(data stored in ACNUC9435 zone)

EMBL: BX936399

ID   BX936399; SV 2; circular; genomic DNA; STD; PRO; 68525 BP.
XX
AC   BX936399;
XX
PR   Project:PRJNA12950;
XX
DT   27-AUG-2004 (Rel. 81, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Yersinia pseudotuberculosis IP32953 pYV plasmid, complete sequence.
XX
KW   .
XX
OS   Yersinia pseudotuberculosis IP 32953
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid pYV
XX
RN   [2]
RP   1-68525
RA   Chain P.S.G., Carniel E., Garcia E., Larimer F.W.;
RT   ;
RL   Submitted (08-FEB-2004) to the INSDC.
RL   Biology and Biotechnology Research Program, Lawrence Livermore National
RL   Laboratory, Livermore, CA 94550 USA, Yersinia Research Unit, Institute
RL   Pasteur, 75724 Paris Cedex 15, France, and the Genome Analysis Group, Oak
RL   Ridge National Laboratory, Oak Ridge, TN 37831 USA
XX
RN   [3]
RX   DOI; 10.1073/pnas.0404012101.
RX   PUBMED; 15358858.
RA   Chain P.S.G., Carniel E., Larimer F.W., Lamerdin J., Stoutland P.O.,
RA   Regala W.M., Georgescu A.M., Vergez L.M., Land M.L., Motin L.V.,
RA   Brubaker R.R., Fowler J., Hinnebusch B.J., Marceau M., Medigue C.,
RA   Simonet M., Chenal-Francisque V., Souza B., Dacheux D., Elliott J.M.,
RA   Derbise A., Hauser L.J., Garcia E.;
RT   "Insights into the evolution of Yersinia pestis through whole-genome
RT   comparison with Yersinia pseudotuberculosis";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(38):13826-13831(2004).
XX
DR   MD5; 8dcc09c027e1d3431416465ddf1c2fdd.
DR   BioSample; SAMEA3138251.
DR   EnsemblGenomes-Gn; EBG00001217969.
DR   EnsemblGenomes-Gn; pYV0014.
DR   EnsemblGenomes-Gn; pYV0015.
DR   EnsemblGenomes-Gn; pYV0037.
DR   EnsemblGenomes-Gn; pYV0038.
DR   EnsemblGenomes-Tr; EBT00001786720.
DR   EnsemblGenomes-Tr; pYV0014.
DR   EnsemblGenomes-Tr; pYV0015.
DR   EnsemblGenomes-Tr; pYV0037.
DR   EnsemblGenomes-Tr; pYV0038.
DR   EuropePMC; PMC518763; 15358858.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF01396; isrN.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..68525
FT                   /organism="Yersinia pseudotuberculosis IP 32953"
FT                   /plasmid="pYV"
FT                   /strain="IP 32953"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:273123"
FT   CDS_pept        complement(12..2210)
FT                   /transl_table=11
FT                   /locus_tag="pYV0001"
FT                   /product="ypkA; putative targeted effector protein kinase"
FT                   /note="similar to Y. pestis YPCD1.72c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25344"
FT                   /db_xref="GOA:Q05608"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR019093"
FT                   /db_xref="PDB:2H7O"
FT                   /db_xref="PDB:2H7V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05608"
FT                   /protein_id="CAF25344.1"
FT                   /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIID
FT                   NQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPNAL
FT                   SNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAK
FT                   IERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRC
FT                   SDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNVVFDRA
FT                   SGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHCIEGFE
FT                   KNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDS
FT                   NEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSS
FT                   AATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREG
FT                   DTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVL
FT                   VTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADV
FT                   ARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTVDSIPLL
FT                   IQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
FT   CDS_pept        complement(2218..2667)
FT                   /transl_table=11
FT                   /locus_tag="pYV0002"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.73c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25345"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G5"
FT                   /protein_id="CAF25345.1"
FT                   /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRAD
FT                   EILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHLSL
FT                   DELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
FT   CDS_pept        complement(2919..3239)
FT                   /transl_table=11
FT                   /locus_tag="pYV0003"
FT                   /product="putative transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.14c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25346"
FT                   /db_xref="GOA:Q663G4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G4"
FT                   /protein_id="CAF25346.1"
FT                   /translation="MKRLLFHSDQGGQYRSKKSRQLLWRTGVMQSMSRRGNCLDNSPME
FT                   RVFRSLKSEWLPVGGYMDVHHAVRDIGEWGYKVITTHPHRHNGGLPPCEYEEQGKKATK
FT                   VS"
FT   CDS_pept        complement(3411..3650)
FT                   /transl_table=11
FT                   /locus_tag="pYV0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25347"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G3"
FT                   /protein_id="CAF25347.1"
FT                   /translation="MSKKHYCRLHDLNIATFYYWLKHHQDDTTVAIPPAFIPARRVIPD
FT                   NNGTEAVTLNLPNGCSVSCLPAQLRAVMQALSLC"
FT   CDS_pept        complement(4823..5701)
FT                   /transl_table=11
FT                   /locus_tag="pYV0005"
FT                   /product="repA, repA1; putative replication initiation
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.77c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25348"
FT                   /db_xref="GOA:Q663G2"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G2"
FT                   /protein_id="CAF25348.1"
FT                   /translation="MREGVTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKA
FT                   EGFTSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNL
FT                   AIECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFS
FT                   ALDVSDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAH
FT                   GLKRARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSRN
FT                   NNYTRLATGAT"
FT   CDS_pept        5803..5955
FT                   /transl_table=11
FT                   /locus_tag="pYV0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25349"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G1"
FT                   /protein_id="CAF25349.1"
FT                   /translation="MGPGNLLASPKMRKFIGVFAFLVPSKHLSRTSSLPPYGVASQKFF
FT                   KQSVI"
FT   CDS_pept        complement(5998..6252)
FT                   /transl_table=11
FT                   /locus_tag="pYV0007"
FT                   /product="repB, repA2, copB; putative replication
FT                   transcriptional regulator"
FT                   /note="similar to Y. pestis YPCD1.79c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25350"
FT                   /db_xref="GOA:Q663G0"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G0"
FT                   /protein_id="CAF25350.1"
FT                   /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINVF
FT                   IQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
FT   CDS_pept        6779..7183
FT                   /transl_table=11
FT                   /locus_tag="pYV0008"
FT                   /product="possible transposase remnant"
FT                   /note="identical to Y. pestis YPCD1.81"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25351"
FT                   /db_xref="GOA:Q663F9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F9"
FT                   /protein_id="CAF25351.1"
FT                   /translation="MMDIHIAPYRQPFTFQASVYSRRIVGSAISSSPDAELVCRAWRNA
FT                   LETRPREKRLLFHSDQGGQYRSKKYRQLLWRNGVMQSMSRRGNCLDNSPMERVKVNHQC
FT                   QVAPATIDFDIADISTPHTIGLRRLKLPFQ"
FT   CDS_pept        complement(7489..7806)
FT                   /transl_table=11
FT                   /locus_tag="pYV0009"
FT                   /product="hyothetical protein"
FT                   /note="similar to Y. pestis YPCD1.83c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25352"
FT                   /db_xref="GOA:Q663F8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F8"
FT                   /protein_id="CAF25352.1"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
FT   CDS_pept        complement(7978..8436)
FT                   /transl_table=11
FT                   /locus_tag="pYV0010"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.84c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25353"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F7"
FT                   /protein_id="CAF25353.1"
FT                   /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTAQ
FT                   DISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIVDP
FT                   QKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
FT   CDS_pept        8586..8774
FT                   /transl_table=11
FT                   /locus_tag="pYV0011"
FT                   /product="possible transposase remname"
FT                   /note="identical to C-term of Y. pestis YPCC1.85"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25354"
FT                   /db_xref="GOA:Q663F6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F6"
FT                   /protein_id="CAF25354.1"
FT                   /translation="MRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEI
FT                   LKQAAVLMSEFPIKSLR"
FT   CDS_pept        complement(8771..8980)
FT                   /transl_table=11
FT                   /locus_tag="pYV0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25355"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F5"
FT                   /protein_id="CAF25355.1"
FT                   /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRSR
FT                   VNTARYFEQAAQFDHWPFCFQPCD"
FT   CDS_pept        complement(9103..10401)
FT                   /transl_table=11
FT                   /locus_tag="pYV0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25356"
FT                   /db_xref="GOA:P10858"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10858"
FT                   /protein_id="CAF25356.1"
FT                   /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQISP
FT                   NVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKGIH
FT                   SIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDGVAI
FT                   GARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSVSIGH
FT                   ESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKHSNSVA
FT                   RTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAISESNQY
FT                   TDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIG
FT                   SGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
FT   CDS_pept        11010..11234
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pYV0014"
FT                   /product="possible transposase remnant"
FT                   /note="similar to N-term of Y. pestis YPCD1.89"
FT                   /db_xref="PSEUDO:CAF25357.1"
FT   CDS_pept        11219..11389
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pYV0015"
FT                   /product="possible transposase remnant"
FT                   /note="similar to C-term of Y. pestis YPCD1.89"
FT                   /db_xref="PSEUDO:CAF25358.1"
FT   CDS_pept        complement(11386..13701)
FT                   /transl_table=11
FT                   /locus_tag="pYV0016"
FT                   /product="tnpA; putative transposase protein"
FT                   /note="similar to Y. pestis YPCD1.90c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25359"
FT                   /db_xref="GOA:Q663P8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P8"
FT                   /protein_id="CAF25359.1"
FT                   /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRRG
FT                   KHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTRRE
FT                   HTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILLPGA
FT                   TTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLVYDAE
FT                   GRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVCRALGH
FT                   PTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEEPLSLLR
FT                   LNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVLMAEACNI
FT                   GLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRWGGGEVASV
FT                   DGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGL
FT                   LEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRVDKSANYGALD
FT                   ELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMAVGRV
FT                   NKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKRYREGQEDQLGAL
FT                   GLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHINMLGHYTFTLSDDI
FT                   LNGELRALNFNLNNELSP"
FT   CDS_pept        13865..14416
FT                   /transl_table=11
FT                   /locus_tag="pYV0017"
FT                   /product="putative resolvase"
FT                   /note="identical to Y. pestis YPCD1.91"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25360"
FT                   /db_xref="GOA:Q663P7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P7"
FT                   /protein_id="CAF25360.1"
FT                   /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSADR
FT                   EGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGEMG
FT                   KMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMGATE
FT                   IAKKMNIARSTIYKVINESQ"
FT   CDS_pept        15467..15733
FT                   /transl_table=11
FT                   /locus_tag="pYV0018"
FT                   /product="putative transposase"
FT                   /note="identical to Y. pestis YPCD1.93"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25361"
FT                   /db_xref="GOA:Q663P6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P6"
FT                   /protein_id="CAF25361.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT   CDS_pept        15757..16566
FT                   /transl_table=11
FT                   /locus_tag="pYV0019"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.94"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25362"
FT                   /db_xref="GOA:Q663P5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P5"
FT                   /protein_id="CAF25362.1"
FT                   /translation="MEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREIA
FT                   ETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVT
FT                   ALEQCWSMDFVADNLFNGRRVRALTIVDNFSRECLALEVGQGLRGDDVVAVMDRLKHSL
FT                   GRIPQRLQTDNGSEFISKSMDRWAYENRVTMDFSRPGKPTDNAFIESFNGSLRDECLNV
FT                   HGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
FT   CDS_pept        complement(16714..17139)
FT                   /transl_table=11
FT                   /locus_tag="pYV0020"
FT                   /product="sycH; putative yopH targeting protein"
FT                   /note="similar to Y. pestis YPCD1.95c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25363"
FT                   /db_xref="GOA:I3NIC8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:I3NIC8"
FT                   /protein_id="CAF25363.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQ
FT                   LASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
FT   CDS_pept        complement(17484..17915)
FT                   /transl_table=11
FT                   /locus_tag="pYV0021"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.96c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25364"
FT                   /db_xref="GOA:Q663P3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P3"
FT                   /protein_id="CAF25364.1"
FT                   /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVILLG
FT                   PPGVGKTHLAVALGVKAADAGHRVLFMPLYEDITNIGVY"
FT   CDS_pept        complement(17915..19087)
FT                   /transl_table=11
FT                   /locus_tag="pYV0022"
FT                   /product="putative transposase"
FT                   /note="similar to fusion of Y.pestis YPCD1.03c and
FT                   YPCD1.97c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25365"
FT                   /db_xref="GOA:Q663P2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P2"
FT                   /protein_id="CAF25365.1"
FT                   /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPPA
FT                   RKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKMRP
FT                   SKRTVRFETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDAEHT
FT                   YESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRACRPRR
FT                   ARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQTPEQRF
FT                   ALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDEL
FT                   RSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
FT   CDS_pept        19220..19834
FT                   /transl_table=11
FT                   /locus_tag="pYV0023"
FT                   /product="possible transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.04"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25366"
FT                   /db_xref="GOA:Q663P1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P1"
FT                   /protein_id="CAF25366.1"
FT                   /translation="MYRLYHLSSLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMD
FT                   ALATGRRIKCLTCVDDYTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPE
FT                   FTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDVSHARKTIS
FT                   EWRQDYNECRPHSTLNYQTPSEFAAAWRKGNSDSEGSDITK"
FT   CDS_pept        complement(19897..20289)
FT                   /transl_table=11
FT                   /locus_tag="pYV0024"
FT                   /product="sycE, yerA; putative yopE chaperone"
FT                   /note="similar to Y. pestis YPCD1.05c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25367"
FT                   /db_xref="GOA:Q663P0"
FT                   /db_xref="InterPro:IPR005416"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="PDB:1JYA"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P0"
FT                   /protein_id="CAF25367.1"
FT                   /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQ
FT                   ILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLY
FT                   TQLEMLVQGAERLQTSSLISPPRSFS"
FT   CDS_pept        20483..21142
FT                   /transl_table=11
FT                   /locus_tag="pYV0025"
FT                   /product="putative outer membrane virulence protein"
FT                   /note="identical to Y. pestis YPCD1.06"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25368"
FT                   /db_xref="GOA:P08008"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR015110"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="PDB:1L2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08008"
