(data stored in ACNUC1104 zone)

EMBL: BX950851

ID   BX950851; SV 1; circular; genomic DNA; STD; PRO; 5064019 BP.
XX
AC   BX950851;
XX
PR   Project:PRJNA350;
XX
DT   01-JUL-2004 (Rel. 80, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Erwinia carotovora subsp. atroseptica SCRI1043, complete genome
XX
KW   complete genome.
XX
OS   Pectobacterium atrosepticum SCRI1043
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Pectobacteriaceae; Pectobacterium.
XX
RN   [1]
RP   1-5064019
RA   Bell K.S., Sebaihia M., Pritchard L., Holden M., Hyman L.J., Holeva M.C.,
RA   Thomson N.R., Bentley S.D., Churcher C., Mungall K., Atkin R., Bason N.,
RA   Brooks K., Chillingworth T., Clark K., Doggett J., Fraser A., Hance Z.,
RA   Hauser H., Jagels K., Moule S., Norbertczak H., Ormond D., Price C.,
RA   Quail M.A., Sanders M., Walker D., Whitehead S., Salmond G.P.C.,
RA   Birch P.R.J., Barrell B.G., Parkhill J., Toth I.K.;
RT   "The genome sequence of the enterobacterial phytopathogen Erwinia
RT   carotovora subsp. atroseptica SCRI1043 and functional genomic
RT   identification of novel virulence factors";
RL   Unpublished.
XX
RN   [2]
RP   1-5064019
RA   Sebaihia M.;
RT   ;
RL   Submitted (18-FEB-2004) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   ms5@sanger.ac.uk
XX
DR   MD5; b92db145572668af136c2e87acee356a.
DR   BioSample; SAMEA1705920.
DR   EnsemblGenomes-Gn; EBG00000000748.
DR   EnsemblGenomes-Gn; EBG00000000749.
DR   EnsemblGenomes-Gn; EBG00000000750.
DR   EnsemblGenomes-Gn; EBG00000000751.
DR   EnsemblGenomes-Gn; EBG00000000752.
DR   EnsemblGenomes-Gn; EBG00000000753.
DR   EnsemblGenomes-Gn; EBG00000000754.
DR   EnsemblGenomes-Gn; EBG00000000755.
DR   EnsemblGenomes-Gn; EBG00000000756.
DR   EnsemblGenomes-Gn; EBG00000000757.
DR   EnsemblGenomes-Gn; EBG00000000758.
DR   EnsemblGenomes-Gn; EBG00000000759.
DR   EnsemblGenomes-Gn; EBG00000000760.
DR   EnsemblGenomes-Gn; EBG00000000761.
DR   EnsemblGenomes-Gn; EBG00000000762.
DR   EnsemblGenomes-Gn; EBG00000000763.
DR   EnsemblGenomes-Gn; EBG00000000764.
DR   EnsemblGenomes-Gn; EBG00000000765.
DR   EnsemblGenomes-Gn; EBG00000000766.
DR   EnsemblGenomes-Gn; EBG00000000769.
DR   EnsemblGenomes-Gn; EBG00000000770.
DR   EnsemblGenomes-Gn; EBG00000000772.
DR   EnsemblGenomes-Gn; EBG00000000773.
DR   EnsemblGenomes-Gn; EBG00000000774.
DR   EnsemblGenomes-Gn; EBG00000000775.
DR   EnsemblGenomes-Gn; EBG00000000776.
DR   EnsemblGenomes-Gn; EBG00000000777.
DR   EnsemblGenomes-Gn; EBG00000000778.
DR   EnsemblGenomes-Gn; EBG00000000780.
DR   EnsemblGenomes-Gn; EBG00000000781.
DR   EnsemblGenomes-Gn; EBG00000000782.
DR   EnsemblGenomes-Gn; EBG00000000783.
DR   EnsemblGenomes-Gn; EBG00000000784.
DR   EnsemblGenomes-Gn; EBG00000000785.
DR   EnsemblGenomes-Gn; EBG00000000786.
DR   EnsemblGenomes-Gn; EBG00000000787.
DR   EnsemblGenomes-Gn; EBG00000000788.
DR   EnsemblGenomes-Gn; EBG00000000789.
DR   EnsemblGenomes-Gn; EBG00000000790.
DR   EnsemblGenomes-Gn; EBG00000000791.
DR   EnsemblGenomes-Gn; EBG00000000792.
DR   EnsemblGenomes-Gn; EBG00000000793.
DR   EnsemblGenomes-Gn; EBG00000000794.
DR   EnsemblGenomes-Gn; EBG00000000795.
DR   EnsemblGenomes-Gn; EBG00000000796.
DR   EnsemblGenomes-Gn; EBG00000000797.
DR   EnsemblGenomes-Gn; EBG00000000798.
DR   EnsemblGenomes-Gn; EBG00000000799.
DR   EnsemblGenomes-Gn; EBG00000000800.
DR   EnsemblGenomes-Gn; EBG00000000801.
DR   EnsemblGenomes-Gn; EBG00000000802.
DR   EnsemblGenomes-Gn; EBG00000000803.
DR   EnsemblGenomes-Gn; EBG00000000804.
DR   EnsemblGenomes-Gn; EBG00000000805.
DR   EnsemblGenomes-Gn; EBG00000000806.
DR   EnsemblGenomes-Gn; EBG00000000807.
DR   EnsemblGenomes-Gn; EBG00000000808.
DR   EnsemblGenomes-Gn; EBG00000000809.
DR   EnsemblGenomes-Gn; EBG00000000810.
DR   EnsemblGenomes-Gn; EBG00000000811.
DR   EnsemblGenomes-Gn; EBG00000000812.
DR   EnsemblGenomes-Gn; EBG00000000813.
DR   EnsemblGenomes-Gn; EBG00000000816.
DR   EnsemblGenomes-Gn; EBG00000000818.
DR   EnsemblGenomes-Gn; EBG00000000819.
DR   EnsemblGenomes-Gn; EBG00000000820.
DR   EnsemblGenomes-Gn; EBG00000000821.
DR   EnsemblGenomes-Gn; EBG00000000822.
DR   EnsemblGenomes-Gn; EBG00000000823.
DR   EnsemblGenomes-Gn; EBG00000000824.
DR   EnsemblGenomes-Gn; EBG00000000825.
DR   EnsemblGenomes-Gn; EBG00000000826.
DR   EnsemblGenomes-Gn; EBG00000000827.
DR   EnsemblGenomes-Gn; EBG00000000828.
DR   EnsemblGenomes-Gn; EBG00000000829.
DR   EnsemblGenomes-Gn; EBG00000000830.
DR   EnsemblGenomes-Gn; EBG00000000831.
DR   EnsemblGenomes-Gn; EBG00000000832.
DR   EnsemblGenomes-Gn; EBG00000000833.
DR   EnsemblGenomes-Gn; EBG00000000834.
DR   EnsemblGenomes-Gn; EBG00000000835.
DR   EnsemblGenomes-Gn; EBG00000000836.
DR   EnsemblGenomes-Gn; EBG00000000837.
DR   EnsemblGenomes-Gn; EBG00000000838.
DR   EnsemblGenomes-Gn; EBG00000000839.
DR   EnsemblGenomes-Gn; EBG00000000840.
DR   EnsemblGenomes-Gn; EBG00000000841.
DR   EnsemblGenomes-Gn; EBG00000000842.
DR   EnsemblGenomes-Gn; EBG00000000843.
DR   EnsemblGenomes-Gn; EBG00000000844.
DR   EnsemblGenomes-Gn; EBG00000000845.
DR   EnsemblGenomes-Gn; EBG00000000846.
DR   EnsemblGenomes-Gn; EBG00000000847.
DR   EnsemblGenomes-Gn; EBG00000000848.
DR   EnsemblGenomes-Gn; EBG00000000849.
DR   EnsemblGenomes-Gn; EBG00000000850.
DR   EnsemblGenomes-Gn; EBG00000000851.
DR   EnsemblGenomes-Gn; EBG00000000852.
DR   EnsemblGenomes-Gn; EBG00001046695.
DR   EnsemblGenomes-Gn; EBG00001046703.
DR   EnsemblGenomes-Gn; EBG00001046706.
DR   EnsemblGenomes-Gn; EBG00001046707.
DR   EnsemblGenomes-Gn; EBG00001046711.
DR   EnsemblGenomes-Gn; EBG00001046715.
DR   EnsemblGenomes-Gn; EBG00001046726.
DR   EnsemblGenomes-Gn; EBG00001046731.
DR   EnsemblGenomes-Gn; EBG00001046732.
DR   EnsemblGenomes-Gn; EBG00001046734.
DR   EnsemblGenomes-Gn; EBG00001046737.
DR   EnsemblGenomes-Gn; EBG00001046739.
DR   EnsemblGenomes-Gn; EBG00001046742.
DR   EnsemblGenomes-Gn; EBG00001046745.
DR   EnsemblGenomes-Gn; EBG00001046751.
DR   EnsemblGenomes-Gn; EBG00001046755.
DR   EnsemblGenomes-Gn; EBG00001046759.
DR   EnsemblGenomes-Gn; EBG00001046765.
DR   EnsemblGenomes-Gn; EBG00001046771.
DR   EnsemblGenomes-Gn; EBG00001046777.
DR   EnsemblGenomes-Gn; EBG00001046787.
DR   EnsemblGenomes-Gn; EBG00001046793.
DR   EnsemblGenomes-Gn; EBG00001046802.
DR   EnsemblGenomes-Gn; EBG00001046807.
DR   EnsemblGenomes-Gn; EBG00001046811.
DR   EnsemblGenomes-Gn; EBG00001046828.
DR   EnsemblGenomes-Gn; EBG00001046835.
DR   EnsemblGenomes-Gn; EBG00001046841.
DR   EnsemblGenomes-Gn; EBG00001046844.
DR   EnsemblGenomes-Gn; EBG00001046848.
DR   EnsemblGenomes-Gn; EBG00001046852.
DR   EnsemblGenomes-Gn; EBG00001046860.
DR   EnsemblGenomes-Gn; EBG00001046864.
DR   EnsemblGenomes-Gn; EBG00001046870.
DR   EnsemblGenomes-Gn; EBG00001046881.
DR   EnsemblGenomes-Gn; EBG00001046891.
DR   EnsemblGenomes-Gn; EBG00001046895.
DR   EnsemblGenomes-Gn; EBG00001046900.
DR   EnsemblGenomes-Gn; EBG00001046912.
DR   EnsemblGenomes-Gn; EBG00001046923.
DR   EnsemblGenomes-Gn; EBG00001046925.
DR   EnsemblGenomes-Gn; EBG00001046937.
DR   EnsemblGenomes-Gn; EBG00001046947.
DR   EnsemblGenomes-Gn; EBG00001046962.
DR   EnsemblGenomes-Gn; EBG00001046966.
DR   EnsemblGenomes-Gn; EBG00001046969.
DR   EnsemblGenomes-Gn; EBG00001046972.
DR   EnsemblGenomes-Gn; EBG00001046975.
DR   EnsemblGenomes-Gn; EBG00001046980.
DR   EnsemblGenomes-Gn; EBG00001046982.
DR   EnsemblGenomes-Gn; EBG00001046988.
DR   EnsemblGenomes-Gn; EBG00001046990.
DR   EnsemblGenomes-Gn; EBG00001046993.
DR   EnsemblGenomes-Gn; EBG00001046995.
DR   EnsemblGenomes-Gn; EBG00001047000.
DR   EnsemblGenomes-Gn; EBG00001047003.
DR   EnsemblGenomes-Gn; EBG00001047005.
DR   EnsemblGenomes-Gn; EBG00001047007.
DR   EnsemblGenomes-Gn; EBG00001047011.
DR   EnsemblGenomes-Gn; EBG00001047016.
DR   EnsemblGenomes-Gn; EBG00001047020.
DR   EnsemblGenomes-Gn; EBG00001047026.
DR   EnsemblGenomes-Gn; EBG00001047028.
DR   EnsemblGenomes-Gn; EBG00001047034.
DR   EnsemblGenomes-Gn; EBG00001047037.
DR   EnsemblGenomes-Gn; EBG00001047038.
DR   EnsemblGenomes-Gn; EBG00001047039.
DR   EnsemblGenomes-Gn; EBG00001047040.
DR   EnsemblGenomes-Gn; EBG00001047041.
DR   EnsemblGenomes-Gn; EBG00001047042.
DR   EnsemblGenomes-Gn; EBG00001047043.
DR   EnsemblGenomes-Gn; EBG00001047044.
DR   EnsemblGenomes-Gn; EBG00001047045.
DR   EnsemblGenomes-Gn; EBG00001047046.
DR   EnsemblGenomes-Gn; EBG00001047047.
DR   EnsemblGenomes-Gn; EBG00001047048.
DR   EnsemblGenomes-Gn; EBG00001047049.
DR   EnsemblGenomes-Gn; EBG00001047050.
DR   EnsemblGenomes-Gn; EBG00001047051.
DR   EnsemblGenomes-Gn; EBG00001047052.
DR   EnsemblGenomes-Gn; EBG00001047053.
DR   EnsemblGenomes-Gn; EBG00001047054.
DR   EnsemblGenomes-Gn; EBG00001047055.
DR   EnsemblGenomes-Gn; EBG00001047056.
DR   EnsemblGenomes-Gn; EBG00001047057.
DR   EnsemblGenomes-Gn; EBG00001047058.
DR   EnsemblGenomes-Gn; EBG00001047059.
DR   EnsemblGenomes-Gn; EBG00001047060.
DR   EnsemblGenomes-Gn; EBG00001047061.
DR   EnsemblGenomes-Gn; EBG00001047062.
DR   EnsemblGenomes-Gn; EBG00001047063.
DR   EnsemblGenomes-Gn; EBG00001047064.
DR   EnsemblGenomes-Gn; EBG00001047065.
DR   EnsemblGenomes-Gn; EBG00001047066.
DR   EnsemblGenomes-Gn; EBG00001047067.
DR   EnsemblGenomes-Gn; EBG00001047068.
DR   EnsemblGenomes-Gn; EBG00001047069.
DR   EnsemblGenomes-Gn; EBG00001047070.
DR   EnsemblGenomes-Gn; EBG00001047071.
DR   EnsemblGenomes-Gn; EBG00001047072.
DR   EnsemblGenomes-Gn; EBG00001047073.
DR   EnsemblGenomes-Gn; EBG00001047074.
DR   EnsemblGenomes-Gn; EBG00001047076.
DR   EnsemblGenomes-Gn; EBG00001047077.
DR   EnsemblGenomes-Gn; EBG00001047078.
DR   EnsemblGenomes-Gn; EBG00001047079.
DR   EnsemblGenomes-Gn; EBG00001047082.
DR   EnsemblGenomes-Gn; EBG00001047088.
DR   EnsemblGenomes-Gn; EBG00001047092.
DR   EnsemblGenomes-Gn; EBG00001047095.
DR   EnsemblGenomes-Gn; EBG00001047103.
DR   EnsemblGenomes-Gn; EBG00001047106.
DR   EnsemblGenomes-Gn; EBG00001047108.
DR   EnsemblGenomes-Gn; EBG00001047116.
DR   EnsemblGenomes-Gn; EBG00001047121.
DR   EnsemblGenomes-Gn; EBG00001047124.
DR   EnsemblGenomes-Gn; EBG00001047128.
DR   EnsemblGenomes-Gn; EBG00001047134.
DR   EnsemblGenomes-Gn; EBG00001047139.
DR   EnsemblGenomes-Gn; EBG00001047141.
DR   EnsemblGenomes-Gn; EBG00001047142.
DR   EnsemblGenomes-Gn; EBG00001047143.
DR   EnsemblGenomes-Gn; EBG00001047144.
DR   EnsemblGenomes-Gn; EBG00001047145.
DR   EnsemblGenomes-Gn; EBG00001047147.
DR   EnsemblGenomes-Gn; EBG00001047148.
DR   EnsemblGenomes-Gn; EBG00001047152.
DR   EnsemblGenomes-Gn; EBG00001047154.
DR   EnsemblGenomes-Gn; EBG00001047155.
DR   EnsemblGenomes-Gn; EBG00001047156.
DR   EnsemblGenomes-Gn; EBG00001047158.
DR   EnsemblGenomes-Gn; EBG00001047159.
DR   EnsemblGenomes-Gn; EBG00001047160.
DR   EnsemblGenomes-Gn; EBG00001047161.
DR   EnsemblGenomes-Gn; EBG00001047165.
DR   EnsemblGenomes-Gn; EBG00001047166.
DR   EnsemblGenomes-Gn; EBG00001047167.
DR   EnsemblGenomes-Gn; EBG00001047169.
DR   EnsemblGenomes-Gn; EBG00001047170.
DR   EnsemblGenomes-Gn; EBG00001047171.
DR   EnsemblGenomes-Gn; EBG00001047172.
DR   EnsemblGenomes-Gn; EBG00001047173.
DR   EnsemblGenomes-Gn; EBG00001047174.
DR   EnsemblGenomes-Gn; EBG00001047176.
DR   EnsemblGenomes-Gn; EBG00001047180.
DR   EnsemblGenomes-Gn; EBG00001047182.
DR   EnsemblGenomes-Gn; EBG00001047183.
DR   EnsemblGenomes-Gn; EBG00001047189.
DR   EnsemblGenomes-Gn; EBG00001047191.
DR   EnsemblGenomes-Gn; EBG00001047194.
DR   EnsemblGenomes-Gn; EBG00001047202.
DR   EnsemblGenomes-Gn; EBG00001047210.
DR   EnsemblGenomes-Gn; EBG00001047220.
DR   EnsemblGenomes-Gn; EBG00001047222.
DR   EnsemblGenomes-Gn; EBG00001047236.
DR   EnsemblGenomes-Gn; EBG00001047239.
DR   EnsemblGenomes-Gn; EBG00001047249.
DR   EnsemblGenomes-Gn; EBG00001047251.
DR   EnsemblGenomes-Gn; EBG00001047256.
DR   EnsemblGenomes-Gn; EBG00001047262.
DR   EnsemblGenomes-Gn; EBG00001047266.
DR   EnsemblGenomes-Gn; EBG00001047268.
DR   EnsemblGenomes-Gn; EBG00001047270.
DR   EnsemblGenomes-Gn; EBG00001047273.
DR   EnsemblGenomes-Gn; EBG00001047281.
DR   EnsemblGenomes-Gn; EBG00001047284.
DR   EnsemblGenomes-Gn; EBG00001047288.
DR   EnsemblGenomes-Gn; EBG00001047292.
DR   EnsemblGenomes-Gn; EBG00001047296.
DR   EnsemblGenomes-Gn; EBG00001047303.
DR   EnsemblGenomes-Gn; EBG00001047306.
DR   EnsemblGenomes-Gn; EBG00001047309.
DR   EnsemblGenomes-Gn; EBG00001047314.
DR   EnsemblGenomes-Gn; EBG00001047318.
DR   EnsemblGenomes-Gn; EBG00001047321.
DR   EnsemblGenomes-Gn; EBG00001047328.
DR   EnsemblGenomes-Gn; EBG00001047331.
DR   EnsemblGenomes-Gn; EBG00001047337.
DR   EnsemblGenomes-Gn; EBG00001047349.
DR   EnsemblGenomes-Gn; EBG00001047354.
DR   EnsemblGenomes-Gn; EBG00001047359.
DR   EnsemblGenomes-Gn; EBG00001047365.
DR   EnsemblGenomes-Gn; EBG00001047367.
DR   EnsemblGenomes-Gn; EBG00001047370.
DR   EnsemblGenomes-Gn; EBG00001047373.
DR   EnsemblGenomes-Gn; EBG00001047376.
DR   EnsemblGenomes-Gn; EBG00001047379.
DR   EnsemblGenomes-Gn; EBG00001047383.
DR   EnsemblGenomes-Gn; EBG00001047387.
DR   EnsemblGenomes-Gn; EBG00001047389.
DR   EnsemblGenomes-Gn; ECA0236.
DR   EnsemblGenomes-Gn; ECA0392.
DR   EnsemblGenomes-Gn; ECA0411.
DR   EnsemblGenomes-Gn; ECA0415.
DR   EnsemblGenomes-Gn; ECA0417.
DR   EnsemblGenomes-Gn; ECA0529.
DR   EnsemblGenomes-Gn; ECA0535.
DR   EnsemblGenomes-Gn; ECA0703.
DR   EnsemblGenomes-Gn; ECA0707.
DR   EnsemblGenomes-Gn; ECA0719.
DR   EnsemblGenomes-Gn; ECA0808.
DR   EnsemblGenomes-Gn; ECA0961.
DR   EnsemblGenomes-Gn; ECA1630.
DR   EnsemblGenomes-Gn; ECA1806.
DR   EnsemblGenomes-Gn; ECA1945.
DR   EnsemblGenomes-Gn; ECA2177.
DR   EnsemblGenomes-Gn; ECA2597A.
DR   EnsemblGenomes-Gn; ECA3483.
DR   EnsemblGenomes-Gn; ECA4370.
DR   EnsemblGenomes-Gn; ECA4456.
DR   EnsemblGenomes-Tr; EBG00000000748-1.
DR   EnsemblGenomes-Tr; EBG00000000749-1.
DR   EnsemblGenomes-Tr; EBG00000000750-1.
DR   EnsemblGenomes-Tr; EBG00000000751-1.
DR   EnsemblGenomes-Tr; EBG00000000752-1.
DR   EnsemblGenomes-Tr; EBG00000000753-1.
DR   EnsemblGenomes-Tr; EBG00000000754-1.
DR   EnsemblGenomes-Tr; EBG00000000755-1.
DR   EnsemblGenomes-Tr; EBG00000000756-1.
DR   EnsemblGenomes-Tr; EBG00000000757-1.
DR   EnsemblGenomes-Tr; EBG00000000758-1.
DR   EnsemblGenomes-Tr; EBG00000000759-1.
DR   EnsemblGenomes-Tr; EBG00000000760-1.
DR   EnsemblGenomes-Tr; EBG00000000761-1.
DR   EnsemblGenomes-Tr; EBG00000000762-1.
DR   EnsemblGenomes-Tr; EBG00000000763-1.
DR   EnsemblGenomes-Tr; EBG00000000764-1.
DR   EnsemblGenomes-Tr; EBG00000000765-1.
DR   EnsemblGenomes-Tr; EBG00000000766-1.
DR   EnsemblGenomes-Tr; EBG00000000769-1.
DR   EnsemblGenomes-Tr; EBG00000000770-1.
DR   EnsemblGenomes-Tr; EBG00000000772-1.
DR   EnsemblGenomes-Tr; EBG00000000773-1.
DR   EnsemblGenomes-Tr; EBG00000000774-1.
DR   EnsemblGenomes-Tr; EBG00000000775-1.
DR   EnsemblGenomes-Tr; EBG00000000776-1.
DR   EnsemblGenomes-Tr; EBG00000000777-1.
DR   EnsemblGenomes-Tr; EBG00000000778-1.
DR   EnsemblGenomes-Tr; EBG00000000780-1.
DR   EnsemblGenomes-Tr; EBG00000000781-1.
DR   EnsemblGenomes-Tr; EBG00000000782-1.
DR   EnsemblGenomes-Tr; EBG00000000783-1.
DR   EnsemblGenomes-Tr; EBG00000000784-1.
DR   EnsemblGenomes-Tr; EBG00000000785-1.
DR   EnsemblGenomes-Tr; EBG00000000786-1.
DR   EnsemblGenomes-Tr; EBG00000000787-1.
DR   EnsemblGenomes-Tr; EBG00000000788-1.
DR   EnsemblGenomes-Tr; EBG00000000789-1.
