIGKGGEEVYSAQGNAHIY
FT                   LNTHLNGDGLLNNQKTDRLLIDGDVAGKTTVHVQFIAGNQAEALGNGNAKSISIVQVSG
FT                   KAAEDSFQLSSAYIVLEGLPYQYYLHAYGPSSSLGKAKISQRLVKGDGDFWDFRLESKY
FT                   VQLTPNISIVPDSQLMVRNVVPQVPTYLFLPNALFHVGLMDIESQNKQLKVMRSVSSKL
FT                   LKVEGSPVLSVHGYSGNYRYVSDLSKLEYGYGGDLGYKALEVDILLKTIEGTHSTTSFG
FT                   IMATYGRLSLRPQDVENSQKSIFHKWLVTAYGSLESNAGFYVDGLLSYGLFEGDVLTFV
FT                   RGKTATLKGNPLNVSLSAGKAFTTGDEGFIFDPQIQLIYQHLQFHKAHDIDRFDVEMGK
FT                   LDQWAMRIGGRLTKMLAAFEKDRIVSFYGKLHVSHGFRGKQSVYFKDAFQLSAFGSSLE
FT                   AGVGVYSQLSSKLILHSDLMYQHKLTKAGFSGIHFSGGLRYRF"
FT   CDS_pept        complement(783756..784055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06600"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06600"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27463"
FT                   /db_xref="GOA:A0A0H3M342"
FT                   /db_xref="InterPro:IPR003996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M342"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27463.1"
FT                   /translation="MVRISMATTWAFLDEKIINLCLKRENFCQMPIGRKENICWLIDFV
FT                   APYGYVVCIIHNMQWYVFLHQYYCYAIRRNQDGGIRKIACWCCYRAQNPSEELL"
FT   CDS_pept        784033..784459
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH06610"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(785004..785312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06620"
FT                   /product="Virulence-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06620"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27465"
FT                   /db_xref="GOA:A0A0R4J9L8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27465.1"
FT                   /translation="MNDIPVQHNKNRCPSHPGDLLAEIIPATGKTKLEIAQMLGISRQH
FT                   LYAILRAKKPISPSVSARLGKLFGDGAAVWLRMQAAYDAWHAEHETDVSQIPTLHVV"
FT   CDS_pept        complement(785323..785601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06630"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06630"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27466"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J886"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27466.1"
FT                   /translation="MIKTFKSKALAELYETGSSSKTDKKLFKRIIVRLDRLNVAEKPEE
FT                   MNLPGFNFHALIGFHPIRYTVHINGPWCITFEFDSCNAYRVDLEQYH"
FT   CDS_pept        785750..786133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06640"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:BH06640"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27467.1"
FT                   /translation="MEFKNPGFTGLFVIGRKYFMTAENTEMTLHPKKLPPNAGKGRVKG
FT                   VPNKTTSLLKESVIEAAKRAGSKYGKEGLISYLEKQALKCPAAYLALLGKVLPLQVTGE
FT                   DGGAIKMIGRVEIAPLGHDNTTD"
FT   CDS_pept        786231..787253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06650"
FT                   /product="Terminase large subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06650"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27468"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27468.1"
FT                   /translation="MAALKGYQFGMGGISGTILCARQFQNSLAESSLEEIKRAIEGHDF
FT                   LKDYYKVGESSIKSIDGRIAFQFSGLDRNIASIKSMGRILLCWVDEAEPVTETAWQTLI
FT                   PTLREEGEGWRAELWVTWNPLRDNAPVERRFRFSNNEAIKRVEINWSDNPKFPKILNEA
FT                   RLDDLKNRPETYKHIWEGAYLTAIQGAYYQKEMLAAEQEGRIGRVARDPLMQMRAFWDI
FT                   GGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLRRNGYEKALMVLPHDGA
FT                   TKDRVHNVSFESALNDAGFETQVIPHQGAGAVKMRIEAVRRILPSVWFHEETTVLCIKN
FT                   "
FT   CDS_pept        788025..789827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06660"
FT                   /product="Hemolysin activator protein hec"
FT                   /db_xref="EnsemblGenomes-Gn:BH06660"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27469"
FT                   /db_xref="GOA:A0A0H3LWE6"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27469.1"
FT                   /translation="MNGAKRGQFVLLFIFLRQSSLLRIFLAILVLFDLFHGVMVYGRSF
FT                   SVLSPHSPTENFSRGYSEKQQLESIENLRALTPKGMTRPFEGKPRALWGSGYCFPIHDI
FT                   IVDGVYHLKKSSIAAVTGPYVGRCIGLSDIQFLIKQLTQIYLDQGYITARFYIPDQDIK
FT                   SSKALKLVVVEGKLSDIYYNGLPASSHNYVVWSAFPGLEGHILNMRDIEQGLDQINRLF
FT                   SGHAQSELLPGREDGSTIVNINNRPSKAFKVGVSHDNMGQSSTGYARYKAGLTLENILG
FT                   FNDAWNFSYQRSQSDYWGGSTQEGHSNNISASVSIPYGYWSFGLNGYAYNYQSILPGNF
FT                   TDIETTGDSSELHASTSRVFHRDSVSLTILNVGLSYKRSNNYLLGNKIEVGSRQYSVAN
FT                   FGILHTRQMFGGTWSFDVSYLQGLPLFQSVKKHVPGAGDAEPQFAKFTGTLSVMTPFKV
FT                   GEWNFLLSNLLSGQYSPHNLLGAEQISLGGASNVRGMRESLIFGNNGFFIRNELFLRTI
FT                   WWSNNATLKKVFGELRPFVGLDYGRVFPQALYGFTHEQLAGWTAGVKLSGGMVSLDASY
FT                   SSIFWSTIKHKKSGTFLMTLTMDL"
FT   CDS_pept        789911..797839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaB2"
FT                   /locus_tag="BH06670"
FT                   /product="Filamentous hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:BH06670"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27470"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M346"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27470.1"
FT                   /translation="MLKKVLFWGLGFSCLLAPSALQAQISVDAKANSAHRPDIVAAPNG
FT                   VPSIDIVTPNSSGLSHNKYDDFNIGHVGVIWNNHAQEVGQSQLGGIIPGNPHLRFSGSA
FT                   KVILNEVTSGKRSALNGPGEVFGKQADVIIANPNGISCDGCGFINTPHATLTTGVPEID
FT                   VSGFLKGFVVKGGEITFGARGANFFSGKGVVDVVDIVSRTVHFEGPVAGREIGVAAGTG
FT                   NFDYASRQMKALTDITGKPEYAIDGSALGALQADQIKLVATEKGVGVRMRHDMAANAGQ
FT                   LHLSADGKISLQNAFGHRGVVLKSKSQSVLAKHIASKKHIEIAAKKNVTLETIGADGHF
FT                   IAEAQEGLLTIAGQATSGGNMQLSSREAIKVSGLGAGADIAFATGGDLTIGGTILSGGN
FT                   LKAHAGGDIRAHLLAGGVDMAATGAAGKLVLGSHGGVDLQSVGGIIDAESIYGAGEITL
FT                   VSHNGVSVSQFLQSHDNVAIHTQPDAGVHFGQLIAYGRADIDGGAVDFSSLMTGGDAVL
FT                   KVRNLEAGTLMTGGDFVQSSVFGKLILHEKGSLSITAQRGIKVGHIISGENIALFAGND
FT                   IYYDQVIGYGSTTLTSGSGGISVENVLSAMGDVRLTANTLDLSKNCSHIYTPQTLYLKG
FT                   DHIDVSGSELTYGGLDFQSTNALDIQHARLQAVTDKGGSGDIVFRAPGIMTDKETSVLA
FT                   ARDFTIKTGKLHNSGQLAAGQNLAFSVTGDATNSKTGLVYVKGNGALKVDGALLNDLGA
FT                   IVAEGDLSFTNLGGTGKSLSLVNKAGLIQAGGNLSIQTKTLQNEADSIPEMKEKKEYSD
FT                   LSFQRPDNYDLLYKEGLLNKITSNRWSKGYIDTPFLEHREFILEKELWDSKEKTYGKIT
FT                   LNSGIVYKAFTWQIAAENGKDRTQTYIWNDQSYMTEKTVTQAFSYKPAVQGMIQSTGDL
FT                   IIHADNIENHYSIMRAGGNADIYVSVLTNVGATAYKNTYLGCKVHTDAYCYGYKADGSR
FT                   DVSLDIANGTFRQTGSEVLDTVSGLVQAGGTLNLVVNTLNNTAAEGSITGDAHFEAKAA
FT                   GGNPLEALSGLTGAGALFTPKVDLNNSGEPSEGLPLPKPQSGGVGGTLPQQNFLYETRA
FT                   EFLDVGKFYGSAYFLNRIGYNPDREIFFLGDAYFEKQLVEKQMRDLVGQGLGKGSFIPG
FT                   SDAIEQVKTLLDVGADYVKANNLVFGEALSEEQLASLEAPMVIYVRQRIKGMDVYAPVL