FT                   /protein_id="CAF25368.1"
FT                   /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAG
FT                   RTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSD
FT                   SIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQA
FT                   EASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM"
FT   CDS_pept        complement(21282..21581)
FT                   /transl_table=11
FT                   /locus_tag="pYV0026"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.08c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25369"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N8"
FT                   /protein_id="CAF25369.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   PELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
FT   CDS_pept        complement(21574..21849)
FT                   /transl_table=11
FT                   /locus_tag="pYV0027"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.09c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25370"
FT                   /db_xref="GOA:Q663N7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N7"
FT                   /protein_id="CAF25370.1"
FT                   /translation="MYYSVIHNGGDMAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLR
FT                   DALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
FT   CDS_pept        complement(21960..22163)
FT                   /transl_table=11
FT                   /locus_tag="pYV0028"
FT                   /product="putative transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.10c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25371"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N6"
FT                   /protein_id="CAF25371.1"
FT                   /translation="MMTKHGISVEHSTLHSWVIRVVPLLHKAFCRYKCTVGRRWRMDEA
FT                   SKVSGNTCTGRLILAVRLSIFC"
FT   CDS_pept        22359..22532
FT                   /transl_table=11
FT                   /locus_tag="pYV0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25372"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N5"
FT                   /protein_id="CAF25372.1"
FT                   /translation="MKSPYPTWRDGYRYQKADIMLNDVGSRPGQIDMFDETPPHANSKH
FT                   LMQVVDASIALG"
FT   CDS_pept        complement(22682..22975)
FT                   /transl_table=11
FT                   /locus_tag="pYV0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25373"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N4"
FT                   /protein_id="CAF25373.1"
FT                   /translation="MDIQVGPWSQLLTLALDIQVGPWSQLPTLALDIQVGPWSQLLTLA
FT                   LDIQVGPWSQLPTLTLDIQVGPWSQLPTLALDIQVGPWSQLLTLALNILVEM"
FT   CDS_pept        complement(23123..24088)
FT                   /transl_table=11
FT                   /locus_tag="pYV0031"
FT                   /product="sopB; putative plasmid partitioning control
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.12c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25374"
FT                   /db_xref="GOA:Q663N3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N3"
FT                   /protein_id="CAF25374.1"
FT                   /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNELSA
FT                   RSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
FT   CDS_pept        complement(24085..25293)
FT                   /transl_table=11
FT                   /locus_tag="pYV0032"
FT                   /product="sopA; putative plasmid partitioning transcription
FT                   repressor"
FT                   /note="similar to Y. pestis YPCD1.13c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25375"
FT                   /db_xref="GOA:Q663N2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N2"
FT                   /protein_id="CAF25375.1"
FT                   /translation="MFYYKDANFIEIIHMDLKSTLDRCIERGQFMTQEIAKSQFGNDSP
FT                   AARTITRRWRITEAAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDM
FT                   RDVFKTRLSKPKGENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQAT
FT                   ASLYHGYVPDLHIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIY
FT                   GLHDQGKLPVAPHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAE
FT                   LYDYVSTLQFFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGM
FT                   VLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRW
FT                   ENA"
FT   CDS_pept        25800..25913
FT                   /transl_table=11
FT                   /locus_tag="pYV0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25376"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N1"
FT                   /protein_id="CAF25376.1"
FT                   /translation="MPKSLNAAKWVSIARIMAEGTAYEVEPDLCFTALGTV"
FT   CDS_pept        complement(26051..26245)
FT                   /transl_table=11
FT                   /locus_tag="pYV0034"
FT                   /product="putative transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.14c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25377"
FT                   /db_xref="GOA:Q663N0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N0"
FT                   /protein_id="CAF25377.1"
FT                   /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLPVGGYMDVHHAVRDIGE
FT                   WIQSYYNTPPSAQWWITAL"
FT   CDS_pept        complement(26357..26815)
FT                   /transl_table=11
FT                   /locus_tag="pYV0035"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.15c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25378"
FT                   /db_xref="GOA:Q663M9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M9"
FT                   /protein_id="CAF25378.1"
FT                   /translation="MVELCRLLKITRSVYSASLNLRVDVKRLQLRELHQQSRGAAGNRT
FT                   LSLLMRQSGYNVGRWLAGRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEP
FT                   NRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
FT   CDS_pept        complement(26842..27102)
FT                   /transl_table=11
FT                   /locus_tag="pYV0036"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.85"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25379"
FT                   /db_xref="GOA:Q663M8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M8"
FT                   /protein_id="CAF25379.1"
FT                   /translation="MSRVVKYQRSTIEVARALELDPSQLRKWIHQYKEEVSGVTPDNPA
FT                   LIPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR"
FT   CDS_pept        complement(27269..27874)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pYV0037"
FT                   /product="C-term conjugative transfer: surface exclusion"
FT                   /db_xref="PSEUDO:CAF25380.1"
FT   CDS_pept        complement(27894..28007)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pYV0038"
FT                   /product="N-term fragment conjugative transfer: surface
FT                   exclusion"
FT                   /db_xref="PSEUDO:CAF25381.1"
FT   CDS_pept        complement(28171..28353)
FT                   /transl_table=11
FT                   /locus_tag="pYV0039"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.18c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25382"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M7"
FT                   /protein_id="CAF25382.1"
FT                   /translation="MPMKEIAKRVHRIYCLLKLNIRRKGKQRLPACNPSPLAVPERLNL
FT                   SGSVDFMHNAQCTMH"
FT   CDS_pept        complement(28491..29039)
FT                   /transl_table=11
FT                   /locus_tag="pYV0040"
FT                   /product="yop targeting protein yopK, yopQ"
FT                   /note="similar to Y. pestis YPCD1.19c, yopK, yopQ, probable
FT                   virulence determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25383"
FT                   /db_xref="InterPro:IPR016505"
FT                   /db_xref="UniProtKB/TrEMBL:I3NI99"
FT                   /protein_id="CAF25383.1"
FT                   /translation="MFIKDTYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLRT
FT                   DVCSLVNRVGIEPLKSGSILSTLEELWQAVGIVYRLYEWQHVSDIDTNFKKLPNNSDFG
FT                   LVFSVLDCDIEYVFIGKKDSEGNIEFYDPKNSLLIENDDIKKYLYDENFHRFCIMLIIS
FT                   KSELEELSRESCDQECIMG"
FT   CDS_pept        29513..30481
FT                   /transl_table=11
FT                   /locus_tag="pYV0041"
FT                   /product="yop targeted effector yopT"
FT                   /note="similar to Y. pestis YPCD1.20"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25384"
FT                   /db_xref="GOA:Q93RN4"
FT                   /db_xref="InterPro:IPR003951"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93RN4"
FT                   /protein_id="CAF25384.1"
FT                   /translation="MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSHS
FT                   NLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRE
FT                   SVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQLYVG
FT                   GRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTG
FT                   TTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFH
FT                   FSDKEKFRKWFTNSFWDNSMYHYPLGVGQRFRVLTFDSKEV"
FT   CDS_pept        30481..30873
FT                   /transl_table=11
FT                   /locus_tag="pYV0042"
FT                   /product="yopT chaperone"
FT                   /note="similar to Y. pestis YPCD1.21"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25385"
FT                   /db_xref="GOA:Q663M4"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M4"
FT                   /protein_id="CAF25385.1"
FT                   /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQ
FT                   QWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERF
FT                   IDDIEQRKEPQNTKFQPNSTSPILFI"
FT   CDS_pept        31368..31559
FT                   /transl_table=11
FT                   /locus_tag="pYV0043"
FT                   /product="possible transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.24c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25386"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M1"
FT                   /protein_id="CAF25386.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYRV
FT                   REGSTFMNRLFNIEVVLA"
FT   CDS_pept        31576..31995
FT                   /transl_table=11
FT                   /locus_tag="pYV0044"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.23"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25387"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M2"
FT                   /protein_id="CAF25387.1"
FT                   /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVFI
FT                   QVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIATA
FT                   LCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
FT   CDS_pept        complement(32524..32715)
FT                   /transl_table=11
FT                   /locus_tag="pYV0045"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.24c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25388"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M1"
FT                   /protein_id="CAF25388.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYRV
FT                   REGSTFMNRLFNIEVVLA"
FT   CDS_pept        32890..33189
FT                   /transl_table=11
FT                   /locus_tag="pYV0046"
FT                   /product="putative transposase remnant"
FT                   /note="similar to Y. pestis YPCD1.25"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25389"
FT                   /db_xref="GOA:Q663M0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M0"
FT                   /protein_id="CAF25389.1"
FT                   /translation="MVLQSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLTK
FT                   TKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRLDKVITL"
FT   CDS_pept        complement(33232..34884)
FT                   /transl_table=11
FT                   /locus_tag="pYV0047"
FT                   /product="yopM; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.26c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25390"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L9"
FT                   /protein_id="CAF25390.1"
FT                   /translation="MYGFVCSEKLDNKNIFRKAFNMFINPRNVSNTFLQEPLRHSSNLT
FT                   EMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGL
FT                   SSLPELPPHLESLVASCNSLTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVREND
FT                   LTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYAD
FT                   NNLLETLPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTA
FT                   SSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPHLEILVASYNSLTELPELPQSLKS
FT                   LRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPS
FT                   LKKLHVRENDLTDLPELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEIRSLCDLPP
FT                   SLVDLNVKSNQLSELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQNALREFPDIP
FT                   ESLEELEMDSERVVDPYEFAHETTDKLEDDVFE"
FT   CDS_pept        complement(35009..35104)
FT                   /transl_table=11
FT                   /locus_tag="pYV0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25391"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L8"
FT                   /protein_id="CAF25391.1"
FT                   /translation="MAGIETTAPKYTDLKFNDIAGKVDSAAIQYF"
FT   CDS_pept        complement(35209..35424)
FT                   /transl_table=11
FT                   /locus_tag="pYV0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25392"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L7"
FT                   /protein_id="CAF25392.1"
FT                   /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDTA
FT                   KQYTNTVSSNTLDSANTYTNNKADSH"
FT   CDS_pept        35445..35567
FT                   /transl_table=11
FT                   /locus_tag="pYV0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25393"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L6"
FT                   /protein_id="CAF25393.1"
FT                   /translation="MAPGDFKWEHFAPDELCQCQRYAVRAWDFRLSLYHLPLVY"
FT   CDS_pept        35593..35916
FT                   /transl_table=11
FT                   /locus_tag="pYV0051"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis Y0056, similar to Y. intermedia
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25394"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37133"
FT                   /protein_id="CAF25394.1"
FT                   /translation="MKRYQFTDADSSWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYFS
FT                   PKRNKNTAYPFIKRVLKTYSVERQPKILNTDKHSSYGYAITRLMKEGKDTRCCKAAASQ
FT                   IPE"
FT   CDS_pept        35951..36073
FT                   /transl_table=11
FT                   /locus_tag="pYV0052"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-term Y. pestis YPCD1.24c, possible
FT                   transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25395"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L4"
FT                   /protein_id="CAF25395.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRRL"
FT   CDS_pept        36160..36327
FT                   /transl_table=11
FT                   /locus_tag="pYV0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25396"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L3"
FT                   /protein_id="CAF25396.1"
FT                   /translation="MSKITDSHYWDMCHSFLIAYYWNDTAFLTLSLYTSKMPITAADVL
FT                   NDRVLPFNNR"
FT   CDS_pept        complement(36551..37471)
FT                   /transl_table=11
FT                   /locus_tag="pYV0054"
FT                   /product="yopD; putative Yop negative regulation/targeting
FT                   component"
FT                   /note="similar to Y. pestis YPCD1.28c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25397"
FT                   /db_xref="InterPro:IPR008898"
FT                   /db_xref="PDB:1KDL"
FT                   /db_xref="PDB:1OOS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06131"
FT                   /protein_id="CAF25397.1"
FT                   /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQAI
FT                   KSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQR
FT                   DIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQI
FT                   LNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDS
FT                   KANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFM
FT                   KDVLRLIEQYVSSHTHAMKAAFGVV"
FT   CDS_pept        complement(37490..38695)
FT                   /transl_table=11
FT                   /locus_tag="pYV0055"
FT                   /product="yopB; putative Yop targeting protein"
FT                   /note="similar to Y. pestis YPCD1.29c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25398"
FT                   /db_xref="GOA:Q06114"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06114"
FT                   /protein_id="CAF25398.1"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIA
FT                   SKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAM
FT                   KILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQI
FT                   STGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
FT   CDS_pept        complement(38673..39179)
FT                   /transl_table=11
FT                   /locus_tag="pYV0056"
FT                   /product="lcrH, sycD; low calcium response protein H"
FT                   /note="similar to Y. pestis YPCD1.30c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25399"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="PDB:1OOL"
FT                   /db_xref="PDB:1OOS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23995"
FT                   /protein_id="CAF25399.1"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
FT   CDS_pept        complement(39192..40172)
FT                   /transl_table=11
FT                   /locus_tag="pYV0057"
FT                   /product="lcrV; putative V antigen, antihost
FT                   protein/regulator"
FT                   /note="similar to Y. pestis YPCD1.31c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25400"
FT                   /db_xref="GOA:P23994"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="InterPro:IPR036139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23994"
FT                   /protein_id="CAF25400.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNID
FT                   ISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQT
FT                   TIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
FT   CDS_pept        complement(40174..40461)
FT                   /transl_table=11
FT                   /locus_tag="pYV0058"
FT                   /product="lcrG; putative Yop regulator"
FT                   /note="similar to Y. pestis YPCD1.32c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25401"
FT                   /db_xref="InterPro:IPR009863"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69958"
FT                   /protein_id="CAF25401.1"