DR   EnsemblGenomes-Tr; EBG00000000790-1.
DR   EnsemblGenomes-Tr; EBG00000000791-1.
DR   EnsemblGenomes-Tr; EBG00000000792-1.
DR   EnsemblGenomes-Tr; EBG00000000793-1.
DR   EnsemblGenomes-Tr; EBG00000000794-1.
DR   EnsemblGenomes-Tr; EBG00000000795-1.
DR   EnsemblGenomes-Tr; EBG00000000796-1.
DR   EnsemblGenomes-Tr; EBG00000000797-1.
DR   EnsemblGenomes-Tr; EBG00000000798-1.
DR   EnsemblGenomes-Tr; EBG00000000799-1.
DR   EnsemblGenomes-Tr; EBG00000000800-1.
DR   EnsemblGenomes-Tr; EBG00000000801-1.
DR   EnsemblGenomes-Tr; EBG00000000802-1.
DR   EnsemblGenomes-Tr; EBG00000000803-1.
DR   EnsemblGenomes-Tr; EBG00000000804-1.
DR   EnsemblGenomes-Tr; EBG00000000805-1.
DR   EnsemblGenomes-Tr; EBG00000000806-1.
DR   EnsemblGenomes-Tr; EBG00000000807-1.
DR   EnsemblGenomes-Tr; EBG00000000808-1.
DR   EnsemblGenomes-Tr; EBG00000000809-1.
DR   EnsemblGenomes-Tr; EBG00000000810-1.
DR   EnsemblGenomes-Tr; EBG00000000811-1.
DR   EnsemblGenomes-Tr; EBG00000000812-1.
DR   EnsemblGenomes-Tr; EBG00000000813-1.
DR   EnsemblGenomes-Tr; EBG00000000816-1.
DR   EnsemblGenomes-Tr; EBG00000000818-1.
DR   EnsemblGenomes-Tr; EBG00000000819-1.
DR   EnsemblGenomes-Tr; EBG00000000820-1.
DR   EnsemblGenomes-Tr; EBG00000000821-1.
DR   EnsemblGenomes-Tr; EBG00000000822-1.
DR   EnsemblGenomes-Tr; EBG00000000823-1.
DR   EnsemblGenomes-Tr; EBG00000000824-1.
DR   EnsemblGenomes-Tr; EBG00000000825-1.
DR   EnsemblGenomes-Tr; EBG00000000826-1.
DR   EnsemblGenomes-Tr; EBG00000000827-1.
DR   EnsemblGenomes-Tr; EBG00000000828-1.
DR   EnsemblGenomes-Tr; EBG00000000829-1.
DR   EnsemblGenomes-Tr; EBG00000000830-1.
DR   EnsemblGenomes-Tr; EBG00000000831-1.
DR   EnsemblGenomes-Tr; EBG00000000832-1.
DR   EnsemblGenomes-Tr; EBG00000000833-1.
DR   EnsemblGenomes-Tr; EBG00000000834-1.
DR   EnsemblGenomes-Tr; EBG00000000835-1.
DR   EnsemblGenomes-Tr; EBG00000000836-1.
DR   EnsemblGenomes-Tr; EBG00000000837-1.
DR   EnsemblGenomes-Tr; EBG00000000838-1.
DR   EnsemblGenomes-Tr; EBG00000000839-1.
DR   EnsemblGenomes-Tr; EBG00000000840-1.
DR   EnsemblGenomes-Tr; EBG00000000841-1.
DR   EnsemblGenomes-Tr; EBG00000000842-1.
DR   EnsemblGenomes-Tr; EBG00000000843-1.
DR   EnsemblGenomes-Tr; EBG00000000844-1.
DR   EnsemblGenomes-Tr; EBG00000000845-1.
DR   EnsemblGenomes-Tr; EBG00000000846-1.
DR   EnsemblGenomes-Tr; EBG00000000847-1.
DR   EnsemblGenomes-Tr; EBG00000000848-1.
DR   EnsemblGenomes-Tr; EBG00000000849-1.
DR   EnsemblGenomes-Tr; EBG00000000850-1.
DR   EnsemblGenomes-Tr; EBG00000000851-1.
DR   EnsemblGenomes-Tr; EBG00000000852-1.
DR   EnsemblGenomes-Tr; EBT00001648704.
DR   EnsemblGenomes-Tr; EBT00001648705.
DR   EnsemblGenomes-Tr; EBT00001648706.
DR   EnsemblGenomes-Tr; EBT00001648707.
DR   EnsemblGenomes-Tr; EBT00001648708.
DR   EnsemblGenomes-Tr; EBT00001648709.
DR   EnsemblGenomes-Tr; EBT00001648710.
DR   EnsemblGenomes-Tr; EBT00001648711.
DR   EnsemblGenomes-Tr; EBT00001648712.
DR   EnsemblGenomes-Tr; EBT00001648713.
DR   EnsemblGenomes-Tr; EBT00001648714.
DR   EnsemblGenomes-Tr; EBT00001648715.
DR   EnsemblGenomes-Tr; EBT00001648716.
DR   EnsemblGenomes-Tr; EBT00001648717.
DR   EnsemblGenomes-Tr; EBT00001648718.
DR   EnsemblGenomes-Tr; EBT00001648719.
DR   EnsemblGenomes-Tr; EBT00001648720.
DR   EnsemblGenomes-Tr; EBT00001648721.
DR   EnsemblGenomes-Tr; EBT00001648722.
DR   EnsemblGenomes-Tr; EBT00001648723.
DR   EnsemblGenomes-Tr; EBT00001648724.
DR   EnsemblGenomes-Tr; EBT00001648725.
DR   EnsemblGenomes-Tr; EBT00001648726.
DR   EnsemblGenomes-Tr; EBT00001648727.
DR   EnsemblGenomes-Tr; EBT00001648728.
DR   EnsemblGenomes-Tr; EBT00001648729.
DR   EnsemblGenomes-Tr; EBT00001648730.
DR   EnsemblGenomes-Tr; EBT00001648731.
DR   EnsemblGenomes-Tr; EBT00001648732.
DR   EnsemblGenomes-Tr; EBT00001648733.
DR   EnsemblGenomes-Tr; EBT00001648734.
DR   EnsemblGenomes-Tr; EBT00001648735.
DR   EnsemblGenomes-Tr; EBT00001648736.
DR   EnsemblGenomes-Tr; EBT00001648737.
DR   EnsemblGenomes-Tr; EBT00001648738.
DR   EnsemblGenomes-Tr; EBT00001648739.
DR   EnsemblGenomes-Tr; EBT00001648740.
DR   EnsemblGenomes-Tr; EBT00001648741.
DR   EnsemblGenomes-Tr; EBT00001648742.
DR   EnsemblGenomes-Tr; EBT00001648743.
DR   EnsemblGenomes-Tr; EBT00001648744.
DR   EnsemblGenomes-Tr; EBT00001648745.
DR   EnsemblGenomes-Tr; EBT00001648746.
DR   EnsemblGenomes-Tr; EBT00001648747.
DR   EnsemblGenomes-Tr; EBT00001648748.
DR   EnsemblGenomes-Tr; EBT00001648749.
DR   EnsemblGenomes-Tr; EBT00001648750.
DR   EnsemblGenomes-Tr; EBT00001648751.
DR   EnsemblGenomes-Tr; EBT00001648752.
DR   EnsemblGenomes-Tr; EBT00001648753.
DR   EnsemblGenomes-Tr; EBT00001648754.
DR   EnsemblGenomes-Tr; EBT00001648755.
DR   EnsemblGenomes-Tr; EBT00001648756.
DR   EnsemblGenomes-Tr; EBT00001648757.
DR   EnsemblGenomes-Tr; EBT00001648758.
DR   EnsemblGenomes-Tr; EBT00001648759.
DR   EnsemblGenomes-Tr; EBT00001648760.
DR   EnsemblGenomes-Tr; EBT00001648761.
DR   EnsemblGenomes-Tr; EBT00001648762.
DR   EnsemblGenomes-Tr; EBT00001648763.
DR   EnsemblGenomes-Tr; EBT00001648764.
DR   EnsemblGenomes-Tr; EBT00001648765.
DR   EnsemblGenomes-Tr; EBT00001648766.
DR   EnsemblGenomes-Tr; EBT00001648767.
DR   EnsemblGenomes-Tr; EBT00001648768.
DR   EnsemblGenomes-Tr; EBT00001648769.
DR   EnsemblGenomes-Tr; EBT00001648770.
DR   EnsemblGenomes-Tr; EBT00001648771.
DR   EnsemblGenomes-Tr; EBT00001648772.
DR   EnsemblGenomes-Tr; EBT00001648773.
DR   EnsemblGenomes-Tr; EBT00001648774.
DR   EnsemblGenomes-Tr; EBT00001648775.
DR   EnsemblGenomes-Tr; EBT00001648776.
DR   EnsemblGenomes-Tr; EBT00001648777.
DR   EnsemblGenomes-Tr; EBT00001648778.
DR   EnsemblGenomes-Tr; EBT00001648779.
DR   EnsemblGenomes-Tr; EBT00001648780.
DR   EnsemblGenomes-Tr; EBT00001648781.
DR   EnsemblGenomes-Tr; EBT00001648782.
DR   EnsemblGenomes-Tr; EBT00001648783.
DR   EnsemblGenomes-Tr; EBT00001648784.
DR   EnsemblGenomes-Tr; EBT00001648785.
DR   EnsemblGenomes-Tr; EBT00001648786.
DR   EnsemblGenomes-Tr; EBT00001648787.
DR   EnsemblGenomes-Tr; EBT00001648788.
DR   EnsemblGenomes-Tr; EBT00001648789.
DR   EnsemblGenomes-Tr; EBT00001648790.
DR   EnsemblGenomes-Tr; EBT00001648791.
DR   EnsemblGenomes-Tr; EBT00001648792.
DR   EnsemblGenomes-Tr; EBT00001648793.
DR   EnsemblGenomes-Tr; EBT00001648794.
DR   EnsemblGenomes-Tr; EBT00001648795.
DR   EnsemblGenomes-Tr; EBT00001648796.
DR   EnsemblGenomes-Tr; EBT00001648797.
DR   EnsemblGenomes-Tr; EBT00001648798.
DR   EnsemblGenomes-Tr; EBT00001648799.
DR   EnsemblGenomes-Tr; EBT00001648800.
DR   EnsemblGenomes-Tr; EBT00001648801.
DR   EnsemblGenomes-Tr; EBT00001648802.
DR   EnsemblGenomes-Tr; EBT00001648803.
DR   EnsemblGenomes-Tr; EBT00001648804.
DR   EnsemblGenomes-Tr; EBT00001648805.
DR   EnsemblGenomes-Tr; EBT00001648806.
DR   EnsemblGenomes-Tr; EBT00001648807.
DR   EnsemblGenomes-Tr; EBT00001648808.
DR   EnsemblGenomes-Tr; EBT00001648809.
DR   EnsemblGenomes-Tr; EBT00001648810.
DR   EnsemblGenomes-Tr; EBT00001648811.
DR   EnsemblGenomes-Tr; EBT00001648812.
DR   EnsemblGenomes-Tr; EBT00001648813.
DR   EnsemblGenomes-Tr; EBT00001648814.
DR   EnsemblGenomes-Tr; EBT00001648815.
DR   EnsemblGenomes-Tr; EBT00001648816.
DR   EnsemblGenomes-Tr; EBT00001648817.
DR   EnsemblGenomes-Tr; EBT00001648818.
DR   EnsemblGenomes-Tr; EBT00001648819.
DR   EnsemblGenomes-Tr; EBT00001648820.
DR   EnsemblGenomes-Tr; EBT00001648821.
DR   EnsemblGenomes-Tr; EBT00001648822.
DR   EnsemblGenomes-Tr; EBT00001648823.
DR   EnsemblGenomes-Tr; EBT00001648824.
DR   EnsemblGenomes-Tr; EBT00001648825.
DR   EnsemblGenomes-Tr; EBT00001648826.
DR   EnsemblGenomes-Tr; EBT00001648827.
DR   EnsemblGenomes-Tr; EBT00001648828.
DR   EnsemblGenomes-Tr; EBT00001648829.
DR   EnsemblGenomes-Tr; EBT00001648830.
DR   EnsemblGenomes-Tr; EBT00001648831.
DR   EnsemblGenomes-Tr; EBT00001648832.
DR   EnsemblGenomes-Tr; EBT00001648833.
DR   EnsemblGenomes-Tr; EBT00001648834.
DR   EnsemblGenomes-Tr; EBT00001648835.
DR   EnsemblGenomes-Tr; EBT00001648836.
DR   EnsemblGenomes-Tr; EBT00001648837.
DR   EnsemblGenomes-Tr; EBT00001648838.
DR   EnsemblGenomes-Tr; EBT00001648839.
DR   EnsemblGenomes-Tr; EBT00001648840.
DR   EnsemblGenomes-Tr; EBT00001648841.
DR   EnsemblGenomes-Tr; EBT00001648842.
DR   EnsemblGenomes-Tr; EBT00001648843.
DR   EnsemblGenomes-Tr; EBT00001648844.
DR   EnsemblGenomes-Tr; EBT00001648845.
DR   EnsemblGenomes-Tr; EBT00001648846.
DR   EnsemblGenomes-Tr; EBT00001648847.
DR   EnsemblGenomes-Tr; EBT00001648848.
DR   EnsemblGenomes-Tr; EBT00001648849.
DR   EnsemblGenomes-Tr; EBT00001648850.
DR   EnsemblGenomes-Tr; EBT00001648851.
DR   EnsemblGenomes-Tr; EBT00001648852.
DR   EnsemblGenomes-Tr; EBT00001648853.
DR   EnsemblGenomes-Tr; EBT00001648854.
DR   EnsemblGenomes-Tr; EBT00001648855.
DR   EnsemblGenomes-Tr; EBT00001648856.
DR   EnsemblGenomes-Tr; EBT00001648857.
DR   EnsemblGenomes-Tr; EBT00001648858.
DR   EnsemblGenomes-Tr; EBT00001648859.
DR   EnsemblGenomes-Tr; EBT00001648860.
DR   EnsemblGenomes-Tr; EBT00001648861.
DR   EnsemblGenomes-Tr; EBT00001648862.
DR   EnsemblGenomes-Tr; EBT00001648863.
DR   EnsemblGenomes-Tr; EBT00001648864.
DR   EnsemblGenomes-Tr; EBT00001648865.
DR   EnsemblGenomes-Tr; EBT00001648866.
DR   EnsemblGenomes-Tr; EBT00001648867.
DR   EnsemblGenomes-Tr; EBT00001648868.
DR   EnsemblGenomes-Tr; EBT00001648869.
DR   EnsemblGenomes-Tr; EBT00001648870.
DR   EnsemblGenomes-Tr; EBT00001648871.
DR   EnsemblGenomes-Tr; EBT00001648872.
DR   EnsemblGenomes-Tr; EBT00001648873.
DR   EnsemblGenomes-Tr; EBT00001648874.
DR   EnsemblGenomes-Tr; EBT00001648875.
DR   EnsemblGenomes-Tr; EBT00001648876.
DR   EnsemblGenomes-Tr; EBT00001648877.
DR   EnsemblGenomes-Tr; EBT00001648878.
DR   EnsemblGenomes-Tr; EBT00001648879.
DR   EnsemblGenomes-Tr; EBT00001648880.
DR   EnsemblGenomes-Tr; EBT00001648881.
DR   EnsemblGenomes-Tr; EBT00001648882.
DR   EnsemblGenomes-Tr; EBT00001648883.
DR   EnsemblGenomes-Tr; EBT00001648884.
DR   EnsemblGenomes-Tr; EBT00001648885.
DR   EnsemblGenomes-Tr; EBT00001648886.
DR   EnsemblGenomes-Tr; EBT00001648887.
DR   EnsemblGenomes-Tr; EBT00001648888.
DR   EnsemblGenomes-Tr; EBT00001648889.
DR   EnsemblGenomes-Tr; EBT00001648890.
DR   EnsemblGenomes-Tr; EBT00001648891.
DR   EnsemblGenomes-Tr; EBT00001648892.
DR   EnsemblGenomes-Tr; EBT00001648893.
DR   EnsemblGenomes-Tr; ECA0236.
DR   EnsemblGenomes-Tr; ECA0392.
DR   EnsemblGenomes-Tr; ECA0411.
DR   EnsemblGenomes-Tr; ECA0415.
DR   EnsemblGenomes-Tr; ECA0417.
DR   EnsemblGenomes-Tr; ECA0529.
DR   EnsemblGenomes-Tr; ECA0535.
DR   EnsemblGenomes-Tr; ECA0703.
DR   EnsemblGenomes-Tr; ECA0707.
DR   EnsemblGenomes-Tr; ECA0719.
DR   EnsemblGenomes-Tr; ECA0808.
DR   EnsemblGenomes-Tr; ECA0961.
DR   EnsemblGenomes-Tr; ECA1630.
DR   EnsemblGenomes-Tr; ECA1806.
DR   EnsemblGenomes-Tr; ECA1945.
DR   EnsemblGenomes-Tr; ECA2177.
DR   EnsemblGenomes-Tr; ECA2597A.
DR   EnsemblGenomes-Tr; ECA3483.
DR   EnsemblGenomes-Tr; ECA4370.
DR   EnsemblGenomes-Tr; ECA4456.
DR   EuropePMC; PMC1064049; 15743960.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC1393189; 16517643.
DR   EuropePMC; PMC1595483; 16952940.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2394748; 17547764.
DR   EuropePMC; PMC2443915; 18443127.
DR   EuropePMC; PMC2493155; 18487400.
DR   EuropePMC; PMC2576667; 18790860.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC2810300; 20015388.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3294861; 22247511.
DR   EuropePMC; PMC3409226; 22860008.
DR   EuropePMC; PMC3486416; 23105077.
DR   EuropePMC; PMC3678301; 23781227.
DR   EuropePMC; PMC3816273; 24204365.
DR   EuropePMC; PMC4471427; 26150828.
DR   EuropePMC; PMC4814525; 27065965.
DR   EuropePMC; PMC503747; 15263089.
DR   EuropePMC; PMC5320501; 28225009.
DR   EuropePMC; PMC6286560; 30526490.
DR   EuropePMC; PMC6567464; 31195968.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; BX950851.
DR   SILVA-SSU; BX950851.