FT                   YIPEKDRASFVSAGALIMGDDVNITSQNTSTSTVTNSGRIAANHQLHVHGGDILSQGGH
FT                   FAAGSDAVLLAENNIHLDAGRTMVDGVETVLNTNALSAGGNATVLAKKDMTASGVKIST
FT                   GGDLAMATEQGNLTIGAIKTTDHDAQGNASMHQQSEVNSGGSTTLSSGKDLNILGSEVQ
FT                   TKDNLFLQAKDTVSLDATRNSANSYRGDHTSHVAVHNGSYLSSGKETTVLSGKDIRVFA
FT                   SDIDAKGNVALGAQGNITIDTKSDEMEYHLQGTNLKVDMQASRAVGSSINAGGDFTAIA
FT                   GQDGKPHDLIITGSAVTADGKVELKASNAILITNAENSLQYEMSYHKKGEVFSSSKSQH
FT                   NKIDAAQVVGSLISGGKGVALDSANNTEIVASILTAGKPGEKTPEEQAKADMTIHSGGN
FT                   ILIKGAQEKYNQQQQSSTSSVLHEKSSDNSEAHTTTVSSILGATGNIVLDAQGDATLTA
FT                   SHMIANEDINVAGQSVTIDGMTDHHSSHSETHETGFGVGSGKGFVSIYGSESKTENEES
FT                   FEHQGSSLNGKNITITAKKEDVNVVGSDFSAGEDIKLSAVHNVNVLPGHKSHSASTQEE
FT                   RSGFGFQFEKNRSGASVGVGVASAKDTGDQWEKSNTPSNFKAGRDVQINAGNDVNLQAT
FT                   NVSANRDVNIDAGNNITLETSYDISKAEEKHEKSFAGVTGSVNVGILGTVQDIRDAVKR
FT                   AKNKDNKHHIINGLLGGLKGYDLYNKGKGLYNGMQGGATKDDLLNMADVSTSITVDFKA
FT                   EKAEAFSHTSTAVTDSIEAGRAINMHANKGSIHGIGADLIAGTNSLNNDEQSGNINLEA
FT                   GQDITFESAQNRQNTQNHSQNISVNVGVGYGYGSGGSGWRGNASFGKGKGSSEQVHQKN
FT                   SHIIGTGTVHSNSGGNTTLAGGVVSANRVEMGVGGDFTITSHSDTGQSSSKQNSVSVGF
FT                   NGGKKDDAATTNLALNKDKTFSDYHSVVEHSGIKAGDGGFDITVAGATTLTGGIIDSSA
FT                   SADKNKLTTGTITTSDIANSAKAQASSQGLSLATGGPMSQGKYGLAKNIAKNVLDHAKA
FT                   KDSQEGQTKAAISNGTIILTDEVEQKALTGQDVEQVIASLNRDTANAHKGVQQLDVAKL
FT                   EQIVHENREMATQLLEEGFKVSNEAYKTMFIKKHPIAVVERDEQGHIIYKTDKNGQYIK
FT                   NARGQKIPKSHSLTAEEKEHLQAGSDGKVHVSFNGIFTPPEEAAVYAEQHAVNKNEPLY
FT                   FVVFPQADTALSELLVAGYQKLLENNFWGLTNSTQEAKDLMSRYGNTGLELYAHSRGSM
FT                   TLGNMLYSFQQQGVHGIANENTTINLYGPAFNVLVASDLLGYVSDGKQTTVGFDGHRYD
FT                   FVSRWIGGNSYTYKTILSDSNAWKEWWRMFTDPDNPHTCLGDAGPKCQKRYGSSHLKQK
FT                   P"
FT   CDS_pept        797859..798275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06680"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06680"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27471.1"
FT                   /translation="MKQTLKLFSAVTLLGIAGCQFNKPPAGYLTAWEKNGVTDFTEVGK
FT                   ALLECGMPTPYDRDPENQKLSPNDMVSIDACMVQAGFRYKDEEVERAGGWCYTFRAENL
FT                   PNCRPGVVFPQRSVKKRLNSPFCKKHPEQYECYP"
FT   CDS_pept        798259..798459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06690"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06690"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5F3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27472.1"
FT                   /translation="MNAILKYCCLWKLQSPHSCVPMLVWDCSLHPPSQYCSPLFETAVA
FT                   ENINRLSSHCIKKKSIQRGEK"
FT   CDS_pept        798456..798860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06700"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06700"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27473.1"
FT                   /translation="MKQTLKLLGVVTLLGIAGCQFNKPPLGEVATWEKNGVTDFTEVGK
FT                   ALLECGMPSLIDADSENDNRSFNQKATVYACMVQAGFRDKVGGGTWCENHKVENLPICR
FT                   PGAVIPQRSVKKRLNSPFCKKHPEQYECKP"
FT   CDS_pept        798844..799044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06710"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06710"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LWF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27474.1"