FT                   /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVM
FT                   KIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
FT   CDS_pept        complement(40503..40943)
FT                   /transl_table=11
FT                   /locus_tag="pYV0059"
FT                   /product="lcrR; hypothetical protein lcrR"
FT                   /note="similar to Y. pestis YPCD1.33c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25402"
FT                   /db_xref="InterPro:IPR013405"
FT                   /db_xref="InterPro:IPR022797"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69960"
FT                   /protein_id="CAF25402.1"
FT                   /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
FT   CDS_pept        complement(40940..43054)
FT                   /transl_table=11
FT                   /locus_tag="pYV0060"
FT                   /product="lcrD, yscV; putative membrane-bound Yop protein"
FT                   /note="similar to Y. pestis YPCD1.34c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25403"
FT                   /db_xref="GOA:P69956"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69956"
FT                   /protein_id="CAF25403.1"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRICL"
FT   CDS_pept        complement(43041..43385)
FT                   /transl_table=11
FT                   /locus_tag="pYV0061"
FT                   /product="yscY; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.35c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25404"
FT                   /db_xref="GOA:Q663K5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016684"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K5"
FT                   /protein_id="CAF25404.1"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESP"
FT   CDS_pept        complement(43382..43750)
FT                   /transl_table=11
FT                   /locus_tag="pYV0062"
FT                   /product="yscX; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.36c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25405"
FT                   /db_xref="InterPro:IPR012672"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K4"
FT                   /protein_id="CAF25405.1"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
FT   CDS_pept        complement(43747..44118)
FT                   /transl_table=11
FT                   /locus_tag="pYV0063"
FT                   /product="sycN; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.37c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25406"
FT                   /db_xref="GOA:P61381"
FT                   /db_xref="InterPro:IPR012673"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61381"
FT                   /protein_id="CAF25406.1"
FT                   /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGAT
FT                   LTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLTLP
FT                   LLHQAFEQLLRLQQEVLAP"
FT   CDS_pept        complement(44105..44383)
FT                   /transl_table=11
FT                   /locus_tag="pYV0064"
FT                   /product="tyeA; putative Yop secretion and targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.38c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25407"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69969"
FT                   /protein_id="CAF25407.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
FT   CDS_pept        complement(44364..45245)
FT                   /transl_table=11
FT                   /locus_tag="pYV0065"
FT                   /product="yopN, lcrE; putative membrane-bound Yop targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.39c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25408"
FT                   /db_xref="GOA:Q663K1"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663K1"
FT                   /protein_id="CAF25408.1"
FT                   /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGKTNGVRPF"
FT   CDS_pept        45305..45409
FT                   /transl_table=11
FT                   /locus_tag="pYV0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25409"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K0"
FT                   /protein_id="CAF25409.1"
FT                   /translation="MLIDAKISREILVLLGYFSKNSRLPLQFFSVFSH"
FT   CDS_pept        45443..46762
FT                   /transl_table=11
FT                   /locus_tag="pYV0067"
FT                   /product="putative Yops secretion ATP synthase"
FT                   /note="identical to Y. pestis YPCD1.40"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25410"
FT                   /db_xref="GOA:P40291"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40291"
FT                   /protein_id="CAF25410.1"
FT                   /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIG
FT                   ELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLL
FT                   GQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQ
FT                   RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLV
FT                   VATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTR
FT                   RGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSR
FT                   KLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQ
FT                   DKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
FT   CDS_pept        46759..47223
FT                   /transl_table=11
FT                   /locus_tag="pYV0068"
FT                   /product="yscO; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.41"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25411"
FT                   /db_xref="GOA:P40294"
FT                   /db_xref="InterPro:IPR009929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40294"
FT                   /protein_id="CAF25411.1"
FT                   /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
FT   CDS_pept        47223..48590
FT                   /transl_table=11
FT                   /locus_tag="pYV0069"
FT                   /product="yscP; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.42"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25412"
FT                   /db_xref="GOA:Q663J7"
FT                   /db_xref="InterPro:IPR013354"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663J7"
FT                   /protein_id="CAF25412.2"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHPK
FT                   EESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLSPL
FT                   AEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKRLAE
FT                   EPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGDHLLATM
FT                   RATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVE
FT                   LIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEEWEAEE"
FT   CDS_pept        48587..49510
FT                   /transl_table=11
FT                   /locus_tag="pYV0070"
FT                   /product="yscQ; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.43"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25413"
FT                   /db_xref="GOA:P40296"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="PDB:3UEP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40296"
FT                   /protein_id="CAF25413.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILISLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
FT   CDS_pept        49507..50160
FT                   /transl_table=11
FT                   /locus_tag="pYV0071"
FT                   /product="yscR; putative Yop secretion membrane protein"
FT                   /note="identical to Y. pestis YPCD1.44"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25414"
FT                   /db_xref="GOA:P69981"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69981"
FT                   /protein_id="CAF25414.1"
FT                   /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
FT   CDS_pept        50162..50428
FT                   /transl_table=11
FT                   /locus_tag="pYV0072"
FT                   /product="yscS; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.45"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25415"
FT                   /db_xref="GOA:P69983"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69983"
FT                   /protein_id="CAF25415.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
FT   CDS_pept        50425..51210
FT                   /transl_table=11
FT                   /locus_tag="pYV0073"
FT                   /product="yscT; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.46"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25416"
FT                   /db_xref="GOA:P69985"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69985"
FT                   /protein_id="CAF25416.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   AVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
FT   CDS_pept        51210..52274
FT                   /transl_table=11
FT                   /locus_tag="pYV0074"
FT                   /product="yscU; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.47"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25417"
FT                   /db_xref="GOA:P69987"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="PDB:2ML9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69987"
FT                   /protein_id="CAF25417.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGL
FT                   SDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
FT   CDS_pept        52850..53245
FT                   /transl_table=11
FT                   /locus_tag="pYV0075"
FT                   /product="virG; putative Yop targeting lipoprotein"
FT                   /note="similar to Y. pestis YPCD1.48"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25418"
FT                   /db_xref="InterPro:IPR013400"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q663J1"
FT                   /protein_id="CAF25418.1"
FT                   /translation="MSRIIALIISFLLVGCATPPMPAQRIVGEVRMSRPLSRIAHIDVS
FT                   MFGLYEGKVREVQRTHFETGNLPLFFSIKLNPAQRGEGELYLRSTLSFPERGVQAVAQQ
FT                   KLTGKNKVVLQMIPKTCYPNCQLPNTR"
FT   CDS_pept        53369..54184
FT                   /transl_table=11
FT                   /locus_tag="pYV0076"
FT                   /product="lcrF, virF; putative thermoregulatory protein"
FT                   /note="identical to Y. pestis YPCD1.49"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25419"
FT                   /db_xref="GOA:Q663J0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q663J0"
FT                   /protein_id="CAF25419.1"
FT                   /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
FT   CDS_pept        54263..54361
FT                   /transl_table=11
FT                   /locus_tag="pYV0077"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.50"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25420"
FT                   /db_xref="GOA:Q663I9"
FT                   /db_xref="InterPro:IPR035181"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I9"
FT                   /protein_id="CAF25420.1"
FT                   /translation="MSQISTKHRTVLFRRWMAIICCLIINMAYLVY"
FT   CDS_pept        54587..55000
FT                   /transl_table=11
FT                   /locus_tag="pYV0078"
FT                   /product="hypothetical protein"
FT                   /note="identical to Y. pestis YPCD1.51"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25421"
FT                   /db_xref="GOA:Q663I8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="InterPro:IPR013353"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I8"
FT                   /protein_id="CAF25421.1"
FT                   /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
FT   CDS_pept        55006..56829
FT                   /transl_table=11
FT                   /locus_tag="pYV0079"
FT                   /product="yscC; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.52"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25422"
FT                   /db_xref="GOA:Q663I7"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I7"
FT                   /protein_id="CAF25422.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
FT   CDS_pept        56826..58085
FT                   /transl_table=11
FT                   /locus_tag="pYV0080"
FT                   /product="yscD; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.53"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25423"
FT                   /db_xref="GOA:Q663I6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="PDB:4D9V"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I6"
FT                   /protein_id="CAF25423.1"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQ
FT                   GAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVESKVR
FT                   IAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFRQEFGNR
FT                   PKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDA
FT                   VIVSKGKREFVIQLNGGKPR"
FT   CDS_pept        58082..58282
FT                   /transl_table=11
FT                   /locus_tag="pYV0081"
FT                   /product="yscE; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.54"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25424"
FT                   /db_xref="GOA:Q663I5"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I5"
FT                   /protein_id="CAF25424.1"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQ
FT                   RESKALESAIAIIHYVAGDLK"
FT   CDS_pept        58283..58546
FT                   /transl_table=11
FT                   /locus_tag="pYV0082"
FT                   /product="yscF; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.55"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25425"
FT                   /db_xref="GOA:Q663I4"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I4"
FT                   /protein_id="CAF25425.1"
FT                   /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKP
FT                   DNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
FT   CDS_pept        58548..58895
FT                   /transl_table=11
FT                   /locus_tag="pYV0083"
FT                   /product="yscG; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.56"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25426"
FT                   /db_xref="GOA:Q663I3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013348"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I3"
FT                   /protein_id="CAF25426.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIR
FT                   LSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
FT   CDS_pept        58892..59389
FT                   /transl_table=11
FT                   /locus_tag="pYV0084"
FT                   /product="yscH, yopR, lcrP; putative type III secretion
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.57"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25427"
FT                   /db_xref="GOA:Q663I2"
FT                   /db_xref="InterPro:IPR013349"
FT                   /db_xref="InterPro:IPR041814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663I2"
FT                   /protein_id="CAF25427.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQFD
FT                   SFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQIDM
FT                   DT"
FT   CDS_pept        59390..59737
FT                   /transl_table=11
FT                   /locus_tag="pYV0085"
FT                   /product="yscI, lcrO; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.58"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25428"
FT                   /db_xref="GOA:P69971"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69971"
FT                   /protein_id="CAF25428.1"
FT                   /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
FT   CDS_pept        59744..60478
FT                   /transl_table=11
FT                   /locus_tag="pYV0086"
FT                   /product="yscJ, ylpB; putative type III secretion
FT                   lipoprotein"
FT                   /note="similar to Y. pestis YPCD1.59"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25429"
FT                   /db_xref="GOA:P69973"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69973"
FT                   /protein_id="CAF25429.1"
FT                   /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGLS
FT                   ADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEELAR
FT                   LNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQFDTY
FT                   IPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHLIGLL
FT                   SLLILLLPVTNLAQYFWLQRKK"
FT   CDS_pept        60457..61107
FT                   /transl_table=11
FT                   /locus_tag="pYV0087"
FT                   /product="yscK; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.60"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25430"
FT                   /db_xref="GOA:P69975"
FT                   /db_xref="InterPro:IPR009510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69975"
FT                   /protein_id="CAF25430.1"
FT                   /translation="MVTTQEVMMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQW
FT                   RDSAHLNAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLA
FT                   SPLQQLLTLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAME
FT                   PQPQAWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
FT   CDS_pept        61086..61718
FT                   /transl_table=11
FT                   /locus_tag="pYV0088"
FT                   /product="yscL; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.61"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25431"
FT                   /db_xref="GOA:P69977"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69977"
FT                   /protein_id="CAF25431.1"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
FT   CDS_pept        61943..62290
FT                   /transl_table=11
FT                   /locus_tag="pYV0089"
FT                   /product="yscM, lcrQ; putative type III secretion
FT                   regulatory"
FT                   /note="identical to Y. pestis YPCD1.62"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25432"
FT                   /db_xref="GOA:P69979"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69979"
FT                   /protein_id="CAF25432.1"
FT                   /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKA
FT                   FANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLE
FT                   AAMRQDTAADG"
FT   CDS_pept        62838..63104
FT                   /transl_table=11
FT                   /locus_tag="pYV0090"
FT                   /product="putative transposase"
FT                   /note="identical to Y. pestis YPCD1.63"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25433"
FT                   /db_xref="GOA:P69962"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69962"
FT                   /protein_id="CAF25433.1"
FT                   /translation="MKKARFTETQILRVLKEVEGGRHVKDVCRENGGSEASYYNWKSKY
FT                   GGMESSDIKRMKEREEENRRLKQMYASLSLDHEILKDVVAKKL"
FT   CDS_pept        63140..63562