DR   StrainInfo; 494319; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5064019
FT                   /organism="Pectobacterium atrosepticum SCRI1043"
FT                   /strain="SCRI1043"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:218491"
FT   CDS_pept        complement(32..475)
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="ECA0001"
FT                   /product="putative flavoprotein (initiation of chromosome
FT                   replication)"
FT                   /note="Similar to Escherichia coli protein MioC
FT                   SWALL:MIOC_ECOLI (SWALL:P03817) (146 aa) fasta scores: E():
FT                   3.6e-36, 71.23% id in 146 aa, and to Yersinia pestis
FT                   putative flavoprotein SWALL:AAM83597 (EMBL:AJ414141) (146
FT                   aa) fasta scores: E(): 7.7e-38, 72.6% id in 146 aa, and to
FT                   Salmonella typhimurium, and Salmonella typhi initiation of
FT                   chromosome replication MioC SWALL:Q8XET7 (EMBL:AE008881)
FT                   (147 aa) fasta scores: E(): 1.7e-35, 68.7% id in 147 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72925"
FT                   /db_xref="GOA:Q6DB97"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB97"
FT                   /protein_id="CAG72925.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLAELLEKDNFSTEILHGPTLDALP
FT                   ESGIWLVVTSTHGAGEFPDNLKALFEQLEQQKPDLSQVNFGAIGIGSKEYDTFCGAIQT
FT                   ADRLLAQLGAKRIGEILEIDITQHQIPEDPAEEWLGSWVNLLK"
FT   misc_feature    complement(38..469)
FT                   /note="HMMPfam hit to PF00258, DE Flavodoxin, score
FT                   4.4e-31"
FT   CDS_pept        complement(565..1026)
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="ECA0002"
FT                   /product="AsnC-family transcriptional regulator"
FT                   /note="Similar to Yersinia pestis regulatory protein AsnC
FT                   SWALL:Q8ZJT4 (EMBL:AJ414141) (153 aa) fasta scores: E():
FT                   3.5e-48, 86.92% id in 153 aa, and to Escherichia coli,
FT                   Escherichia coli O6, Escherichia coli O157:H7, and Shigella
FT                   flexneri regulatory protein AsnC SWALL:ASNC_ECOLI
FT                   (SWALL:P03809) (152 aa) fasta scores: E(): 8e-47, 87.41% id
FT                   in 151 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72926"
FT                   /db_xref="GOA:Q6DB96"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB96"
FT                   /protein_id="CAG72926.1"
FT                   /translation="MAEIYQIDNLDRGILSALMENARTPYAELAKQFSVSPGTIHVRVE
FT                   KMKQAGIIIGTRLDVNPKQLGYDVCCFIGIILKSAKDYPSALEKLNNLEEVVEAYYTTG
FT                   HYSIFIKVMCRSIEALQHVLINKIQTIDEIQSTETLISLQNPIMRTIAP"
FT   misc_feature    complement(631..936)
FT                   /note="HMMPfam hit to PF01037, DE AsnC family, score 2e-16"
FT   misc_feature    complement(892..957)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1710.000, SD 5.01 at aa 24-45, sequence
FT                   TPYAELAKQFSVSPGTIHVRVE"
FT   CDS_pept        1179..2171
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="ECA0003"
FT                   /product="putative asparagine synthetase A"
FT                   /EC_number="6.3.1.1"
FT                   /note="Similar to Escherichia coli aspartate-ammonia ligase
FT                   AsnA SWALL:ASNA_ECOLI (SWALL:P00963) (330 aa) fasta scores:
FT                   E(): 2.7e-107, 81.51% id in 330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72927"
FT                   /db_xref="GOA:Q6DB95"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB95"
FT                   /protein_id="CAG72927.1"
FT                   /translation="MKKQYIEKQQQISFVKSFFSSQLEQLLGLIEVQAPILSRIGDGTQ
FT                   DNLSGTEKAVQVKVKALPDATFEVVHSLAKWKRKTLGAYDFSFGEGIYTHMKALRPDED
FT                   RLSPIHSVYVDQWDWERVMEDGERNAEYLKSTVTRIYQGIKATEAAVHQAFGIQPFLPE
FT                   QIHFVHTETLLKRYPDLDAKGRERAIAKELGAVFLIGIGGKLSSGHSHDVRAPDYDDWT
FT                   TPGEQELAGLNGDIVVWNPVLNDAFEISSMGIRVDAEALTRQLALTQDEERLKLEWHQA
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQLPHIGQVQCGVWPQPLRESVSGLL"
FT   misc_feature    1185..1916
FT                   /note="HMMPfam hit to PF03590, DE Aspartate-ammonia ligase,
FT                   score 2.8e-173"
FT   CDS_pept        complement(2168..3646)
FT                   /transl_table=11
FT                   /locus_tag="ECA0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   YieM SWALL:AAN83105 (EMBL:AE016769) (483 aa) fasta scores:
FT                   E(): 1.1e-124, 63.03% id in 487 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72928"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB94"
FT                   /protein_id="CAG72928.1"
FT                   /translation="MITLESLEMLLSIDENELLDDLVVTLMATPQLAFFFEKYPSLKSA
FT                   LLNDLPHWKETLKQRLRTTQVPPELEREFSCYQRSQSIDNQAFQTRLPAIMDTLNNVES
FT                   PFLTQASQLITSPERTLGQKVTSGLHALFLQRWRLSLTLQTVSLHQQLMNQEREILLDE
FT                   LQQRLTLSGKLEPILAENENAAGRLWDLSAAQRIQTDPRLLLDFGTFLQRQPALQKLAE
FT                   RLGRSRETKSILTQEAPQEAFRVRVREPATVPEQVSGVHQSDDILRLMPTELVTLGISE
FT                   LEYEFYRRLLEHRLLTYRLQGESWREKVTERPVVHQQNEQQPRGPFIVCVDTSGSMGGF
FT                   NERCAKAFCLALMRIALADNRRCYIMLFSTGVVKYELTSEDGLEQAIRFLSQSFRGGTD
FT                   MAACLSALLDKMDDALWHDADAVVISDFIAQRLPDEVVNKVKSRQKQLQHRFHAVAMSD
FT                   HGKPGIMHIFDHIWRFDTGLKSRLMRRWQHGKAY"
FT   misc_feature    complement(2939..3004)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1237.000, SD 3.40 at aa 215-236, sequence
FT                   PALQKLAERLGRSRETKSILTQ"
FT   CDS_pept        complement(3652..5151)
FT                   /transl_table=11
FT                   /locus_tag="ECA0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0005 or y0005 SWALL:Q8ZJT1 (EMBL:AJ414141) (517 aa)
FT                   fasta scores: E(): 1.3e-132, 68.87% id in 498 aa, and to
FT                   Salmonella typhimurium paral putative regulator protein
FT                   yien or stm3879 SWALL:Q8ZKW2 (EMBL:AE008881) (498 aa) fasta
FT                   scores: E(): 8.1e-130, 68% id in 497 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72929"
FT                   /db_xref="GOA:Q6DB93"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB93"
FT                   /protein_id="CAG72929.1"
FT                   /translation="MRQTAALAERISRLSHALEHGLYERQHTIRLCLLAALSGESVFLL
FT                   GPPGIAKSMIARRLKFAFRHANAFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTAGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGNSEDTIPMRLLVAASNELPEADGG
FT                   LEALYDRMLIRLWLDRVQEKQNFHALLVNNSSDRDNPVPPALSVSDEEYQQWQKDIEHV
FT                   ALPEVGFELIYMLRQQLDALEQAPYISDRRWKKALRLLQASAFFCGRDAITPVDIILLK
FT                   DCLWHDQSTLTLIERQLELLITEHAYQQKSLLFRLQQVNTKRQQYQREQSELQAFSVEK
FT                   QGHFLGRKFHYTLPDTIAAETLDLVLQRPLILHDIEVNHLTIEKNALQGWLQKGGEIRG
FT                   KLNGIGFTQRLDLLVDDRQHLAIRDISLQSSVLSLPEKRDCALPAEITDEYEKLNMQLR
FT                   EQRRLFSQHQPCLFVPSEWLAKIEASLQQVAEQIQQSEQQD"
FT   CDS_pept        5629..7497
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="ECA0006"
FT                   /product="potassium uptake protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   potassium uptake protein Kup SWALL:KUP_ECOLI (SWALL:P30016)
FT                   (622 aa) fasta scores: E(): 1.4e-208, 82.63% id in 622 aa,
FT                   and to Yersinia pestis potassium transport protein Kup
FT                   SWALL:Q8ZJT0 (EMBL:AJ414141) (622 aa) fasta scores: E():
FT                   2.2e-210, 84.24% id in 622 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72930"
FT                   /db_xref="GOA:Q6DB92"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB92"
FT                   /protein_id="CAG72930.1"
FT                   /translation="MSSEHKRSLPAVTLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVE
FT                   PHSVFGFLSLIFWLLVLVVSLKYLTYVMRADNAGEGGILTLMSLAGRNTSDRMTSVLVI
FT                   MGLIGGSFFYGEVVITPAISVMSAMEGLEIAAPAMDSYIVPLSIVVLTLLFIIQKHGTG
FT                   SVGKLFAPVMLIWFLTLGVLGVRGIIANPEVLQALNPMYAVRFFIEYKAVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLMVLATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIVHTSDMESGQIYIP
FT                   AINWMLYIAVVIVIVSFEHSSNLAAAYGIAVTGTMVITSILFCTVAVKNWLWNRYLAWV
FT                   LLVGLLIIDVPMFLANVVKILSGGWLPLALGMVMFIIMTTWKSERFRLLRRLHEHGNSL
FT                   DAMIASLEKSPPTRVPGTAVYFSRATRVIPFALLHNLKHNKILHERVVLLTMRTEDAPY
FT                   VLNARRVTVEQLSPTFWRVIANYGWRETPDVEEVFQRCWQEGLTCQMMETSFFMSNESL
FT                   IIGERPWYLRLRGKLFMMLSRNALRAADQFEIPPNRLIELGIQVEI"
FT   misc_feature    5629..5694
FT                   /note="Signal peptide predicted for ECA0006 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.892) with cleavage site
FT                   probability 0.891 between residues 22 and 23"
FT   misc_feature    order(5647..5715,5773..5841,5932..6000,6028..6096,
FT                   6130..6198,6256..6324,6361..6429,6487..6555,6628..6696,
FT                   6724..6792,6811..6879,6892..6948)
FT                   /note="12 probable transmembrane helices predicted for
FT                   ECA0006 by TMHMM2.0 at aa 7-29, 49-71, 102-124, 134-156,
FT                   168-190, 210-232, 245-267, 287-309, 334-356, 366-388,
FT                   395-417 and 422-440"
FT   misc_feature    5665..7491
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02705, DE K+ potassium transporter,
FT                   score 1e-291"
FT   CDS_pept        complement(7668..9017)
FT                   /transl_table=11
FT                   /gene="qseC"
FT                   /locus_tag="ECA0007"
FT                   /product="two-component system sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli sensor protein QseC
FT                   SWALL:QSEC_ECOLI (SWALL:P40719) (449 aa) fasta scores: E():
FT                   7.4e-94, 56.15% id in 447 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72931"
FT                   /db_xref="GOA:Q6DB91"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB91"
FT                   /protein_id="CAG72931.1"
FT                   /translation="MNRLSLRLRLIAGFALLTLICWSVASLLSWYQTRHNINELFDTQQ
FT                   MLFAKRLATMNPDELQIQSTSLPKTKSLVHKNRGKQDDDALAFAIFTRNGKMVLNDGDN
FT                   GKDFIFDSTRNGFTDGKLRDDNDAWRIVWLTTEDNRYVIAVGQEWEYRQDMTLDIVKTN
FT                   LMPWLFALPIMLALLFWLVTRELSPLKRIAAELQLRSPDESTPLATQRIPQEVLPLVNA
FT                   LNLLFSRIHDMLTRERRFTSDAAHELRSPLAALKVQTEVAQLAHDDEAMRRHALMNLDK
FT                   GIDRATRLVDQLLTLSRLDAESHPEGMQPVQFNELLQQAVIAHYHTAQTAGIELTLDLP
FT                   NTPIIRQGHPLLLTLLVRNLLDNAIRYSHEGGIVSLTLTERGFQVADNGPGISDEALAR
FT                   IGERFYRPPGQEKSGSGLGISIVNNIAMLHQMRVTFTNQPEGGLIVSVNW"
FT   misc_feature    complement(7674..7976)
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 7.4e-23"
FT   misc_feature    complement(8112..8312)
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 1.3e-14"
FT   misc_feature    complement(8322..8528)
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   2.5e-07"
FT   misc_feature    complement(order(8469..8528,8922..8990))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0007 by TMHMM2.0 at aa 10-32 and 164-183"
FT   misc_feature    complement(8934..9017)
FT                   /note="Signal peptide predicted for ECA0007 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.423 between residues 28 and 29"
FT   CDS_pept        complement(9014..9676)
FT                   /transl_table=11
FT                   /gene="qseB"
FT                   /locus_tag="ECA0008"
FT                   /product="two-component system response regulator."
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulatory protein QseB SWALL:QSEB_ECOLI (SWALL:P52076)
FT                   (219 aa) fasta scores: E(): 3.1e-59, 68.34% id in 218 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72932"
FT                   /db_xref="GOA:Q6DB90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB90"
FT                   /protein_id="CAG72932.1"
FT                   /translation="MRVLLIEDDRLIGDGLKAGLNKLGFNIDWFTEGKAGATALKAAPY
FT                   DAVVLDLSLPGMDGMDILRQWRQAGHDEPVLILTARDALEQRVEGLQQGADDYLCKPFA
FT                   LTEVAARLQALIRRRHGQLQPVLTHGAVSLEPSSRSVTLNSEPLILKSRELALLELFLL
FT                   NPNRVLTRAQLEEKLYGWDDDVSSNAVEVHIHHLRKKLGSGFIRTVHGVGYILGDAP"
FT   misc_feature    complement(9038..9241)
FT                   /note="HMMPfam hit to PF00486, DE Transcriptional
FT                   regulatory protein, C terminal, score 8.1e-26"
FT   misc_feature    complement(9317..9676)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 1.6e-34"
FT   CDS_pept        9921..10316
FT                   /transl_table=11
FT                   /locus_tag="ECA0009"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi putative outer membrane proteinYgiW or stm3176 or
FT                   sty3353 SWALL:Q8XGT5 (EMBL:AE008846) (130 aa) fasta scores:
FT                   E(): 1.8e-27, 63.35% id in 131 aa, and to Yersinia pestis
FT                   putative exported protein ypo3027 or y1455 SWALL:Q8ZCG4
FT                   (EMBL:AJ414155) (137 aa) fasta scores: E(): 1.4e-20, 50.73%
FT                   id in 136 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72933"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB89"
FT                   /protein_id="CAG72933.1"
FT                   /translation="MKKAAALFAITALVSAPVFAAQSGGGFVNPETSAVGTHKGGFIDP
FT                   QNSLTTVDKAKDLRDDSWVTLSGNIEKRIGDENYLFRDSTGTMEVEIDHKRWNGQMVSP
FT                   TDKVEIQGELDKDFNSVELDVKQIRKL"
FT   misc_feature    9921..9980
FT                   /note="Signal peptide predicted for ECA0009 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   CDS_pept        10521..10940
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="ECA0010"
FT                   /product="high affinity ribose transport protein"
FT                   /note="Similar to Escherichia coli high affinity ribose
FT                   transport protein RbsD SWALL:RBSD_ECOLI (SWALL:P04982) (151
FT                   aa) fasta scores: E(): 6.7e-35, 66.9% id in 139 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72934"
FT                   /db_xref="GOA:Q6DB88"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB88"
FT                   /protein_id="CAG72934.1"
FT                   /translation="MKKAALLNSDISSVIARLGHTDSLVIGDAGLPIPETTTRIDLALT
FT                   HNVPTFLQVVNVVTSEMQVEAAILAEEMIEKNPAVHDALLDQLKRLEQHQGNSIALHYV
FT                   SHEEFKTQSGKSRAIIRSGECSPYANVILCAGVTF"
FT   CDS_pept        10948..12453
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="ECA0011"
FT                   /product="ribose transport ATP-binding protein"
FT                   /note="Similar to Escherichia coli ribose transport
FT                   ATP-binding protein RbsA SWALL:RBSA_ECOLI (SWALL:P04983)
FT                   (501 aa) fasta scores: E(): 1.4e-147, 84.43% id in 501 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72935"
FT                   /db_xref="GOA:Q6DB87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB87"
FT                   /protein_id="CAG72935.1"
FT                   /translation="MQPLLQLQGITKSFPGVKALSGAALNVYPGKVMALVGENGAGKST
FT                   MMKVLTGIYRKDAGSIHFLGQEVDFNGPKASQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFTNRFGRIDWNKMYAEADKLLKRLNLRYDSRRMVGDLSIGDQQMVEIAKVLSFESKVI
FT                   IMDEPTDALTDTETASLFSVINELQSQGCGIVYISHRLKEIFEICDDITVFRDGQFIGE
FT                   RPVSDLEEDTLIEMMVGRKLEDQYPRSNKAPGEVRLKVQNLSGPGVDSVSFTVRKGEIL
FT                   GVAGLMGAGRTELMKILYGALPRTGGNVTLDGRDVVTRKPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSHAGGRLKHAEEQLTVADFIRLFNVKTPSMEQPIGLLSGG
FT                   NQQKVAIARGLMTRPNVLILDEPTRGVDVGAKKEIYQLINQFKEEGLSIILVSSEMPEV
FT                   LGMSDRIIVMHEGRLSGDFPIEQATQEALMAAAVGKQYGAKQE"
FT   misc_feature    11035..11598
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   3.7e-50"
FT   misc_feature    11056..11079
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    11779..12360
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.5e-35"
FT   misc_feature    12133..12177
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        12461..13429
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="ECA0012"
FT                   /product="ribose transport permease system protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi ABC superfamily RbsC SWALL:Q8XFM3 (EMBL:AE008881)
FT                   (321 aa) fasta scores: E(): 2.1e-96, 89.02% id in 319 aa,
FT                   and to Escherichia coli, Escherichia coli O6, and
FT                   Escherichia coli O157:H7 ribose transport system permease
FT                   protein RbsC SWALL:RBSC_ECOLI (SWALL:P04984) (321 aa) fasta
FT                   scores: E(): 2.3e-96, 88.71% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72936"
FT                   /db_xref="GOA:Q6DB86"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB86"
FT                   /protein_id="CAG72936.1"
FT                   /translation="MSSQSIAAKRWFSKEWLLEQKSLIALLILIAVVSALSPNFFTLNN
FT                   LFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEVNALVAVFGA
FT                   LAVGALIGAGTGVIVSKGKVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFSDVADAFGW
FT                   FGIGRPLGIPTPIWIMAIVFAAAWYMLHHTRLGRYIYALGGNESATRLSGISVDKIKII
FT                   VYSLCGLLSALAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIG
FT                   ALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKSSK"
FT   misc_feature    12461..12565
FT                   /note="Signal peptide predicted for ECA0012 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.929) with cleavage site
FT                   probability 0.303 between residues 35 and 36"
FT   misc_feature    order(12524..12592,12653..12721,12749..12817,12836..12904,
FT                   12962..13030,13121..13189,13283..13351)
FT                   /note="7 probable transmembrane helices predicted for
FT                   ECA0012 by TMHMM2.0 at aa 22-44, 65-87, 97-119, 126-148,
FT                   168-190, 221-243 and 275-297"
FT   misc_feature    12584..13420
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 3.6e-05"
FT   CDS_pept        13455..14342
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="ECA0013"
FT                   /product="ribose-binding periplasmic protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi D-ribose-binding periplasmic protein precursor RbsB
FT                   SWALL:RBSB_SALTY (SWALL:P02926) (296 aa) fasta scores: E():
FT                   4.9e-82, 84.4% id in 295 aa, and to Escherichia coli
FT                   D-ribose-binding periplasmic protein precursor RbsB
FT                   SWALL:RBSB_ECOLI (SWALL:P02925) (296 aa) fasta scores: E():
FT                   1.8e-81, 84.06% id in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72937"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB85"
FT                   /protein_id="CAG72937.1"
FT                   /translation="MNMKKLATLVSAVALSATVSANALAKDTVALVVSTLNNPFFVSMK
FT                   EGAQKEADKLGYELIVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAIKMAN
FT                   QAKIPVITLDRVASSGDVVSHVASDNAFGGKVAGDFIAKKLGEGAKVIQLEGIAGTSAA
FT                   RERGAGFMKSAEKNKFAMLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGA
FT                   LRALQTAGKTDVLVVGFDGTQDGVKAVESGKLAATVAQRPDQIGVIGIETAAKVLKGEK
FT                   TQAIIPVDLKLVAK"
FT   misc_feature    13455..13529
FT                   /note="Signal peptide predicted for ECA0013 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.931 between residues 25 and 26"
FT   misc_feature    13530..14336
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   2.4e-14"
FT   misc_feature    14127..14150
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        14538..15464
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="ECA0014"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ribokinase RbsK or b3752 or z5253 or ecs4694
FT                   SWALL:RBSK_ECOLI (SWALL:P05054) (309 aa) fasta scores: E():
FT                   8.4e-81, 73.35% id in 304 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72938"
FT                   /db_xref="GOA:Q6DB84"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB84"
FT                   /protein_id="CAG72938.1"
FT                   /translation="MKTGKLVVLGSINADHILNLEQFPRPGETVIGEQYSVAFGGKGAN
FT                   QAVAAGRSGANIAFIACVGEDDIGSRICQQLSKDNIDVSAVEAISGETTGVALIFVNAE
FT                   AENMIAINAGANAAVTPDYLHRHQQHIIDASALLMQLESPLETVIAAARLAHEHQTKVI
FT                   LNPAPARELPDELLSLVDMITPNETEAQLLTEITVETEEDAARAAQVLHDKGIETVLIT
FT                   LGSRGVWLSESGQGQRIPGYRVKAVDTIAAGDTFNGALVTALLENQPMSSAVKFAHAAA
FT                   AISVTRRGAQPSVPWREEIDAFLQAQE"
FT   misc_feature    14556..15428
FT                   /note="HMMPfam hit to PF00294, DE pfkB family carbohydrate
FT                   kinase, score 3.2e-83"
FT   misc_feature    14655..14729
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT   misc_feature    15279..15320
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   CDS_pept        15468..16463
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="ECA0015"
FT                   /product="ribose operon repressor"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri ribose
FT                   operon repressor RbsR SWALL:AAN45274 (EMBL:M13169) (330 aa)
FT                   fasta scores: E(): 2.9e-90, 68.99% id in 329 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72939"
FT                   /db_xref="GOA:Q6DB83"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB83"
FT                   /protein_id="CAG72939.1"
FT                   /translation="MATMKDVARLAGVSTSTVSHVINNNRFVSDAIREKIMKAVDDLNY
FT                   APSALARSLKINQTRTIGMLLTASSNPFYAEVVRGVERCCYERGYSLILCNTEGDRDRM
FT                   SHSLETLLQKRVDGVLLMCTESHRPLPEMMSRYPSIPMVMMDWAPFEGAIDVIKDNSLL
FT                   GGEIATNYLISRGYKKIACIAGPKDKTTAYNRLEGYRQAMQLAGLSVPTDYEIFGDFEF
FT                   ETGYRAMQQLLALEDKPEAVFTSNDAMAVGVYHALYQAGLSIPQDMAVIGYDDIELARY
FT                   MSPPLTTVHQPKDELGELAVDTLLYRLEHPNTEPNVLVLTPELMVRQSVQ"
FT   misc_feature    15468..15548
FT                   /note="HMMPfam hit to PF00356, DE Bacterial regulatory
FT                   proteins, lacI family, score 1.8e-12"
FT   misc_feature    15471..15536
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2156.000, SD 6.53 at aa 2-23, sequence
FT                   ATMKDVARLAGVSTSTVSHVIN"
FT   misc_feature    15477..15533
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT   misc_feature    15642..16454
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   9.5e-24"
FT   rRNA            16895..18438
FT                   /note="16S rRNA"
FT   tRNA            18580..18655
FT                   /note="tRNA Glu anticodon TTC, Cove score 56.95"
FT   rRNA            18884..21791
FT                   /note="23S rRNA"
FT   rRNA            21919..22038
FT                   /note="5S rRNA"
FT   CDS_pept        complement(22163..22684)
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="ECA0016"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="Similar to Escherichia coli molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B MobB SWALL:MOBB_ECOLI
FT                   (SWALL:P32125) (174 aa) fasta scores: E(): 1.2e-34, 64.84%
FT                   id in 165 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72940"
FT                   /db_xref="GOA:Q6DB82"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB82"
FT                   /protein_id="CAG72940.1"
FT                   /translation="MNSNHLPLLAIVAYSGTGKTTLLKHVIPLLANQGIRIGLIKHTHH
FT                   QMDIDTPGKDSYELRKAGAAQTIVASSQRWALMTETPEQEEPDLYDLAEKMDASTLDLV
FT                   LVEGFKHEKIAKIALFRQSLGRELSDLIDEYVIAIAADSEIGTILPVLDINQPEQVANF
FT                   IHQWLQSSRL"
FT   misc_feature    complement(22262..22666)
FT                   /note="HMMPfam hit to PF03205, DE Molybdopterin guanine
FT                   dinucleotide synthesis protein B, score 1.1e-53"
FT   misc_feature    complement(22625..22648)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(22674..23264)
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="ECA0017"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="Similar to Escherichia coli molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A MobA SWALL:MOBA_ECOLI
FT                   (SWALL:P32173) (194 aa) fasta scores: E(): 6.7e-35, 47.84%
FT                   id in 186 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72941"
FT                   /db_xref="GOA:Q6DB81"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB81"
FT                   /protein_id="CAG72941.1"
FT                   /translation="MGSKMITGVILAGGRATRMGGHDKGLIVLNGVPLYLHVLSRLKTQ
FT                   VDEVIISANRNQDVYEQSGCRIIGDSDANFLGPLAGILSGLHASTSEWVVFVPCDVPVF
FT                   PLDLVRRLWQARGEANATYARDGERPHPTLLLINKNLIEQLEAYLHLGNRKLMLFMEQV
FT                   GAKPVSFNDQPEAFHNLNSPEDLSNWEDHHREF"
FT   CDS_pept        23466..23735
FT                   /transl_table=11
FT                   /locus_tag="ECA0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pectobacterium carotovorum subsp.
FT                   carotovorum YihD SWALL:Q9RB12 (EMBL:AF146615) (89 aa) fasta
FT                   scores: E(): 6.6e-33, 98.87% id in 89 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 protein YihD SWALL:YIHD_ECOLI (SWALL:P32126) (89
FT                   aa) fasta scores: E(): 1.8e-26, 80.89% id in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72942"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB80"
FT                   /protein_id="CAG72942.1"
FT                   /translation="MKCHRVNELIELLHPAWQKEPDLNLVQFLQNLAQEAGFEGQLNEL
FT                   TDDILIYHLKMRDSDKEQVIPGLKKDYEEDFKTALLRARGVIKD"
FT   CDS_pept        23805..24800
FT                   /transl_table=11
FT                   /locus_tag="ECA0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pectobacterium carotovorum subsp.