FT                   /translation="MNANLKHCCLWKLQSPHSCVPMPVWDCSLHPPSQYCSPLFETAVA
FT                   ENINRLSSHCIKKKSIQRGEK"
FT   CDS_pept        799041..799445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06720"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06720"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M350"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27475.1"
FT                   /translation="MKQTLKLLGAVTLLGIAGCQFNKPPGGYLSVWEKNGVTDFTEVGK
FT                   ALLECGMPTPYDRDPENRKLSNNAIGSIEACMLQSGFRDKVGGGTMCENHKVENLPICR
FT                   PGAVIPQRSVKKRLNSPFCKKYKNSRKCQP"
FT   CDS_pept        799456..800076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06730"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06730"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27476.1"
FT                   /translation="MWKLQSPHSCVPMLVWDCSLHPPSQYCSPLFETAVAENINRLSSH
FT                   CIKKKSIQRGEKMKKILKLLSCIVVLTIAGCLNQPPPSTLALWEKPGADKAMTQQALTK
FT                   CGWKPVYASPDDMNSYASEFASVYECMKKAGFRYKLQDSKGIYFSPPAKSSSFLSNLMV
FT                   AGYQQFMENESFGVSNSTKHERELMLRIEKEKKRQKTKKSLQR"
FT   CDS_pept        800240..800647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06740"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06740"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27477.1"
FT                   /translation="MKKTLQLLSCIALLIVAGCNMFDEQLALDMWAKPGADQLEVKKAL
FT                   LECGMPSPYNDSMNSKDLSMNANAAVNMCLVKAGFYHKLFKVGLRDRCHNYNAEDLPIC
FT                   VPGSVIPKRSVERRLKSAYCQKYRNKPECQP"
FT   CDS_pept        800676..802376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhaB3"
FT                   /locus_tag="BH06750"
FT                   /product="Filamentous hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:BH06750"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27478"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LX11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27478.1"
FT                   /translation="MSVGYGYGSGGSGWRGNASFGKGRGSSEQVHQKNSHIIGTGTVHS
FT                   NSGGNTTLAGGVVSANRVEMGVGGDFTITSHSDTGQSSSKQNSVSVGFNGGKKDDAATT
FT                   NLALNKDKTSSDYHSVVEHSGIKAGDGGFEINVKDTTTLTGGIIDSSASADKNKLTTGT
FT                   IIMSDIANSAKAQASSQGLSLATGGPMSQGKYGLAKNIAKNVLDHTKAKDSQEGQTKAA
FT                   ISNGTIILTDEVEQKALTGQDVEQAIASLNRDTANAHKGVQQLDVAKLEQIVHENREMA
FT                   TQLLEEGFKVSNEAYKTMFIKEHPIAVVDRDEQGHIIYETDANGEPIENARGQPIPKFH
FT                   SLTAEEKEHLQAGSDGKVHVSFNGIFTPPEEAAVYAEQHAVNKNEPLYFVVFPQADTAL
FT                   SELLVAGYQKLLENNFWGLTNSTQEAKDLMSRYGNTGLELYAHSRGSMTLGNMLYSFQQ
FT                   QGVHGIANKNTTINLYGPAFNVLVASDLLGYVSDGKQTTVGFDGHRYDFVSRWIGGNSY
FT                   TYKTIPSDSNAWKEWWRVVTDPDNPHTCLGDANLNCISMYGSSHLKQKP"
FT   CDS_pept        802397..802810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06760"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06760"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J7I5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27479.1"
FT                   /translation="MKQTLRLLGAVTLFGIAGCHLGGPPTSSIGMWEKPGADFTEIGKA
FT                   LLECGMPTPYDRDPENQKLSPNDMVSIDACMVQSGFRYKDEEVERAGGWCYTFRAENLP
FT                   NCRPGVVFPQRSVKKRLNSPFCKKYKNSRKCQP"
FT   CDS_pept        802992..803396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06770"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06770"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M353"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27480.1"