FT                   /transl_table=11
FT                   /locus_tag="pYV0091"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.64"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25434"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00932"
FT                   /protein_id="CAF25434.1"
FT                   /translation="MTEYQASERRGCRIMGISRSLLHYCPNTARDIPVVEVLQKLAHQY
FT                   PAYGFGLMFNKLRQSGLPWNVKRVYRVYRLLKLNFRRKGKKRLPNRHPQPLAIPLKMNH
FT                   CWSVDFMSDALPDGRRFRLFNVVEILTGKHWQLKLT"
FT   CDS_pept        63559..63960
FT                   /transl_table=11
FT                   /locus_tag="pYV0092"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.65"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25435"
FT                   /db_xref="GOA:Q663H4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q663H4"
FT                   /protein_id="CAF25435.1"
FT                   /translation="MNIPVHRVVRILERLSTERGYPAFIRSDNGPEFIAAALVEWAEHH
FT                   GVILDMYLFRSLSEVRTLTEDWRTNARIAHWVICHPLSMQDKNWMEILTGGGTKNRRDY
FT                   IHTGKISIPSSAIRPISARPSTPRMPLSH"
FT   CDS_pept        63966..64145
FT                   /transl_table=11
FT                   /locus_tag="pYV0093"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.66"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25436"
FT                   /db_xref="GOA:Q663H3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q663H3"
FT                   /protein_id="CAF25436.1"
FT                   /translation="MIRQAIKKRKVFPTDDSVREVIYLAIRDASKKWSMPIQNWRLAMS
FT                   RFIIEFGDRLNDHL"
FT   CDS_pept        complement(64366..65772)
FT                   /transl_table=11
FT                   /locus_tag="pYV0094"
FT                   /product="yopH; putative protein-tyrosine phosphatase Yop
FT                   effector"
FT                   /note="similar to Y. pestis YPCD1.67c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25437"
FT                   /db_xref="GOA:P08538"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="PDB:1K46"
FT                   /db_xref="PDB:1M0V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08538"
FT                   /protein_id="CAF25437.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
FT   CDS_pept        66153..66689
FT                   /transl_table=11
FT                   /locus_tag="pYV0095"
FT                   /product="putative transposase"
FT                   /note="similar to Y. pestis YPCD1.69"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25438"
FT                   /db_xref="GOA:Q663H1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q663H1"
FT                   /protein_id="CAF25438.1"
FT                   /translation="MTTRHRHARPEVTALDQCWSMDFVADNLFNGHRVRALTIVDNFSR
FT                   ECLALEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMD
FT                   FSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNL
FT                   TPAEFARSHQKGPDL"
FT   CDS_pept        complement(66691..66819)
FT                   /transl_table=11
FT                   /locus_tag="pYV0096"
FT                   /product="transposase, IS630 family"
FT                   /note="similar to Y. pestis YPCD1.70c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25439"
FT                   /db_xref="UniProtKB/TrEMBL:Q663H0"
FT                   /protein_id="CAF25439.1"
FT                   /translation="MPIIAPIPRNKRHQMEKIVHKTADKNHSRHLIADPSPISVPG"
FT   CDS_pept        complement(66902..66994)
FT                   /transl_table=11
FT                   /locus_tag="pYV0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25440"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G9"
FT                   /protein_id="CAF25440.1"
FT                   /translation="MQNAQIRLLDIIAYERVVFSEIQLLNNCAK"
FT   CDS_pept        complement(67275..68141)
FT                   /transl_table=11
FT                   /locus_tag="pYV0098"
FT                   /product="yopP, yopJ; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.71c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25441"
FT                   /db_xref="GOA:P31498"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31498"
FT                   /protein_id="CAF25441.1"
FT                   /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWF
FT                   HKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAE
FT                   YKTLLKV"
FT   CDS_pept        complement(68142..68276)
FT                   /transl_table=11
FT                   /locus_tag="pYV0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25442"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G7"
FT                   /protein_id="CAF25442.1"
FT                   /translation="MGIFVRVLPVCSGFTHQRLNVLLQCTVYLEYKIHTAVNSLNKDK"
XX
SQ   Sequence 68525 BP; 18670 A; 15384 C; 15177 G; 19294 T; 0 other;
     gggggcactt gtcacatcca ttcccgctcc aaccggttca gtcgctcggc gatggtcgtc        60
     agctctcgca acttttctct ctgttcaacc aaatgctcat ccattaaact gcttcgtcca       120
     agttgaatca gtagtggaat agagtccact gtaaagtttc gcatatcatc agtaaactcc       180
     gatacctcct gtagcgtaat agctgcatgg gccgccatca tctgacggtg aattgcggta       240
     tactgctcag tgccgaattt cactacaggc cgggtactgt caaaacgctg cagggactga       300
     cgagcaacat cggcccaaga acctgaacga ttaatcagaa tagatagttg cgctttcgca       360
     ctctcctgct gctgctggag agtgttcaat tgctgcgaca aggtgatctt agcctcagct       420
     aatcgattca ggaagccgta ggtttcagag gacacgggct gcccttgctg tgacaaggtg       480
     actaagacct ctaaaagcgt ttccaggtgc ttatgtgcgc gcactagtga accgatatca       540
     gaaaaagagt gtgtctggtc cagatgcttc tggatcctct gcagtgaagg ttcgacgatc       600
     gatagcataa agttactgcg atgatagggg gatacttccg tactggaatt cttggtatcc       660
     ccttctctgc ctttgacata gtcttcaatc actctgtaag tcttcagaat caaactgtta       720
     aaactcttca actgatcctt gtctactccc ccctcgcgtt cggccttgtc gagtgccacc       780
     aacatggtat caagatccga caaaaccccc cccatatcca attgcttagt tgctgcactg       840
     ctcaaatgcg tcctaagcaa atcagatagc tcccgaagct tcttgggtgt tatccgcctt       900
     acatcagtag ataatgggct catttctccg gttagggtat cttttaggat ctgcttggcc       960
     gactcctcgt cgatagttcc gtcgctcaag aactcgtgga gtctggcttc gttggaatca      1020
     ggtcttgagt cagcggaaac gccaaggatg tctgtgatga agcgtgtata ggctgtctcg      1080
     actccagcta taccaggtcg atggattgga taaccattct catccattac gtgcgctggt      1140
     tctgaggtaa tgaatctcag tccttgatta ggctttatct ccggattttt ctcaaaacct      1200
     tcgatacaat gtagaagggt tgacactacg agaaaaacat cgctcttttc tgatgcgcct      1260
     aggtttccta ctccaagctc cggcgctttg aaggattctg taaacccctt aggttgttcc      1320
     cctgaacgag agtgtaatcc tagatcaata acaacgggct ctccgctagc gcggtcaaat      1380
     accacattac cgggtttgat atcgttatgt actacccctg ccttggcaag gtgattggtt      1440
     acatctaata gccgatgggc aataaacttg atcgttcccc agtaggcttc actattgatc      1500
     tttccttgct tccagctatc ggcgagggtt cttagtgtgt cagaacaacg ccaaccatcc      1560
     acctcatcca tcagcaatgc ttcctcctta cggttaccgt atggcaccac agccatgcca      1620
     tgaacattgg caagattagg atgtttgccc gcggttttat agatgtgttt ataagcctcc      1680
     agttctgcga acaaatgccc ctcggcaatg gagcgttcaa tcttagctac caaccgctgc      1740
     ttatccttag tttctattat actaatatgg ctttcgccct cggcaaactt atcggtttca      1800
     gccactcgca tcccttcaag atccggagct cctgacaagg gctccccttt ccaacccagc      1860
     ggcagttcgg tctgtggctt ggctccaaag agattactga gagcattggg gatatcagac      1920
     cttagctcct gcgaagtcgt tttctgggcc gcatggagtg tgtcagtaag gttacgagca      1980
     attgaaaagt taaacatctt ccccgaaaag atcttaccaa ccccttctcg aaagagagaa      2040
     aaaccactgt gggggttcaa gcgcaacact tgattatcga taattctata ccgttttcct      2100
     ccgatattga gctcaccgac aggattttgc caatgttggc tgatgcgctc atgagctttg      2160
     gcgagggaga tcgacggtgg catagttccc atgattttca cgcttttcat gctttactca      2220
     tccccattta accgattgag tagattgagt atgaaggggc agttcctgct gagtttctgc      2280
     tggtaaactg accaagctca accagtcgta aaagttcgct atctccttgc taacgttctc      2340
     aacattcagc tcgtcgagag aaaggtgctt gaatgcgatc agccccagtt cttcactcca      2400
     agcgaaacaa gggccgtcct tattcaaggc attgatgcta taacagaaaa aaagctgact      2460
     agcggcgctg cgcgcctctg gtccagaaaa tcctaagatt ggccccaaca gagtcaatcg      2520
     attcaatatt tcatcagccc tcagcataat aacgactcgg tcgttgagga taagctcaca      2580
     caagccatat tcatcttggc tcaatttatc taatccaaag tgacttgcta tttttgggag      2640
     tagctcagta aaggtggtgt taatcacaca aaagctcttt aatctgattt acggtgatat      2700
     ctatcattga ttaaccccgt cccagaatat atcacttcca gccactgatt tttagtgatt      2760
     gtagatattt ggggagccca cctgtagaca aatctgacct atatcttaag cataggagga      2820
     gtctatgggc acaccacgtt ttacccctga atttaaggaa gaagctgtcc gtcagatcac      2880
     tgagcggagc tattccgttg ctgtagtgga tcacaaaatc aggacacctt cgtagccttt      2940
     ttcccctgct cttcgtattc acagggcggt aatccaccat tgtgccgatg ggggtgtgtt      3000
     gtaataactt tgtatcccca ttcaccgata tctcgtaccg catgatggac atccatatag      3060
     ccccctacag gcagccattc acttttcagg cttcggaaca ctctttccat tggtgagtta      3120
     tccaggcagt tacccctgcg gctcatactc tgcatcactc cggtcctcca cagtaactgc      3180
     ctggatttct tactcctgta ctgccctccc tgatccgaat gaaacagcag cctcttcaca      3240
     accagacccc gtgtttgttc caacgcagaa ctttgatacg cgaacgcgcc tttgttgcaa      3300
     aagacaaagg cggcttcgcc ttgccagggc tgatgcagat ggtcggtaat gtattgcgat      3360
     accgcgacgc atatcgaccg gctcgcgtgc caaccagatg tgttgtggcg tcaacatagg      3420
     gataaggcct gcataacagc gcgtaactga gcaggaagac aactgaccga acagccattg      3480
     gggaggttga gggtcactgc ctcggtaccg ttattgtctg gtattacccg gcgagcgggg      3540
     ataaacgcag ggggaatggc aacggtggtg tcatcttgat gatgtttgag ccagtaataa      3600
     aaggtggcga tgttcaagtc atgcagccga cagtagtgtt ttttagacat tcagctctat      3660
     tgccaggcgt cgagatggtg ctgccgttca ctacgagaat accgtgtcgt catatttcac      3720
     ctcaggttcg ttgtattgac tgagaccaga gtgtgataac ggaagtgagt taacaatatg      3780
     agatcgccgc tcgcttacgg ctgttccgta tacactgtca atgtagtcac tcagctgcat      3840
     aacgatatcc acaaaagtgc ttataaacac aaacgtttat atcatgtcct taccggacag      3900
     gcgagcagtg cgcagccggt cttttcaatg ccgcatcgcg gcatgaaggc gccagcggat      3960
     attaactata actctgttga caattggcgc cgatagcccg gcgtagccgg ttccggtttg      4020
     ataggtttca ccaatcccaa tctcctccct gcaaagccaa acccactaaa agtagcgtag      4080
     gtgcttcatt acgcggtcgg agtggtcccg acaaggcttt gccgcaggcg gggcgtatct      4140
     ccgcgttagc gggccattag ggccgcttac gagcgtgttc gaatgacttc cagcgacatg      4200
     acttgcagcg actcgaaaat tttagttaca acactcattg taaagccact ctgttccggg      4260
     ccgttggccc ggggcggggc ggctttttag tgggtgaggg tgcgcgcagt ggtctcagat      4320
     gtgtgcggtc tggtattttt ttggtcgaat cgtgaatgtt gtaactaata agggtttatg      4380
     cgctcgtagc atcgtgatag gaggtgtttc tttgtttccg aaccggcgcg aacgtaagtt      4440
     cgctgcaagg gcgggcatta tcatagtctg tccaaaaggc agacgacgaa taggttattt      4500
     atttatagga ataaaagaaa aggtatttaa aagaattact gatcagtggt ttaaaagaaa      4560
     ccacgcactt taaaacaagt tcggctggcg cttaaaaaac atatcggttg taactttatg      4620
     ggaagttccc ttgcagttaa ctgtggataa cctaaatcag tacattcaag cgacgatatt      4680
     gggagaattc gagggcattt tcagggcggg aaagagaaga taggtcatgt agcggccgtc      4740
     acatcgctca aataacaagc actgacagga ggcagacgag cgaaatcctc cggcgctaac      4800
     cggattttca gtaaatacga cgtcaggtag cgccggtggc caaccgggtg tagttattgt      4860
     tcctggacat cagcatgcgt tccttcacgc gacgggcttt ctccctgcgt accgcatcca      4920
     gattaccgac aaaccgcccc tcagctatct cacgcgtcag ctgccggtta acgatagctt      4980
     caatgtcacg gcgcgtacgg tcaacatcac ggcgcgcacg ggcacgtttc aatccatgag      5040
     ccttacgttc agtttgatag ctacggaaac gctcgcggac gaaccgccat gcctttgcta      5100
     tcagctcatc catctccaat ctaggcagac gttgtttctc cctttgctga ttttcccatt      5160
     caacgcggct gcgtcgggct gctgcgacag caacgtccga cacatccaac gcagaaaaca      5220
     gcgccggtgt gaacgtgata tcagtcggaa tattacagcc aatctgtgga tcatattcgg      5280
     tctggtaggt aatcagcccc agctcagata aaaagcgcag cgcacgcgtg gcgcgggtga      5340
     tggaaaggtt gccactcttt gactctgtcg ccagaccaca ctcaatggcc agattggtaa      5400
     tcgagcgctg gatacggttg gccagtgggt cgtagtggaa acacataccc tgcagtaatg      5460
     catcgatagc acgccgacgt agtaacggcg gcatacgatg acgcaaactc agagaacgcg      5520
     cgaatgcgac gtgcatggag aaatcaaaac gagatgtgaa gccttcggct ttcgccatca      5580
     gcttacggca gaacggcagg gtttttttac cctctcgcgg cgtaaattcc ggattcgggt      5640
     ttttaacctg tcgataatga tgtgtgaaca gggcctggtg gttagtcaca ccttcccgca      5700
     cttatgttgc acggaaggag taacaagcgc agaaggtatt gaacttttct gaacatgcac      5760
     atatactccc tgtatagagc aacagcttct atacagtttt aagtgggccc cggtaacctt      5820
     ctcgcctcgc caaagatgag gaagtttatc ggggtttttg cttttctggt tccaagtaaa      5880
     caccttagca gaaccagttc cctgccacct tacggcgtgg ccagccaaaa attctttaaa      5940
     caatcggtaa tctagcactc actgcctgaa ggatcaagaa agtaacttag ttgccattca      6000
     agctgcatta gttctagcgg ccttttctct ctgaatccag cgctcaatca tttctgtctg      6060
     agtcaaacct gaatcttcac agagttgtaa aagttcgttt ttgagatcgt tctgaatgaa      6120
     cacatttata gctttatgtg tctctttttt ccgggaaaca gacatacgtt gtttctcggc      6180
     tccagttaac gggttcccct ttctgtaggc acgtttcgat gaggaagtta ctgcattttc      6240
     gatctgcgac atatcagccc cctcaaagat caaacaagga tcgtttcgca gagaatacaa      6300
     cagatttatg aaatcagcga cttaactttt gcagacataa cccgtgttgg cgcacggatc      6360
     acattaatga ctcagcgaaa agagtgagat cagtacgacg aacgccagtc agttccttta      6420
     ttccagcgtg actgccaatg ctgcagatac gcctgtacca ccgtgaagtc cccccatata      6480
     atcagcacat tctccgagtt ggactgtacg gctgcttggc taaaattgaa cgaccccatc      6540
     tgcgtattct tgccatcaac gataatcacc ttgtcgtgaa gcgctttgaa actgttgaca      6600
     gttcggacag gaatgccggc attgaccaac agatccatcc tgtagtggat cacaaaatca      6660
     ggacaccttc gtagcctttt tccaccgctc ttcgtattca cagggcggta atccaccatt      6720
     gtgccgatgg gggtgtgttg taataacttt gtatccattc accgatatct tgtaccgcat      6780
     gatggacatc catatagccc cctacaggca gccattcact tttcaggctt cggtttactc      6840
     ccgtcggata gtgggcagtg ccatatcgtc atccccggat gctgagctgg tgtgtcgagc      6900
     ctggcgtaat gcactggaga cgcgcccaag ggaaaagagg ctgctgtttc attcggatca      6960
     aggagggcag tacaggagta agaaatacag gcagttactg tggaggaacg gagtgatgca      7020
     gagtatgagc cgcaggggta actgcctgga taactcacca atggaaagag taaaggtcaa      7080
     tcaccagtgc caggtagcac cagccaccat tgactttgat atagctgata tatccactcc      7140
     acacacgatt gggctccgac ggcttaaact gccttttcag taagtctggc gatgccagtg      7200
     acacctcccg ttcgccacgg taacgaggtt ttccgggttg gcgactcgcc agaccacatt      7260
     cccgcatcag cctgccagcc agccagcgac ccacgttata acccgactga cgcatcagca      7320
     gactcagtgt tctgttgccg gctgctcccc ggctctgttg atgcaattca cgcagttgca      7380
     gacgttttac atcaacccgc aaattcagcg aagcagagta aacactgcgc gttattttga      7440
     gcaggcggca caattcgacc actggccatt ttgttttcag ccgtgtgatt aacgcaaaga      7500
     tttgatgggg aactcgctca tcaacacggc tgcctgcttt agtatttctt tttccatttc      7560
     cagccgttta atctgcgccc tgagcgactg gatttcacgt tgctctggtg tcagtgcagg      7620
     attgtccggc gtcaccccgc tgacttcttc tttgtactgg cgtatccatt tacgcaattg      7680
     gctgggatcc agctccagag cgcgtgcaac ctcgatggtt gaccgctgat acttaacgac      7740
     ctgctcaata gcttccagtt tgaattcagg agaaaaacgg cgtttggtct gtttaggttg      7800
     agtcattatc aattacctca attggctgtc attaaattaa caggctattg agggtgtccg      7860
     gtattactga tccactacaa tgcgcggttt ttccggcatt tgactgcccg gcaagaccca      7920
     accatttaac aacgttgtcc gtatagacct agacatgctc tttggcgcgt gacaatgtca      7980
     cgtaaagaga tgcagagtgg ccatcctctt tctgccacct tcagccccaa acagggcgat      8040
     gacaaaccgc tcactggccc cttgcacacc ataggctgtc agcgtgtagg ccaggtcaat      8100
     atggcggtct tcggtggcct tttgtggatc gacaatcttt tcctggtcgc cctgacgaaa      8160
     acgcacagca ccgtcttcag taaaacccgc cacttcccac agactattgg ccacataacc      8220
     ccggtctgtg tctgagcggg taaatcgcac ccgatcacct tgactgaccg tcagttcccg      8280
     gggcatgaac agggaaatat cctgcgcggt attctgctgc ggagaaatca gtaccgactc      8340
     accctccgcg ttacttagag tgacaagggt tttcgcgcgg ccgcaaaatg gcactgcgta      8400
     ctgataagta aaccaatggg cggccatgcc gcccattggt ttactccagc gccgcgtaaa      8460
     tcgcttcacg ttctggataa cgccgttttt ctcctgaatt caaactggaa gctattgagc      8520
     aggtcgttaa gtatcagcgg tcaaccatcg aggttgcacg cgctctggag ctggatccca      8580
     gccaattgcg taaatggata cgccagtaca aagaagaagt cagcggggtg acgccggaca      8640
     atcctgcact gacaccagag caacgtgaaa tccagtcgct cagggcgcag attaaacggc      8700
     tggaaatgga aaaagaaata ctaaagcagg cagccgtgtt gatgagcgag ttccccatca      8760
     aatctttgcg ttaatcacac ggctgaaaac aaaatggcca gtggtcgaat tgtgccgcct      8820
     gctcaaaata acgcgcagtg tttactctgc ttcgctgaat ttgcgggttg atgtaattag      8880
     gattaataca ggcgcagcca acataaatcg gatgcccgta gcaaatatcg gagagattgt      8940
     ttcgacggtt aatttcatcg ctaaccatgt agttccccat gtaactgaaa ccatgataaa      9000
     aagcagaatt actaaaaaat ttttcattag catattaata aaacaccgat tacgattatg      9060
     taatcggtgt tttcctatag acttgttaat ttctaaatga tattaccact cgatattaaa      9120
     tgatgcgttg tacatgacat tcgaggaacc ggcataagcc acaccggctt taagtgcgac      9180
     actctcattt acacgatagc cagaaccaat tgctaatgcc tgactagaac gatatccccc      9240
     gacacctgca gtaaagttta ctttccctac accatatggc tggaacaagc tgtttaaagc      9300
     ggctgaactg gctaaacctt tgtcaactcg tttgtcaagt ttatctaaac ggttgtcaag      9360
     ttgactgaat ttatgatctg tgtattgatt agattcactg attgctttct tagtcgaact      9420
     acttacagtc acatcggtat agctatttgc agtttttagt gtgtgagaag aattgctgtc      9480
     tgcatacact ttagcgctta ctaacgcctc agctgatttt ttatttgcat gttcttcagc      9540
     agtttctaaa gttgttctgg caacactatt tgagtgtttt ttggccgcat ccaaaacatc      9600
     gttagactga gccaaagtct ctttacgtgc attttccaat gtttcagcca tttctttctt      9660
     taattgcgcg acattcactg catcattgtc tttagtgcca gccgcaagat gtgttaattg      9720
     gcgattaagg ctttcatgac caatggatac actattctct cggtcagttt tagaaagatc      9780
     cccaattgca attgaataac catgatctgc cgcaacgtga ctagagtgtc caatggcaac      9840
     agagttttgt gcatcaactt tcgagttaaa accgacagcg acaccagtat ccgaagctga      9900
     tgctctcgca ccgatagcta ctccatcttt ctgggcggta ctacttgccc cataagtaac      9960
     tgccgaatct cccaatgcct tacttaaagg accaattgca acagaattaa cgcctgttgc     10020
     aattgaacca gcgcccacag caactgctgc tggtttcgct gcttcagcag tagcaccaat     10080
     cgcaatgcta tggataccct tagcgcgagc atcgagcccg cctagtactt gcggttgtat     10140
     tgcttctgct aatctagctc tttttttttc tggaccttgt ggacctcgtg gaggtaattt     10200
     tgggttttct tgacgtaata ttggttttgc tggatataat cccacaccca atttaggatc     10260
     aacatttggg cttatttgaa ctgctgacaa acgaggaata ccatcgttgc catcctcggg     10320
     ctcctcggca aatgcatatg gagatgagaa caacgcagat attaatgccg cagagacact     10380
     gatcttaaaa tctttagtca ttgtaagcac cttttatatt tctttaattt cccgtgaata     10440
     aaagctcagt tataacatct gagaaatata ttaattaaag cgaacgcctc ccatagaaga     10500
     gggataggat tatctatgac ttattttctg ataatcatgc aaaaaacagc actaatcgat     10560
     cttaaaaaga tatcgattaa ctactgaata tatgcatcgt ttgtaatctc taatcgaatc     10620
     gtcggagtca gcccactaca aaatactttc agataacacg aaaagtgtta tgcagataat     10680
     ataaaaaaaa attcctcacc tcaaaccgga tattttgtat aatcctttga aattacctga     10740
     caaaacactt attttcacca aaaaaaaata taaatataga taaaaacacc agaaaacaac     10800
     aagaaactat tactttataa tttttttatt tattatcctc cctctatcaa aaaatataaa     10860