FT                   carotovorum YihE SWALL:Q9RB11 (EMBL:AF146615) (328 aa)
FT                   fasta scores: E(): 5.1e-138, 95.42% id in 328 aa, and to
FT                   Escherichia coli, and Escherichia coli O6 hypothetical
FT                   protein YihE SWALL:YIHE_ECOLI (SWALL:P32127) (328 aa) fasta
FT                   scores: E(): 2e-99, 68.59% id in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72943"
FT                   /db_xref="GOA:Q6DB79"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB79"
FT                   /protein_id="CAG72943.1"
FT                   /translation="MAAMNSSVFNFQTLFPDLIVDALLDVGLRVDSGLTALNSYENRVY
FT                   QFADEDRKRFVVKFYRPERWSESQIQEEHIFALQLAEDEVPIVAPVSLNGQTLNVYEGF
FT                   HFAVFPSIGGRQYEMDNEEQLEWVGRFLGRIHQTGQKSLFTERPTIGVNEYLHEPYRLL
FT                   ETCPLIPKIHRHSFLQATRQLIDTVETYWHSDWRPLRLHGDCHPGNILWRDGPLFVDLD
FT                   DARNGPAIQDLWMLLHGDRREQRIQLDILLEAYSEFADFQEKELALIEPLRAMRQVYYL
FT                   AWIARRWEDPAFPKNFPWMTDADFWLKQTAIFIGQNQLLQEPPLQLMPMY"
FT   CDS_pept        24825..25448
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="ECA0020"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="Similar to Erwinia carotovora thiol:disulfide
FT                   interchange protein DsbA precursor SWALL:DSBA_ERWCA
FT                   (SWALL:Q9RB10) (207 aa) fasta scores: E(): 1.2e-76, 98.55%
FT                   id in 207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72944"
FT                   /db_xref="GOA:Q6DB78"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB78"
FT                   /protein_id="CAG72944.1"
FT                   /translation="MKRLWLALIGVVLAFSASAAEFSDGKQYVELDKPATQEPQVLEFF
FT                   SFYCPHCYQFEQVYHVPDAVKKALPEGTKMTRYHVDFLGPLGKNLTQAWAVAMALGVED
FT                   KITPLMFDAVQKTQTVQKPEDIRAVFVKAGVSAEEFDGALNSFVVKSLVAQQEKAAADL
FT                   QLRGVPAMFVNGKYMIKNDGLDTSSMDGYVKQYADVVKFLITKK"
FT   misc_feature    24825..24881
FT                   /note="Signal peptide predicted for ECA0020 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 19 and 20"
FT   misc_feature    24825..25442
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01323, DE DSBA-like thioredoxin
FT                   domain, score 1.8e-146"
FT   misc_feature    24945..25001
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        25826..28615
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="ECA0021"
FT                   /product="putative DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase I PolA
FT                   SWALL:DPO1_ECOLI (SWALL:P00582) (928 aa) fasta scores: E():
FT                   0, 76.21% id in 929 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72945"
FT                   /db_xref="GOA:Q6DB77"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB77"
FT                   /protein_id="CAG72945.1"
FT                   /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNSAGEATGAMYGVLNM
FT                   LRSLLLQYHPSHVAVVFDAKGKTFRDELFENYKAHRPPMPEDLREQIEPLHSMVKAMGL
FT                   PLLAVSGVEADDVIGTLAVQAEKAGKSVLISTGDKDMAQLVTPSVTLINTMNNTILGPQ
FT                   EVCDKYGIPPELIIDFLALMGDASDNIPGVPGVGEKTAQALLQGLGGLDSLYANLDKIA
FT                   ELSFRGAKTMAPKLEQHKEVAYLSYQLATIKTDVELELSCEQLTVNELDVDELHRLFSR
FT                   YEFKRWLSDIESGTWMQGKKSSQPVQTVSNAVVEQAVEEDNAPTLSADGYVTILDEKTL
FT                   LDWIERLKQAEVFAFDTETDGLDTLTANLIGLSFAIKPGEAAYLPLAHDYLDAPEQLDR
FT                   AQVLALFKPLLEDEKLLKIGQNLKFDKGVMQRYDIDLRGIAFDTMLESYVLDSVAGRHD
FT                   MDSLAERYLKHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLHLHQTLWGKL
FT                   QPHADLCQVFQAIDMPLVPVLSRIERTGVLIDPAILAEHSKELTTRLAGLETQAYELAG
FT                   EEFNLASTKQLQGILYEKQKLPILKKTPKGAPSTNEEVLAELALDYPLPKLILEYRGLA
FT                   KLKSTYTDKLPLMINPATKRVHTSYHQAVTATGRLSSSDPNLQNIPVRNDEGRRIRQAF
FT                   IASKGYSIVAADYSQIELRIMAHLSGDKGLLNAFANGLDIHRATASEVFGIALDKVTSE
FT                   QRRSAKAINFGLIYGMSAFGLSRQLNIPRSESQKYMNLYFERYPGVQDYMERTRQQAAE
FT                   HGYVSTLDGRRLYLPDIHSRNAMARKGAERAAINAPMQGTAADIIKKAMISIDDWLQKD
FT                   TPLVKMIMQVHDELVFEIHDSVIEESISKIKILMEGCMQLNVPLQVDIGTGMNWDQAH"
FT   misc_feature    25844..26332
FT                   /note="HMMPfam hit to PF02739, DE 5'-3' exonuclease,
FT                   N-terminal resolvase-like domain, score 9.6e-89"
FT   misc_feature    26336..26656
FT                   /note="HMMPfam hit to PF01367, DE 5'-3' exonuclease,
FT                   C-terminal SAM fold, score 1.3e-53"
FT   misc_feature    26798..27379
FT                   /note="HMMPfam hit to PF01612, DE 3'-5' exonuclease, score
FT                   1.7e-62"
FT   misc_feature    27467..28609
FT                   /note="HMMPfam hit to PF00476, DE DNA polymerase family A,
FT                   score 1.2e-211"
FT   misc_feature    28088..28147
FT                   /note="PS00447 DNA polymerase family A signature."
FT   misc_RNA        28751..28868
FT                   /gene="spot_42"
FT                   /note="Erwinia_carotovora 28751 28868 RF00021 1 60 45.81
FT                   Spot_42"
FT   CDS_pept        complement(29034..29669)
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="ECA0022"
FT                   /product="probable GTP-binding protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   probable GTP-binding protein EngB SWALL:ENGB_ECOLI
FT                   (SWALL:P24253) (210 aa) fasta scores: E(): 2.3e-61, 83.49%
FT                   id in 206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72946"
FT                   /db_xref="GOA:Q6DB76"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB76"
FT                   /protein_id="CAG72946.1"
FT                   /translation="MTQQYNYHMTRFIISAPDIRHLETDNGIEVAFAGRSNAGKSSALN
FT                   TLTNQKSLARTSKTPGRTQLINLFQVAEGVRLVDLPGYGYAEVPEQMKIKWQRALGEYL
FT                   QKRNSLKGLVVLMDIRHPLKDLDQQMILWAVDVKLPVLVLLTKADKLASGARKAQLNMV
FT                   REAVLPFMGDIQVEAFSSLKKIGVDKLQQKLDNWFSTLQHIEEEQDAE"
FT   misc_feature    complement(29547..29570)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        29873..30427
FT                   /transl_table=11
FT                   /locus_tag="ECA0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   SWALL:Q8ZJR9 (EMBL:AJ414141) (188 aa) fasta scores: E():
FT                   7.4e-26, 58.96% id in 173 aa, and to Escherichia coli
FT                   O157:H7 orf, hypothetical protein SWALL:Q8X8G9
FT                   (EMBL:AE005617) (168 aa) fasta scores: E(): 2e-12, 53.29%
FT                   id in 167 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72947"
FT                   /db_xref="GOA:Q6DB75"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB75"
FT                   /protein_id="CAG72947.1"
FT                   /translation="MNRPVKGVADKAEKSKVKRKTREELEREARERKRDKKHRGHSAGS
FT                   RTQEKASTDQNSGQRKVADPRIGSKKPVQLGVLDSAIVKPKPKSKPSEPVEKVVAAKPT
FT                   MSPEEELAMLENDTRLDALLDRLDSGETLSAKDQSWVDETLDRIDILMEELGIELGDDD
FT                   EEEQQEDMLQLLKRNNPKDAL"
FT   CDS_pept        30749..32122
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="ECA0026"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="Similar to Escherichia coli oxygen-independent
FT                   coproporphyrinogen III oxidase HemN SWALL:HEMN_ECOLI
FT                   (SWALL:P32131) (457 aa) fasta scores: E(): 3.5e-152, 80.96%
FT                   id in 457 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72948"
FT                   /db_xref="GOA:Q6DB74"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB74"
FT                   /protein_id="CAG72948.1"
FT                   /translation="MSIPSVDWDLALIQKYNYSGPRYTSYPTALEFSEAYDEPAFQHAI
FT                   ARYPQRPLSLYIHIPFCHRLCYFCGCNKLVTRQQHKADEYLDVLELEIRQRAPLFAGRT
FT                   VTQLHWGGGTPTYLNKVQISRLMSLLRELFSFSEQAELSLEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKDVQKLVNREQDEDFIFALIERAKALGFTSTNIDLIYGLPKQTPESF
FT                   AFTLQRVAELSPHRLSVFNYAHLPSLFAAQRKIKDADLPSAEQKLDILQQTIGSLTQSG
FT                   YQFIGMDHFARPDDELAVAQREGTLHRNFQGYTTQGDSDLLGMGVSAISMIGDNYAQNQ
FT                   KELKQYYAQVKDKGNGLWRGLQLTRDDCLRRDVIKTLICNFQLSYAPIEAEYAIDFKTY
FT                   FEQDLALLAPLVADGLVDSQEDGLAVTPKGRLLIRNICMCFDVYLRSKLRTQQFSRVI"
FT   misc_feature    31043..31804
FT                   /note="HMMPfam hit to PF02473, , score 7.7e-160"
FT   CDS_pept        complement(32447..33859)
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /gene_synonym="ntrC"
FT                   /gene_synonym="glnT"
FT                   /locus_tag="ECA0027"
FT                   /product="nitrogen regulation two-component system,
FT                   response regulator"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 nitrogen regulation protein nr(I) GlnG or NtrC or
FT                   GlnT SWALL:NTRC_ECOLI (SWALL:P06713) (469 aa) fasta scores:
FT                   E(): 1.9e-160, 91.91% id in 470 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72949"
FT                   /db_xref="GOA:Q6DB73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB73"
FT                   /protein_id="CAG72949.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALAGAGLTCATFENGNQVLHALAT
FT                   QTPDVLLSDIRMPGMDGLALLQQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALAERAISHYLEQQQPVRNQPINGPTTDIIGEAPAMQDVFRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRTKAPFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QIRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAAVKVDVRIIAAT
FT                   HQNLEQRVQEGKFRDDLFHRLNVIRVHLPPLRERREDIPRLARYFLQATAKELGVEPKN
FT                   LHPEAETALTRLPWPGNVRQLENTCRWLTVMAAGQEVLIQDLPPELFETTAPDSTVHIL
FT                   PDSWATLLAQWADRALRSGHQNLLAEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRN
FT                   TLTRKLKELGME"
FT   misc_feature    complement(32459..32581)
FT                   /note="HMMPfam hit to PF02954, DE Bacterial regulatory
FT                   protein, Fis family, score 3e-15"
FT   misc_feature    complement(32465..32530)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1763.000, SD 5.19 at aa 444-465, sequence
FT                   GHKQEAARLLGWGRNTLTRKLK"
FT   misc_feature    complement(32771..32800)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    complement(32774..33439)
FT                   /note="HMMPfam hit to PF00158, DE Sigma-54 interaction
FT                   domain, score 5.6e-144"
FT   misc_feature    complement(33134..33181)
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    complement(33326..33367)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   misc_feature    complement(33491..33850)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 6e-38"
FT   CDS_pept        complement(33868..34917)
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /gene_synonym="ntrB"
FT                   /gene_synonym="glnR"
FT                   /locus_tag="ECA0028"
FT                   /product="nitrogen regulation two-component system,
FT                   histidine kinase"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri nitrogen regulation protein
FT                   nr(II) GlnL or NtrB or GlnR SWALL:AAN45374 (EMBL:X05173)
FT                   (349 aa) fasta scores: E(): 1.2e-108, 84.81% id in 349 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72950"
FT                   /db_xref="GOA:Q6DB72"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB72"
FT                   /protein_id="CAG72950.1"
FT                   /translation="MATGTLPDAGQILNSLINSILLLDNDLAIHYSNPAAQQLLAQSSR
FT                   KLSGTPLPDLLGYFSLNIDLLRESLDSGQGFTDNEVTLVVDGKAHIMSLTAQRVQNDFI
FT                   LLEMAPMDNQRRLSQEQLQHAQQQAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA
FT                   LTEYTKVIIEQADRLRNLVDRLLGPQQPGLHVTQSIHQVAERVCQLVSLEKPDNVTLVK
FT                   DYDPSLPELTHDPDQIEQVLLNITRNALQALGEEGGTITIRTRTAFQLTLHGVRYRLAA
FT                   RIDVEDDGPGVPAQLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   misc_feature    complement(33874..34221)
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.4e-28"
FT   misc_feature    complement(34336..34533)
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 2.5e-14"
FT   CDS_pept        complement(35258..36667)
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="ECA0029"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri glutamine
FT                   synthetase GlnA or b3870 or c4819 or z5406 or ecs4792 or
FT                   sf3940 SWALL:GLNA_ECOLI (SWALL:P06711) (468 aa) fasta
FT                   scores: E(): 3e-170, 90.17% id in 468 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72951"
FT                   /db_xref="GOA:Q6DB71"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB71"
FT                   /protein_id="CAG72951.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAMIDPFFEDTTLIIRCDILEPGTMQGYDRD
FT                   PRSIAKRAEDFLRSSGIADTVLFGPEPEFFLFDDIRFGSSTSGSHVAIDDVEAYWNSGK
FT                   AYEGGNKGHRPGLKGGYFPVPPVDSSQDIRSAMCLTMEQMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAYGKTATFMPKPMFGDNGSGMHCHMSLSKDGTN
FT                   LFAGDKYGGLSEMALFYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEALAALNEDREFLTRGGVFTDDAIEAYIELRKPEIDRVRMTP
FT                   HPVEFELYYSV"
FT   misc_feature    complement(35474..35512)
FT                   /note="PS00182 Glutamine synthetase class-I adenylation
FT                   site."
FT   misc_feature    complement(35519..36364)
FT                   /note="HMMPfam hit to PF00120, DE Glutamine synthetase,
FT                   catalytic domain, score 1.2e-166"
FT   misc_feature    complement(35846..35893)
FT                   /note="PS00181 Glutamine synthetase putative ATP-binding
FT                   region signature."
FT   misc_feature    complement(36380..36628)
FT                   /note="HMMPfam hit to PF03951, DE Glutamine synthetase,
FT                   beta-Grasp domain, score 7.9e-47"
FT   misc_feature    complement(36464..36520)
FT                   /note="PS00180 Glutamine synthetase signature 1."
FT   CDS_pept        37037..38860
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /gene_synonym="bipA"
FT                   /locus_tag="ECA0030"
FT                   /product="GTP-binding regulatory protein"
FT                   /note="Similar to Escherichia coli GTP-binding protein TypA
FT                   or BipA or b3871 SWALL:TYPA_ECOLI (SWALL:P32132) (591 aa)
FT                   fasta scores: E(): 1.1e-189, 90.18% id in 591 aa. Found to
FT                   be a virulence regulator in an enteropathogenic Escherichia
FT                   coli (PMID: 9622352)."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72952"
FT                   /db_xref="GOA:Q6DB70"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB70"
FT                   /protein_id="CAG72952.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERVEATERVMDS
FT                   NDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFANGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALNGIAGLDHNDMAEDMTPLYQAIVDHVSPPLVEMDAPFQMQISQLDYNNYVGVIG
FT                   IGRIKRGKVKPNQQVTIVDSEGKTRNGKVGKVLTHLGLERIDATEAEAGDIIAITGLGE
FT                   LNISDTICDPQNVEALPALSVDEPTVTMFFNVNTSPFCGKEGKYVTSRQILERLNKELV
FT                   HNVALRVDETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRVIDGRNQEP
FT                   FENVTLDIEEQHQGSVMQAMGERKGDVKDMIPDGKGRIRLDYLIPARGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRQGEIGQRQNGVLVSNGQGKAVAFALFSLQDRGKLFLGHGAE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEATTLVPAIKMSLEQALEFIDDDE
FT                   LVEVTPQSVRIRKRHLTENDRKRASRGSKDV"
FT   misc_feature    37043..37630
FT                   /note="HMMPfam hit to PF00009, DE Elongation factor Tu GTP
FT                   binding domain, score 2.5e-73"
FT   misc_feature    37070..37093
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    37166..37213
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT   misc_feature    37655..37903
FT                   /note="HMMPfam hit to PF03144, DE Elongation factor Tu
FT                   domain 2, score 5.9e-16"
FT   misc_feature    38219..38485
FT                   /note="HMMPfam hit to PF00679, DE Elongation factor G
FT                   C-terminus, score 1.6e-28"
FT   CDS_pept        39022..39633
FT                   /transl_table=11
FT                   /locus_tag="ECA0031"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   SWALL:AAM87347 (EMBL:AJ414141) (196 aa) fasta scores: E():
FT                   4.3e-55, 71.42% id in 196 aa, and to Escherichia coli
FT                   hypothetical protein YihX SWALL:YIHX_ECOLI (SWALL:P32145)
FT                   (199 aa) fasta scores: E(): 2.8e-51, 64.61% id in 195 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72953"
FT                   /db_xref="GOA:Q6DB69"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB69"
FT                   /protein_id="CAG72953.1"
FT                   /translation="MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFE
FT                   QHERGEISDEEFATRLCQEMGIALSFEQFTAGWQAIFVALRPEVIDIMQRLRQEGHRVV
FT                   ILSNTNRLHCSHWPALFPEVATAADRLYLSQDIGLRKPELAIYQYVLTQEGVTPAQAVF
FT                   FDDNSANVDAAQSLGIHSILVTDRQVVTDFFAMQAITAKA"
FT   misc_feature    39022..39582
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 2.8e-14"
FT   CDS_pept        39698..40135
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="ECA0032"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   D-tyrosyl-tRNA Dtd SWALL:DTD_ECOLI (SWALL:P32147) (145 aa)
FT                   fasta scores: E(): 6.4e-42, 75.69% id in 144 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72954"
FT                   /db_xref="GOA:Q6DB68"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB68"
FT                   /protein_id="CAG72954.1"
FT                   /translation="MIALIQRVSSASVTVEGNIIGEIDKGLLILLGVEQGDDEQKATRL
FT                   CERVLGYRIFADDDGKMNLNVRQAGGNVLVVSQFTLVADTQRGMRPGFSRGADPSEADR
FT                   LYQYFVEQCREQGVHTETGQFAADMKVALVNDGPVTFWLQT"
FT   misc_feature    39779..40129
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02580, DE D-Tyr-tRNA(Tyr)
FT                   deacylase, score 2.5e-71"
FT   CDS_pept        40213..41199
FT                   /transl_table=11
FT                   /locus_tag="ECA0033"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hypothetical protein YiiD
FT                   SWALL:YIID_ECOLI (SWALL:P32148) (329 aa) fasta scores: E():
FT                   1.6e-108, 82.31% id in 311 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi putative
FT                   acetyltransferase YiiD SWALL:Q8XF59 (EMBL:AE008888) (329
FT                   aa) fasta scores: E(): 2.7e-107, 81.34% id in 311 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72955"
FT                   /db_xref="GOA:Q6DB67"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB67"
FT                   /protein_id="CAG72955.1"
FT                   /translation="MSHGAIKHHRHRGRVMYHLRVPESAEDLDAYYQFRWEMLRKPLHQ
FT                   PLGSERDAYDALAHHQTVVDEQGRLVAIGRLSINADNEAAIRFLAVHPDLRGKGLGTLL
FT                   AITLESVARQEGVKRVVCSAREDAMDFFSKLGFVNQGEISAPQTTPVRHFLMIKPVATL
FT                   DDILHRADWCGQLQQAWYDHIPLSEKMGVRISQYTGKKFITTMPEAGNQNPHHTLFAGS
FT                   MFSLATLTGWGLIWLLLRERHLGGTIILADAHIRYSTPVSGRPSAIADLGSLSGDLDRL
FT                   ARGRKARVQLNVELFGDDNKGALFEGVYIVLPAQPDAPLEEGGSEVD"
FT   misc_feature    40396..40626
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 3.4e-16"
FT   CDS_pept        complement(41509..43200)
FT                   /transl_table=11
FT                   /locus_tag="ECA0034"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis possible exported protein
FT                   ypo0033 SWALL:Q8ZJQ9 (EMBL:AJ414141) (569 aa) fasta scores:
FT                   E(): 1.9e-128, 55.37% id in 558 aa, and to Escherichia coli
FT                   O6 hypothetical protein YicH SWALL:AAN82916 (EMBL:AE016769)
FT                   (577 aa) fasta scores: E(): 5.3e-123, 48.92% id in 558 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72956"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB66"
FT                   /protein_id="CAG72956.1"
FT                   /translation="MKFIGKLLLTLLLLAFLALVVVYVLLQTSWAAGWVSNWVNQNTDY
FT                   QLSLGKINHDWSTADHIQLTDVSFGQKNQPPTLTAKQVSAGFSVRQVTEPHHFASLELE
FT                   GGTLNLSSQAATLPIEADVLQLRTMALQAKDGDWRLNGQQINGGIMPWQPEAGYLLGKQ
FT                   GQFQLSARSLKLNDIPASQVLVQGEINHNQLILSNFGADVAQGQLTGNASRAEDGSWQV
FT                   GSLRLSNVRLQTQRTPEAFWQPVTELPSVTVNRFDLIDARIEGPGWAFIDLDVALQNVT
FT                   FKQNDWQSEGGTLSFNATDIVNGNMHLIDPIVNLDLSPAGINIKQFSTRWEGGLLRTNG
FT                   NWQRNNRRLQINEFVVAGMEYTLPGDWRQRWQATLPSWLAEVNVRKFTANRNLLIDINP
FT                   DFPFQLTALDGYGSDLLLARNHQWGMWTGSLNLNASNATFNKVDVRRPSIALVTNDNQI
FT                   AINELSAFTQNGMLDAKATINQQPARNFSLSLTGRAVPLDVLTRWGWPEPTTAPTGNTN
FT                   LQLQLNGRLAADTPLKPTLNGTLQGVDSNDHPIRQQMHQGAVTEAQ"
FT   misc_feature    complement(43108..43200)
FT                   /note="Signal peptide predicted for ECA0034 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.912 between residues 31 and 32"
FT   CDS_pept        complement(43358..44746)
FT                   /transl_table=11
FT                   /locus_tag="ECA0035"
FT                   /product="putative purine permease"
FT                   /note="Similar to Yersinia pestis putative membrane
FT                   permease ypo0034 SWALL:Q8ZJQ8 (EMBL:AJ414141) (461 aa)
FT                   fasta scores: E(): 1.8e-149, 86.98% id in 461 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 putative purine permease YicE SWALL:YICE_ECOLI
FT                   (SWALL:P27432) (463 aa) fasta scores: E(): 3.4e-148, 85.65%
FT                   id in 460 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72957"
FT                   /db_xref="GOA:Q6DB65"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB65"
FT                   /protein_id="CAG72957.1"
FT                   /translation="MTTTTETSQTEAAAAPQRSELIYRLEDRPPLPQTLFAASQHLLAM
FT                   FVAVITPALLICQALGLPAQDTQRIISMSLFASGLASILQIKTWGPVGSGLLSIQGTSF
FT                   NFVTPLIMGGLALKNGGADVPTMMAALFGTLMVASFTEIILSRFLHLTRRIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYAAMGNNTFGAPKNLLLAGAVLVVIILLNRQRNPYLRVA
FT                   SLVIAMAVGYLGAWLMGMLPESAPAPHDTVIMVPTPLYYGLGFDWNLLIPLMLIFMVTS
FT                   LETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSCLSAVFNTFPNSCFGQNNGVI
FT                   QLTGVASRYVGFVVSLMLIALGLFPAVSGFVQHIPEPVLGGATIVMFGTIAASGVRIVS
FT                   REPLNRRAIMIIALSLAVGLGVSQQPLILQFAPDWIKTLLSSGIAAGGITAIVLNIVFP
FT                   HEEK"
FT   misc_feature    complement(order(43376..43435,43463..43531,43550..43618,
FT                   43646..43714,43901..43969,44027..44095,44114..44173,
FT                   44216..44284,44303..44371,44399..44467,44555..44623))
FT                   /note="11 probable transmembrane helices predicted for
FT                   ECA0035 by TMHMM2.0 at aa 42-64, 94-116, 126-148, 155-177,
FT                   192-211, 218-240, 260-282, 345-367, 377-399, 406-428 and
FT                   438-457"
FT   misc_feature    complement(43466..44653)
FT                   /note="HMMPfam hit to PF00860, DE Permease family, score
FT                   1.6e-151"
FT   misc_feature    complement(43565..43627)
FT                   /note="PS01116 Xanthine/uracil permeases family signature."