FT                   /translation="MKQTLRLLGGLALLSIAGCQFNKPPAGYLTAWEKNGVTDFTEVGK
FT                   ALLECGMPTPYDVFPENRNLSNNAWATIEACMIQAGFRDKVGGGTWCENHKVENLPICR
FT                   PGAVIPQRSVKKRLNSPFCKKHPEQYECQP"
FT   CDS_pept        803380..803934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06780"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06780"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27481"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27481.1"
FT                   /translation="MNANLKYCCLWKLQSPHSCVPMPVWDCSLHPPSQYCSPLFETAVA
FT                   ENINRLSSHCIKKKSIQRGEKMKQTLKLLGAVILFIITGCQFNKLPPGDVAAWEKNGVT
FT                   DFTEVGKALLECGLPSLIDADTENRNLSYNANATIDACMLQAGFRYKYDVGGDGVETIK
FT                   PKTFRFVVLALSFHSAVSRSA"
FT   CDS_pept        803962..804453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06790"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06790"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3M5G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27482.1"
FT                   /translation="MHLNANLKYCCLWKLQSPHSCVPMLVWNCSLHPPSQYCSPLFETA
FT                   VAENINRLSSHCIKKKSIQRGEKMKQTLRLLGAVTLLGITGCQFNQPPVSSIGAWEKPG
FT                   ADFTEIGKALLECGMPTPYDRDPENDNRSFNQMATIDACMLQAGFRYKYDVGGGMVWKS
FT                   "
FT   CDS_pept        804836..805299
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BH06800"
FT                   /product="dnaB"
FT                   /note="Identified by comparison to Bartonella henselae"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        805807..806088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06810"
FT                   /product="Proteic killer suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06810"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27484"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J9B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27484.1"
FT                   /translation="MAIVSFKHKGLKLFYTTGSTKAIRPDHVKKLRVILTALTSATCPE
FT                   MLKAPAFKMHPLKGELTGYYSIWVNGNWRVTFRFIGTDVELVDYQDYH"
FT   CDS_pept        806107..806406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapA3"
FT                   /locus_tag="BH06820"
FT                   /product="Virulence-associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BH06820"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27485"
FT                   /db_xref="GOA:A0A0R4J994"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J994"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27485.1"
FT                   /translation="MMHNPAHPGEVLKVAFLEEMGLTIQKLADHLHMTRASLSRVINGH
FT                   ASMSTELAIKLELAGFSKAKFWLDMQTNYNLWKTMQQAQPPISPLVSDSPQTSL"
FT   CDS_pept        complement(806463..807500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06830"
FT                   /product="Integrase /recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BH06830"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27486"
FT                   /db_xref="GOA:A0A0R4J8B7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J8B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27486.1"
FT                   /translation="MPKRRPPHLVKETTRHGKVVWYVRIGHGPRYRIEGTYGTQEFVDS
FT                   YTLAIKQAQNGTPKRMTQTRLTEGSFDWLLHQYLQSMQWHNQSESTKKVKYRILNNVSK
FT                   HIGNHAYKSIEKRHILDAVDRRRATPAAAKHFLTSLNGLFNWAVDNALLNRNPALNIKA
FT                   PKSLNSEGLQPWLEEDIDKYYHHWSHGSHERVWIDVLLYTGLRRGDAVRIGWKDVKDNI