     aaaaagtggg taataattta tataaaataa tctgtactgt aatgaccatc aaaaataacc     10920
     attctctttt agagaatttc cgacatactg aatatgtatt ttgaggagtt caccatgcga     10980
     aaaaaactga ttcactgaac accagatcag tggtcgagcg ttatccacgc gacggtttct     11040
     ttaaggtttt tcaaatcctg aggcgatggg gatatgtctg gaaccataaa cgggtacacc     11100
     gtatctattg tctcctgaaa ctcaatattc gccgcaaagg gaaacaacgc ctgccagctc     11160
     gtaccccatc accgctggcg gtgccggaac gacttaacct gagcgggcgg tcgattttat     11220
     gcacgatgca ctgatctgtg tggatgatta caatcgtgaa aagctggcga ttgaaatcga     11280
     tctgaacctg ccaacacagc acgtcatcag agtactggat cgcattgtgg tcaaccgtgg     11340
     ctacccggtg atgggttttg aggtccaatg ggacgaaaac gtacgttaag gagataattc     11400
     attgtttaaa ttgaaattta atgctctcag ttctccgttt aaaatatcat ccgatagcgt     11460
     gaacgtataa tgccccagca tattgatatg cccgtgcatc agtggagata accgggcgat     11520
     atcctcatcc ctggtttctt ctccattact gcgcatccag ctcagtgctt cctgcatata     11580
     aagcgtgttc cacagtacca ctgcgttagt gaccagcccc aatgcgccca gttgatcttc     11640
     ctgcccctca cggtagcgtt ttctgatctc accgcgctgc ccgtaacaaa ttgcacgtgc     11700
     cacggcatgg cggctctctc cccgattgag ttgcgtcagg atccggcgac gataatcttc     11760
     atcatcaata taattaagaa gatacagcgt cttgtttaca cgccccaccg ccatgatggc     11820
     ctgagccagc cctgacggcc gtgagctttt cagtagtgag cgaatgagtt ctgaagcatg     11880
     aatggtgccc agcttgagcg aacccgcagt tcgcatcatc tcatcccact gattttctgc     11940
     cttcgacaga tctgcacacc cacgagcaag ctcatcaagt gctccgtaat ttgccgattt     12000
     atccactcgc cagaatacag cttcaccggc atcagccaga cggggggaaa actgataccc     12060
     aagtagccag aacaggccaa atataatgtc gctggtaccg gctgtgtctg tcatgatctc     12120
     aaccggattc agccctgtct gctgttccag aaggccttcc agcacaaaaa tggaatcccg     12180
     taatgtgccg gggacaacga tgccgtggaa tccagagtac tgatcagaga cgaagttgta     12240
     ccaggtgatg ccacgcccgg agccaaaata ttttctgttc ggcccggaat tgaccgtttt     12300
     cactggcgtg acaaagcgca taccgtcaac tgaagccacc tcgccgccac cccagcggcg     12360
     agcaagctcc agcgtggact gaaaatcaac taaccgggca ttggcgctga ccagcgtttc     12420
     tgcctgaagg taattctgtt tcatccaact gagccggtgg cgcgtcagtg ccggtatatt     12480
     gtgctttatc agcggttcca gcccgatatt gcaggcttca gccatcagta ccgcgcacag     12540
     gctgatgtgc agatcttgcg ctcgagcccc ggattcactg acatgtgtaa actcacgtgt     12600
     aaatcccgtt ctggcatcta tttcaagcaa cagttccgtc aaatctaccg gtggtagcag     12660
     ttgcctgacc cgattgttta gacgaagcaa cgacagtggc tcctccaatt tctccagact     12720
     gctgatagtc agggaaggat atttaccgtc attgcagata tggacttccg tatttccttc     12780
     aaagcgggat gcaactgctc tccaggtttc atccagttgg accgccaact gttgtacgcc     12840
     tttatgtcca tcggtgggat gtcccaacgc ccggcagacg aggacccgct gagcctgcca     12900
     ctcttccccc tgcaacaact tctcgcggag atctccccag cgatcgctat ttttcagcca     12960
     gatgtcccgg cgtctcaatg catcctgaag gcgctccagc agacaaagcg agtaaccggc     13020
     acgttgtatc cggccctccg catcgtacac caggcgtttc caggggccgg taataatatg     13080
     ttcaggagca tcatccagga ggcgtttttt cgtgccgttt agttcggtca gataatgaat     13140
     ggcggccagc tttttccaga gccgctgatt tgccctttcg cgtatttcac tgacgagacg     13200
     tacaagtgtg gttgctccgg gcaacagaat cttattctga agcagccacg cagtggcaaa     13260
     atcaaacatc agaccggggc gttcattgct gagccatgca cgggtgtaca gcagacgttt     13320
     caggcggaaa gaccacggaa aatcaccaaa ttcatgatag ccgtaatatt cctttatctg     13380
     cgcggtatgt tccctgcgag tggtgtcacg ctcggcatag cgggagagga cttccggacg     13440
     gcgtatatta agctgtacag cgacaaaatg ctgaacacct ggcagaactt gggttaaatc     13500
     cgtaataaag gttcccagaa aacgggccgt tgtgagctga agtgctattc ccaggcggtt     13560
     atgctttccc cgccgctggt aaatgaaagc aagatcccgc tcgtcaagat gaaaatagcg     13620
     caccagttgc acgtcattgg gttctgcaac gtaacaaccg taattctgtt cttgctcagt     13680
     ggtcagaaaa tcgactggca tacaggcctc cctgcctgac ggttatttgt taacaacttt     13740
     ttaaccgtcc gaaatattat aagttgtcgg acacactgaa atggtgcggt ttgtgtgtct     13800
     atttaatcgc ttttttgtta taatagacac cagttgtccg atatttgatt taggatacat     13860
     ttttatgcga ctttttggtt acgcgcgggt atcaaccagt cagcaatccc tcgatattca     13920
     gatcaaaaca ctcaaagacg cgggcgtgaa agcaaatcgt atatttactg ataaggcatc     13980
     cggcagctct gccgacaggg aggggctgga tctgctgcgt atgaaggtgg aagaaggtga     14040
     cgtcattcta gtgaagaagc tcgaccgtct tggccgcgac accgtcgaca tgatccagtt     14100
     gataaaagag tttgacgccc agggtgtgtc catccagttt attgatgacg gaatcagtac     14160
     cgatggggaa atgggtaaaa tggttgtcac tattctatca gcagtggctc aagccgaacg     14220
     acagagaata ctggagcgta caaatgaagg gagagaagag gctaagctaa agggggttaa     14280
     attcggacga aagcgcagaa tcaacagaaa ggaactactc gaattgcatg aacaggggat     14340
     gggcgcgaca gaaatagcca aaaaaatgaa tatagctcgt tcaactattt ataaagtcat     14400
     caatgaatca caataaacag ctaaggggcg taaaatgaat ttgcagaata atttacactc     14460
     tattttagaa aaagtggaat ctcttaagaa tataaaaatg cttgataaaa ataatggtga     14520
     gtttacctat attgaaggta attattattt ttcagacctc acaactgaca gtttaaacat     14580
     ttatgaaatt aaatatcttt ttactttcga gaactttgac tttttcagca atggaaagcc     14640
     aaatgaagtt tcagtatata aagcaacaaa ttcctttaac tcagtatgtc tcggaattaa     14700
     ggcaagttta aattcgctag acgttgaaag aaaagaactt acggttcagt ttacatatag     14760
     catggtgttt gatgcctcaa agggtattcc aaatttttcc aatgaactag aaacatctat     14820
     gggacttctt agaattgccc ctaaaaagct aagtaatagc tttaaagaca aagggataga     14880
     acacaactat gtaaactaaa gcagataaat aaaaatgact atttatacat ttttatcata     14940
     tgcaattccc gctattttta tggcttcggt tgggttttat attcctaaat ccacatgacc     15000
     atcaaatatt caatttctgg tttacacact cagtgtaatg ttaacatttt ttgcaaaata     15060
     ctactttgat ttatttttca acaaagagaa aaatagaaag gaaaaagaaa taacaactcg     15120
     gctagagaaa agaatatcta aacttgagaa ggaaaatatt tctcttaggg atgacttaat     15180
     aaagtgtaag cttgaacata ttgatgaagt gatgcgaatt gagaggagtt tgaatactca     15240
     attaaaaaca aattacaaga acaataataa tgaaaatctc tgggccggca ttgatgatat     15300
     aataaaaacc attgaatgcg tgtctattga atcaaagatt ggaggagtca aaacaaattt     15360
     aaaataatcg acaaacaagg attgcttgat cttccccctt cgttcagtac cgctgtaaag     15420
     tagagttttc ggcccttctt ttccgtccaa aaaggggtca ttcgttatga aaaagacgcg     15480
     ttataccgaa gaacaaatcg cttttgcact caaacaggct gaaacgggta ctcgagtgga     15540
     agaagtctgt aggaagatgg gcatttcgga agcgacattt tacaactgga agaagaagtt     15600
     tgggggaatg ggtgtcacgg aattgcgccg tcttcggcag cttgaggatg agaatcagcg     15660
     cctcaaacgt ctggtggccg atctgagtct ggataaggaa atgctgcagg atgtcatccg     15720
     aaaaaagttc tgaggccgct gcagaagcgc gatgccgtgg aatatctgct ggcggcgtac     15780
     cgtatcggag tacgcagagg gtgcaggctg atgatgcaga gccgcactgt atacaactat     15840
     cgtagccatc gtgacgatcg ggctattact cagcgaatac gggaaattgc ggagacgcgc     15900
     atccgttatg gctgtccgcg cattcatatc ctgctgcgga gagaaggctg gcttgttaac     15960
     cataagaaaa cgcaccgtat ttactgtctt gagggtctca atctacgttc gaaacgtcca     16020
     cggcggcatg tgacagcgaa gcacaggcac gcacgtccag aagtgaccgc gttagagcag     16080
     tgctggagca tggatttcgt tgctgataat ctgttcaacg ggcgtcgggt cagggcgcta     16140
     actatagtgg ataattttag tcgcgaatgt ctggcgctcg aggtcggtca ggggttacgt     16200
     ggagatgatg ttgtggctgt catggacaga ttaaaacatt cgctggggcg tattccacaa     16260
     aggctgcaga cagataacgg cagcgaattc atctcgaagt cgatggaccg atgggcgtat     16320
     gaaaacaggg tcacgatgga cttttcacgc cccggaaagc ctacagataa tgcctttatc     16380
     gagtcattta atggcagtct gagggatgaa tgtctgaacg tgcacgggtt cctttctctg     16440
     gaagatgctc aggagaaaat tgaacaatgg cggcaagaat ataatcattt tcgtccgcat     16500
     tcttcgttaa ataacctgac tccggcagaa tttgcccgaa gtcatcaaaa aggtccggat     16560
     ctctgattta gcctggtacg gatattgggg agggatcaaa tttgcctgtc tccgttgttg     16620
     gagtaaagat atcaaaaaca ggcaattaca caatcttgtt tacagtctca accaaaccca     16680
     ttaatggata tcgtacgttt ttcttttata gaattaaacc agtaaatgag atgatgaagg     16740
     acgatgatca tcctcctctt tcttcattgt gggttcacaa gaaagagtaa cagctttatc     16800
     aaccagcgac gtcaatacgc tcgccagttg cgtcccactg gtgtcattaa tgtttaactg     16860
     actccacaat agccagtgat catctttatc aagcgcacaa cgaattacac cagatagtgg     16920
     gctaaagagg tttttccgca aaatatcata aagttgagac tgaccagtca agatccctgc     16980
     ccgcataaaa gccactaact ccttctcatt gataggtgcc agatgtacta cccatatttt     17040
     atcaatggta acagccccat gccctaactc atttgtttct atttcttcaa gacctagctc     17100
     tgtagcaaat tcttcaagta atgaactgta agtgcgcata taactgaccc tttaaaatta     17160
     gaaaaatata gaattttttt atttctctcc ttcccagatg ctaccccaac gttgtatcac     17220
     cgtggatata aagtataaca aacttataca gctcaaccat tcacattgag aactcttccg     17280
     gtactcctca ttaccaatga ggaggcggcg acgccaccaa gtgaatggac ttaatacaag     17340
     tcttttacat taaaaattaa aaaaaaaaca ggagataaaa gtcaacactc caacttggtg     17400
     ttaactttta ctgagcgaaa tctgatatta ctggcaccac aaatttatag gttatcgcta     17460
     tttcctgacc tgctcctcgt tgattagtac accccgatgt tagtaatgtc ttcataaagt     17520
     ggcatgaaca gtacccgatg ccctgcatcc gctgctttca cgccgagagc aacggccaga     17580
     tgggttttcc cgacacctgg aggacccagc aggatcacat tctcgcagcg ctccacgaac     17640
     gccagaccgg ccagctcccg gacaacctta cgatcgatgc ccggctggaa ggtgaagtcg     17700
     aactgctcca gcgttttgac ccacggcaga cgcgcctgct tcagtcggga ctccatgccg     17760
     cgctgatgtc tgccgttcca ctcctgttgc agcgccatgc acaggaactc ccggtagttc     17820
     agctcttttt tagccgcctg ctccagcaga ctttcaacgt gatagctcag gtgctccatt     17880
     ttcaggcgac tcagcagcgc ttcaagttca tgcatcacag caactcctca taagcactca     17940
     gtgggcgatg ttctaccatg ctgacctgtt gccagagcgg ggcgtggtgc tccggcacag     18000
     tctgccagcc agacgatgct gaacagagtc gatgtgaggc cacctgctgc tcattactgt     18060
     agctccgcag ctcgtcatcc agcgatatac gtatcgagac tggttgcccg cacagagcct     18120
     cgggaacact gtaacgattg ccgccaacct cgatatagct gtcccaggac acatggcgga     18180
     tgtcgaagta gctggtatcg aagtccgtat ccggcaacgg ctgcagatgc tcctgttcca     18240
     gcgcgaagcg ctgttccggt gtttgtctga actggcgaag ctcgcgttta tcagcaacat     18300
     ccgccatcca ctgctccagc tgttggttaa catgggtgaa gctgtcgaac ctgcggtacc     18360
     ggacgaagac gttatcctta agatatttca ccatccgctc caccttacct ttggttctgg     18420
     ccctgcgcgg gcggcaggcc cgtggcagga agtcataatg ttcggccaac aagaggaacc     18480
     cggagttgaa caccactttt ccgttgttat ttttcagcac cgcggctttc tggttatcaa     18540
     ccagcacggt tttcacactg ccgccgaagt aacggaaggc acggaccagc gactcatagg     18600
     tgtgttcagc atcctgcttt ggcgcagcga agacatggaa gcgtcgggag aaccccagcg     18660
     tattaaccgc gaagttaact ttacaccgtt gcccagcaac ctctagctcg acttcgcccc     18720
     agtcgtgctg gagctgatat cccggctggg tttcgaagcg aaccgttctt tttgatggcc     18780
     gcattttacg tttgggctgg atgtagtaac gcagcatgga acgcccgccg gtatagccca     18840
     ttgccttaat ttccgcgagg atgacctcgc tattccagac attctctgcc aggcgcatgt     18900
     cgatgtagtc cataaacggt ttcagcttaa ccattttgtg gcgagtcttt ctggctggcg     18960
     gttcagggta tttgaggtag cgtctgacag ttcgttcaga gcaacccacc tgagtcgcaa     19020
     tatcgataat gtacgccccc tgctggcgca tttgctttat catgtaaaag tcctctctgc     19080
     tcagcatgtt gatgtccttt ctggtgtgag aacctcaagg aaacaacatg ttgggtggag     19140
     cggacaatac taatggtgaa ttaccgtctt atatcactgg cgctaacacc gtgaagggct     19200
     tcatgttaat cataagcgcg tgtaccggct ttatcacctc agtagcctgg gcgtaaaacg     19260
     cagaaggcgt cggaaagggc tggcaacaga acgtctgccg ctgctccgtc cggcggcgcc     19320
     caatctgacc tggtcgatgg atttcgtcat ggacgcattg gccaccggtc gcaggatcaa     19380
     gtgccttacc tgcgtggacg actacacgaa ggaatgcctg acggtcactg ttgcctttgg     19440
     gatttcaggc gtgcaggtca cgcgtattct ggacagcatt gcgctgtttc gcggctatcc     19500
     ggcgacgata agaactgatc agggcccgga atttacctgc cgcgcgctcg atcaatgggc     19560
     ctttgagcat ggcgtggaac tgcgacttat ccagcccggc aagccgacac agaacggatt     19620
     tattgagagt tttaacggac gctttcgcga tgaatgcctg aatgagcact ggttcagtga     19680
     cgtcagtcat gccaggaaaa ccatcagtga atggcgtcag gattataacg agtgccgccc     19740
     gcactctacg ctgaattatc agacgccgtc tgaatttgcg gcggcctgga gaaagggtaa     19800
     ttctgatagt gaaggatccg acattactaa gtgagcgttg tatctaatcc tgggggcagg     19860
     tcattccgta taataaggca acaaccaaaa atctactcaa ctaaatgacc gtggtggtga     19920
     gattagtgat gaggtttgta gccgttcagc cccctgcacc agcatctcaa gctgagtata     19980
     tagtgagtta ttatccaggc tgttcaatgg ttgtcgattc cataacactg ggtgcccccc     20040
     aacctcgtcc caggataaga tgggttttaa tatatcttga ctgaatatat tatggctaag     20100
     taaggtttcc ttttcatcat tattgtcaag agaaggtagg gtaaacatta atatttgccc     20160
     gacaggatgc tctgttatat ggcaggcgaa ttccccaact ttgacaccga taaccggttc     20220
     aatagtatct ggaatagaca acgaaagttg ttgaaataat tgagtgatag cttgttcaaa     20280
     tgaatacatt atgatctcat aatagttaga taaaatatca acttaaccaa agcactctcg     20340
     gcagaccatc aattttagcc tataattttt agtttttgtt ttgtctaata taacaacaaa     20400
     aacagcagcg attttttata tagccatcgg ctattttccc actaagataa ccttgtttta     20460
     atagccaagg taataaatag tcatgaaaat atcatcattt atttctacat cactgcccct     20520
     gccgacatct gtgtcaggat ctagcagcgt aggagaaatg tctgggcgct cagtctcaca     20580
     gcaaacaagt gatcaatatg caaacaatct ggccgggcgc actgaaagcc ctcagggttc     20640
     cagcttagcc agccgtatca ttgagaggtt atcatcagtg gcccactctg tgattgggtt     20700
     tatccaacgc atgttctcgg aggggagcca taaaccggtg gtgacaccag cacccacacc     20760
     tgcacaaatg ccaagtccta cgtctttcag tgacagtatc aagcaacttg ctgctgagac     20820
     gctgccaaaa tacatgcagc agttgaatag cttggatgca gagatgctgc agaaaaatca     20880
     tgatcagttc gctacgggca gcggccctct tcgtggcagt atcactcaat gccaagggct     20940
     gatgcagttt tgtggtgggg aattgcaagc tgaggccagt gccatcttaa acacgcctgt     21000
     ttgtggtatt cccttctcgc agtggggaac tattggtggg gcggccagcg cgtacgtcgc     21060
     cagtggcgtt gatctaacgc aggcagcaaa tgagatcaaa gggctggcgc aacagatgca     21120
     gaaattactg tcattgatgt gatatggata aaaacaaggg gatagtgttt cccccttttt     21180
     ctatcaatat tgcgaatatc ttcgtccctg atctttcagg ggcgaatcgt tttttagcat     21240
     gctcattgtt agaatttctg acttatctct cttctgtatt actactcatg ctctggaaaa     21300
     tcctgaacat ctatatctat ggattgatgc agcactcgag aaatcaaaat atcattgcta     21360
     agcgttatat agtatatacc gtgcttttta tactgaaaac ggcgaatatc agagcaaatc     21420
     cagttacact cagcccctaa ctctggattt ttagctaata gctcgaatac ctttgccaag     21480
     ttctcatggt ataacttagc ctgagtcaca ccgaaatgcc ggatagtata actggcaata     21540
     ttataaatat cctcatcagc tagttcagac agtttataca ctagtacctt tcaccgcagc     21600
     agaaaaaatc tcatccatta aacgatggct cacaggtaca tttgttcctg caagcaccat     21660
     atcgcgtaca tgttgaacac gctgttcacg tgcttccatt agccttaagg catcacgaag     21720
     cacttctgat atattgccat aacgaccaga ctgaatcatt tcccccacaa aacctgtcaa     21780
     atgctctcca agtgttacgc tggttacgtg agccatatcc cctccgttat gtattactga     21840
     gtaatacaat tatagctaaa caatctgtaa tgagccagcc ctgcctactt taatatatga     21900
     atttaccggg agacctgata ccagtcggca cagtgctgcc gccgcatcct gctttaccgt     21960
     cagcagaaaa tcgatagtct aaccgcgagt atcaaccgcc cggtacaggt atttccactg     22020
     acctttgagg cttcatccat tcgccaccgg cgacccacgg tacatttata acggcaaaaa     22080
     gctttatgca gtaatggcac cacacgaata acccaactgt ggagtgtgga atgctcaaca     22140
     gagataccgt gtttcgtcat catttcctct agatttagaa aactcagggc atcgccaaga     22200
     taccagtgaa cacactgagc tataacatcg atggggtaat gcaggcgaca aaaaaatttt     22260
     tggattaaag atatgtgcag gcaatatcat aaaaaaacag catgttacca gactgtgcct     22320
     taatgcaata gagccgtcat tgttacatcg atactaacat gaaatcgccg tatccaacct     22380
     ggcgggatgg atatcgctat caaaaagccg acatcatgct taatgacgtc ggcagtcgac     22440
     caggtcagat agatatgttt gatgaaacac cgccgcacgc gaacagtaaa catctgatgc     22500
     aagttgttga tgcatcaata gctctgggct aagaatagta tgacttggtg aacagagtat     22560
     tgcgaagggg tgataaatga agcgaaaatt actatctcca taatgaaata tccgctagtt     22620
     taatctccct aaaagctatc actaaaaaaa tgctcatcga cttaatcgct ttcaattcga     22680
     atcacatttc cactaggatg ttcaatgcca gtgttagtaa ttgggaccac ggtcccactt     22740
     ggatatccaa tgccaacgtt ggtaattggg accacggtcc cacctggata tccaatgtca     22800
     acgttggtaa ttgggaccac ggtcccactt ggatatccaa tgccaacgtt agtaattggg     22860
     accacggtcc cacctggata tccaatgcca acgttggtaa ttgggaccac ggtcccacct     22920
     ggatatccaa tgccaacgtt agtaattggg accacggtcc cacctggata tccaatgcta     22980
     acgttggtga ttggggccac agttcagctt aggaaatgag ttgtaaagaa ggagatcttc     23040
     tacgaaggat gagctaaaac aatagatata cactaaataa aggcgggcag acaacccacc     23100
     ttgttctgat cttattcagg cactacaaag aatgttcctt tgcataggta ttcaagagtt     23160
     cttctatttg tttaaccaag gactctggca cagatttgag atagaaagaa acattgtctt     23220
     ttgaatattt tgcttctata tttttgccaa agcttttttt atgaatgttc tctggttgtt     23280
     ttctctcagg catcagcaat acgattaatt cttccgtagt aaactggcga ccttcctgtt     23340
     tttgcttcat aattttatac gtaactcgct ttagcgtatc aacattattt tcataagctt     23400
     tacttaatgc ttcgccacta cgagcactta attcattagg gttagcaaac agttgaatag     23460
     ttttaagggg cagcccagcc gttttaatac aacgctgaat aattttgcga gagagatgct     23520
     cggcctctgc caatttacta atattacctt caaattcaga tattagccgt tgggcgtaac     23580
     gcaggcctcg ttcataagca ctcgtcggac gatactcatt agcaatttgg gacagccata     23640
     gcatctgctc atcattcaag ttaccaacca gaaccttata gtcacttccg gtgagtatcg     23700
     cggctttacg tcggcgactt ccatcagcaa cctcgatgtt cccgttatgt tcacgtgcaa     23760
     aggcggggat ctgctgccct gacgttaaaa atgaagggat caagtcatct aacgacgtct     23820
     cacttaataa tgcttggttt cgctcattac cactaaaaac gattgtttta gattcaacat     23880
     caggtgctgc tatcacttta agcgtaaaag caacgttcct tccacaaaca ggtaatacga     23940
     ttgtgttgcc tttcatgcca ctaactcgag aagcaagctg actcaccgcc ggagcagaaa     24000
     ccgagggctc tgcattgctg attgcgggtt tagcatcatc aaaattaatt gaaggcgcat     24060
     tacgtaacac tggtgacctt ttcatcatgc attctcccaa cgaggcttaa ccagccgatt     24120
     gaatatttct gcacaaacag gctcccaaat cgaaacagcg ttacgccaag cagctggcgt     24180
     tgaacgctgg ttagctgcct gttcaaatac agtacgcatt cgtacttggc ctttccccac     24240
     ttcgtcagtc acgcgaacaa cttctttcaa caccattcca ccccatgcat tccttatctg     24300
     atcgtccatc cactgagact gactaccgat cgcattacta aatttagtaa ttaaaacgcg     24360
     cacatcaggt tcaaaaccgt tgagatcaat atttgacatc aaatccctaa gcatggtgaa     24420
     aaattgcaac gtggaaacat agtcataaag ctccgccgga gtaggcacta cgatgacatc     24480
     agcagcgcac acgacattaa tagtcccaat acctaagttt ggtgcactat ctaacaccac     24540
     aacatcataa ctatcccaga ctgactcaat agcagcacgt aataaaagat gaggggctac     24600
     aggtaatttc ccctgatcat gcaagccata aatttccgac tcaatacgat gcactgccag     24660
     acaagaagga atgacttcaa gatttggcca gcaagtcggt tttatcgcat aagcagcatc     24720
     atctcgttga ccaagataat aaggcaacaa agtatcttct tcatgtatat gcagatcggg     24780
     aacatagcca tgatataaag aggccgtagc ttgaggatca gtcgcatcaa tcaacaaaac     24840
     ccgtaaccct tgtaacgcca tccattgagc aatatgaaca gatgtcgatg tcttgtatgc     24900
     accaccttta tgagctgcaa tggcaagaac aacaggattt tcgccttttg gtttggatag     24960
     tcttgtttta aacacatcac gcatatcatt aatttgctgg atggaatatc cagttcgttg     25020
     ctcaacacga ccaatcattg ctgtatcagg cggtggcagt ttgcctgagt cttcatagtt     25080
     acggatcgtt tgtggtgtta ctccgacaag ttcagcagct tcagtaatac gccagcgtct     25140
     agtaatcgtt cgagcagccg gactgtcatt accgaattgt gatttagcaa tttcttgagt     25200
     catgaactgt ccacgttcaa tacagcggtc aagagttgac tttaggtcca tatgtattat     25260