FT   misc_feature    complement(44117..44164)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   CDS_pept        complement(45107..47188)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ECA0036"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Salmonella typhimurium DNA helicase,
FT                   resolution of holliday junctions, branch migration RecG
FT                   SWALL:Q8ZL39 (EMBL:AE008874) (693 aa) fasta scores: E():
FT                   9.6e-214, 82.1% id in 693 aa, and to Escherichia coli
FT                   ATP-dependent DNA helicase RecG SWALL:RECG_ECOLI
FT                   (SWALL:P24230) (693 aa) fasta scores: E(): 8.1e-212, 81.81%
FT                   id in 693 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72958"
FT                   /db_xref="GOA:Q6DB64"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB64"
FT                   /protein_id="CAG72958.1"
FT                   /translation="MKGRLLNTQPLSTLAGVGASQAAKLARLGLETVQDLLLHLPLRYE
FT                   DRTHLYPIGDLLPGMYATVEGEILRNDITFGSRRMLTCQISDGSGLLTMRFFNFSAAMK
FT                   NSLAPGQRVTAYGEIKRGKIGAEIIHPEYRVQGDSTQVELQESLTPVYPSTEGIRQATL
FT                   RKLTDQALELLAANHIDELLPESLSRSLISLPDALRTLHRPPPDMQLSELEHGKHPAQQ
FT                   RLIMEELLAHNLSMLAVRAGEQRHKASPLPTKDSLKQQLLAALPFTPTQAQERVVAEIE
FT                   TDMKKDFPMMRLVQGDVGSGKTLVAALAALRAIANGKQVALMAPTELLAEQHVHNFRQW
FT                   FEPLGLEVGWLAGKQKGKARQAQQDAIASGQVSMVVGTHAIFQQQVKFNGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDSRRSDIIERVNSACQQEGRQAYWVCTLIEESDLLEAQAAEATSEELKAALPN
FT                   LKVGLVHGRMKAQEKLAVMQAFKQGELQLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPMSKTAQKRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGNAEFKVADLLRDRDLIPQVHRVARHLHEHYPEHAIALIERWLPERARYTNA"
FT   misc_feature    complement(45422..45640)
FT                   /note="HMMPfam hit to PF00271, DE Helicase conserved
FT                   C-terminal domain, score 8.3e-22"
FT   misc_feature    complement(45812..46414)
FT                   /note="HMMPfam hit to PF00270, DE DEAD/DEAH box helicase,
FT                   score 1.4e-31"
FT   misc_feature    complement(46280..46303)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(46781..47005)
FT                   /note="HMMPfam hit to PF01336, DE OB-fold nucleic acid
FT                   binding domain, score 2e-07"
FT   CDS_pept        complement(47188..47880)
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /gene_synonym="spoU"
FT                   /locus_tag="ECA0037"
FT                   /product="putative tRNA (guanosine-2'-O)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="Similar to Salmonella typhi tRNA
FT                   (guanosine-2'-O)-methyltransferase TrmH SWALL:Q8Z2I1
FT                   (EMBL:AL627280) (229 aa) fasta scores: E(): 1.5e-72, 79.91%
FT                   id in 229 aa, and to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri tRNA
FT                   (guanosine-2'-O)-methyltransferase TrmH or SpoU
FT                   SWALL:TRMH_ECOLI (SWALL:P19396) (229 aa) fasta scores: E():
FT                   4.8e-72, 79.03% id in 229 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72959"
FT                   /db_xref="GOA:Q6DB63"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB63"
FT                   /protein_id="CAG72959.1"
FT                   /translation="MTPQRYARIKEMLNCRQPDLTICMEQVHKPHNISAVIRTADAVGV
FT                   HQVHAIWPTSRMKTLVSSAAGSNSWVQVKTHRTIQDAVGHLKNEGMQVLATNLSEHAVD
FT                   FREIDYTRPTCILLGQEKTGITAEALKLADRDIIIPMTGMVQSLNVSVASALILYEAQR
FT                   QRQIAGMYQREDSPLDEEEQQRLLFEGGYPVLARVAKHKGLPRPYIDHQGQIVADTPWW
FT                   AAMQSSGC"
FT   misc_feature    complement(47404..47826)
FT                   /note="HMMPfam hit to PF00588, DE SpoU rRNA Methylase
FT                   family, score 6.2e-56"
FT   CDS_pept        complement(47886..49985)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="ECA0038"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri
FT                   guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolase
FT                   SpoTor b3650 or z5076 or ecs4525 or sf3690 SWALL:SPOT_ECOLI
FT                   (SWALL:P17580) (702 aa) fasta scores: E(): 0, 90.74% id in
FT                   702 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72960"
FT                   /db_xref="GOA:Q6DB62"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB62"
FT                   /protein_id="CAG72960.1"
FT                   /translation="MYIFESLNLLIQRYLPEDQIKRLQQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIACRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKELDTCYRVLGQVH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTDDMDQMAEMGVAAHWA
FT                   YKEGESSTTAQVRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEMYVFTPEGRIVEL
FT                   PADATPVDFAYAVHTDIGHACVGARVDRQPYPLSQSLTSGQTVEIITAPGARPNAAWLN
FT                   FVVSSRARSKIRQMLKNLKRDDSVSLGRRLLNHALGNGRKLSDIPEKSIQLELERMKLA
FT                   TLDDLMAEIGMGNAMSVVVAKNLLNEQSELGTSGLRKLPIKGADGVMLSFAKCCRPIPG
FT                   DPIIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDKVTEQEFIAEIKVDMFNHQG
FT                   ALANLTAAINAANSNIQSINTEEKDGRVYSAFIRLTTLDRVHLANIMRKIRVMPDVIKV
FT                   NRNRN"
FT   misc_feature    complement(47904..48116)
FT                   /note="HMMPfam hit to PF01842, DE ACT domain, score 0.046"
FT   misc_feature    complement(48648..48839)
FT                   /note="HMMPfam hit to PF02824, DE TGS domain, score
FT                   1.4e-26"
FT   misc_feature    complement(49554..49853)
FT                   /note="HMMPfam hit to PF01966, DE HD domain, score 2.6e-18"
FT   misc_feature    complement(49824..49856)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(50004..50279)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ECA0039"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, Salmonella typhimurium, and
FT                   Salmonella typhi DNA-directed RNA polymerase omega chain
FT                   RpoZ SWALL:RPOZ_ECOLI (SWALL:P08374) (91 aa) fasta scores:
FT                   E(): 5.1e-29, 93.4% id in 91 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72961"
FT                   /db_xref="GOA:Q6DB61"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB61"
FT                   /protein_id="CAG72961.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQLQTGGKDPLVPEENDK
FT                   YTVIALREIEDGLINNQILDVRDRQEQQEQEAAEIQAVTAIAEGRR"
FT   misc_feature    complement(50085..50246)
FT                   /note="HMMPfam hit to PF01192, DE RNA polymerase Rpb6,
FT                   score 1.8e-21"
FT   CDS_pept        complement(50333..50956)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /gene_synonym="spoR"
FT                   /locus_tag="ECA0040"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Similar to Escherichia coli O6 guanylate kinase Gmk
FT                   or SpoR or b3648 or c4473 or sf3688 SWALL:KGUA_ECOLI
FT                   (SWALL:P24234) (207 aa) fasta scores: E(): 9.5e-66, 87.44%
FT                   id in 207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72962"
FT                   /db_xref="GOA:Q6DB60"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB60"
FT                   /protein_id="CAG72962.1"
FT                   /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVEADEFKRMIQDSEFLEHAEVFGNYYGTSRPAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPQARSIFILPPSKEELARRLRGRGQDSDEVIARRMSQAVAEMTHYGEY
FT                   DYLIVNDDFDLALLDLKTIIRAERLRLSRQKIRHDALITKLLAD"
FT   misc_feature    complement(50522..50836)
FT                   /note="HMMPfam hit to PF00625, DE Guanylate kinase, score
FT                   7.2e-56"
FT   misc_feature    complement(50786..50839)
FT                   /note="PS00856 Guanylate kinase signature."
FT   misc_feature    complement(50903..50926)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        50958..51185
FT                   /transl_table=11
FT                   /locus_tag="ECA0041"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72963"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB59"
FT                   /protein_id="CAG72963.1"
FT                   /translation="MKFIYVTMVDVDIPVILQAACVLASSLTPVTYLSKLLGTHCVAAF
FT                   PQLELFMVYTAGTCAFLRIIHANVPSVALR"
FT   misc_feature    order(51000..51068,51105..51158)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0041 by TMHMM2.0 at aa 15-37 and 50-67"
FT   CDS_pept        51400..53091
FT                   /transl_table=11
FT                   /locus_tag="ECA0043"
FT                   /product="putative DNA ligase"
FT                   /note="Similar to Yersinia pestis putative DNA ligase
FT                   ypo0041 SWALL:Q8ZJQ1 (EMBL:AJ414141) (567 aa) fasta scores:
FT                   E(): 5.8e-121, 49.29% id in 564 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72964"
FT                   /db_xref="GOA:Q6DB58"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB58"
FT                   /protein_id="CAG72964.1"
FT                   /translation="MWLRNSVFLIIIVVGGIGGFPAVAAVCPDWDNTRASKEIDALRQQ
FT                   LEQWDDVYYTEGKSPIEDDVYDQLREQLNQWSQCFQPQNVIPARLPDNGKQPHPVAHTG
FT                   LKKLSDRVQLVQWIVQREDLWVQPKVDGVAVTLVYQHGKLVSAVSRGNGLQGEDWTEKA
FT                   RLIPDIPHLLSGAPSSFVLQGELFLKMTDHRQYAQGGVNARSIVAGEMRRHQPSPVLSQ
FT                   IGLFVWEWPDGPKAMPERLDKLKEMGFAMTADYTHAIESFADVEKWRDHWYHSPLPFVT
FT                   DGVVIRQTKEPQGRYWRNTSADWAIAWKYPPVHQVAEVVDVAFSVGRTGKVAVVLKISP
FT                   LKLDDKSVSRVNVGSLSRWKQWDVLPGDRVSVSLAGQGIPRLDNVVWRGTERPVIVSPD
FT                   EHNFHAFSCFRYSVVCQQQFLARLVWLSGEHGLNLAGMRDGMWLRLMQHDLLGDVLSWL
FT                   YLTEAQLNAVNGMGDKRARDIYMSLQSARQKSLSHWLLALGIPVPRSAISALNNVNWLA
FT                   LQQRTAQQWRQFSGIGERRAEEIMAFLNHPIVMELIARLDLEGIHR"
FT   misc_feature    51400..51471
FT                   /note="Signal peptide predicted for ECA0043 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.981 between residues 24 and 25"
FT   misc_feature    51471..51479
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT   misc_feature    51496..52338
FT                   /note="HMMPfam hit to PF01653, DE NAD-dependent DNA ligase
FT                   adenylation domain, score 3.3e-53"
FT   misc_feature    51784..51873
FT                   /note="PS01055 NAD-dependent DNA ligase signature 1."
FT   misc_feature    52342..52581
FT                   /note="HMMPfam hit to PF03120, DE NAD-dependent DNA ligase
FT                   OB-fold domain, score 3.1e-19"
FT   CDS_pept        53350..55035
FT                   /transl_table=11
FT                   /locus_tag="ECA0044"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo4013 SWALL:Q8ZA13 (EMBL:AJ414160) (563 aa) fasta scores:
FT                   E(): 5e-173, 75.4% id in 557 aa, and to Escherichia coli
FT                   membrane-protein YhjW SWALL:YHJW_ECOLI (SWALL:P37661) (563
FT                   aa) fasta scores: E(): 7.5e-150, 64.99% id in 557 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72965"
FT                   /db_xref="GOA:Q6DB57"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB57"
FT                   /protein_id="CAG72965.1"
FT                   /translation="MKFVASFSQPKLSFVLAVYIGLFLNISVYYRRFDYFSLSAGSQVP
FT                   TFIPALVELTASILFTFFLMRIISLGGRRFYRIIASLLVLISVAASYYMTFFNVVIGYG
FT                   IIAAVMTTDIDLSKEVIGFRFFLWMLVVSALPLFLIWKNSLRHTLIEQLKSPGKRLIPL
FT                   LVLVAVVALVWMPLRYMGNIQSISERESNVDLPSYGGVVAHSYLPSNWLSALGLFAYTK
FT                   YDESLDSSNLFDPAQHFTYVPPKGIDDTYVVFIIGETTRWDHMGLLGYERDTTPKLSKE
FT                   KNLVAFRGQSCDTSTKLSMRCMFVREGGTEDNPQRTLKEQNVFAVMKELGFTSELFAMQ
FT                   SEVWFYNSIEANNYSFREMIASEKHNDGKSVQDMLLVDEVKESLGRYPKGKHLIVLHTK
FT                   GSHYLYSMRYPRSFARYQPECMGVDASCTREQLINAFDNSVLYTDSFIDSVIDQVRDKK
FT                   AIVFYASDHGESIDDNYHLHGTPRQMAPPEQFRSPMMVWTSDKFLADTDNLHAFEQLKA
FT                   QQRVGKTHRHEELFDTILGCLGYTSPDGGINPKNNWCQRPVYPK"
FT   misc_feature    53368..55026
FT                   /note="HMMPfam hit to PF02418, , score 3.9e-145"
FT   misc_feature    order(53383..53448,53491..53559,53596..53664,53707..53766,
FT                   53827..53880)
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0044 by TMHMM2.0 at aa 12-33, 48-70, 83-105, 120-139 and
FT                   160-177"
FT   misc_feature    54898..54921
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   tRNA            55285..55361
FT                   /note="tRNA Pro anticodon TGG, Cove score 92.73"
FT   CDS_pept        55765..56313
FT                   /transl_table=11
FT                   /locus_tag="ECA0045"
FT                   /product="putative virulence-associated outer membrane
FT                   protein"
FT                   /note="Similar to Salmonella typhimurium resistance to
FT                   complement killing Rck or pslt009 SWALL:Q04817
FT                   (EMBL:L08613) (185 aa) fasta scores: E(): 7.9e-27, 44.68%
FT                   id in 188 aa, and to Salmonella typhimurium virulence
FT                   membrane protein PagC precursor or stm1246 SWALL:PAGC_SALTY
FT                   (SWALL:P23988) (185 aa) fasta scores: E(): 3.5e-26, 45.05%
FT                   id in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72966"
FT                   /db_xref="GOA:Q6DB56"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB56"
FT                   /protein_id="CAG72966.1"
FT                   /translation="MKKTTLLLSTLITCAMGISVAQATQTVSLGYAQAKVEDFKDLKGV
FT                   TAKYHYQGDSALGIIGSFTYLGGKKDYNQSSIGFSSHESDDVKYYSLMVGPSYQINDVV
FT                   SIYGLAGLGHAKVKNSYNYTLPNQSGSESYSESKTKFAYGAGIQITPVANWAIDIGYEG
FT                   TKIYEARVDGFNIGVGYRF"
FT   misc_feature    55765..55833
FT                   /note="Signal peptide predicted for ECA0045 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.576 between residues 23 and 24"
FT   misc_feature    56284..56307
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00695 Enterobacterial virulence outer membrane
FT                   protein signature 2."
FT   CDS_pept        complement(56357..57964)
FT                   /transl_table=11
FT                   /locus_tag="ECA0046"
FT                   /product="putative signaling membrane protein"
FT                   /note="Similar to Escherichia coli Rtn protein or b2176
FT                   SWALL:RTN_ECOLI (SWALL:P76446) (518 aa) fasta scores: E():
FT                   6.1e-42, 30.6% id in 513 aa, and to Salmonella typhi
FT                   putative Rtn protein sty0376 SWALL:Q8Z923 (EMBL:AL627266)
FT                   (524 aa) fasta scores: E(): 1.8e-67, 35.68% id in 524 aa.
FT                   In E.coli it's found to be involved in resistance to phages
FT                   N4 and lambda."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72967"
FT                   /db_xref="GOA:Q6DB55"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB55"
FT                   /protein_id="CAG72967.1"
FT                   /translation="MMSPRRSERKINMLQLLVAGMLPLLLGLLFTFVESRLMVKRDLES
FT                   TAQIAMNHAENISTQAWKMVDRLQHFHGQPCNAIGDELQRLGSVFSYFRAIGVTHNNDI
FT                   YCSSTFGSTLTPISRVIQQPLPETYSERWSLSIAGSDNVKGRPALIFVQTPLSGYGAYA
FT                   MVDAQYLIDLMIAISQIRGYELILQMDNGHPIQTGPTITPRTGLFSTSALEIKSDRFPI
FT                   TLHIIAPAAQEITNWMQAFFTFLPLAIILSLLFTTAIWYWQKRKLLFRDEIRKGIANGE
FT                   FSVYYQPIYDADSRSCTGVETLLRWRRSNGQWIRPDIFISAAEAESMIIPITRHLFDLV
FT                   ASDIASWQVKPGFHLGLNVAAEHLHHPSFVPDVHRFAEKVASHSLSITLELTERNLISN
FT                   GPEIIQRLHQLREDGFMIAIDDFGTGHCSLSYLQNFPLDCLKIDQGFVSAISSPDEEAP
FT                   ILDAIISLSHRIKLQSIAEGVETEQQLMYLQRRGVKYIQGFLYAKPMDNESLRVWLHYN
FT                   GNKSIESFMIKNEEGEKK"
FT   misc_feature    complement(56438..57172)
FT                   /note="HMMPfam hit to PF00563, DE EAL domain, score
FT                   1.3e-86"
FT   misc_feature    complement(order(57179..57247,57866..57934))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0046 by TMHMM2.0 at aa 11-33 and 240-262"
FT   misc_feature    complement(57866..57964)
FT                   /note="Signal peptide predicted for ECA0046 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.811) with cleavage site
FT                   probability 0.480 between residues 33 and 34"
FT   CDS_pept        complement(58054..59253)
FT                   /transl_table=11
FT                   /locus_tag="ECA0047"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   Ypo3966 SWALL:Q8ZA52 (EMBL:AJ414160) (398 aa) fasta scores:
FT                   E(): 6.5e-123, 79.74% id in 395 aa, and to Salmonella typhi
FT                   putative exported protein sty4215 SWALL:Q8Z267
FT                   (EMBL:AL627281) (400 aa) fasta scores: E(): 1.4e-118,
FT                   75.94% id in 395 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72968"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB54"
FT                   /protein_id="CAG72968.1"
FT                   /translation="MEQFDAVIIGAGAAGMFCAAQAGQRGLRVLLLDNGKKPGRKILMS
FT                   GGGRCNFTNMYAEPAAYLSHNPHFCKSALARYTQWDFISLVNSHRIAYHEKTLGQLFCD
FT                   DSAQQIVDMLVTECERANVTLRLRSEVTSVEKSDDLFTIHLSNGTSFQSTSLVVACGGL
FT                   SMPGLGATPFGYQLAAQFGINVLPTRAALVPFTLHKPLLEQLQTLSGVSVPTVVTAENG
FT                   VIFRENILFTHRGLSGPAILQISSYWQAGEFVTINLLPDCDLTQLINDERTAHPNQSLK
FT                   NTLAQWLPKRLVECLQALGQLPDITLKQLNSTQQTHIEQSLQQWRVQPNGTEGYRTAEV
FT                   TIGGVDTRALSSKTMETSTVPSLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQALPFCK
FT                   "
FT   misc_feature    complement(58087..59112)
FT                   /note="HMMPfam hit to PF03486, DE HI0933-like protein,
FT                   score 3e-186"
FT   misc_feature    complement(59188..59253)
FT                   /note="Signal peptide predicted for ECA0047 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.842) with cleavage site
FT                   probability 0.721 between residues 22 and 23"
FT   CDS_pept        59530..61035
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /gene_synonym="pit"
FT                   /locus_tag="ECA0048"
FT                   /product="low-affinity inorganic phosphate transporter"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 low-affinity inorganic
FT                   phosphate transporter 1 PitA or Pit or b3493 or c4291 or
FT                   z4893 or ecs4365 SWALL:PITA_ECOLI (SWALL:P37308) (499 aa)
FT                   fasta scores: E(): 1.3e-136, 70.37% id in 503 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72969"
FT                   /db_xref="GOA:Q6DB53"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB53"
FT                   /protein_id="CAG72969.1"
FT                   /translation="MLHLFAGLDYYTGLMLILALLFVLMYEAINGFHDTANAVATVIYT
FT                   RAMRAEFAVVMAGVFNFFGVLLGGLSVAYAIVHLLPTDLLLNVSSAHGLAMVFSMLLAA
FT                   IIWNLGTWYFGIPASSSHTLIGAIIGIGLTNALLTDTSIVDALNVPKMISIFLSLLLSP
FT                   IVGMVVAGLMLLVLRRFWNNSKKRKRVHLTPVDREKQDGKRKPPFWTRTALILSAIGVS
FT                   FSHGANDGQKGIGLIMLVLIGVAPAGFIVNMNASGYDISRTRDAVVNLQEYYKQHGDAL
FT                   THVIDLSPPVIPVPESTIPGNGQKEFHCDSSRVMIAIERTQGLLNNLKSYDQLNPDDRS
FT                   RVRRLLMCIADTMDRVVKLPETSGEDKRYLNNLRKDMLQTVEYAPLWIIVAVALALSLG
FT                   TMVGWKRVAVTIGEKIGKKGMTYAQGVSAQVTAALSIGVASYTGMPVSTTHVLSSAVAG
FT                   TMIADGGGVQGKTIRSILLAWVLTLPVSMLMSGTLYWLALKLI"
FT   misc_feature    order(59557..59625,59683..59751,59809..59877,59896..59964,
FT                   59992..60060,60148..60201,60229..60297,60676..60741,
FT                   60784..60852,60955..61023)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0048 by TMHMM2.0 at aa 10-32, 52-74, 94-116, 123-145,
FT                   155-177, 207-224, 234-256, 383-404, 419-441 and 476-498"
FT   misc_feature    59617..60999
FT                   /note="HMMPfam hit to PF01384, DE Phosphate transporter
FT                   family, score 3.9e-93"
FT   misc_feature    60919..60942
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(61234..61569)
FT                   /transl_table=11
FT                   /gene="uspB"
FT                   /locus_tag="ECA0049"
FT                   /product="putative universal stress protein B"
FT                   /note="Similar to Yersinia pestis universal stress protein
FT                   B UspB SWALL:Q8ZA50 (EMBL:AJ414160) (111 aa) fasta scores:
FT                   E(): 3.4e-43, 84.68% id in 111 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Escherichia coli O157:H7 universal
FT                   stress protein b UspB SWALL:USPB_ECOLI (SWALL:P37632) (111
FT                   aa) fasta scores: E(): 4.2e-40, 81.08% id in 111 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72970"
FT                   /db_xref="GOA:Q6DB52"
FT                   /db_xref="InterPro:IPR019598"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB52"
FT                   /protein_id="CAG72970.1"
FT                   /translation="MISTFALFWALCIVCIINMARYYSSLRVLLMILRDCDPLLYQYVD
FT                   GGGFFTSHGQPSKQIRLVGYIYAQRYLDHHDPEFIRRCERVRGQFLLTTALCGLIVISL
FT                   IAMMMWY"
FT   misc_feature    complement(order(61240..61308,61498..61557))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0049 by TMHMM2.0 at aa 5-24 and 88-110"
FT   CDS_pept        62108..62545
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="ECA0050"
FT                   /product="universal stress protein A"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri universal
FT                   stress protein A UspA or b3495 or c4293 or z4895 or ecs4367
FT                   or sf3526 SWALL:USPA_ECOLI (SWALL:P28242) (143 aa) fasta
FT                   scores: E(): 6.7e-47, 94.36% id in 142 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72971"
FT                   /db_xref="GOA:Q6DB51"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB51"
FT                   /protein_id="CAG72971.1"
FT                   /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQQRISEETQNALTELSQNAGYPISETLSGSGDLGQVLVDAIKKYEA
FT                   DLVLCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEENE"
FT   misc_feature    62111..62530
FT                   /note="HMMPfam hit to PF00582, DE Universal stress protein
FT                   family, score 6.6e-56"
FT   CDS_pept        62838..64181
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="ECA0051"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="Similar to Escherichia coli NADP-specific glutamate
FT                   dehydrogenase GdhA or b1761 SWALL:DHE4_ECOLI (SWALL:P00370)
FT                   (447 aa) fasta scores: E(): 7.7e-145, 85.01% id in 447 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72972"
FT                   /db_xref="GOA:Q6DB50"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB50"
FT                   /protein_id="CAG72972.1"
FT                   /translation="MAQIVSLASFLDSVQQRDPHQPEFLQAVNEVLSTLWPFLEQNPHY
FT                   ADYSLLERLVEPERVIQFRVAWTDDKGQVQVNRAWRVQFSSAIGPYKGGMRFHPSVNLS
FT                   ILKFLGFEQTFKNALTTLPMGGGKGGSDFNPKGKSQGEVMRFCQALMTELYRHLGADTD
FT                   VPAGDIGVGGREVGFMTGMMKKLTNNTACVFTGKGLSFGGSLIRPEATGYGLIYFTEAM
FT                   LKRHGLGFEGMRVAVSGSGNVAQYAIEKAMELGARVVTVSDSNGTVVDENGFTPEKLAL
FT                   LEEIKNKRYGRVEDYAREAKLTYLAGKTPWEVPVDIALPCATQNELDLPAAQTLIANGV
FT                   KAVAEGANMPTTIPATDAFLDAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVD
FT                   ARLHHIMLDIHTACVQYGGEDSQTNYVRGANVAGFVKVADAMLAQGVV"
FT   misc_feature    63006..63398
FT                   /note="HMMPfam hit to PF02812, DE Glu/Leu/Phe/Val
FT                   dehydrogenase, dimerisation domain, score 1.9e-78"
FT   misc_feature    63201..63242
FT                   /note="PS00074 Glu / Leu / Phe / Val dehydrogenases active
FT                   site."