FT                   IHLKTEKSQFKTDVFLPILPELTETLQIGPIGDETFICGKSGNKLVKESFGNLFREACN
FT                   AAGIKKSAHGLRKLAATRAANAGATVSQMKALFGWTEDKMASLYTKTADRKRLAIEAIK
FT                   KLQKG"
FT   CDS_pept        complement(807503..807865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06840"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06840"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LY55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27487.1"
FT                   /translation="MTLWGCSLLPAPPPFLTTFNKCVIHAIGELHPNIRRIDMAHHPPT
FT                   ITQPTIARALREAKKQGCELIEIKPTGELFIHINKSIASTTIGNVYSIEDFPPLEDEKE
FT                   EYTTNHSCPSVDGIKF"
FT   CDS_pept        complement(807862..808485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exo"
FT                   /locus_tag="BH06850"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BH06850"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27488"
FT                   /db_xref="GOA:A0A0R4J6C5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J6C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27488.1"
FT                   /translation="MEQRTAEWFQARLGKVTASNIYNVLSKTAKGTPTSKYEEYKIKLM
FT                   TERLTEEISQSYLTPAMQWGIEHEEDALKEYAIIYDTEVIKCGFIQHPTIEMAGASPDG
FT                   LIGEEGLVEVKCPHSTKHLRFYMDGTIKPEYKAQMQFQMACTGRQWCDFVSYDPHFVGR
FT                   SLRLRMKIKRIHRDEKQIEQINQAVEIFLEEIEQEMKQILTQAA"
FT   CDS_pept        complement(808487..809266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06860"
FT                   /product="phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06860"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27489"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27489.1"
FT                   /translation="MSELSITQTELVEKTKDCAIKATAMDRILTRALENDVDMDRLERL
FT                   IALREKEIERQNYQSFVADLSAMQREYQKIQKNATNTHTNSQYATLDQYIDAIKETLSK
FT                   YHFALFSRIKEQSSDSISVEMTLTHPSGNKIATEGKFPHDTKGCKSNIQAVGSAITYAR
FT                   RYLLGMLLNVVSADDDTDGNVPLTSAFPQQISEIRTLMAQTQTEETKILAYAKVNNLAD
FT                   MSDGQAQTVLHLLKDKRNKQIAKAEQSLSQQEQQTAV"
FT   CDS_pept        809175..809342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06870"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27490.1"
FT                   /translation="MVKMRSIAVALIAQSFVFSTNSVCVILSSLILISSIEAQFPRGVN
FT                   HASVKSWFGC"
FT   CDS_pept        complement(809339..809704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06880"
FT                   /product="hypothetical genomic island protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06880"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27491.1"
FT                   /translation="MYKYEIKPTLCAQLVVRNTHNLGELCITISGYKDEPYVDTIISED
FT                   IMHDFLGEDNFKTMMSSNGLLGFTYSYECIAFMCTGFKMVPPYANKILISLMYHNLRAH
FT                   TAILQTDDIIQPIKSKL"
FT   CDS_pept        complement(809708..810091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BH06890"
FT                   /product="phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BH06890"
FT                   /db_xref="EnsemblGenomes-Tr:CAF27492"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2Q8J9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAF27492.1"
FT                   /translation="MEKKYELTDETTDIVSCHTLYRIRALRDFDDVKAGDLGGFIENES
FT                   NLSHDGNCWVYDNACVTWGSKIYDNAKIYNNARVYGGGRIFENAQIYGNAIVYPNARIY
FT                   GDAKIYGDSEICGESRITTNEKK"
FT   CDS_pept        complement(810104..810835)
FT                   /codon_st