     ctctatgaaa tttgcgtctt tatagtaaaa catcaaaaaa tacgcaaaac aacccaaata     25320
     acgcaaaaat atataaatag aatatcaacg ttcgccgcag ccagtgacca agcatcgcga     25380
     tgaagcgtaa gagcctcaat gccgaactgg gcacgttcac atttccgtct atatgacgac     25440
     tatgggaaat accccaagtt tgacagttac ctaatctgct gtagatgacc tttctttttg     25500
     ctcgtcggta acagcagggc atgccaatat ataggtacta aaaatttatc ctatacgtac     25560
     ataatcgaaa acactcgtct tgctacaaaa aacgataaat atcagtcagt aaaatgggtt     25620
     aactgaagct gtatattacc tgccttttca aactaagagt gtccttggtt tttgcttgat     25680
     accgtgcaac cactgaatca ccacggataa tctacacaca ttctagccag gaagactggc     25740
     tgacaaatgt tcccccgagg ggatccgcga tacgtgcaac tgggagcagt tctgtcgctt     25800
     tgcccaagag cctgaacgcc gcaaagtggg tatcgattgc ccgcatcatg gccgagggca     25860
     cggcgtatga ggttgaaccg gatctctgtt ttactgctct ggggactgtt tgacaatgaa     25920
     ttacatgttg aatttgaagg cgagtggacc ggaccttatt acccgatttc tggtccaact     25980
     ctcctgaatg tagtgtagtg gatcacaaaa tcaggacacc ttcgtagcct ttttcccctg     26040
     ctcttcgtat tcacagggcg gtaatccacc attgtgccga tgggggtgtg ttgtaataac     26100
     tttgtatcca ttcaccgata tctcgtaccg catgatggac atccatatag ccccctacag     26160
     gcagccattc acttttcagg cttcggaaca ctctttccat tggtgagtta tccaggcagt     26220
     tacccctgcg gctcatactc tgcatcactc cggtcctcca cagtaactgc ctggatttct     26280
     tactcctgta ctgccctccc tgatccgaat gaaacagcag cctcttttcc cttgggcgcg     26340
     tctccagtgc attacgctag gctcgacaca ccagctcagc atccggggat gacgatatgg     26400
     cactgcccac tatccgacgg gagtaaaggt caatcaccag tgccaggtag caccagccac     26460
     cattgacttt gatatagctg atatatccac tccacacacg attgggctcc gacggcttaa     26520
     actgcctttt cagtaagtct ggcgatgcca gtgacacctc ccgttcgcca cggtaacgag     26580
     gttttccggg ttggcgactc gccagaccac attcccgcat cagcctgcca gccagccagc     26640
     gacccacgtt ataacccgac tgacgcatca gcagactcag tgttctgttg ccggctgctc     26700
     cccggctctg ttgatgcaat tcacgcagtt gcagacgttt tacatcaacc cgcaaattca     26760
     gcgaagcaga gtaaacactg cgcgttattt tgagcaggcg gcacaattcg accactggcc     26820
     attttgtttt cagccgtgtg attaacgcaa agatttgatg gggaactcgc tcatcaacac     26880
     ggctgcctgc tttagtattt ctttttccat ttccagccgt ttaatctgcg ccctgagcga     26940
     ctggatttca cgttgctctg gtatcagtgc aggattgtcc ggcgtcaccc cgctgacttc     27000
     ttctttgtac tggtgtatcc atttacgcaa ttggctggga tccagctcca gagcgcgtgc     27060
     aacctcgatg gttgaccgct gatacttaac gacccggctc aatagcttcc agtttgaatt     27120
     caggagaaaa acggcgtttg gtctgtttag gttgagtcat tatcaattac ctcaattggc     27180
     tgtcattaaa ttaacaggct attgaggtgt ccggtattac tgatccacta catcccagta     27240
     catcttcata ccaggatgct tatatggctt acaggatatt agcgatagac ttcgctagct     27300
     ggtcttccag aaccggccgg gcttcttcaa atttcaggtt gaccttgtta gccgaagaaa     27360
     ccacgcgagt ctggtattga tgtttgttgc ccgtctgtgt gctggtctga actttatagc     27420
     cagaggtgcc ttgcttcagc gccgccacat tgtcagtctg tagggtggtg tccgttttct     27480
     cggaaatctg gacatccgtc accatagtat aattgatgtc ctcgaccatc gcattcgcgg     27540
     ccatcccaac aaggccagcc gccaatccaa cgcctaacgt ggctcccgct gagttagagt     27600
     tgtagcctgt aataccagcc cctaatgcgg ccccctgata cccctgactc agaaatcctt     27660
     cagcttcacg caaatccatt ttatcggctt tcaggacatt agcctggatc cagtaatgtg     27720
     catcttctgg ggaagatgtt acggtatacc ccttatcctg cacagctttt gtgattttgg     27780
     gggctaagcc aagcatattt ttatctgagg tattttttat ctgtagataa acggttttct     27840
     gtgaagacgg ctctaaccag atcgtttcac tcatctgcgt tttcacttcc agattacgtt     27900
     tttttgattg ctgtgctcat cgcaccacag ccggagagga ctaatactga ggacagtacg     27960
     gcagtcattg ctattaactt catgtttttc ttcatatcat cttccattta aaacagggca     28020
     tggcacctcc catagccacg gttgaccaca atgcgatcca gtactctgat gacggcgctg     28080
     tgttggcagg ttcagatcga ttacaatcgc cagtgcttca cgattgtaat catccatgac     28140
     attataacgt actgaaatga cacccaccgc tcagtgcatt gtgcattgtg cattgtgcat     28200
     aaaatcgacc gacccgctca ggttaagtcg ttccggtacc gccagcggtg atgggttaca     28260
     ggctggcagg cgttgtttcc ctttgcggcg aatattgagt ttcaggaggc aatagatacg     28320
     gtgtacccgt ttagcgatct ccttcattgg caaggtcagt atgccggaag atctctaaat     28380
     atgaatggta cgattatcca ggatgattac ataccactgt tttttatatg ttacagataa     28440
     ttaaccttta acataatcaa ctaccatatc ccaaactctt taatatagct tcatcccata     28500
     atacattctt gatcgcagga ttcgcgactc aattcctcca actcagattt agagatgatc     28560
     agcataatac aaaaacgatg aaaattttca tcatataaat atttttttat gtcatcattc     28620
     tctataagta gagagttttt cggatcataa aattctatat tcccttcact gtcttttttc     28680
     cctatgaaca catactctat atcacaatct aatacagaaa acacaagacc aaaatcagaa     28740
     ttattgggta gtttcttaaa attggtgtca atatcgctga catgttgcca ttcgtataag     28800
     cgatatacta taccaacagc ctgccataac tcttctaaag tagataatat tgatccactt     28860
     ttaagtggtt caatccctac tctattgacc aatgaacaaa catccgttct cagtaaatga     28920
     gcagtagcgc agtagtaact gttattttct tctttagatg tatttattat tgtatcagga     28980
     gccgactgtt caagagcggt acataaagca cgcatgttat aagtatcttt aataaacata     29040
     gttactactc ccaaatttac tttataaact acactattta ataaccgtca ctacgagtgt     29100
     ataattaaaa tcactccgta atttataaaa atagaatatc tactctcaat gagcttccca     29160
     tgcatcgaaa tatttcaagc atcctccact ctataattat ttattttaaa gctacagata     29220
     tagtataata tatcattatt agaatggatt tttatcacat tagagtttat tataaactct     29280
     ctaacatcac tgtccccata agttgaattt ttataataaa aagtaacttt taactattga     29340
     aaaaatattt aatcgaatgt acaacatgta ctctgattca gagaaaatcc ctgagtcacc     29400
     tattggttat aatttattgt aggctctatc gttcattgcc agacgtcaaa atccagatat     29460
     attcaattta tcggtatagc aaaataatgg ctaacataaa taggttatac agatgaacag     29520
     tattcacgga cactaccata ttcaactatc gaattattct gccggtgaaa accttcaatc     29580
     agctaccctc accgaagggg tgattggcgc acaccgagtg aaagtggaaa cagcactgtc     29640
     acactcaaac ctgcagaaaa agttatcagc caccataaaa cataaccagt caggccgttc     29700
     tatgctggat agaaagttga ccagcgacgg caaagctaac caacgcagca gctttacctt     29760
     cagtatgatt atgtatcgca tgatacattt tgtactcagc actcgtgtgc ccgcggtgag     29820
     agagtctgtt gcaaattacg gaggtaacat caatttcaag tttgctcaga ccaaaggggc     29880
     ttttcttcat aaaataataa aacattcaga cactgctagc ggtgtctgtg aggctttatg     29940
     tgcacattgg atcaggagcc atgcacaagg ccaaagctta tttgaccagc tctatgttgg     30000
     cgggcgtaag gggaaattcc agatcgatac actttactca attaaacagt tgcaaataga     30060
     tggttgtaaa gcagacgttg atcaagatga ggtaacacta gattggttca agaaaaatgg     30120
     catatcagaa cgtatgattg aacggcattg cttactgcgt ccagttgatg ttactggtac     30180
     gacggaatca gaagggctgg atcaattatt aaacgctatc cttgatactc atgggatagg     30240
     ttacggttat aaaaaaatac atctctcagg ccaaatgtca gcccacgcca tagcggcgta     30300
     tgtcaacgaa aagagtggtg ttactttctt cgatcccaat ttcggtgaat tccacttttc     30360
     tgataaggaa aagttccgca aatggtttac taactcattc tgggataatt ctatgtatca     30420
     ttatcctctg ggggtggggc agcgttttag agtgttaaca tttgactcca aggaggttta     30480
     atgcagacaa ccttcacaga acttatgcaa cagcttttcc tgaagcttgg cttgaaccat     30540
     caagttaatg aaaatgacgt ttatacattt gaagtggatg ggcacatcca agtactgatt     30600
     gcttgttatc atcaacaatg ggtacagttg ttcagtgagc taggtgctga tttgccaacc     30660
     aacgataatt tgtttggcga acattggcct gcccatgttc aaggaagact ggacggtaaa     30720
     cctattctct ggtctcaaca atcactggta gggttggata tcgatgaaat gcaggcttgg     30780
     ttagaacgtt tcattgatga tattgagcag agaaaagaac cgcaaaatac taagtttcag     30840
     cccaactcga catcacccat attattcatc tgaaatgtaa acaatcatat acgcggtacc     30900
     atacaaagtt atttcactac atagttacaa taatatctat taaatttaat agatatggtt     30960
     tatataataa ctcatttgtt tttaattcac tataaattaa gaagttttca ttatttatcc     31020
     aaatttttac atataacatg accaaattag tgttatcaat aattattatt tttattagtg     31080
     atatagacga tttgaaatat cctgccaagt taaatctccc ccagttaata accccaccat     31140
     taagtatttc ggtgattcct ccaattagtt gaattttata tataatgctc acttttaagt     31200
     ttttctcatg atcggcgtta atgttcattg tccccactat gggcttgttg caaaaaatgg     31260
     agttgtcatg aaaactgaaa gaaggaaaag atacgggatg ctgcaaagca gcggcaagtc     31320
     aaatacctga ataatcgtat cgagtctgac catgccccat caaaaaattg gtaaacgcgg     31380
     ccggggattt caaacggcca aaccgtgcct ggtcaacgct tcagggattt gaaacattgc     31440
     gacgactgaa taaaggtcaa tttgatattt ggttacgccg tgacgaacct gaatatcgag     31500
     tgcgggaagg atctaccttt atgaatcggc tctttaacat tgaggttgtt ttagcctaat     31560
     tattcccccc catcaatgag taaaataccg actctcatta tttgcagcaa acccgccgaa     31620
     attgctgtag ggcactttat taccatgagc attaaggcta tattattata ttcatatcag     31680
     gaatatggtc agcacaccga tgtttttatt caagtaaagt ttaattatgg tatgatagaa     31740
     tataaattct atgtaaataa agtaaaattc gataataccc cgggcagaaa gctcaagaca     31800
     acgatagctc actcttctca gctcatgggg cataatctaa cctacgagga ctatgcaatg     31860
     aaaaaacgac tagtgatagc caccgcattg tgcgctgctt tttatgctgg tatgaaagtt     31920
     gagcactttc tgacagtaga tgcttgcctg gatgctggcg gagctatgca gaatgatatc     31980
     ttctgtgaac gttaagacga tagcgacgcc accgttgatt aaaaaaacaa aaaatatcca     32040
     tcaattaagc agtaattatc tttatcaaat atcattgaca tgacttacta aatgtaaaaa     32100
     atatttttta cattgaaatc agttaaacac ataaataaaa ccattaaaca agatacgaca     32160
     tttaataaca aaataaacac catatcatta cttcacgctg tgtaattaac tgtgaggaaa     32220
     atatcatttt aataagtatg actattgata ccattgctac agtatattaa aatgttaagt     32280
     tctgaaagaa caattgtgtt atttatgatt gtgacacaga aaataactct atttaacatt     32340
     acggattatc catggcaact aacatatatg taatcggaga atactcatat gaaaccgtgg     32400
     ggttacaaca tattaagtgg ttttatcccc agttatgatg ggtgatctat gattcagcgc     32460
     aatatatagg tttgctgcaa ataatgagag tcggcgattt tactcattga tgggggggaa     32520
     taattaggct aaaacaacct caatgttaaa gagccgattc ataaaggtag atccttcccg     32580
     cactcgatat tcaggttcgt cacggcgtaa ccaaatatca aattgacctt tattcagtcg     32640
     tcgcaatgtt tcaaatccct gaagcgttga ccaggcacgg tttggccgtt tgaaatcccc     32700
     ggccgcgttt accaattttt tgatgggggc atggtcagac tcatctggct ctggacatcg     32760
     aagccaaccg caaaaatggt tcgtccagaa aaacaatcaa aactcccact ggtacgtttg     32820
     aactcgccac gccccgtgat cgcaatggaa cttttgagcc tcaactggta atggggccaa     32880
     caatatccag tggtactcca gtcgtggcgg aaaaaatggg ccaatttgtc gtgttacttc     32940
     cggtatccga caacgatccg caaggtcatt tacatgacaa atgccattga atcggtacat     33000
     cggctgttca gaaagctgac aaaaacgaaa ggcattttcc ctaatgagaa cagtctgttg     33060
     aaatcactgt atctgggatt aatgaatgcg caggaaagat ggacaatgcc aatccagagc     33120
     tggaatttgg cattgtcaca gttggcgatt tattttgaag gtcgcctcga taaagtgatt     33180
     acgttgtaat aatattttaa cgtgacgcag aattatgaac gctcttgcgt actactcaaa     33240
     aacatcatct tcaagtttgt ctgtagtctc atgagcaaat tcatatggat caactacacg     33300
     ttcagagtcc atctcaagct cttccaatga ctcaggtata tcgggaaact ctctcagagc     33360
     gttttgctct acgtggagct gtttcaggtt ttgcggcaat tcaggtactt cagcaagata     33420
     attaaatgaa gcgattaaac gttctaagtg tggaggtaac gctggcagtt cgctcaactg     33480
     attacttttg acattaaggt ctaccagtga aggaggtaaa tcgcataagg atcttatttc     33540
     attgctggat gcatcgagat aatacaagtt tggtggcaat tccgataatc cagaaatatt     33600
     attatcagaa acatctaaga aggttaaact ctgcggtaat tctggcagat cagttaaatc     33660
     attttctctg acatgaagtt ttttcaggga agggggtaaa tcgggtaatg tttccagtaa     33720
     attgttatca gcataaatcg cagccaagaa gggcaagttt tgcaactctg gtaattcttc     33780
     cagcttatta ctactagcag taagatattc cagtgaagga ggtaaatcgg ataatgcctt     33840
     cagattgtta ttatcaactc gaagtgattt caggctctgc ggcaattccg gtaattcagt     33900
     aagagaatta tatgacgcca ctaaaatctc taaatgcggg ggtaaatcgg gtaatgtttc     33960
     cagtaaattg ttatcagcat aaatcgcagc caagaagggc aagttttgca actctggcaa     34020
     ttcttccagc ttattactac tagcagtaag atattccagt gaaggaggta aatcggataa     34080
     tgccttcaga ttgttattat caactcgaag tgattccagg ctctgcggta attctggcag     34140
     atcagttaaa tcattttctc tgacatgaag ttttttcagg gaagggggta aatcgggtaa     34200
     tgtttccagt aaattgttat cagcataaat cgcagccaag aagggcaagt tttgcaactc     34260
     tggcaattct tccagcttat tactactagc agtaagatat tccagtgaag gaggtaaatc     34320
     ggataatgcc ttcagattgt tattatcaac tcgaagtgat tccaggctct gcggtaattc     34380
     tggcagatca gttaaatcat tttctctgac atgaagtttt ttcagggaag ggggtaaatc     34440
     gggtaatgcc ttcagattgt tattttcaac ttgaagtgat ttcaggctct gcggcaattc     34500
     cggtaattct gtaagagaat tacatgacgc cactaaactc tctaaatgcg gaggtaattc     34560
     cggcaaagaa ctcagcccca gattatttag ttctagctca tgggcttgtc ggtccaggca     34620
     atctcgtaac cttgaaaccg ccatttccct ctgttcacca ttccccggag gggcatttcg     34680
     ttcccattcc gaccatgcat tataatattc agtcttagat ttaacatttt ctgcctcaac     34740
     cggcatctca gttaaattag aagaatgacg taatggttct tgcaaaaaag tattagatac     34800
     atttcttgga tttatgaaca tattgaatgc ctttctgaaa atatttttat tatcgagttt     34860
     ttcactgcaa acaaaaccat acatattaaa tttatatatg tatatagttt ttcgtcggga     34920
     atttttatgc gttatttatc cgaatttagc tcttctacca ttgaaagttt ttggccattt     34980
     ttatgcataa ataaccagaa gaaatatgtc agaagtattg tatggccgca gagtcaacct     35040
     taccggcaat atcattaaac tttaaatcag tgtattttgg ggcagtagtt tcaataccgg     35100
     ccatttgctc tttagtttct tcaatggttt ctcaatataa ttcctgttct ataacaccac     35160
     ttatagcatc tctgtttacc ttctgaacag tataattatt agcatccttc aatgtgagtc     35220
     tgctttatta ttggtatagg tattggcact gtccaatgta ttactgctga cggtgttagt     35280
     atactgtttg gccgtatcca gtaccccttt tgaaaccgtc agggtgtgct tttgcgcggt     35340
     atccagcgtt tgtgccactt cagcatcact atatttgggc ttgttgcaaa aaatggagtt     35400
     gtcatgaaaa ctgaggctat tcatcccttc ttcagtgaat ccacatggcc ccaggtgatt     35460
     tcaagtggga acattttgcc cccgatgagt tatgccaatg tcagcgatat gctgtcagag     35520
     cgtgggattt ccgtttatcg ctctaccatt taccgttagt ttattgaata tacacctata     35580
     cctcgtcaga aattgaaacg atatcaattt acggatgccg actcctcatg gcaactcgat     35640
     gaaatctata tcagggtcaa cggaaaatgg ttttatctct atcgcgccat caataagcac     35700
     ggcactacat tagattttta tttttcgcct aaacgaaata aaaataccgc ctatccattc     35760
     attaaacggg tgttaaaaac ctattctgtt gaaagacagc ctaaaatact caataccgat     35820
     aaacattcgt catacggtta cgctatcact cgtttgatga aagaaggaaa agatacgaga     35880
     tgctgcaaag cagcggcaag tcaaatacct gaataatcgt atcgagtctg accatgcccc     35940
     catcaaaaaa ttggtaaacg cggccgggga tttcaaacgg ccaaaccgtg cctggtcaac     36000
     gcttcaggga tttgaaacat tgcgacgact gaataaaggt caatttgata tttggttacg     36060
     ccggagactg taaacaatat tgagtgcggg aaggatctac ctttatgaat cggctcttta     36120
     acattgaggt tgttttagcc taattattcc cccccatcaa tgagtaaaat caccgactct     36180
     cattattggg atatgtgtca ttcttttttg attgcatatt actggaatga cacagcattt     36240
     ctaacactct cgctgtatac gagcaaaatg ccgatcacag ccgctgacgt gctcaatgac     36300
     cgcgtattgc cgttcaacaa ccggtaactg tcagctcagg tcttgagcta ctacatgtaa     36360
     ataatctttt attttaattg tcatatgatc ctaacttatt atttttaatt taataatcac     36420
     aaccctggat taactaatat taatccaggg cttttcagca ccttatacct tatatagata     36480
     agttctatca ccataagggg taaggtaaaa taaaactttc ggttaattaa ctaaccaagg     36540
     tcatcaatgg tcagacaaca ccaaaagcgg ctttcatggc gtgagtatga ctgctaacat     36600
     attgttcaat caagcgcagg acatctttca taaagttatc attatagttc atcgcctctt     36660
     cggctttttg cttctcgttg gcagcaatac ttgcattgac ttctttctct ttgacctcgg     36720
     cttgagaata cccttgatga acttgaatcg cactgtttgc catttgtcct aacggctgcg     36780
     ttgcggcatt aaacgcattg gcttttgagt cggtcattct gaattcttta tccaataatg     36840
     ccagcttatt ttgatccgct acctgctctg gtttccatat tctcccgata tcctctctgc     36900
     ttaccgcttt atcaccaatg ttactcattt gctgcatttt tgtatcaata agttgttcgc     36960
     ggccagcaat attactgttt agaatttgtt cctgtttaac tattttcacc tctttcgcta     37020
     tagaaaaagc actagcaacc gtagaagtag cagccatgat gccagacacc accgccatgg     37080
     cgatcatcag ttttgcaccg ctgaccatct ccgctacctg ctccttttgg gcagtaatag     37140
     tagctttatt ttctatatcc ctttgttgca aacccatttc tcgcgcttta cgtgccagtt     37200
     ccaacagcaa caacaagata cttaaagtac cattaagatc accctggctt ttactcagta     37260
     atgcaacatt gattccctgg ctcggtttga tcaattctgg cacctgtgac cgagataagc     37320
     ttgcctcgct actctttatt gcttgtgctt catgacgggt gtcttctgtt tttttaatct     37380
     caccgctttg cttgactgtc tctgtagtga tggcatcaag ctgtgaaccg gtcgtgataa     37440
     ttgggctgtc tgtcttgata tttattgtca tggttattcc tccttaaact taaacagtat     37500
     ggggtctgcc ggccaaatta tgcagcatgt caccttttgc attaatcatc tggaaaatca     37560
     gttccatcac ttgttgatgt gactctgaca aatgggataa ttcttctttg agtcggtcaa     37620
     taatactttg taacgctgcc atgtctgcct tgttcaaggc caaatcagcg ttattatgtt     37680
     gtaaatcagc ttgcttttta ttattgatgg tctgagttat tccgctgccc acaccaacgg     37740
     cgacttgtgt tgcctgtgat cctgtacgga ttgcatggct cattgttaaa ccagcaaaac     37800
     tgccccctaa tttagtcact gcactcccga cagtgtttga tatgcctgtc gaaatttggg     37860
     caactttggc cgaaaactcg gctcctttag ccgcaagact tgcggtgtta gcaccgagtt     37920
     ttgcgccaat attagccagg cattttagtg ccgaaccgcc aaaggtcatt acggttgaaa     37980
     ctacagtcaa tgcgacttca atcgcagtga gtatcggccc taatattttc attgcctctt     38040
     gggatatcag gccatcttcc gccgcttgtt tcactgccat attcgccatc ccaattacgc     38100
     ctgaggcaac catcattgca ccggcaacgg ctcctacccc tgaggccacc atgatggcac     38160
     cgacaatcac tgaggctatg gcgctgagcc agccaaaaat ctttgatgca atgccggatt     38220
     tcttgacttg cttggcattc tcttctgttt ctttgatttt ctcttgattc tcttcaattt     38280
     tcttcatgtt ttgttcatga agacgctgaa tatcagcgat ttttatgtct ttgcgtactt     38340
     cttctaaatt agaaactagc ttacctaact caatctcaaa tgtatcaggt gaagcaagcg     38400
     taaacttcgt tagcactgaa acataatttg atatcagttg agatcctgcc gcgccgcggg     38460
     tgaccgactc caataattta gtgacttctt gctgttgtcc ttcagtaact tggctggcaa     38520
     ccactgctag tggtgcaggg agctgtacgc cctgagaact caccccgcca tttttatcct     38580
     tcagttctcc cgcgacttgt tgggtctgaa ggggggcggg cgctggtgtc tcgacgtagg     38640
     gaagtagact tccagttact ggcgttgagc ggtcatgggt tatcaacgca ctcatgttcc     38700
     atctcctttt tcaatttaat tgcttctaac attgagctaa ctcgggtgga aagctcctta     38760
     aactcaggtt tgtctgcgat aagctcttga gccaagaaca agccactttc tgcttcagca     38820
     agctctccct tttgcagtaa acattcggcc gcatgaaacg gaaaacgagg ttcttttata     38880
     tccattatgg cgccatagct gtagctatga atcgctaagt cgtattgccc catggcttga     38940
     cgacaagcgc ctagccctaa aaagaaacgt gaatcatagt ggtctagcac acagagagct     39000
     tgaaagacct tgtgagcatc ctcgtatttt cctgactggt attggttaaa tgcaagagag     39060
     tagagttgct ctaaagtatc acttgaaatt tcgttgagca tggcgatagt tccccctcct     39120
     tttaggaagg attccattgc cagctggtat tcttgagtgt ctgtcgtctc ttgttgcata     39180
     attacctcgt gtcatttacc agacgtgtca tctagcagac gttgcatcac tgaatcatat     39240
     ttctgaatga aacggttcag tgcttcaata gctgaattaa aacgtgatgt aatatcagac     39300
     agctgagttg ttttttggct aaccaagtcg ttgagcggcc tggacttatc cgagcaggtg     39360
     gtggcaaagt gagataattc attattatct ttattataag agtatgagtc tttcagatta     39420
     cccaacgccc cggttctttt tttctcactt tcaagaaagt tctttatcga gactattttt     39480
     ttttcggtct caccttcctg aatggtggtt tgaggcattt tctcgagaat tttgtactct     39540
     gcactggctt taaaaatctc ttcatctgta taaccatata aatttttatc catgagatta     39600
     attgatttat catggatatt tatggtgcca ccactagaca gatgcttatt aatttcggct     39660
     tgaataactg aataaatctt taattcggcg gtaagctcag ctaattcttc acgcaacttg     39720