FT   misc_feature    63441..64172
FT                   /note="HMMPfam hit to PF00208, DE
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase, score
FT                   2.3e-121"
FT   CDS_pept        64337..65650
FT                   /transl_table=11
FT                   /locus_tag="ECA0052"
FT                   /product="conserved hypothetcial protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4186 SWALL:Q9HWJ5 (EMBL:AE004835) (439 aa) fasta
FT                   scores: E(): 1.9e-60, 39.58% id in 432 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72973"
FT                   /db_xref="GOA:Q6DB49"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB49"
FT                   /protein_id="CAG72973.1"
FT                   /translation="MKIKHLPFDQNRNGWSADLVDKPNYPQQRGKTTADWLVIGAGYAG
FT                   IAFAQRLAEQRPDKHIILLDAGEIGDNASGRNSGFVIDLPHNIGSSTAELEKAAAYRRL
FT                   LQSGVAHLKEKVDRHAIACDWSVAGKYHCAVSSTFNGLIDTYVRELNGLGEPYQVVEKD
FT                   ELARRLGTSFYQRAVYTPNCILLNPAALVIGLVASLPKNVTVYAHSPALNIETGSRIRV
FT                   ETPYGEIQADKLMMAINGAARGLPLFNGRVFAVTTFATLTEPLNAEQTARMGDMPDWGL
FT                   TPVNALASATLRYTRDHRFLIREHVKFAPELVNSAVETGRHARRHAAIFARMFPQLSDV
FT                   KMAHTWSGLISVTRNGAPIWGQLSDNVFASAGCNGAGLSKQTAAGHILADLALGEDNPL
FT                   ISDMQSLGQANYLPPRPFLDVGVNGYLTSERWKARSER"
FT   CDS_pept        complement(65657..67552)
FT                   /transl_table=11
FT                   /locus_tag="ECA0053"
FT                   /product="putative phosphodiesterase"
FT                   /note="Similar to Vibrio cholerae 2`,3`-cyclic-nucleotide
FT                   2`-phosphodiesterase, putative vc2416 SWALL:Q9KPF2
FT                   (EMBL:AE004311) (634 aa) fasta scores: E(): 9.2e-161, 66.4%
FT                   id in 634 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72974"
FT                   /db_xref="GOA:Q6DB48"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB48"
FT                   /protein_id="CAG72974.1"
FT                   /translation="MKKTLLSLLLCLSTSAMAVQEPVNITILGTSDLHGTFVPWDYATD
FT                   TANMAGSLSQIATQVHKVRAQQPNVILVDAGDTIQGNFVETFKNDKTSPMILGFNAMNY
FT                   DVWVMGNHEFDFGLNVLSTSLEQFNGTALAGNIFWESGKPYLPAYKIVERQGVKIGIIG
FT                   MDTPMTAEFAKGTDRVKGLNFTDPVGAVKTVIQQIHGKVDAIVLVAHMGIDNENQRPGT
FT                   GVGDIARANPELAAIVAGHMHVKVDKEVINGVIVTEPDRYGRALSRIDLQFEQQNGKYV
FT                   LINKDSYTYSIKDVDSDRKMEDIYEPYHNTLRANASRPIAQLLGHDLVPQDAVKGIPQV
FT                   HVQDTGISALFQEASRHYSPKAQVIALQIDNDRPKLNVGTIAAKDIAFNYQYAGGEITV
FT                   YQLTGKELKKYMEWSAGYFNQLQDGDVTYSFNPQRRASKYSTNDFFDGVTYTIDLTKPA
FT                   GQRITDLKMNNGTPVTDDMPIRLGMNSYRMGHLTQKGGVLEGMQFPVISDTKVEYGEEA
FT                   GTIRNLTIRYLTEVKKGQYEGTVPQRWKLAGLQGYERERKIVESLLNSGKISVPTSDDG
FT                   RYSNVQSINVKPLLLPDATQREKRVAELTQQRDSTTNALTKQRLNDQLTIIAAIN"
FT   misc_feature    complement(66056..66598)
FT                   /note="HMMPfam hit to PF02872, DE 5'-nucleotidase,
FT                   C-terminal domain, score 6.5e-32"
FT   misc_feature    complement(66818..67480)
FT                   /note="HMMPfam hit to PF00149, DE Calcineurin-like
FT                   phosphoesterase, score 1.1e-15"
FT   misc_feature    complement(67208..67243)
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT   misc_feature    complement(67499..67552)
FT                   /note="Signal peptide predicted for ECA0053 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.987 between residues 18 and 19"
FT   CDS_pept        complement(67694..68440)
FT                   /transl_table=11
FT                   /locus_tag="ECA0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3974 SWALL:Q8ZA46 (EMBL:AJ414160) (256 aa) fasta scores:
FT                   E(): 6.2e-77, 82.44% id in 245 aa, and to Escherichia coli,
FT                   and Escherichia coli O157:H7 hypothetical protein YhiQ
FT                   SWALL:YHIQ_ECOLI (SWALL:P37633) (250 aa) fasta scores: E():
FT                   4e-73, 79.18% id in 245 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72975"
FT                   /db_xref="GOA:Q6DB47"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB47"
FT                   /protein_id="CAG72975.1"
FT                   /translation="MSICLIAEEGADSGALSSLAERWGLVSDPNAVMALVLTTERLELR
FT                   KQDEPKLGAIFVDFVAGPMAHRRRFGGGRGEAVAKAVGIKKDYLPDVVDATAGLGRDAF
FT                   VLAALGCHVRMVERNPVVAALLDDGLKRGYQDAEIGPWLRERLTLLHASSMTALRDITP
FT                   PPDVVYLDPMFPHKQKSALVKKEMRVFQSLVGADDDADALLEPARALAKKRVVVKRPDY
FT                   APPLAGVPAQSMLETKSHRFDFYLPV"
FT   CDS_pept        complement(68437..70479)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /gene_synonym="opdA"
FT                   /locus_tag="ECA0055"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Similar to Escherichia coli oligopeptidase A PrlC or
FT                   OpdA or b3498 SWALL:OPDA_ECOLI (SWALL:P27298) (680 aa)
FT                   fasta scores: E(): 0, 85.44% id in 680 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72976"
FT                   /db_xref="GOA:Q6DB46"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB46"
FT                   /protein_id="CAG72976.1"
FT                   /translation="MTNPLLTSFTLPPFSSIKTEDIVPAVKSTLDECRETVERVVAQAG
FT                   PFTWDNLCQTLADSDDRLGRIFSPISHLNAVKNSPELRGAYEQCLPLLSEYSTWVGQHA
FT                   GLYQAYRSLRDGEHYTTLSLAQKKSVDNALRDFELSGIGLSPEKQKRYGEISARLSELG
FT                   SQYSNNVLDATMGWSKLITDVAELDGMPESALAAAKAQAEAKEQDGWLLTLDIPSYLPV
FT                   LTYCTNQALREEMYRAFGTRASDQGPNAGKWDNSEIMAEELALRHELAQLLGFDSYAHK
FT                   SLATKMAENPQQVIDFLTDLAKRARPQAEEELAQLRAFAKEHFGVDELQAWDITYYSEQ
FT                   QKQHLYSISDEQLRPYFPENRAVNGLFEVVKRIYGITAKERNDVDVWHPDVRFFDLFDE
FT                   SGELRGSFYLDLYAREYKRGGAWMDDCAGKLRKGNGELQKPVAYLVCNFNRPVNGKPAL
FT                   FTHDEVTTLFHEFGHGLHHMLTQIDTAGVSGINGVPWDAVELPSQFMENWCWEPEALAF
FT                   ISGHHETGEPLPQELLDKMLAAKNYQAALFILRQLELGLFDFRLHAEFDPAKGAQILPT
FT                   LTEIKAQVAVVPSPSWGRYPHAFSHIFAGGYAAGYYSYLWADVLAADAYSRFEEEGIFN
FT                   RETGQSFLDNILTRGGSEEPMELFKRFRGREPQLDAMLAHYGIKG"
FT   misc_feature    complement(68446..69816)
FT                   /note="HMMPfam hit to PF01432, DE Peptidase family M3,
FT                   score 2.9e-231"
FT   misc_feature    complement(69055..69084)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        70800..73349
FT                   /transl_table=11
FT                   /locus_tag="ECA0056"
FT                   /product="putative TonB-dependent heme receptor"
FT                   /note="Similar to Bordetella avium BhuR SWALL:Q8L1U7
FT                   (EMBL:AY095952) (855 aa) fasta scores: E(): 8.3e-14, 23.68%
FT                   id in 874 aa, and to Pasteurella multocida HemR
FT                   SWALL:Q9CN63 (EMBL:AE006093) (742 aa) fasta scores: E():
FT                   1.5e-143, 51.04% id in 717 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72977"
FT                   /db_xref="GOA:Q6DB45"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB45"
FT                   /protein_id="CAG72977.1"
FT                   /translation="MAINNHNGGCIAHKPTLAVARAVHLALSGVLIFSVGTVSSALAAE
FT                   TAAAVASPTMTFSIPAGALGTTLQAVASRANVILTFSPDQTQNKTSGSVRGTYTVQEAF
FT                   AAALAGTGLNAVQTATGYRLESTLAAEGSDGSLLIPTLSVVGGTSDSAAAGRSVLRQAD
FT                   VDRVQADNIASLLDKLPGVSMAGSPRPGGQSLNIWGMGDMEDVKVVLDGAPKGFEKYRQ
FT                   GSVFIEPELIKRIDVDKGPHDIRSGNGGFGGTIHVDTKDASDLLMPGENFGGMAKYSYH
FT                   TNDRQNIYSGALYGRTEDGMADGLLYMSKRDGDNIERPDGSRFVYSTSDMASYLLKTNI
FT                   YLTDSQTLTLSAMRSESDGWQPFAAKRDDMAAPTQADINRYGWEEAWRRKLVYRDQVDK
FT                   NYSLKWNIAPADQPWLNLTASFATSKTEQHDRRSDSASQSSYLGTLGNESWVSYKDQLA
FT                   EVSNESLFTTGPLDHKLLVGIRWHQHKRDTLIYYPSGKNNAEYNYGYFQPYYMPAGEQE
FT                   TRSLYVQDAVTLGSVTITPGVRYDHVTNTGKPNAAPRYNSSIPAAGHDYSSVTYTGWSP
FT                   RIGALWKATDNLSLFADASRTWRAPVVDEQYEVQSAASSVPGTSRNLEVESIKAFRLGA
FT                   ILDFNNLMLEEDSLQIRTTLFRNRGKNEIFYRRGILCEAQTQSGTSSSCGQPLSNYRNL
FT                   PGYTIEGVEIESFYDSRWLFGSLSFSSIRGERDASPRNPWGNKTWIAEIPPTTAHATLG
FT                   TKIPRLDMAVGWTSDFVRKQDRSPADGDPQADIWALPKSKGYVLHGLFASWQPQTIKGF
FT                   EARVTVDNLLNTDYYPYLGESVSGVGRNVKISVLQRF"
FT   misc_feature    70800..70928
FT                   /note="Signal peptide predicted for ECA0056 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.943) with cleavage site
FT                   probability 0.928 between residues 43 and 44"
FT   misc_feature    73011..73343
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00593, DE TonB dependent receptor,
FT                   score 2e-17"
FT   misc_feature    73293..73343
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT   CDS_pept        73530..74042
FT                   /transl_table=11
FT                   /locus_tag="ECA0057"
FT                   /product="ECF-family RNA polymerase sigma factor"
FT                   /note="Similar to Escherichia coli probable RNA polymerase
FT                   sigma factor FecI or b4293 SWALL:FECI_ECOLI (SWALL:P23484)
FT                   (173 aa) fasta scores: E(): 2.2e-25, 46.38% id in 166 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72978"
FT                   /db_xref="GOA:Q6DB44"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB44"
FT                   /protein_id="CAG72978.1"
FT                   /translation="MVRKATASVNDFAQQLYFDHHRWLYNWLRHKLDCSQNAEDLAQDT
FT                   FLSVLMNPELLTIRQPRPFLATVARRLVANHYRRKKIEDAYLDVLSTQPDACMPSPETR
FT                   LLTLEILEQLDAALDGLPAPVREAFLLAHLHGMRYSDIAERLRVSSSSVKQYLQRANLQ
FT                   CFFALPL"
FT   misc_feature    73605..73769
FT                   /note="HMMPfam hit to PF00776, , score 0.00043"
FT   misc_feature    73641..73733
FT                   /note="PS01063 Sigma-70 factors ECF subfamily signature."
FT   misc_feature    73938..74003
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1671.000, SD 4.88 at aa 137-158, sequence
FT                   MRYSDIAERLRVSSSSVKQYLQ"
FT   CDS_pept        74039..75028
FT                   /transl_table=11
FT                   /locus_tag="ECA0058"
FT                   /product="transmembrane sensor"
FT                   /note="Similar to Escherichia coli protein FecR or b4292
FT                   SWALL:FECR_ECOLI (SWALL:P23485) (317 aa) fasta scores: E():
FT                   3.1e-33, 36.04% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72979"
FT                   /db_xref="GOA:Q6DB43"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB43"
FT                   /protein_id="CAG72979.1"
FT                   /translation="MNDPTFYRDGQGQPIQPDSAREAVAWLTQLMSDSVTEQDRREWQR
FT                   WREASPDNEQAWQHIESVCANLGQLNARAAHQSLSTLNGMQRRSVLKALAILCLTGGAG
FT                   MAGSRTDVWQSFTADYQTQVGEQRHAVLEDGTTLLLNTQTALNVAYGDDLRQLTLIRGE
FT                   VMIETSQVEKAALYPRPFIVTTAQGKVQALGTRFSLRVQDEHTQVAVYDGAVRLHPQRN
FT                   GQDVQVVKSGQTATFTTQRCGQIETEKAEPAWVKGQLLADNQRLVDFVDELSRYRSGVI
FT                   RCQPEVESLRFSGVFPLSDTDNILAALAEALPVQVRYFSRYWVQIAAR"
FT   misc_feature    74189..74218
FT                   /note="PS00904 Protein prenyltransferases alpha subunit
FT                   repeat signature."
FT   CDS_pept        75230..76051
FT                   /transl_table=11
FT                   /locus_tag="ECA0059"
FT                   /product="TonB-like protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo3918 SWALL:Q8ZA93 (EMBL:AJ414159) (267 aa) fasta scores:
FT                   E(): 1.7e-17, 34.7% id in 268 aa, and to Shigella flexneri,
FT                   and Escherichia coli CjrB SWALL:Q933Q6 (EMBL:AF283292) (258
FT                   aa) fasta scores: E(): 7.9e-14, 30.59% id in 268 aa, and to
FT                   Pseudomonas putida TonB SWALL:Q93PQ7 (EMBL:AF315582) (243
FT                   aa) fasta scores: E(): 1.5e-10, 31.74% id in 252 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72980"
FT                   /db_xref="GOA:Q6DB42"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB42"
FT                   /protein_id="CAG72980.1"
FT                   /translation="MATQTLKFNTIQPATTVRWGSGSLLALALHAGVIVWMSYHALDSS
FT                   IEAPPPAMMLMVADSVQSTSSPQDAPVGPQQTLSTPQESAAQPEKIMQDVPPLAPAPKP
FT                   VITTAQKEKPQSQKKVQKKMEKPVQETTPQEAIAPSEKPPAPVTSAPLPGNSQHVAAPY
FT                   NSDAAQMRKGVADWSSKLLAHLSRHKRYPAQAARQRLQGVAQIRVTLDRTGNVLAVSLV
FT                   SSSGVAPLDTESVALPKRAQPLPAPPAEVIGDNAQLTITVPISFDLREARR"
FT   misc_feature    75230..75322
FT                   /note="Signal peptide predicted for ECA0059 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.633) with cleavage site
FT                   probability 0.479 between residues 31 and 32"
FT   misc_feature    75287..75355
FT                   /note="1 probable transmembrane helix predicted for ECA0059
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        complement(76062..76355)
FT                   /transl_table=11
FT                   /locus_tag="ECA0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Shigella flexneri conserved hypothetical
FT                   protein YghW SWALL:AAN44523 (EMBL:AE015317) (95 aa) fasta
FT                   scores: E(): 3.8e-17, 47.25% id in 91 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 hypothetical protein YghW SWALL:AAN82179
FT                   (EMBL:U28377) (95 aa) fasta scores: E(): 3.8e-17, 47.25% id
FT                   in 91 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72981"
FT                   /db_xref="InterPro:IPR022574"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB41"
FT                   /protein_id="CAG72981.1"
FT                   /translation="MGNHFERGVLAGLRSANPKSTNDINPYCYDYRRGYICGYAHHLAE
FT                   TKGDRQQAAFEAGLLSRRYGLERERVAEFFTEQGNPYAIRFFYAGYDAHTPR"
FT   CDS_pept        76671..77513
FT                   /transl_table=11
FT                   /locus_tag="ECA0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3976 SWALL:Q8ZA44 (EMBL:AJ414160) (280 aa) fasta scores:
FT                   E(): 4.8e-91, 80.35% id in 280 aa, and to Escherichia coli
FT                   hypothetical protein YhiR SWALL:YHIR_ECOLI (SWALL:P37634)
FT                   (280 aa) fasta scores: E(): 3.2e-88, 77.85% id in 280 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72982"
FT                   /db_xref="GOA:Q6DB40"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB40"
FT                   /protein_id="CAG72982.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHTVQSLIITALKEKEKPFLYLDTHAGA
FT                   GRYQLSGPHAERTGEYLDGIAKIWQRDDIPAELEPYMQAVRTYNHNGQLRYYPGSPLIA
FT                   RQLLREYDKLHLTELHPSDFPLLRNEFQKDARTKVLRDDGYQQLKAQLPPLSRRGFVLI
FT                   DPPYELKTDYQDVVKGIKEGHKRFGTGVFALWYPVVLRQHIKRMLKELQASGIRNILQI
FT                   ELAVLPDSDRYGMTASGMIVINPPWKLAAQMKDVLPWLHSVLVPEGTGHTLVEQIVPE"
FT   misc_feature    77151..77171
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    77391..77411
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   CDS_pept        77642..78994
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="ECA0062"
FT                   /product="putative glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="Similar to Escherichia coli glutathione reductase
FT                   Gor SWALL:GSHR_ECOLI (SWALL:P06715) (450 aa) fasta scores:
FT                   E(): 3.8e-155, 86.66% id in 450 aa and to to Yersinia
FT                   pestis glutathione reductase Gor SWALL:Q8ZA43
FT                   (EMBL:AJ414160) (450 aa) fasta scores: E(): 7.8e-158,
FT                   88.66% id in 450 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72983"
FT                   /db_xref="GOA:Q6DB39"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB39"
FT                   /protein_id="CAG72983.1"
FT                   /translation="MTKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKYLGGTCVNV
FT                   GCVPKKVMWHAAQIAEAIHQYGPDYGFDTTVNQFNWGTLVKNRSAYIDRIHQSYDNVLG
FT                   KNKVDVIHGFARFVDAHTVEVNGEKITADHILIATGGRPVHPNIPGAEYGIDSDGFFEL
FT                   DALPKRTAIVGAGYIAVEIAGVLNGLGSETHLFVRKHAPLRSFDPLIVDTLVEVMNTEG
FT                   PTLHTESIPKAIVKNADGSLTLELENGQSQTVDCLIWAIGREPATDNLNLSVTGVGLND
FT                   KGYINVDKFQNTTVSGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIP
FT                   TVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGKE
FT                   EKIVGIHGIGFGMDEMLQGFAVAVKMGATKKDFDNTVAIHPTASEEFVTMR"
FT   misc_feature    77657..78580
FT                   /note="HMMPfam hit to PF00070, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 4.5e-83"
FT   misc_feature    77756..77788
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   misc_feature    78656..78988
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02852, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 1e-52"
FT   CDS_pept        complement(79098..79385)
FT                   /transl_table=11
FT                   /locus_tag="ECA0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli Orf43 protein
FT                   SWALL:Q9S123 (EMBL:AB024946) (95 aa) fasta scores: E():
FT                   8.3e-33, 89.47% id in 95 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72984"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB38"
FT                   /protein_id="CAG72984.1"
FT                   /translation="MSYSVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLR
FT                   GIKDCYKIKLRASGFRLVYEVIDDVLIIAVVAVGKRERSGVYHLASERMR"
FT   CDS_pept        complement(79382..79633)
FT                   /transl_table=11
FT                   /locus_tag="ECA0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli incf plasmid repfib
FT                   replicon SWALL:Q60256 (EMBL:M26308) (83 aa) fasta scores:
FT                   E(): 6.4e-27, 87.95% id in 83 aa, and to Escherichia coli
FT                   Orf44 protein SWALL:Q9S122 (EMBL:AB024946) (83 aa) fasta
FT                   scores: E(): 8.8e-27, 87.95% id in 83 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72985"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB37"
FT                   /protein_id="CAG72985.1"
FT                   /translation="MPNIILSDTSASVSELKKNPMATVNAGDGLPVAILNRNQPAFYCI
FT                   PADLYEKMLDALDDQELVKLIGERKNQPLVDVDLDSFL"
FT   CDS_pept        79889..80794
FT                   /transl_table=11
FT                   /locus_tag="ECA0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2033 SWALL:Q9I282 (EMBL:AE004629) (302 aa) fasta
FT                   scores: E(): 7.3e-48, 46.8% id in 297 aa, and to
FT                   Corynebacterium glutamicum siderophore-interacting protein
FT                   cgl0665 SWALL:Q8NSK6 (EMBL:AP005276) (299 aa) fasta scores:
FT                   E(): 1.9e-29, 37.32% id in 292 aa, and to Escherichia coli
FT                   hypothetical protein YqjH SWALL:YQJH_ECOLI (SWALL:Q46871)
FT                   (254 aa) fasta scores: E(): 0.0064, 28.05% id in 303 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72986"
FT                   /db_xref="GOA:Q6DB36"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB36"
FT                   /protein_id="CAG72986.1"
FT                   /translation="MSLANRTTSSAYRLFNLRLESKTLLSPSLARCVFTGPEVRQMKLD
FT                   APDQRIKLLFASESGELTPMTVSDTWYQDYLALPRERRPILRTYTLRSVSRDLQQATID
FT                   FVLHGDTGPASSWAGHAKPGDALQIVAPNAEADGASGGYEWAPHDGVEQVLLIADETAL
FT                   PAAMGILEQLATQPSPPSVQAFFEVPKAADCVTPSDFPFAQIHWLPREETGSTIWGERL
FT                   LYAVQQDVKIPASACINRDDIAQETPEDELLWERATAHRPFYAWVAGESSAIKRLRRYL
FT                   LDERHLDKETINFMAYWSHR"
FT   CDS_pept        complement(80829..81584)