     ctacgggcat caccatgatg attcattgaa tcaacaatca ctttcaaaat atcatcatcg     39780
     atacgatcgg cggttaaaga gaaatgtatt actgccatga acgcccgcaa ttcccattgt     39840
     gtattcggcg atgattcaag gaactctttt actcgcttga tgccattttg cagttggttg     39900
     tcataatgac cgcctttaag aatggcatcc tcgggtagaa aataagctag gattttcttg     39960
     agcaattcga tatcatcagt aattactcta ttggcaaaaa cctccgaatc ttttctggga     40020
     tcatatttaa tggaaatatc tatattttta tctttgacta actgaaccaa ttcttctaaa     40080
     actgaagaac catgaccagt aagttgttcc accctaactt tttctagatc ctcaataaaa     40140
     tgttgtgggt tttgttcgta ggctctaatc atattaaata atttgccctc gcatcatcgt     40200
     tggttttctt ggtctcttcc catcgtaggg atgttgaggc tgcctctccc tctgacgctt     40260
     aatttcatca agcaactcgc gctccgctgg ctttatctct tcggcggaac ggcccgcaaa     40320
     tatcttcatt acggcttcag gcgttaagcc gatatcagca cacatttctt gcaataattt     40380
     tgcgcggtga tcgctgtcgg ctattgccag ttctgcctgt ttaagcgttt tgtcatattc     40440
     atcaaaatgg gaagatttca taatctacct cctattctat tacgttattt ttatttagct     40500
     tgtcaggcaa agccgttgtt ttgtcgcttt ttcatattag ataaggtgat gacttgtgat     40560
     acttttagtg agaaccaccc ggtgcttaat tctttggccc cggtccaacg ccgataaaaa     40620
     tgagcgagcc gttgcgtact gagagaactc cccgccagta catcgacatt gccatacaga     40680
     taatagtcag ggccaagaac ggcccgcgct gcattagcta acatataaag tgccgcgaag     40740
     ggatttttca gccctcgacg ttgttccact cgttggataa gcacgatcca aacccgcctt     40800
     tgttcaattt ctacgcgcca ggcaagcttg aggccagcta attgaaaggc cgaacctaaa     40860
     gaaatggggg tgccagacaa agtatgaggg tggcaaacca agccatgttc ggtaagccac     40920
     ggaattaaag gatctgccat cataagcaaa ttcgtccaag tggttggata ttaatctgct     40980
     gagtcagctc ttggtatgaa agtaccggca agccatagta ttcactctca atcagtttgc     41040
     gcacatagcg acgaatatcc atagaaacaa tcagcaccgg tttactctgg atttgcgata     41100
     gatcgccaat agtcttgcga acttgttcaa gtaaactctc ggtaacagca ggctccaatg     41160
     ccaaataact ccctgcactg gtttggcgca caccgctacg aattttttct tctacttctt     41220
     gatcgaaaag ataagccggc aatatattgt tgccattagc gtatttgtag cagatataac     41280
     gttttagact actgcggata tattctgtga gttgaacgac gtctttctct ttttgtcccc     41340
     attccaccat agcttcaaga atagatcgca tattacggat agaaatatct tctccaacta     41400
     atcgttgtaa tatttcggtc attcgttgta agggaacgat tctttgtact tctttaatta     41460
     attcgccata gcctccttcc atctgttcga gcagatagcg ggtttcttgg ataccaatga     41520
     aatcttcggc atattcacgt aggacatgag aaagatgcca ggttagaact tgggaatgag     41580
     agaaaaattc cagttgagac ttttccaggc gctcctcata ttcaaccgat acccagaaag     41640
     cttcctgatc gggtagcaaa tgttcccctt tttcataggg tatacccagt aattcgagtt     41700
     ggctgacgga ttcacgcacg agtaaataac ctgccttaag ctcacctcgc gccactggaa     41760
     cttcttgcaa ggaaataata tattcgcctt cacccatccc ctcattaaaa cgcagatgga     41820
     tcccagggaa aggtacgcca agatcaagat aaagagcacg gcgcactcga accagctcat     41880
     catttagtgc tatcgcttcc agtgcttcct gttggcttga atctacatca atcagcaagg     41940
     gaaccgtcat agcaaatgct tcttgttccc ctagtcggcc cttgtttgcc ccacttgttt     42000
     tggctttggt tcgagcagcc ggggcgccag aaccgctcgt cagtatggat tgcaggtctt     42060
     gattagcctc gtcattacga ctctgcttac ggctgagcat ataaccacca cagcctacca     42120
     atagcgccaa aatcagaaag gtgactgttg ggaagccggg gataagacca aagagcaaca     42180
     gcagtacgcc accaattagc atggctttag gctgagcgac aacctgtttg ccaatatcgc     42240
     tacccaggtc tgatgaatct tctgaagaga cgcgggtgac gataataccc gcggtaatag     42300
     ctatcagcag ggcaggtacc tgagaaacca tcccatcccc gacagtgagg atggaataga     42360
     gttgcagtgc ctcagcggcc gctaatcctt tttgggtaac accaatggtg acgccgccta     42420
     atatattgac aaagataata atgaggccgg ctattgcatc ccctttgacg aacttcatgg     42480
     cgccgtccat agaaccgaac atttggcttt ctttttctat cgtcgcgcgc cgctcacgcg     42540
     cttcattgac atcgatcacc ccggctcgca tatcgccatc gatactcatc tgtttacccg     42600
     gcatcgcatc aagagagaat ctggcactaa cttctgctac acgttctgag cctttcgtta     42660
     tcactaaaaa ttgcacaata gtgatgatca ggaagatgac aatcccgacg atgaggttac     42720
     cgccaacgac gaaattacca aaggtgtaaa caatctgccc cgcatcagct tgtagcagga     42780
     tcatgcgggt ggtgctaact gaaagtgcga gacgaaataa cgtggtaacg agtagcaccg     42840
     cagggaaagc tgaaaattgt aaaggagagt tgatatagat cgctatcatt aacaacacca     42900
     ctgaaatggt catgttaaca gcaatcagaa tgtccaacac aagggggggg agtggtaaga     42960
     ccatcatgaa taccacagct aacagcagca ctgccagcat gatatcttta cgctcgccaa     43020
     tacgatttag ccactcaaga tcatggggat tcattatgat ctttcaactc caaataatgt     43080
     tgataagcat ggcgagcctt atcaagatcg ccgttcagtt gttgggcgcg gctcaaacag     43140
     agccaattcc cagcctgtaa agggtcatgt gatattagcc attgcgcttc tttttcggca     43200
     cgttctccct ggttattatt aagtagcgcg actaatcggc aacgccgacc ggctaaatgc     43260
     tcaggattta acgtcagcaa ggcgtccaat agaatacatg cgcgctctgc atggccacat     43320
     tgtagttgta accaaccgtt gagcagcaag aactcctgtt gtcgtttggt taaagtaata     43380
     ttcatacttt gtgcaacagg ttaaggatta tttgcagtaa ccgatcatca tcttgttggc     43440
     atttaagcag cgccgcggca gcttgtagct ctgaggactg actggtggtt agcagtgact     43500
     gcaaggtatc cagttcgcgc cgataatctt gagctcgatg taatccatga aatgtatagc     43560
     cgggagaagc aaagtcccat aggctacgct tgctttgtgc tgtagggtaa aggcgctcta     43620
     aatgtggttc gactggatgc ccatcaggcg gcaaggcata acgttcaggc aagccacagg     43680
     atagctcttc caggctaatc gccgacagtt tttcgatgcc aatatggggg gcagttatta     43740
     tgcgactcac ggcgcaagca cctcttgctg caatcgcagt aactgttcga aagcttgatg     43800
     taaaaggggc aaggttaagg aacgctcatc aagcgagaca aataacacca gctgactttc     43860
     ccctaaccac cccgctcgca gcggtaaagc gccactcttt tgggccgccg tgagcgttag     43920
     cgctttgacc atagcatctt cacaccggtg ccaggcaaga gaacgcgcta accacaatgt     43980
     cagtgtcgca ccatgttgtt ccagttgcag cgtgccagat tgagccatct ctaattgaat     44040
     aagaggcgaa agggggctag atgttggcac tcccagatcc tggcagaaat gggaaatgat     44100
     gggttcaatc caactcactc aattcttcct cttcactctc aatagccata tcgatcgcat     44160
     tttgacacat ttgcaataaa ttttgccgtt gctcctcatc gctaaatacc cccagaggga     44220
     aaagacgaaa cattcttttt aaatcttgat agaaacgcac tttgatttca ggcgtaggaa     44280
     gggaaaaggc gttggcaaga tgttcaatgt catgaatccc cgcccagcgc ttgtcaacca     44340
     gtgcgacaat atctcccata aactcagaaa ggtcgtacgc cattagtttt accctctgaa     44400
     aaaaattgcc aaaatccttt aacttggtca ctcacgctac caaactcctt tagcttctgt     44460
     aagtcattaa taactattcc taatttttcc cgtccagacc cgctttgttg actttgtaga     44520
     tctgcactaa gcgccttttg caggaataat atcaccgagt ctatatcccc attaggaaaa     44580
     cgtttttgta aatcactcca gatcgcataa attccttgat aacccatcac tgcatcgcgg     44640
     taggtatcac ggagcggctg cagtggatta acacccgact gggattctct gtacgcttcc     44700
     ggggttatcc tggcacccaa tacaatggtt tctccttgct cttcagccat gctgaccaga     44760
     gcttgttcaa ccaaatgcga aagatgtgct aattcagggc gccctttcag ggcatcacgc     44820
     aagccgcaga gcattttgaa ttgctcactc ggttcttctg atttcccctc cagataagcc     44880
     tttaactggg acaagcttat attggggctg ttactcaaca gactgagcag ctcactcaca     44940
     ttctgttttt gttccaactc tggaactttg ctaaggtatt gattaacctg ctcctcaacg     45000
     tcgctaactc gagcctggct gtcacttaat ttgcgtttgt cgagggagag ctccttacgc     45060
     tcggagaaga caaatgttac ctcttctgcc atatcagcta tagactgcag agtgccgctg     45120
     actatctgca cagattctcc ccgaaattga cccagagtct gatttacgat ctgactactg     45180
     gcaatctctg gacgctcatt atgcagcggg gtattgccat aagataggtt atgaagcgtc     45240
     gtcataacta ctccctgaga tgaacagttt ataattacaa ttaccgcgat tataaaaata     45300
     gttcttgctt atcgatgcca aaatcagccg agaaatttta gtgctgcttg gctatttttc     45360
     taaaaactcg cggctcccgc tacaattttt tagcgttttt agtcactaaa atagtggtta     45420
     atatttcaac cattatggat ttatgctctc actagatcag atacctcatc atattcgtca     45480
     tggcattgta ggtagccgcc taatccaaat tagaggacgt gtcactcaag tgacaggaac     45540
     gttattaaaa gcggtagtgc caggtgtgcg catcggtgag ttatgttact tacgtaaccc     45600
     tgacaacagc ctgtctttac aggctgaagt cataggtttt gcccaacatc aagcattact     45660
     tattccactt ggtgaaatgt acgggatatc ttctaatact gaagttagcc cgacagggac     45720
     aatgcatcag gttggggtgg gtgaacatct gctgggacag gtgttggatg gtttagggca     45780
     gcctttcgat ggggggcatc tccctgaacc ggcggcttgg tacccagttt atcaggatgc     45840
     cccagcgccg atgagccgaa aacttattac cacaccactt tctttgggga tccgggttat     45900
     tgacggtttg cttacctgtg gcgaggggca aagaatgggc atcttcgcgg ccgccggggg     45960
     ggggaaaagt acactgcttg cttcgcttat tcgtagtgct gaagtagacg taaccgtgct     46020
     ggcgcttatt ggtgagcgtg gacgcgaagt gcgtgagttt attgagtctg atttaggcga     46080
     agaggggtta cgcaaagcgg ttctcgtggt ggccacctcg gatcggccct caatggaaag     46140
     agccaaagct ggattcgtgg cgacatctat tgctgaatat tttcgcgatc aagggaaacg     46200
     cgtattgtta cttatggact ctgtaacacg gtttgctcgt gctcagcgtg aaataggctt     46260
     agctgcggga gaaccaccga ctcgccgcgg ttatcctccg tcagtatttg ccgctttacc     46320
     ccgtttgatg gaaagggctg gtcagtccag caaagggtca attacggctc tctataccgt     46380
     actggtcgaa ggggacgata tgaccgaacc cgtggccgac gaaacacgtt cgatacttga     46440
     tggtcatatt attctgtcac ggaaattagc ggcagctaat cattatcctg ccattgacgt     46500
     attacgttca gcgagcaggg tgatgaatca aattgtcagc aaggagcaca aaacctgggc     46560
     gggggactta cgccgtttat tggccaaata tgaagaagtg gaattgctgt tgcaaatcgg     46620
     ggagtaccag aaagggcaag acaaagaggc cgatcaagcg attgaacgca tgggggcgat     46680
     tcgaggatgg ctctgccagg ggacgcacga gttaagccat ttcaatgaga cgctgaactt     46740
     attggagacg ctgacccaat gatacgccgc ctgcaccggg ttaaagtttt acgcgttgaa     46800
     cgtgcggaga aagccatcaa gactcagcaa gcttgcttgc aggcagctca tcgacgtcat     46860
     caagaggcgg tgcaaaccag tcaggattac catttgtggc gtattgatga ggagcaacgt     46920
     ctatttgatc agcgaaaaaa caccacactg aattgtaaag atttggagaa atggcagcga     46980
     caaatagcgt cgctacgtga aaaggaggcc aattatgaac tggagtgcgc caaattattg     47040
     gaacgtttag ccaatgagcg tgagcgcctt acgttatgcc aaaagatgct gcaacaggct     47100
     cgtcataagg aaaataagtt tctcgagcta gtgcgacgag aagatgaaga tgagttaaat     47160
     caacaacatt atcaggaaga acaagaacaa gaagagtttc tacagcatca caggaacgcc     47220
     taatgaataa aatcaccact cgttccccat tagaacctga gtatcaacct ctggggaagc     47280
     cgcatcatgc tttgcaagca tgtgtcgatt ttgagcaagc gctgttgcat aataataagg     47340
     ggaattgtca tcccaaagaa gagtcgctta aacctgtacg tccgcatgac cttggcaaaa     47400
     aagaaggtca gaaaggagat ggcttgcgtg cgcatgcgcc attagcggcg acgtctcaac     47460
     ccggaaggaa agaggtagga ttaaaacctc aacacaacca tcagaataat catgatttca     47520
     acttatctcc gcttgccgaa ggtgctacca atagagcgca cttataccag caggatagcc     47580
     gttttgatga ccgcgtagag agtattatta atgctctcat gccattggcg ccctttttag     47640
     agggggtgac ttgtgaaacg gggacatcaa gtgaatcccc ctgcgagccg tctggacatg     47700
     atgagttatt tgttcagcaa tcgcctatcg attccgctca accagttcaa ttgaatacca     47760
     agccgactgt tcagccattg aatccggctg ctgacggcgc agaggttatt gtatggtctg     47820
     tcggtaggga aactccggcc agtatagcaa aaaaccagcg cgatagcagg caaaaacgcc     47880
     ttgcagaaga accgttagct cttcatcaaa aagcattgcc agagatatgt cccccggcag     47940
     ttagtgccac accggatgat catttggtag caagatggtg tgctactcct gtgactgagg     48000
     tagcagaaaa atctgctcgt tttccgtaca aagcgacagt gcagtcagag caactggaca     48060
     tgaccgagct ggcggatcgg tcccaacatc ttactgatgg cgttgatagc agcaaagata     48120
     ccatcgaacc accgcgacca gaagaactgt tacttccgcg cgaagaaacc ttgccggaga     48180
     tgtattcctt gtcttttaca gcaccggttg tcacgccggg tgatcaccta ttagcaacaa     48240
     tgcgcgcgac caggctggca tcagtctcag agcaacttat acagttagca cagcgactag     48300
     cggtagaact agaactgcgc ggcggctcat cccaagtaac ccaattacac cttaacttac     48360
     ctgaattggg ggctattatg gttcgtattg ctgagattcc gggaaaactg catgtagaac     48420
     tgatcgccag tcgggaagct ttaagaattt tagcgcaggg aagttatgat cttcttgagc     48480
     gattacaacg cattgagcca acacaacttg attttcaagc tagcgatgac agtgaacagg     48540
     agtcacgtca gaaacgccac gtctatgagg agtgggaggc tgaagaatga gtttgttaac     48600
     cttgccacag gccaaattaa gtgaactgtc gctacgtcaa cggctcagcc attatcaaca     48660
     aaactacttg tgggaagagg gaaaactcga acttaccgtc tctgagcctc cttcgtcttt     48720
     gaactgtata ttacagttac aatggaaggg aacgcacttc acgctctact gttttggcaa     48780
     tgatctggct aactggttaa ccgccgactt actaggggct ccattcttta ctctgccgaa     48840
     agagttgcaa cttgcgctgt tggaacgcca gacagttttc ctgccgaaac tggtctgtaa     48900
     tgatatagcg acagcgtctc tttctgtcac gcaacctctg ttgagtttgc ggctgtcccg     48960
     agataatgcg catatctcct tctggctaac ctcagctgag gctctgttcg ctctgttacc     49020
     cgcacgaccc aattctgagc gcataccttt gcctatcctt atttctttgc gttggcataa     49080
     agtatacctg actctagatg aggttgattc ccttcgatta ggtgatgtgt tgttggcccc     49140
     tgaggggagt gggcctaatt cgccagtact cgcctatgtt ggtgagaacc cttggggcta     49200
     ctttcaatta caatcaaata aattggagtt tatcggtatg agtcatgaat ctgacgaact     49260
     taaccccgaa ccattgaccg atttgaacca acttccggtt caagttagct ttgaagtggg     49320
     gcggcaaatc ttagattggc acacactcac tagcctggag ccgggttctc ttattgatct     49380
     tacaacacct gttgatggtg aagtgcgctt gctggctaac ggccggttgc ttggacatgg     49440
     tcgattggtc gagatccaag ggcgcctcgg ggttcgaatt gaacgcctga cagaggttac     49500
     gatttcatga tccagttacc ggatgaaatt aatctcatca tcgttttatc tttgctgact     49560
     ctgcttccat tgatttcggt aatggctaca tcgtttgtca aatttgcggt ggtcttttca     49620
     ctactccgca atgcccttgg ggtacagcaa atccccccca acatggcaat gtatggctta     49680
     gcaatcatcc ttagtcttta tgtaatggca cccgttggct tcgcgacgca agactattta     49740
     caagctaatg aggttagcct cacgaacata gaatctgttg agaaattctt tgatgaaggg     49800
     cttgccccct atcgcatgtt ccttaagcag catattcaag cgcaagaata ctcttttttt     49860
     gttgacagca ctaaacagtt atggcccaag cagtatgctg accggttaga gtcagacagc     49920
     ctgttcattt tattgcctgc gtttacggtg agtgagttga ctcgagcatt tgagataggc     49980
     tttctcatct atttaccatt tatcgtcatt gacctggtta tttccaatat cttgttggca     50040
     atggggatga tgatggtttc ccccatgact atttcactgc catttaaatt gctgctattt     50100
     gttttacttg atggctggac acgactcacg catgggctgg tgattagcta cggagggtga     50160
     catgagtcaa ggtgacataa ttcacttcac cagtcaggca ttatggctgg tgctagtcct     50220
     ttcaatgccg ccggtgttag tggctgcggt ggtaggaact ttggtatctt tagtacaagc     50280
     tttaacgcaa atccaagagc aaactctggg cttcgttatc aaattgatcg ctgtggtggt     50340
     cacactgttt gctaccgcct cgtggcttgg taatgaattg cacagttttg cagaaatgac     50400
     catgatgaag atacaaggca taagatgata gcggatttaa tccaaagacc attgctcact     50460
     tataccctgc tgttgcctcg ttttatggct tgttttgtta tattgccagt gttaagtaaa     50520
     cagctcctcg gtggagtatt gctgcgtaat ggtattgtct gttcattggc tctttatgtc     50580
     tatcctgccg tcgctaacca accttatatt gaggttgatg cgtttacgtt gatgctgctt     50640
     atcggcaaag agatcatact ggggttattg attgggtttg tggccaccat tcctttctgg     50700
     gccttagaat ccgcaggatt tattgtagat aaccaaagag gtgccgcgat ggcatctcta     50760
     ctcaatcctg gacttgatag tcaaactagt ccgactggtt tacttttgac tcaaacgtta     50820
     ataacaattt tcttcagcgg aggggctttc ctctctttgc tttcagccct ctttcacagc     50880
     tatgtaaatt ggccggtggc cagctttttc cctgcagtta gtgaacagtg ggttgatttc     50940
     ttttataacc aattcagcca gatactatta atcgccgctg tattggctgc tcctttactc     51000
     atcgctatgt ttttagctga atttggactt gcactcatca gtcgttttgc gccttcttta     51060
     aacgtctttg tgctggctat gccgataaaa agcgcgatag caagcctgtt gttggttatc     51120
     tactgtatgc aaatgatgag tcatgccagt aaagcaatgc tgttggttat ggatcctata     51180
     agtttactga tccctgtttt ggagaagtaa tgagcggaga aaagacagag caacccaccc     51240
     cgaagaaaat ccgtgatgcg cgcaaaaagg gacaggtagc gaaaagtaag gaagtggtct     51300
     ctactgcgct tatcgtcgcg ctgagtgcga tgttaatggg gctttctgac tactatttcg     51360
     agcattttag taagctgatg ctaatccccg cagagcagag ctatcttcct ttctcgcagg     51420
     cgcttagcta tgtggttgac aatgtgttgc tcgagttttt ttatctctgt tttcctttgt     51480
     taacagtggc ggcattaatg gcgatcgcat ctcatgttgt gcagtatggt tttcttataa     51540
     gtggtgaagc aattaaaccg gatattaaaa aaatcaatcc aatagagggt gccaagcgta     51600
     tcttttccat caaaagttta gtggagtttc tcaaatccat tctcaaggtt gttttgctca     51660
     gtatactcat ctggataatc attaagggaa atctagtcac actcttgcag ttgccaacct     51720
     gtggaattga atgtattacc cctttattgg ggcaaatact ccggcagttg atggttatct     51780
     gtactgttgg ctttgtggtc atctccatag ccgactatgc ctttgaatac tatcaatata     51840
     ttaaggaact taaaatgagc aaggatgaga tcaaacgcga gtacaaagaa atggagggta     51900
     gcccagaaat caaaagcaag cgtcgtcagt ttcatcaaga gatccaatcg aggaacatgc     51960
     gggaaaatgt taaacgctca tcagtggtgg tagctaatcc gacccatatt gctattggta     52020
     ttctttacaa gcgaggggaa acaccactac cgttggtaac attcaaatat accgatgccc     52080
     aagttcagac tgtgcgcaaa atagcagaag aagaaggggt gcctatttta caacgtatcc     52140
     cattagcccg tgctctttat tgggatgcgc tcgtcgatca ctatattccg gctgagcaaa     52200
     tagaggccac agctgaagtg ctacgatggc tagaaaggca aaatatcgag aaacaacatt     52260
     ccgaaatgtt ataataggct gcaatgtaac taggaatatg gttaaaacag atgacatttt     52320
     tgttggtcta tactattttc tctactttct agtctatgtt tttatcggaa aaatggggtg     52380
     attaacaccg gctattggga atatgtaatt tattcgatat ggttaaccaa caagaggttc     52440
     acttatatta ggaatatatg atgcgattta aaaccatata tacagtatgg taattgtatt     52500
     tctcctgtgc attttacaat taaacataac tagcactaat taggattaat ctcttgactt     52560
     ttttttgttg aatacaaata atacagtatt gtcattacta ttacatgtgt ttgtttgctg     52620
     attccgattc taaccaaaca tcctttcttt atgaaagaaa ggatgtttgg ctttatatgc     52680
     gcaaggtgtg atattgcagt agctaaatta aatgagttcg tggtggaccc gttgagataa     52740
     ttgggaatgg gttgttattt tacaataata aatttcacca catattgcgc gaactcggat     52800
     tgctatcatc tagctatctt ctttgtgtga actcaaggga gggactggcg tgagtcgtat     52860
     tatagcactc atcatttctt ttctattagt ggggtgcgct acccccccaa tgccagctca     52920
     gcgtattgtg ggggaggtgc gtatgtcacg accattatct cgcatagcac acattgatgt     52980
     tagtatgttt gggttgtatg aggggaaagt tcgagaggtt cagcgcactc atttcgaaac     53040
     aggtaaccta cctttattct tttctataaa actgaatcca gctcaacgcg gggaaggtga     53100
     actttaccta cggtcaaccc tctcttttcc agagcgagga gttcaggcgg tggctcagca     53160
     aaagcttact ggtaaaaaca aagtcgtttt acaaatgata cctaaaacat gttatccaaa     53220
     ttgccagtta cctaatacca gataggtgat ttattatatt ggttttggtt gcattaatcg     53280
     atggttgtac atcgcacgca taataactca atacacctca ttagataaat atatacaagt     53340
     tttagatttt taggacagta taacatttat ggcatcacta gagattatta aattagaatg     53400
     ggtcacacct atatttaagg ttgttgagca ttcacaagat ggcctatata ttcttttgca     53460
     aggtcagatt tcatggcaga gcagcggtca gacatatgat ttagatgagg ggaatatgct     53520
     gtttttgcgt cgtggcagct atgctgttcg atgtggtaca aaagaaccct gccaattact     53580
     ttggattcca ttacccggca gttttttgag tacttttttg catcgctttg gttctttgct     53640
     tagtgaaatt ggacgagaca actccacacc caaaccattg ttaattttta atatttcacc     53700
     aatattatca caatccattc aaaatctatg tgccatattg gaacggagtg attttccgtc     53760
     agtattaacg caactgcgta ttgaggaatt actgcttttg cttgccttta gctcgcaagg     53820
     gactttattt ctctcggctc tgcgccattt aggcaaccgc ccagaagaac ggttgcaaaa     53880
     atttatggag gaaaattatc tacaagggtg gaagctaagc aaatttgcgc gagaattcgg     53940
     catgggatta accacattca aagaactgtt tggtacagtt tatggcattt caccacgcgc     54000
     ctggataagc gagcgacgta ttctctatgc tcaccaatta cttcttaatg gtaagatgag     54060
     tattgttgat attgccatgg aagcggggtt ctcgagtcag tcttatttca ctcaaagtta     54120
     tcgacgtcgc ttcggatgca ctccaagcca agcccgtctt actaaaatag caaccacagg     54180