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECA0066"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="Similar to Escherichia coli thiol:disulfide
FT                   interchange protein DsbG precursor DsbG or b0604
FT                   SWALL:DSBG_ECOLI (SWALL:P77202) (248 aa) fasta scores: E():
FT                   4.3e-58, 61.6% id in 250 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72987"
FT                   /db_xref="GOA:Q6DB35"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB35"
FT                   /protein_id="CAG72987.1"
FT                   /translation="MIKRVSLTLTLLTLSASSLAQDALPDAVKSIEKQGITIIKPFTAP
FT                   GGMQGWLGSYQGVGVTIYLTPDGKHAISGYMYDEHGNNLSEALIQQEVYVPAGREMWQK
FT                   LQQAPFITEGAKDAPRKIIVFADPFCPYCKQFWQQAQPWVKAGKVQLQTLLVGVIKPES
FT                   GRYAAAILAASDPAKAWHEYELSNGKTVPPFPESASRDIWNNIQLNQRLMDELGANVTP
FT                   AIYYLNDKDELQQVVGLPDEQQLAEMMGK"
FT   misc_feature    complement(81525..81584)
FT                   /note="Signal peptide predicted for ECA0066 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 20 and 21"
FT   CDS_pept        81805..82428
FT                   /transl_table=11
FT                   /locus_tag="ECA0067"
FT                   /product="putative LysE family transporter"
FT                   /note="Similar to Caulobacter crescentus efflux protein,
FT                   LysE family cc0456 SWALL:Q9AAY6 (EMBL:AE005719) (208 aa)
FT                   fasta scores: E(): 1.4e-42, 56.25% id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72988"
FT                   /db_xref="GOA:Q6DB34"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB34"
FT                   /protein_id="CAG72988.1"
FT                   /translation="MTLTESLIAFTFAATLLTLTPGLDTALILRTATVEGSKKAFHAAF
FT                   GINVGCLIWGAMVAFGLGTLIAASELAYNILKWCGAAYLCWLGLQMILKPRTELVMAAS
FT                   QTAPKHQNWFLRGMLGNVLNPKIGVFYVSFLPQFIPAGHSVVLWTYLLVLIHVFIGTLW
FT                   SSTLIAATRPLSRFLRRGSVVKWMDRTTGVVFLAFAARLAFSRR"
FT   misc_feature    81805..81882
FT                   /note="Signal peptide predicted for ECA0067 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.622) with cleavage site
FT                   probability 0.477 between residues 26 and 27"
FT   misc_feature    order(81823..81891,81934..82002,82015..82083,82141..82209,
FT                   82234..82302,82360..82419)
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0067 by TMHMM2.0 at aa 7-29, 44-66, 71-93, 113-135,
FT                   144-166 and 186-205"
FT   misc_feature    82012..82335
FT                   /note="HMMPfam hit to PF01810, DE LysE type translocator,
FT                   score 8.3e-10"
FT   CDS_pept        complement(82475..83347)
FT                   /transl_table=11
FT                   /locus_tag="ECA0068"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa3225 SWALL:Q9HZ15
FT                   (EMBL:AE004745) (309 aa) fasta scores: E(): 1.4e-30, 38.11%
FT                   id in 286 aa, and to Escherichia coli hypothetical
FT                   transcriptional regulator YeeY SWALL:YEEY_ECOLI
FT                   (SWALL:P76369) (309 aa) fasta scores: E(): 7.8e-10, 28.34%
FT                   id in 247 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72989"
FT                   /db_xref="GOA:Q6DB33"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB33"
FT                   /protein_id="CAG72989.1"
FT                   /translation="MQAKTTLEQWEILQAVIDLGGYTQAANVLHRSQSSVSYQLSLLQE
FT                   RLGIELLTIHGRKAELTPEGENLLAQARSVIRSFHALEARAHSLKMGEQASINLVVDST
FT                   FPKDRLFHLLSTFQKQHPATRIHLTEVLRNETSAQLKARDADIYIITQREIDGCAGRWL
FT                   MNVDFVAVAHSHHPLFSLPTPLSHEALSRYPCVEIVMRTPPHSQPASAESWTFTTFEAA
FT                   TQAVLHQVGYGWLPEARISEHITRGELHILPLQQGERRTTPLYLLAEEKGQPLGKEIIM
FT                   LIELLFGRL"
FT   misc_feature    complement(82484..83080)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.9e-15"
FT   misc_feature    complement(83150..83329)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 6.4e-17"
FT   misc_feature    complement(83225..83290)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1394.000, SD 3.93 at aa 14-35, sequence
FT                   GGYTQAANVLHRSQSSVSYQLS"
FT   CDS_pept        83450..83959
FT                   /transl_table=11
FT                   /gene="padC"
FT                   /gene_synonym="pad"
FT                   /locus_tag="ECA0069"
FT                   /product="phenolic acid decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Similar to Bacillus subtilis phenolic acid
FT                   decarboxylase PadC or Pad SWALL:PADC_BACSU (SWALL:O07006)
FT                   (161 aa) fasta scores: E(): 5.6e-33, 53.16% id in 158 aa,
FT                   and to Vibrio cholerae probable phenolic acid decarboxylase
FT                   PadC or vc2240 SWALL:PADC_VIBCH (SWALL:Q9KPX2) (174 aa)
FT                   fasta scores: E(): 3.2e-46, 63.41% id in 164 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72990"
FT                   /db_xref="GOA:Q6DB32"
FT                   /db_xref="InterPro:IPR008729"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB32"
FT                   /protein_id="CAG72990.1"
FT                   /translation="MPAFNQHDLSHFVGKHLIYTYDNGWNYELYVKNANTIDYRIHSGI
FT                   VGNRWVKDQQVYIVQVAREVYKISWTEPTGTDVSLIANIADKVFHGTIFFPRWVINNPE
FT                   KTVCFQNEHIAEMEAYRDAGPAYPTEVIDEFATITFIRDCGENNNDVINCPASELPADF
FT                   PACLKK"
FT   CDS_pept        complement(84016..85152)
FT                   /transl_table=11
FT                   /locus_tag="ECA0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Corynebacterium glutamicum hypothetical
FT                   protein Cgl2435 SWALL:Q8NMX8 (EMBL:AP005281) (411 aa) fasta
FT                   scores: E(): 1e-33, 40.97% id in 288 aa, and to
FT                   Corynebacterium efficiens conserved hypothetical protein
FT                   ce2330 SWALL:BAC19140 (EMBL:AP005222) (414 aa) fasta
FT                   scores: E(): 1.4e-33, 33.97% id in 418 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72991"
FT                   /db_xref="GOA:Q6DB31"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR023923"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB31"
FT                   /protein_id="CAG72991.1"
FT                   /translation="MTHANTLHTHDVLDALAEIGPDSALAAARKTREAATRHTQGSYDA
FT                   LFNATVHDNATLPLSLRFWFATKISGWQQDEQLQHFYTERLADFPEPVLTPALQLALDH
FT                   AERLTKTPVQAAPSHVNALEQAGWSVDDIVTLSQLIAFVNFQSRLLRGYRLIAGHRVSQ
FT                   PHSQAAVAGQWHNTQSQTHSGKSAPQAFTQAELDWEPWIAPKPLAEFNTDEQAILARFG
FT                   HTDSDYFRLLGRNLPVLEQRTLTDKGIFYTSGGLPRKERELIAAVTSKVNGCIYCASVH
FT                   ARKASQLSKQDSDVQRLLDVVPGGNLSIGQSPRWQAIIDFSARLSATPAQVNANDVKQL
FT                   QEQGLDTLEIVDVVQSAAFFSWANRLMLTLGEPFWPES"
FT   misc_feature    complement(84061..84090)
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT   CDS_pept        complement(85149..86183)
FT                   /transl_table=11
FT                   /locus_tag="ECA0071"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Bradyrhizobium japonicum Bll6902 protein
FT                   SWALL:BAC52167 (EMBL:AP005960) (378 aa) fasta scores: E():
FT                   3.4e-73, 58.99% id in 339 aa, and to Bradyrhizobium
FT                   japonicum LuxA-like protein bll7033 SWALL:BAC52298
FT                   (EMBL:AP005960) (408 aa) fasta scores: E(): 3.7e-14, 28.77%
FT                   id in 358 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72992"
FT                   /db_xref="GOA:Q6DB30"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024003"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB30"
FT                   /protein_id="CAG72992.1"
FT                   /translation="MATKRLGFFTRLLDDVSAQQLYRLATEQIVKAEQLGFDSAWVAQH
FT                   HFHADEGGLPSPLVFLALVAARTQRIQLGTGVITLPMEEPLRVAEDTAVLDLLSNGRLE
FT                   VGVGSGGTPSSFAAFGHDSAQRGQILGRYLEKLRAAWRGDALSEDGNRLYPAAPHLDKR
FT                   VWQATFSIEGAERAGKAGDGLMLSRTQPRPEHFPDATLADLQNPMIDAYLAALPAGVAP
FT                   RILSSRSVFVADDRQLALSLAEKGLNRSAARSGTFRAIPHDSIEALIASFDSHVGTAQD
FT                   VTASLKTDSSLERATDVTFQVHSIDPPHALILRSLELIATQVAPALGWKPAVKQKSPLG
FT                   QEIA"
FT   misc_feature    complement(85203..86162)
FT                   /note="HMMPfam hit to PF00296, DE Luciferase-like
FT                   monooxygenase, score 1.5e-23"
FT   CDS_pept        complement(86185..87882)
FT                   /transl_table=11
FT                   /locus_tag="ECA0072"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Similar to Corynebacterium glutamicum ABC-type
FT                   transporter, duplicated ATPase component cgl2436
FT                   SWALL:Q8NMX7 (EMBL:AP005281) (547 aa) fasta scores: E():
FT                   8.2e-93, 54.2% id in 535 aa, and to Escherichia coli
FT                   hypothetical ABC transporter ATP-binding protein YejF
FT                   SWALL:YEJF_ECOLI (SWALL:P33916) (529 aa) fasta scores: E():
FT                   4.8e-65, 42.8% id in 528 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72993"
FT                   /db_xref="GOA:Q6DB29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB29"
FT                   /protein_id="CAG72993.1"
FT                   /translation="MSLSASLQTSAAVPVLALENVTIAYRSDDREQTVVEGVSFHIQPG
FT                   EVVALVGESGSGKTTTAQAVIGLLAENGRLTRGAIRLNGVDISGWSQKRLDSVRGAQIS
FT                   LIPQDPTSSLNPVQTIGEQVDEILRIHQREDRQTTRQKTLALLERVGLNQPELRAKQYP
FT                   HELSGGMKQRVLIAIAIALKPALIIADEPTSALDVTVQKRILDLLDELRRENGTAVLFV
FT                   THDLGVAAERADRLLVFQNGYIQEQGPTLDVLSAPLSHYARTLLANVPSLNPTPRPPRS
FT                   HASDIIVSVENLVQTFPLSGRKGEHFRAVDDVSFSVARGTTHAIVGESGSGKTTTARSL
FT                   LGFHHPSAGRILIDGTDITHLKGEALRQFRQKIQLVYQNPFGSLDPSQRLYDIVEEPLR
FT                   NFNRHSSGQRERKIHEMFERVALPVALLSRKPRELSGGQRQRVAIARALVLEPQVLVLD
FT                   EAVSALDVTVQAQILRLLTELQESLGLTYVFISHDLAVVRQIADTVSVLYHGKQLESGP
FT                   VEHIFAQPGHRYTRELIEAIPGQQHPAFARSHQPPIHTESTFALNQGL"
FT   misc_feature    complement(86353..86925)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.9e-59"
FT   misc_feature    complement(86539..86583)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(86881..86904)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(87157..87750)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   5.4e-59"
FT   misc_feature    complement(87343..87387)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(87706..87729)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(87832..87882)
FT                   /note="Signal peptide predicted for ECA0072 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.621) with cleavage site
FT                   probability 0.582 between residues 17 and 18"
FT   CDS_pept        complement(87879..88739)
FT                   /transl_table=11
FT                   /locus_tag="ECA0073"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Corynebacterium efficiens putative
FT                   transport protein ce2332 SWALL:BAC19142 (EMBL:AP005222)
FT                   (305 aa) fasta scores: E(): 2.3e-58, 62.22% id in 270 aa,
FT                   and to Escherichia coli hypothetical ABC transporter
FT                   permease protein YliD SWALL:YLID_ECOLI (SWALL:P75799) (303
FT                   aa) fasta scores: E(): 1.3e-33, 38.34% id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72994"
FT                   /db_xref="GOA:Q6DB28"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB28"
FT                   /protein_id="CAG72994.1"
FT                   /translation="MTTIPLEKITFPLLRKRLFIRRYAFQPGLLLAWLVILTVALWALF
FT                   PGWFTSYNPTEGIAGAQRLAPDAAYWLGTDQLGRDLYARIVYGAVHSLSGAFIAVGLGL
FT                   VLGSLFGLLAGAIGGWLDSVVMRSIDVLLAIPGLLLALSVIILLGFGTVNAAIAVGVTS
FT                   VASFTRLVRSEVLRVRHSDYVEAAYGSGGTFFSVLWRHILPNSLTTVFAFAALQFGSAI
FT                   LAISTLSFLGYGAPPPTPEWGLLIAEGRNYIATAWWLTTFPGLIVVLVVLSANRISQSI
FT                   RSKER"
FT   misc_feature    complement(order(87918..87986,88044..88112,88131..88184,
FT                   88281..88349,88386..88454,88605..88673))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0073 by TMHMM2.0 at aa 23-45, 96-118, 131-153, 186-203,
FT                   210-232 and 252-274"
FT   misc_feature    complement(87987..88217)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 6.5e-11"
FT   misc_feature    complement(88611..88739)
FT                   /note="Signal peptide predicted for ECA0073 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.802) with cleavage site
FT                   probability 0.626 between residues 43 and 44"
FT   CDS_pept        complement(88736..89680)
FT                   /transl_table=11
FT                   /locus_tag="ECA0074"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Corynebacterium glutamicum ABC-type
FT                   transporter, permease component cgl2438 SWALL:Q8NMX5
FT                   (EMBL:AP005281) (313 aa) fasta scores: E(): 3.9e-60, 55.15%
FT                   id in 301 aa, and to Salmonella typhi hypothetical ABC
FT                   transporter permease protein YliC SWALL:Q8Z862
FT                   (EMBL:AL627268) (306 aa) fasta scores: E(): 6.1e-30, 36.03%
FT                   id in 308 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72995"
FT                   /db_xref="GOA:Q6DB27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB27"
FT                   /protein_id="CAG72995.1"
FT                   /translation="MNRYLALRIGQALLVLWAAFTLSFILLQAMPGDAVLIKFQNPELG
FT                   LSAEQIAQLRLSYGADKPVLTQYFHAIAQILRGDLGLSIQAGVPVSELIAANLPPTLLL
FT                   SVLGFIAAGLLAFALAFLSTLTPFQWLRTALQSLPSLFISVPTFWLGIVLIQIFSFRLG
FT                   LIPVINPGEWEGLILPVLTLALPISAPLAQVLMRSIDQVQTQPFVAVARAKGASRSGVL
FT                   WRHIARNAMLPTLTIAGLLLGELIAGALITETVFGRNGLGQLTQEAVNYQDSSVLQAIV
FT                   LISAAAFVVVNLAVDLLYPLLDPRLKRTPGATL"
FT   misc_feature    complement(order(88787..88855,88913..88981,89096..89158,
FT                   89201..89269,89306..89374,89585..89644))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0074 by TMHMM2.0 at aa 13-32, 103-125, 138-160, 175-195,
FT                   234-256 and 276-298"
FT   misc_feature    complement(88871..89089)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 0.0023"
FT   misc_feature    complement(89594..89680)
FT                   /note="Signal peptide predicted for ECA0074 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.937) with cleavage site
FT                   probability 0.603 between residues 29 and 30"
FT   CDS_pept        complement(89707..91344)
FT                   /transl_table=11
FT                   /locus_tag="ECA0075"
FT                   /product="ABC-type transporter, substrate binding protein"
FT                   /note="Similar to Corynebacterium glutamicum ABC-type
FT                   transporter, periplasmic component cgl2439 SWALL:Q8NMX4
FT                   (EMBL:AP005281) (569 aa) fasta scores: E(): 1.1e-87, 47.85%
FT                   id in 535 aa, and to Corynebacterium efficiens putative
FT                   peptide binding protein ce2334 SWALL:BAC19144
FT                   (EMBL:AP005222) (615 aa) fasta scores: E(): 1.6e-86, 47.29%
FT                   id in 535 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72996"
FT                   /db_xref="GOA:Q6DB26"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023920"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB26"
FT                   /protein_id="CAG72996.1"
FT                   /translation="MATFLHPHQKLTLFASLLLLGGAVNVHAANDAPKIGGTLVYLEQQ
FT                   PHTNLYTPAGGFYPNGGILNQITDKLTYQNPETLEIEPWVAESWSINADNTEYTFKIRP
FT                   GVSFSDGTPLDANAVAKNVDTYGLGNTALNQPVSEVINNYLRSEVIDPLTVKFYFKKPS
FT                   PGFLQGTSAIGSGLVSLSTLERNFNQLGNAKNIIGSGPFVVSSEKLGRELKLTARKDYD
FT                   WAPVKSKHQGRAYLDGITYLVTPEDSVRIGALVSGQADFIRQIQAYDEKRVQSQGFNLY
FT                   APPTRGVNNSVVFRPDNPLVADIRVRKALLHATNTKEIIDTLLSDNYPQATSPLAKTAA
FT                   GYVDLSSKLTFDPVQANKLLDEAGWKTGPQGLRQKDGKTLELTAYESLPQPQNKETLQL
FT                   VSQQWAKVGVKLNVLAGDAGSKTVDSLDPLKTGVAPAMVGRADPDVLKSQYYPTVRNVL
FT                   LQKGGSSDKVKDFVDPHLNTLLDGIAAETDRSKRLTLVGEVQGYLIDQAYVIPIFEEPQ
FT                   VFAGAPTTKGIAFEAVGRPSFYNTWLDK"
FT   misc_feature    complement(89716..91314)
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 6.4e-20"
FT   misc_feature    complement(91261..91344)
FT                   /note="Signal peptide predicted for ECA0075 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 28 and 29"
FT   CDS_pept        91666..92868
FT                   /transl_table=11
FT                   /locus_tag="ECA0077"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pyrococcus abyssi related beta-lactamase
FT                   precursor Pbp SWALL:Q9V2D6 (EMBL:AJ248283) (447 aa) fasta
FT                   scores: E(): 2.5e-14, 22.94% id in 340 aa, and to Bacillus
FT                   cereus alkaline D-peptidase adP SWALL:P94288 (EMBL:D86380)
FT                   (388 aa) fasta scores: E(): 1.7e-10, 29.52% id in 254 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72997"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB25"
FT                   /protein_id="CAG72997.1"
FT                   /translation="MHLCFRLVLGTATLLMLSGCSALSNMSIDESDADVLRLACYQDLT
FT                   AEVDRLAVPFLKQKAIPGLVVGVLTADGNRRSWGYGFTDSHHRYPITGDTLFAVGSVSK
FT                   GFMAETTGILVKRGILRWDNTLEELLPGQVLLSESVKKITLLQLVTHTSGLPRQMMDMQ
FT                   MLGLFAEYLFTGNNFYTLLDDDRVLDYLADFTVPPNPTPMYSNLGYAILGYVLQLKTGE
FT                   SIDQLVNETIIEPLRLENTSFTPQKLTRFPYRAIGHAGDQPKFIMRGKPIPDWHFSSNM
FT                   VGAASLYTSANDLLKFARAHIYPTGYYALDEAINDSMKTYYNRTKQAANIAWITDEVGT
FT                   QHITYQVGYIGGYSSYIGLDRHNRIAVVVLQNSFNWDNNLGHTLISRIGQAMHYQGVCK
FT                   A"
FT   misc_feature    91666..91737
FT                   /note="Signal peptide predicted for ECA0077 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.565 between residues 24 and 25"
FT   misc_feature    91693..91725
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(92960..93925)
FT                   /transl_table=11
FT                   /gene="tkrA"
FT                   /locus_tag="ECA0078"
FT                   /product="2-ketogluconate reductase"
FT                   /EC_number="1.1.1.215"
FT                   /note="Similar to Erwinia herbicola 2-ketogluconate
FT                   reductase TkrA SWALL:TKRA_ERWHE (SWALL:P58000) (323 aa)
FT                   fasta scores: E(): 1e-85, 69.6% id in 329 aa, and to
FT                   Escherichia coli 2-ketogluconate reductase TkrA or b3553
FT                   SWALL:TKRA_ECOLI (SWALL:P37666) (324 aa) fasta scores: E():
FT                   1.3e-86, 69.56% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72998"
FT                   /db_xref="GOA:Q6DB24"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB24"
FT                   /protein_id="CAG72998.1"
FT                   /translation="MMKPSVILYKKVADDLRARLDQHFTVTELDAFPALDHPALATAEG
FT                   IIGSGGKVDKDFLQHAPRLRAASTISVGYDTFNVDALNEKGVILMHTPTVLTETVADTV
FT                   LALMLASARRVVEVVERVKAGEWKGGVGSDWFGTDVHHKTIGILGMGRIGLAVAQRAHF
FT                   GFSMPVLYNARRHHAEAEERFNARHCDLDTLLAESDFLCITLPLTAETHHLIGREQLAK
FT                   MKPSAILINIGRGAVVDEDALTEALVKGTIQAAGLDVFVKEPLPVDSPLLDLPNVVALP
FT                   HIGSATHETRYDMAACAVDNLIAALSGQVKENCVNPQVLK"
FT   misc_feature    complement(93080..93640)
FT                   /note="HMMPfam hit to PF02826, DE D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain, score
FT                   4.4e-81"
FT   misc_feature    complement(93209..93259)
FT                   /note="PS00671 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases signature 3."