     ctaaaattat ctgtgttttt tttaaaagac acttttggac tataaagtaa aatacgggat     54240
     tagattgtga agattcaatg ggatgagcca aatttcaacg aaacatagaa cagtattgtt     54300
     tcgccgctgg atggcaataa tatgttgttt aataatcaat atggcttatc tggtttatta     54360
     agtgcggtgg cgcaagaaac gacctccatc aaatagagca agtctcatta gttcgattaa     54420
     cgtaatatca tctattgcta tacaggtggt tgataattat cacgaacatt tttttgaata     54480
     tctggaagtt tgagctgaac cgcgaaacct tatgtcacga tgacatgaag taggttattt     54540
     atttggcgca ggattactta gtttatatat aaccatctga gaaataatgc aaaatttact     54600
     aaaaaacttg gcggccagtt taggaagaaa accgtttgtt gccgataaac aaggtgttta     54660
     ccgtttaact atagataagc atcttgtcat gctggctccg catggttcag aactggtatt     54720
     acgcactcct attgacgcac caatgttacg tgaaggaaat aacgttaacg tcacattgct     54780
     tcgctcccta atgcaacaag cgttggcatg ggctaaacgt taccctcaaa ctttagtatt     54840
     ggatgattgt ggtcaattgg tactggaggc gcgtttacgt ctacaagagc ttgatactca     54900
     cggattgcaa gaagtaataa ataaacaact ggctctgcta gaacatttaa ttcctcagtt     54960
     aacaccattt tctgtagcgt ctcgcgtggg gtggaattaa gtaatatggc ttttccgcta     55020
     cattcttttt tcaagcgcgt actcaccggg acgttactgt tactttctaa ctatagctgg     55080
     gcgcaagaac ttgattggtt gcctatacct tatgtttatg tggcgaaggg ggaaagttta     55140
     cgcgatttat taattgattt cagcgctaat tatgatgcta cagtggtagt aagcgataag     55200
     attaatgaca aagtttccgg ccagtttgag catgataacc ctcaggattt cctacagcat     55260
     attgcctccc tttacaattt ggtttggtac tatgatggca atgtgctcta catttttaaa     55320
     aatagtgagg tagcgtctcg tctcattcgt ttacaggaaa gtgaggccgc agagttaaag     55380
     ctggcattac aacgttctgg tatatgggag cctcgttttg gctggcgccc tgatgctagc     55440
     aaccgccttg tttacgtctc tggtcctcct cgttatcttg aattggttga acagaccgca     55500
     gccgcattgg aacaacagac gcaaattcgc agtgaaaaaa caggggcatt agcgattgag     55560
     attttccctc tcaaatatgc atcagcgagc gatcgaacta ttcattaccg tgatgacgaa     55620
     gtggctgctc ctggggttgc aacgatactt caacgcgtgt taagcgatgc cacaatccaa     55680
     caagtgacag tggataatca gagaataccg caggccgcta cccgggcttc agctcaagcc     55740
     aaggttgaag cggatccatc gctcaatgcg ataatagtgc gcgattctcc tgagcgtatg     55800
     ccaatgtatc aacggttaat tcatgcgctt gataaaccta gcgctcgtat tgaagtggcg     55860
     ttatccattg tcgatataaa tgccgaccaa cttactgaat taggtgtgga ctggcgagtt     55920
     ggcattcgta ctggcaacaa tcatcaggtg gtaataaaaa caaccgggga tcaaagtaac     55980
     atcgcttcaa acggtgcatt gggtagtttg attgatgctc gcgggcttga ctacctatta     56040
     gcaagagtca atttacttga aaatgaaggt tcggctcaag ttgtttcacg tccgaccctg     56100
     ctaacacaag aaaatgccca agcggtgatt gatcaccatg aaacctatta cgtcaaagtg     56160
     acaggtaaag aagtggctga actgaaaggg atcacctacg gcactatgct gcgtatgaca     56220
     ccaagggtgc tgactcaagg agataagtca gaaatcagtc tcaatctaca cattgaggat     56280
     gggaaccaaa aaccgaatag ttcagggatt gacggaatcc ccactatcag tcgtacggtc     56340
     gttgatactg tcgctcgcgt gggacatggc cagagtttga ttattggtgg tatttatcgt     56400
     gacgaattga gtgttgctct tagtaaggtg cctttgcttg gtgatattcc ttatcttggc     56460
     gcacttttcc gccgtaaaag tgagttaact cgccgtacgg tacggctgtt tatcatcgaa     56520
     ccacggatta ttgacgaagg tattgcgcat catttagcgt taggtaatgg tcgggatcta     56580
     cgtactggta tcttagctgt tgatgaaata tctaatcaaa gtactacctt gaataagtta     56640
     ttaggtgtct cccagtgtca gcctttaaac aaagcgcaag aagtgcagaa atggctgagt     56700
     caaaacaata aatcatccta tcttactcag tgcaagatgg acaaaagttt gggatggcgc     56760
     gtggttgaag gtgcttgtac tcccgcggaa tcatggtgtg tttcagcgcc taagcgtggc     56820
     gtattgtgag ttgggtctgt cgtttttatc aagggaagca ccgtggtgtt gaagttgagc     56880
     ttcctcatgg gcgctgtgtt tttggttcag acccgttgca gtcagatatt gttctttctg     56940
     acagcgaaat agcacccgtg catttagtgc tgatggtcga tgaagaaggt attcgcctaa     57000
     ctgattctgc agaacctcta ctacaagaag ggcttcccgt gccgttgggg actcttcttc     57060
     gcgcgggctc ttgtctggaa gtaggttttt tactgtggac atttgtcgcc gtagggcaac     57120
     ctttgccaga gacgttacag gttcccacgc agagaaaaga gccaaccgac aggttacctc     57180
     gttcacgact tgggattggg cttggagttc tttctttatt gttgcttttg acttttttgg     57240
     ggctgctagg gcacggattg tggcgcgagt ataaccagga tggacaactt gttgagcaag     57300
     aagtacggcg cttgctggca actgctgctt acaaggatgt cgttttaaca tcgcccaaaa     57360
     aagagggtga accttggtta ttaactggtt atatccagga taatcatgcc cgcttgtcac     57420
     tgcaaaattt tcttgagagc catggcattc cattccggct tgaactgcgc agcatggaag     57480
     aactgcgtca gggggcagaa ttcatcctgc aacggttggg ataccatgga attgaggttt     57540
     ctttagcacc gcaagcggga tggctacaat tgaatgggga agtgtcagag gaaatacaaa     57600
     agcaaaaaat tgatagcctg ctgcaagctg aagtgccagg gctgctcggt gtagaaagta     57660
     aagtgcggat tgccggtaat caacgcaagc ggcttgatgc attacttgaa caatttggtc     57720
     tggattcaga tttcactgta aatgttaaag gtgagctgat tgaattacgc gggcaagtca     57780
     atgatgaaaa attgaattca tttaatcaac tacaacaaac ttttcgccaa gagtttggca     57840
     atcgacctaa attagaactg gtcaatgtcg gggggcaacc ccagcatgat gaattgaatt     57900
     tcgaggtgca agctatctcg ttagggaaag tgccctatgt ggtactcgac aatcatcaac     57960
     gctatccaga aggtgccata cttaacaatg gcgttcgtat tctggctatt cgacgcgatg     58020
     cggtgattgt gagtaaagga aaacgggaat ttgtgatcca actcaatgga ggtaaacctc     58080
     gatgacacaa ttagaggagc aactgcataa cgtggagaca gtgcgctcta tcaccatgca     58140
     actagaaatg gcactaacta agctcaaaaa agatatgatg cgcggtggtg atgccaagca     58200
     gtatcaggtt tggcagagag aatctaaagc tcttgagtca gctatagcca ttattcatta     58260
     tgtagcagga gacctaaaat aaatgagtaa cttctctgga tttacgaaag gaaccgatat     58320
     cgcagactta gatgcggtgg ctcaaacgct caagaagcca gcagacgatg caaacaaagc     58380
     ggttaatgac tcgatagcag cattgaaaga taagcctgac aacccggcgc tacttgctga     58440
     cttacaacat tcaattaata aatggtcggt aatttacaat ataaactcaa ccatagttcg     58500
     tagcatgaaa gacttaatgc aaggcatcct acagaagttc ccataatatg aaatataaac     58560
     tcaacgtact gttagcagag attgctctga ttggaaccgg caaccactgc cacgaagaag     58620
     cgaattgcat tgctgaatgg ttacatttga aaggtgaaga agaggcggtt caattgattc     58680
     gcctttcctc tttgatgaac cgtggggact acgcaagcgc cttgcaacaa ggaaataaat     58740
     tagcttatcc tgatttggaa ccttggttag ccttatgtga atatcgcctc gggttgggga     58800
     gcgccttaga gtcacgttta aatcgtctcg caaggagtca ggatcctaga atacagacat     58860
     ttgtgaatgg aatgagggag caactaaaaa catgacggtt acccttaata gaggttccat     58920
     tacatcgttg atgtcttcgt ctcaggcagt ctctacgcta caaccggtag catctgagct     58980
     gaaaacacaa ctggagaata agctaaaaag tgaatccgct gaaaagacac gggaagttct     59040
     gtggcagcaa tattatgcca gtaaccctcc tgaccatgcc gttcttgagg ttttggcgat     59100
     gccagtacgt gaggcgttac tggcgcgttt cggtcaacat caagggtctg ttgtaccggc     59160
     tatagattta cctgaattgc gtagtgtatt gcagcagttt gactcgtttg gtaagcggtg     59220
     ggaagcaata ttgctccaag tattagaggg tataaaaccc aatgagagcc aggttggatt     59280
     accttattta tcagagttaa taaataaaga attaatgatc ctattaccgt ctaactcgat     59340
     tgtagatagc ctacttcata acagccatca aattgatatg gatacataaa tgccgaacat     59400
     agaaatagct caggccgatg aggtgatcat aaccacgctg gaggaattag ggccggcaga     59460
     gccaacaact gaccaaataa tgcgctttga tgcggcaatg tcagaagata cgcagggact     59520
     gggccattca ctcctcaagg aggttagtga tattcagaag tcttttaaga cggttaaaag     59580
     tgacttacac actaagctgg ctgtttcagt tgataatccc aacgacctga tgctaatgca     59640
     atggtcactt atccgtataa caatccaaga agaacttatc gccaagactg ccgggcgaat     59700
     gagccaaaat gttgaaacct tgtcgaaggg ggggtgaaaa ctagtgaaag ttaagacttc     59760
     actgtcaaca ttgatattaa tcttgttttt aactggttgc aaagttgatc tttataccgg     59820
     aattagtcag aaggaaggga acgaaatgct tgcgctgttg cgccaagaag gcctttccgc     59880
     agacaaagag ccagacaaag atgggaagat taagctcttg gttgaggagt cagatgtcgc     59940
     tcaggctatt gatattctca aacggaaggg ctatccacac gagagtttct ccacgttaca     60000
     ggatgtgttc cccaaagatg ggttgatatc ttcaccgata gaagagttgg cgaggcttaa     60060
     ttatgccaag gcgcaagaga tctcccgcac tttatctgaa attgacgggg tattagtggc     60120
     tcgagtgcat gtcgtattgc ctgaagagca aaataacaaa ggtaagaagg gtgtagcagc     60180
     atccgcttcg gtttttatca agcatgcagc agatattcag tttgatacct acatacctca     60240
     gattaaacaa ttagtgaata atagtattga ggggctggcc tatgatcgca tcagtgtcat     60300
     tttggtgcca tcggtagatg ttcgtcaaag ctctcattta cctcgtaaca cgagcatact     60360
     gtcaattcaa gtgagtgaag agtcaaaagg gcatcttatt ggcttgttgt cgttgcttat     60420
     tttgcttttg ccagtgacca atcttgctca atatttttgg ttacaacgca agaagtgatg     60480
     atggaaaatt atattacctc ttttcaattg cgcttctgcc ccgcggctta tttgcacttg     60540
     gaacagttac catcattatg gcgttcaata ttgccctact tacctcagtg gcgcgatagt     60600
     gctcatctca atgctgcttt attggatgaa ttttctcttg ataccgacta tgaagagccc     60660
     catgggctgg gggcgctgcc tttgcagcct caatcacagc tcgaactgtt actttgtcgc     60720
     cttggattag ttctgcatgg ggaggcgatt cgccgttgtg tactggcctc cccattacaa     60780
     caattattga cattggttaa tcaagaaaca ttaaggcaaa ttattgtaca gcatgagctg     60840
     ctaatcgggc cttggcccac tcactggcag cgcccgctgc caacagaaat agagagccgt     60900
     accatgatcc agtcggggct ggctttttgg ttagcagcaa tggaacccca acctcaggca     60960
     tggtgtaaac ggctcagttt acgcctccca ttagctacgc cgtcagaacc ttggttagtg     61020
     gccgagtcac aacgcccact ggcccaaact ttatgtcaca aacttgtcaa acaggttacg     61080
     cctacatgca gccatttgtt caaataatac caagtaatct ctcgctcgct tgcggtctgc     61140
     gtattttgcg cgccgaagat taccaatcca gtttaacaac cgaagagttg attagtgccg     61200
     caaaacagga tgctgaaaag atcctggctg acgcccaaga ggtttatgag caacaaaagc     61260
     agttaggatg gcaggctggc atggatgagg cgcgtacctt acaggcgact ttgattcatg     61320
     aaacacagtt acaatgtcag caattttatc gccacgtcga acaacagatg agtgaagttg     61380
     tacttttggc ggtacgtaaa atcctcaatg actatgatca agtggctatg acactgcaag     61440
     ttgtgcggga ggctttagcc ttggtgagta atcagaagca agtcgtggtc agggtcaacc     61500
     ctgatcaggc aggagctatt cgtgaacaaa tagctaaagt acataaagac ttcccggaaa     61560
     taagctattt agaggtgact gccgatgcgc gtttggatca agggggctgt atattagaga     61620
     ctgaggtagg tattattgac gcgagtattg atgggcaaat tgaagcactt tctcgggcaa     61680
     tatctaccac tttaggacaa atgaaagtta cagaatagga ataactatcg atatatgttt     61740
     agtgttatct attataagat tgagttatct acctaaattg gatttttcat cctcgtttta     61800
     tgagaatgat tcccaagaat aattttttat tgtgattttc tgtttaaaag ccgattaaaa     61860
     aaataaatcg tctacgacag tagtttagca aaaataaata acttagaata tcgtagagac     61920
     aattatagcg acaggagact cgatgaaaat caatactctt caatcgttaa taaatcaaca     61980
     aattacccaa gtgggacacg gggggcaggc cggtcgtctc actgaaacta acccactcac     62040
     agagaatagt catcagatat ctaccgccga aaaagccttt gccaatgagg tgctggaaca     62100
     tgtgaaaaat acggctctca gtcgtcacga tattgcctgc ttattaccac gcgtttctaa     62160
     tttggaacta aagcagggca aggcagggga agtgatagtg accggcttgc gtactgaaca     62220
     actctcgctt agcgatgcta aattattgct agaagccgcc atgcgccagg atacggcggc     62280
     tgacggctga gataatatat atctactgta tattgaggca ataatatccc ccaggttgat     62340
     ttacgtaacc atttttcaag gagtcatgta tcaattcttt cccctgagcc aatttagaat     62400
     aataatacgc ctccttcggt gatcccctga agtgggggta tttatcagta gagtctgctc     62460
     ctcatataaa ttgagagaat taggatgaaa gatcacattg tagcgactgc cgggttatgg     62520
     ttattttgat gtcatctcag tcaatattcg ttgctatctc tggtattcct gcattaccag     62580
     tgggctagct gaccttattg ctaataaata gggtttgggg ggatggatac tttatatttt     62640
     tacgccatgc cggcggggca ttggaattaa aaacgtattt atctaaatga taattagttt     62700
     aaattacatt tgcgtattga aatgaataac gcattattaa cgtattgtcc actccccgtt     62760
     atcttgtagt cccccctgaa tttagtctta tcgtttaatg gagttctctg gttaatatat     62820
     aatcagcgga ggtcattatg aagaaagcac gttttactga aactcagatc ctgcgggttc     62880
     taaaagaagt tgaaggtggc cggcatgtga aggatgtctg tcgcgagaac ggcggatctg     62940
     aagccagtta ctacaactgg aaatccaaat atggtggcat ggagtcctct gatataaagc     63000
     gaatgaaaga gcgggaagag gaaaaccgac gattaaagca gatgtatgcc tctctgagtt     63060
     tagatcatga aattcttaag gatgtcgtgg caaaaaaact ttaacggtac ctgaaaagcg     63120
     cgaactggtg cgttacgtga tgacggaata tcaggccagt gaacggcgcg ggtgccggat     63180
     tatgggtatc agtcgaagtt tgctgcatta ttgtcctaac accgcgaggg atataccggt     63240
     tgttgaggta ttacaaaaat tggcacatca atatccggca tatggctttg gtcttatgtt     63300
     caataagtta cggcagtctg gattaccgtg gaatgtaaaa cgggtatatc gcgtttatcg     63360
     cttactgaag cttaactttc ggcgaaaagg taaaaagcgc ctgcccaatc ggcatccaca     63420
     acctttggct attccactta aaatgaacca ctgctggtca gtcgatttta tgagtgatgc     63480
     cctgccagac ggtcggaggt tcagattatt caatgtagtg gagattttaa ccgggaagca     63540
     ctggcaattg aaattgactt gaatataccg gtacaccgag tggtccgtat tttggagcga     63600
     ttaagtacag aaagaggcta tcctgctttt atacggagtg ataacggtcc agaatttatt     63660
     gctgcagcac tggttgaatg ggcagaacat cacggagtga tacttgatat gtatttgttc     63720
     cgttcactgt ccgaagtccg tacgcttaca gaagactggc gaacgaacgc ccgcatagct     63780
     cactgggtaa tatgccaccc gttatctatg caagacaaaa actggatgga gatcctcact     63840
     ggcggtggta ctaaaaatag gagggactac atacacactg ggaaaatctc aataccttct     63900
     tcggctatcc gcccgatatc cgcaaggcca tctacaccac gaatgccatt gagtcactga     63960
     acagtgtgat ccggcaggcg ataaagaaac gcaaagtatt cccgacggat gactcggtgc     64020
     gggaggttat ttatctggct atccgggatg cttcgaaaaa atggagcatg ccaatacaaa     64080
     actggcggtt ggcaatgagt cgttttatta tcgagttcgg tgaccgtcta aacgatcacc     64140
     tttaatacag tggcgattac acagaattat agacaggctc gtttggttac ataaagtaga     64200
     cacataactt ttaattttgt tgtttatatt tttgttaaaa attattctac agcagataaa     64260
     cctcaactaa ttgcttactt tagttgaggt ttaaagtttc tttgattggc aaagtggtgt     64320
     atatctctta gtaattttat ttactcatag gaataaatat ttacattagc tatttaataa     64380
     tggtcgccct tgtccttcag ccaacttaat cagaacatca agttgctcat ctttttgtac     64440
     cataatacca tttctttgta ctcgcatttg gctgaccata tcttctacgc ttaactgact     64500
     attacgacta tcattcatgc acattgcgcc aatcagttgc gcagtacggc caacacccgc     64560
     acggcaatgt attaccggcc gtaatttgga gtcatctcct accgctgaac ttcctttgct     64620
     ttcatacata ttgcgttttg tttctgctgt ttgatctacc agtgaagcga gtgccttggt     64680
     aacttcagag ctgactgcgg tctgatcggg ccaattgcca acatgaacca caggaacaga     64740
     gattgttttt tgacccgctt cacgaatcgt taaagtatac atatctgcca taatcccgtc     64800
     accgagacca acttgctgag tcattttaga ctctacagtg atactgccat aggtaccact     64860
     ctggcggaaa taatctggca taccgaatct ttgattggct atctcagaac tggacgctaa     64920
     aacagccaac actggcgttc ggttttctgc cagcatacgg aaatggcttt caagttgaga     64980
     ttgtagcgga tactggcacg ctatggtacg agtgttaccg acctggatgt aattggcatt     65040
     aagatcggcg cgtactgcgg tttgccgaca gcattgaata tctctaaatc ggtttagctt     65100
     ttcaccgccg caggcttgta agtaacgcgg atcattcgtt gctggcgcca gcgtattgcg     65160
     caatgtggtg aggcggctgc tgagttctgc gcgcgcttct gggccataag gagaaacagt     65220
     gcttggtgcg gtggctctgg cttcgccagc cccgtgatgg ccagaagtgt gtggtcgttc     65280
     acgcggtggc aacggtggag ttctggggtc tagatgtgaa cgcagtcctt cacgcaccgg     65340
     ggttcccggt gcgtgaaggg ctgaatgtga atgagatgat acatgccccc tcgctcccga     65400
     ctcttgtcgc aatgcggcct ccaacagcac tttggcgtct tgtagtgtca tttggtcact     65460
     acgtaaactg acaagtacac tattaccatt gccgacactt cttaagtcat aattattcaa     65520
     attatgcttt accgtacttt gcaatagctt agcggtatct tcttgagtta gaacaacatt     65580
     tgctacgtgg cttagtacag tttgagcaaa tactttttct gactctctgg caccactggc     65640
     tatggtcaaa ccttgaaagg tagtttcttt attggcagca acgttacctc ttaatttccc     65700
     ggtacaatca ccgctctctt gctgcaccaa tcgagatacc tgacgatgaa gatcgcttaa     65760
     tgataagttc atgcttccct ccttaattaa atacacgcct atactataaa cataaaaaat     65820
     attttttctt ataatgctag tcgtattatt ttaataatag gtgagccgtg tattttcatt     65880
     aatgttaatc gaattattat agtgttcgtt agttttttgg cttttcccat aagatatata     65940
     ctcattgtta ccttaaattt tttaaaaaat taagcgggaa cagatggtaa tactgtaacc     66000
     gaacggtgaa ctcgcgttgc tcgattaaaa taatgcaata agctggcggg gtaacaacca     66060
     gttcttgcgg cctacggcca ccggacggat gcagttttcc gtgcgattat cttgagggtc     66120
     tcaatctacg ttcgaaacgt ccacggcggc atgtgacaac gaggcacagg cacgcacgtc     66180
     cagaagtgac cgcgttagat cagtgctgga gcatggattt cgttgctgat aatctgttca     66240
     acgggcatcg ggtcagggcg ctaactatag tggataattt tagtcgtgaa tgtctggcgc     66300
     tcgaggtcgg tcaggggtta cgtggagatg atgttgtggc tgtcatggac agattaaaac     66360
     attcgctggg gcgtattcca caaaggctgc agacagataa cggcagcgaa ttcatctcga     66420
     agtcgatgga ccgatgggcg tatgaaaaca gggtcacgat ggacttttca cgccccggaa     66480
     agcctacaga taatgccttt atcgagtcat ttaatggcag tctgagggat gaatgtctga     66540
     acgtgcacgg gttcctttct ctggaagatg ctcaggagaa aattgaacaa tggcggcaag     66600
     aatataatca ttttcgtccg cattcttcgt taaataacct gactccggca gaatttgccc     66660
     gaagtcatca aaaaggtccg gatctctgat ttagcctggt acggatattg gggagggatc     66720
     agcgatgaga tgtctggaat ggtttttgtc tgctgtttta tggacaattt tttccatctg     66780
     atgtcgttta tttctgggta tcggtgctat gatcggcata actcagtccg gttgtggtga     66840
     tttgggatat tcagcgattg atcagatcgc ttaaaccgga ttgagttccc tcagtgatct     66900
     actatttggc gcagttattt aggagctgta tttcgctgaa tactacccgt tcataagcaa     66960
     taatatctaa taacctgatt tgtgcgttct gcacaaataa cgtaaacccg agaaatgccc     67020
     gtactgtgat tttttaacgc tttctttttc ggccattgga agaagttact atttagagct     67080
     tctgctagcg gctcatacca cccgtactct agcagcgctg aaactggggt gacggaaaaa     67140
     tctgggattc cggcgtagaa ccccagttaa tctgtttctt cacaggcagg caatccgaag     67200
     cgtctatgtt ggtgaccatg agccagaaag aactgaaccg tattcccata ctggagcaag     67260
     atttccaaaa tacattatac tttgagaagt gttttatatt cagctattct ctttttatgt     67320
     accgaaactg ataattcctt tccatctaca atggatttat tgttatcaaa tctattaacg     67380
     atggtttcat tttttttgtt aacaacagta ccaactccct gcgggttagt atttaaatat     67440
     tcattaagac gttttttacc ttgagtatgt ttgtaaaaag ttaccgggag atacgggtcc     67500
     aacttatcgt ggggtaaagg attttcacca tcacttaata taccttttat attatcttca     67560
     tgtattttca acaggctatc tctctcgatg taaagttttt ttgccagtgc aaaactaaaa     67620
     ataccacatt cagatgagct tcgctgaata tccatttcca ccatggagaa atggcaatca     67680
     ggtaattgat aacgttcaat agccgttttt gtccttattg ccagcatcgc tggccccata     67740
     ctgttaaagt ttgctggttc aaacaatatc agagatgttt tcccatttat atgtttgtaa     67800
     tcaattacac tgaaatgtat tccaccttcc cccatgttaa ttatgaagcg ggaagatcta     67860
     actccatttt ctatgacgtt ttttatttct attgaaaggt ccaatggaga tgtaacaaga     67920
     ttaagattca tttccggata tttattgttc gcctggatta ccaatgcggg catgacttct     67980
     acatccatac gtgaataatt tttatggaac caggatccat ccgatatatc agtttccaac     68040
     tgtgttatga tatttttaag ctcttcatta ctgattaaag aactggtctc tttttctgat     68100
     aagccaccgg agatatttat ttgtgatatt ggtccgatca tttatttatc cttattcagg     68160
     gaattaacag cggtatgaat tttatattcc agataaacgg tacattgcaa taagacgttc     68220
     aatcgttgat gggtgaaccc ggaacagacg ggcagcactc gaacaaaaat tcccaataac     68280
     tcctatcata cctatacatt ggatatttct gcgaaaaagg aaaatttgat agcatcaaaa     68340
     attttctcta ttacacattc cagattaata ttctccggta gagaaacttg ttgagattaa     68400
     tactggaaat tttcatttgt atatataacg tattttttgt gttacgtatt tttaataaga     68460
     aaataattat tgttaagcaa ttgccaaatc ttaacctatt ctcggatata tcaactcaag     68520
     gctta                                                                 68525
//

If you have problems or comments...

PBIL Back to PBIL home page