FT   misc_feature    complement(93644..93916)
FT                   /note="HMMPfam hit to PF00389, DE D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain, score
FT                   6.7e-17"
FT   CDS_pept        complement(93967..94173)
FT                   /transl_table=11
FT                   /locus_tag="ECA0079"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Possible false
FT                   CDS."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAG72999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB23"
FT                   /protein_id="CAG72999.1"
FT                   /translation="MSDINHKGNILINRSSRNVIQGHLHAAVKRLYAIVHHINRANPPL
FT                   IEINLGQMRGRYRLQSLASYAII"
FT   CDS_pept        94276..96228
FT                   /transl_table=11
FT                   /locus_tag="ECA0080"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Yersinia pestis methyl-accepting
FT                   chemotaxis protein II Tar or Tsr SWALL:AAM87624
FT                   (EMBL:AJ414160) (649 aa) fasta scores: E(): 4e-72, 42.03%
FT                   id in 659 aa, and to Escherichia coli methyl-accepting
FT                   chemotaxis protein I Tsr SWALL:MCP1_ECOLI (SWALL:P02942)
FT                   (551 aa) fasta scores: E(): 1.2e-55, 51.04% id in 384 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73000"
FT                   /db_xref="GOA:Q6DB22"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB22"
FT                   /protein_id="CAG73000.1"
FT                   /translation="MHFFTRIMSELKVSHKLYGGFGIVLLLVMIASGVGAVRFFIIHDL
FT                   YVKTTILNEMNHYLDQSKMARVKYSFTFADDNIKNLNTYISQANQQKEKAKALTWEAVY
FT                   LSDFNNLDQDFSNYDTDLNSMKAAANTVVETAKKISQMNASDALTAFMTGLPVDADESA
FT                   LSMQKEALSLLFLKLVNSTYTLQRENSEAAFTAQKQIYGESKTSYDALASSVTGDRRRV
FT                   VDSFWQSFENYHQTAEQYYARLGQLKTTDVKFRATGDKMTSDIGSILQKLGAKNDDIIN
FT                   SSVLQTLVLGAIAIVFGLLIAWSVTRQITRSIITNLKLAERIAGGDLSANVTVERHDEL
FT                   GQLTAAMMVMTEKLRHLMTDIRQSVYSVESASADIASGNNDLSSRTEQQSAAIVETAAS
FT                   MEELTATVKNNAENARHASQIAGEASTNANRGGDIINRVINTMSDISGSSKKISDITSV
FT                   INSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSQAAKEIETLISESVS
FT                   RVDAGTELVSRAGTTMDDIVASVNRVNDIMGEISSASDEQSRGIAQIGSAVAEMDTTIQ
FT                   QNASMVSESSAAANSLQEQASKLATLMSVFRISDKDVARLQGSNTGNPNSGNKATARLP
FT                   TLASRDNGNDNWTTF"
FT   misc_feature    order(94333..94401,95125..95193)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0080 by TMHMM2.0 at aa 28-50 and 292-314"
FT   misc_feature    95137..95343
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   3.6e-08"
FT   misc_feature    95404..96102
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 5.6e-105"
FT   CDS_pept        complement(96284..96727)
FT                   /transl_table=11
FT                   /locus_tag="ECA0081"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /note="Similar to Yersinia pestis putative
FT                   acetyltransferase ypo4075 SWALL:Q8Z9W4 (EMBL:AJ414160) (151
FT                   aa) fasta scores: E(): 1.8e-28, 51.37% id in 146 aa, and to
FT                   Escherichia coli hypothetical acetyltransferase YiaC
FT                   SWALL:YIAC_ECOLI (SWALL:P37664) (146 aa) fasta scores: E():
FT                   2.2e-22, 45% id in 140 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73001"
FT                   /db_xref="GOA:Q6DB21"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB21"
FT                   /protein_id="CAG73001.1"
FT                   /translation="MIRPYRDLDLEPLMQLWLKSTILAHPFIHEDYWRESATAVRDIYI
FT                   PQSQTWVYEEQGSLVGFISVLEARFIGALFVEQNYYGKQIGATLIQHVQALFPLLSLEV
FT                   YQQNTRACRFYHKQGFAIVEENVNQDTQATALIMQWAKRVREQ"
FT   misc_feature    complement(96365..96577)
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 8.2e-13"
FT   CDS_pept        complement(96724..97287)
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="ECA0082"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="Similar to Escherichia coli DNA-3-methyladenine
FT                   glycosylase I Tag or b3549 SWALL:3MG1_ECOLI (SWALL:P05100)
FT                   (187 aa) fasta scores: E(): 3.8e-53, 69.23% id in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73002"
FT                   /db_xref="GOA:Q6DB20"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB20"
FT                   /protein_id="CAG73002.1"
FT                   /translation="MQRCGWVTQDTLYQDYHDNEWGKPCTDSQKLFELLCLEGQQAGLS
FT                   WITVLKKRENYRRCFHQFNPEQVAKMTQDDVDRLVQDSGIIRHRGKIEAIITNAKIWVA
FT                   MESQGESFSHFIWSFVEHQPRLNHPASLAEVPAKTDVSDAMSKALKKRGFKFIGSTICY
FT                   AFMQAGGLVNDHVTDCFCHQESTS"
FT   misc_feature    complement(96736..97272)
FT                   /note="HMMPfam hit to PF03352, DE Methyladenine
FT                   glycosylase, score 1.4e-121"
FT   CDS_pept        97589..98332
FT                   /transl_table=11
FT                   /locus_tag="ECA0083"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas putida conserved hypothetical
FT                   protein pp5143 SWALL:AAN70708 (EMBL:AE016793) (260 aa)
FT                   fasta scores: E(): 1e-36, 48.3% id in 236 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73003"
FT                   /db_xref="GOA:Q6DB19"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB19"
FT                   /protein_id="CAG73003.1"
FT                   /translation="MEWIAAYLALGAVVGFMAGLLGIGGGGIMVPVLTALFAAQGVDNT
FT                   HLVHLALGTSMAAIVVTAISSLRTHHQHQAVLWPVVVRITPAILIGTFAATWLATMLPT
FT                   RTLAIFFSCFMAYVSLQMVLNIKPKPQRQLPGTAGVSFAGLVIGSISALVAIGGGSLTV
FT                   PFLTWCNVRIQQAIGTSAAVGLPIALSGALGYMINGWSANGLPDYSVGYVSLPAVLLIS
FT                   AVSFFTAPVGARLALVWRTVCLLRR"
FT   misc_feature    97589..97702
FT                   /note="Signal peptide predicted for ECA0083 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.849) with cleavage site
FT                   probability 0.474 between residues 38 and 39"
FT   misc_feature    order(97625..97693,97721..97789,97826..97894,97907..97966,
FT                   98003..98071,98114..98182,98216..98284)
FT                   /note="7 probable transmembrane helices predicted for
FT                   ECA0083 by TMHMM2.0 at aa 13-35, 45-67, 80-102, 107-126,
FT                   139-161, 176-198 and 210-232"
FT   misc_feature    97868..98323
FT                   /note="HMMPfam hit to PF01925, DE Domain of unknown
FT                   function DUF81, score 3e-06"
FT   CDS_pept        98527..99441
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ECA0084"
FT                   /product="glycine-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Escherichia coli O6, Escherichia coli
FT                   O157:H7, and Shigella flexneri glycyl-tRNA synthetase alpha
FT                   chain GlyQ SWALL:AAN45053 (EMBL:AE016768) (303 aa) fasta
FT                   scores: E(): 6.4e-122, 97.34% id in 301 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73004"
FT                   /db_xref="GOA:Q6DB18"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB18"
FT                   /protein_id="CAG73004.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKE
FT                   LGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGLLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFSC
FT                   FEQYEKEAQHLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCNKKES"
FT   misc_feature    98551..99420
FT                   /note="HMMPfam hit to PF02091, DE Glycyl-tRNA synthetase
FT                   alpha subunit, score 1.3e-247"
FT   misc_feature    99016..99045
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        99451..101520
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ECA0085"
FT                   /product="glycine-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Escherichia coli glycyl-tRNA synthetase
FT                   beta chain GlyS or GlyS(b) or b3559 SWALL:SYGB_ECOLI
FT                   (SWALL:P00961) (688 aa) fasta scores: E(): 0, 84.3% id in
FT                   688 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73005"
FT                   /db_xref="GOA:Q6DB17"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB17"
FT                   /protein_id="CAG73005.1"
FT                   /translation="MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDAANLAHGDV
FT                   SWFAAPRRLALKVARLSASQPDREVEKRGPAISQAFDAEGKPTKAAEGWARGCGITVEQ
FT                   AERLTTDKGEWLLYRAHAKGEQAQALLAGMVSTALSKLPIPKLMRWSDKETQFVRPVHT
FT                   VTLLLGEELIPGQVLGIHSARTIRGHRFMGEAEFTIDNAEQYPQILLERGKVVADYDAR
FT                   KAKIKADAEDAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPSEALVYTM
FT                   KGDQKYFPVYDNSGNLLPHFIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKK
FT                   RLEDHLPRLETVLFQQQLGSLRDKTDRIQALAGWVASQIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSSAVACALAIADKM
FT                   DSLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTEEAVRLYGTKLTN
FT                   TKAVDEVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVKAVSHFRSLDAA
FT                   AALAAANKRVSNILAKSTDKLNESVNAAVLKDAAEITLATHLVVLRDKLTPLFAEGRYQ
FT                   EALVELASLREPVDAFFDQVMVMAEDEQVRVNRLTLLSQLRELFLQVADISVLQ"
FT   misc_feature    99466..101118
FT                   /note="HMMPfam hit to PF02092, DE Glycyl-tRNA synthetase
FT                   beta subunit, score 0"
FT   CDS_pept        101812..102516
FT                   /transl_table=11
FT                   /locus_tag="ECA0086"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo4070 SWALL:Q8Z9W8 (EMBL:AJ414160) (241 aa) fasta scores:
FT                   E(): 1.3e-39, 49.11% id in 226 aa, and to Escherichia coli,
FT                   Escherichia coli O6, Escherichia coli O157:H7, and Shigella
FT                   flexneri hypothetical protein YiaF SWALL:AAN45039
FT                   (EMBL:U00039) (276 aa) fasta scores: E(): 2.7e-33, 44.09%
FT                   id in 220 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73006"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB16"
FT                   /protein_id="CAG73006.1"
FT                   /translation="MTYRSRWLLPVLVILAALQLAACGDSEAEQRKAFIAFLQSVQSQQ
FT                   DGILPALTEEQKKNFGNFTNDYAILTTFSQQFNQAVSGSLTPMLGQISRIRVPKDYLTQ
FT                   RDALRQSVGTMSLLAQHVQAAKAQADNTHRALKQPEEVQIPYERLYARTVIQPTNALLP
FT                   AIPNATSFAQSLIQVGDFLQAQGDQAEFNGASVQFRTPQQVAQYNGMVAALPVQQQNLM
FT                   NALRGVNGVNYP"
FT   misc_feature    101812..101877
FT                   /note="Signal peptide predicted for ECA0086 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.747 between residues 22 and 23"
FT   CDS_pept        102940..104847
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="ECA0087"
FT                   /product="PTS system, mannitol-specific IIabc component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to Escherichia coli PTS system,
FT                   mannitol-specific IIabc component MtlA or b3599
FT                   SWALL:PTMA_ECOLI (SWALL:P00550) (637 aa) fasta scores: E():
FT                   1.1e-188, 81.63% id in 637 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73007"
FT                   /db_xref="GOA:Q6DB15"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB15"
FT                   /protein_id="CAG73007.1"
FT                   /translation="MLSPDIKIKVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWIP
FT                   NETLAKLVGPMITFLLPLLIGYTGGRLVFGERGGVVGAITTMGVIVGTDIPMFLGAMIV
FT                   GPLGGWTIKRFDRMVDGKIKSGFEMLVNNFSAGIIGMLLAILSFLAIGPLVEVFSQVLA
FT                   SGVNLMVQNNLLPLTSIFVEPAKILFLNNAINHGIFSPLGIQQATETGKSIFFLIEANP
FT                   GPGMGVLMAYMFFGRGNAKESAPGAAIIHFLGGIHEIYFPYVLMNPRLIIAVILGGMTG
FT                   VFTLSVLGGGLVSPASPGSILAVLAMTPKGAYFANLAAIAAAFAVSFIVSAILLKSTKQ
FT                   KEEDLGDATRRVQEMKASSKGAATGAGVSGDMSTVRKIIVACDAGMGSSAMGAGVLRKK
FT                   VQDAGLTNISVTNSAINSLPDDVDLVITHRDLTERAMRHAPQAQHISLTNFLDSGLYSD
FT                   LAARLVAAQGAAKHETVATPAPAVADVQTNLFQLGAGNVFLNQHATHKEQAIRFAGEQL
FT                   VKGGYVEPEYVEAMLEREKLTSTYLGESIAVPHGTIEAKDRVLKTGVVFCQYPEGVRFG
FT                   DEEDEVARLVIGIAARNNEHIQVITSLTNALDDDAVIERLAHTQDVQEVLDLLSGKKSA
FT                   "
FT   misc_feature    order(103000..103068,103096..103164,103201..103269,
FT                   103348..103416,103579..103647,103675..103734,
FT                   103747..103815,103873..103941)
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0087 by TMHMM2.0 at aa 21-43, 53-75, 88-110, 137-159,
FT                   214-236, 246-265, 270-292 and 312-334"
FT   misc_feature    104407..104835
FT                   /note="HMMPfam hit to PF00359, DE
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 2.4e-79"
FT   misc_feature    104542..104592
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT   CDS_pept        104909..106057
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="ECA0088"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="Similar to Escherichia coli mannitol-1-phosphate
FT                   5-dehydrogenase MtlD or b3600 SWALL:MTLD_ECOLI
FT                   (SWALL:P09424) (382 aa) fasta scores: E(): 5.7e-108, 77.48%
FT                   id in 382 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73008"
FT                   /db_xref="GOA:Q6DB14"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB14"
FT                   /protein_id="CAG73008.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADANVELTFADVNQPLLDALNSRKS
FT                   YSVRIVGDNTQVEAVSNVSAVHSGSQDAIALIAAADLVTTAVGPQILEKIAGTIAQGLV
FT                   KRHEDGNTRPLNIIACENMVRGTSQLKQHVLKLLPEAHQEWVVEHVGFVDSAVDRIVPP
FT                   SEAGSDDVLAVTVETFSEWIVDKTQFCGEPPAIPGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGQQARHQTIRDAILDPKVRAVVKGAMEESGAVLIKRYGFDADKHAAYINKILSRF
FT                   ENPHLHDDVDRVGRQPLRKLSAGDRLIKPLLGTLEYHLPHDNLIIGIAAAMHYRSEQDP
FT                   QALELAELIRTLGPQATLVQISGLDADSEVVAQAVNVYNAMQ"
FT   misc_feature    104909..105985
FT                   /note="HMMPfam hit to PF01232, DE Mannitol dehydrogenase,
FT                   score 1.4e-152"
FT   misc_feature    105356..105394
FT                   /note="PS00974 Mannitol dehydrogenases signature."
FT   CDS_pept        106133..106735
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="ECA0089"
FT                   /product="mannitol operon repressor"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   mannitol operon repressor MtlR or b3601 or c4418
FT                   SWALL:MTLR_ECOLI (SWALL:P36563) (195 aa) fasta scores: E():
FT                   2.6e-47, 74.15% id in 178 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73009"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB13"
FT                   /protein_id="CAG73009.1"
FT                   /translation="MSPHLPVSMLPRWVCCADLKVREVTMEETQAFENRVLEALNSGKT
FT                   VRDFMLCAVELLAEAASILMLQVFRKDDYAVKYAVEPLMTGTGPLGDLSVRLKLIYGLG
FT                   MISRKEYEDAELLMALGEELAHDDRHYRFTDDEILGPIGELHCVAALPAEPTLPLGADA
FT                   DPLLVSMQQQRYQQMVRSTLVLSLTTLIAQISLKKAF"
FT   CDS_pept        106894..107256
FT                   /transl_table=11
FT                   /locus_tag="ECA0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo4065 SWALL:AAM87627 (EMBL:AJ414160) (118 aa) fasta
FT                   scores: E(): 6.1e-24, 67.52% id in 117 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 hypothetical protein YibL SWALL:YIBL_ECOLI
FT                   (SWALL:P36564) (120 aa) fasta scores: E(): 2.8e-21, 63.63%
FT                   id in 121 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73010"
FT                   /db_xref="InterPro:IPR021230"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB12"
FT                   /protein_id="CAG73010.1"
FT                   /translation="MKEQEKTEIKLLSDQLDKLTHKQTTLLAQGDGEAIALNLEACEKL
FT                   TAEIERLRNVREQKLSKEAQKLANLPFNRAITKKEQADMGTLKKNVRGLVIVHPMTALG
FT                   REMGLKEMTGYAPKSF"
FT   CDS_pept        complement(107366..109258)
FT                   /transl_table=11
FT                   /locus_tag="ECA0091"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Yersinia pestis methyl-accepting
FT                   chemotaxis protein II Tar or Tsr SWALL:AAM87624
FT                   (EMBL:AJ414160) (649 aa) fasta scores: E(): 2.3e-112,
FT                   57.98% id in 626 aa, and to Escherichia coli
FT                   methyl-accepting chemotaxis protein III Trg
FT                   SWALL:MCP3_ECOLI (SWALL:P05704) (546 aa) fasta scores: E():
FT                   5.9e-56, 55.47% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73011"
FT                   /db_xref="GOA:Q6DB11"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB11"
FT                   /protein_id="CAG73011.1"
FT                   /translation="MAMNFDNLKVGKKLGLGFFLILLMTMVIAGAGIMHIGSLKDSIDK
FT                   VNLSNDINDEINQAKYYRALYGTTYNPDDIKKNIEHISNISKLAEKAKEFNWPESDAKK
FT                   IASIPTLISSYQEKQKGYINAVNTKDTVRKGWNISTTEKPLQQLNDQLKTDNNSATLQL
FT                   LLSDLNQKLIAVRYHVRGLLLSTNKESEEKLTDSINAAQTSLTFLYQSLSAEQRETLAP
FT                   VMTIMNNYEEQVLAYMPAYQEEMAQAGQMRVVADQLNAVILSLLSDQLAASQADIHNAT
FT                   LQMSIAALITLLLGLLISWFISRQITTPLGNTLNMAEKIAMGDLTMSINTTRKDELGQL
FT                   MSAMSKMNDNLHNMIDDIRVGVSQISNASSEIVAGNTDLSSRTEQQAAAVEQTAASMEQ
FT                   LTATVKQNADNAHHANKLAISASQTAKQGGEQVNKVVQTMTAIESSSKRIAEITSVINS
FT                   IAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSQAAKEIEGLISESVNQVS
FT                   RGATLVGNAGKTMNDIVTSITQVHDIMGEIATASDEQSKGITQVSQAIVEMDSTTQQNA
FT                   ALVEQSSAAADSLEEQARLLKQAVSVFRLANAQHDDTPAGIAFNNQPHRLHAPR"
FT   misc_feature    complement(107441..108139)
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 7.8e-111"
FT   misc_feature    complement(108047..108115)
FT                   /note="PS00538 Bacterial chemotaxis sensory transducers
FT                   signature."
FT   misc_feature    complement(108200..108409)
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   1.9e-09"
FT   misc_feature    complement(order(108353..108421,109148..109216))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0091 by TMHMM2.0 at aa 15-37 and 280-302"
FT   misc_feature    complement(109172..109258)
FT                   /note="Signal peptide predicted for ECA0091 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.980) with cleavage site
FT                   probability 0.748 between residues 29 and 30"
FT   CDS_pept        complement(109636..110262)
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="ECA0092"
FT                   /product="manganese superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="Similar to Erwinia chrysanthemi manganese superoxide
FT                   dismutase SodA SWALL:Q937L1 (EMBL:AJ278262) (213 aa) fasta
FT                   scores: E(): 3.7e-73, 87.98% id in 208 aa, and to
FT                   Escherichia coli superoxide dismutase [Mn] SodA or b3908
FT                   SWALL:SODM_ECOLI (SWALL:P00448) (205 aa) fasta scores: E():
FT                   4.8e-69, 83.49% id in 206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73012"
FT                   /db_xref="GOA:Q6DB10"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB10"
FT                   /protein_id="CAG73012.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAVLES
FT                   LPELAKLSVEELIAQLDKVPAEKKAALRNNAGGHANHSLFWKGLKLDTTLTGDLKAAIE
FT                   RDFGSVDAFKEKFEQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGY
FT                   PIVGLDVWEHAYYLKFQNRRPDYAKAFWNVLNWDEASARFASAKK"
FT   misc_feature    complement(109642..109986)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02777, DE Iron/manganese superoxide
FT                   dismutases, C-terminal domain, score 1.5e-65"
FT   misc_feature    complement(109735..109758)
FT                   /note="PS00088 Manganese and iron superoxide dismutases
FT                   signature."
FT   misc_feature    complement(109993..110193)
FT                   /note="HMMPfam hit to PF00081, DE Iron/manganese superoxide
FT                   dismutases, alpha-hairpin domain, score 3.3e-22"
FT   CDS_pept        complement(110522..111355)
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="ECA0093"
FT                   /product="putative formate dehydrogenase formation protein"
FT                   /note="Similar to Escherichia coli fdhd protein FdhD or
FT                   b3895 SWALL:FDHD_ECOLI (SWALL:P32177) (277 aa) fasta
FT                   scores: E(): 4.7e-79, 72.3% id in 278 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73013"
FT                   /db_xref="GOA:Q6DB09"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB09"
FT                   /protein_id="CAG73013.1"
FT                   /translation="MQVFQVKEVHSQADAVLEGATQHSVYHPDSLHQPQSDWLAEEVPV
FT                   ALVYNGISHVVMMASPKELEQFALGFSLSEGIIQSPADIYGIDVQNACNGIEVQIELSS
FT                   RRFAGLKERRRSMDGRTGCGVCGVEQLAEIGKPVAPLPFTQTFSLSKLENALVRLRDVQ
FT                   KIGQVTGCTHAASWIAPDGTLSGGSEDVGRHVALDKLLGARAKQGWQQGAALVSSRASY
FT                   EMVQKSAMCGVEILFAVSAATSLAVDVAQRCNLTLVGFCRPGQATIYTHPQRLSE"
FT   misc_feature    complement(110537..111268)
FT                   /note="HMMPfam hit to PF02634, DE FdhD/NarQ family, score
FT                   2e-123"
FT   CDS_pept        111626..113161
FT                   /transl_table=11
FT                   /gene="aldB"
FT                   /locus_tag="ECA0094"
FT                   /product="aldehyde dehydrogenase B"
FT                   /EC_number="1.2.1.22"
FT                   /note="Similar to Escherichia coli aldehyde dehydrogenase B
FT                   AldB or b3588 SWALL:ALDB_ECOLI (SWALL:P37685) (512 aa)
FT                   fasta scores: E(): 1.4e-172, 83.2% id in 500 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73014"
FT                   /db_xref="GOA:Q6DB08"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB08"
FT                   /protein_id="CAG73014.1"
FT                   /translation="MAHDNLEGRSAFGEVGSLDLKKRYDNFIGGTWVPPDAGQYFVNLT
FT                   PVTGQPMCEVASSSTRDIDHALDAAHKAKAEWGGLSVQERALVLNRIADRMEQNLERLA
FT                   QVETWDNGKPIRETSGADVPLAIDHFRYFAACIRAQEGAISEIDGDTVAYHFHEPLGVV
FT                   AQIIPWNFPLLMACWKMAPALAAGNCIVLKPAKLTPMSVLILMELIQDLLPAGVINVVN
FT                   GSGSEIGEYLATSKRVAKVAFTGSTEVGQQIMSYAAQNVTPVTLELGGKSPNIFFADVM
FT                   DKEDSFFDKALEGFTLFAFNQGEVCTCPSRALVQESIYDRFMERAIKRVEAIRIGNPLD
FT                   SKTMMGAQVSAGQLETILNYIDIGKKEGARVLTGGQRKAMPGGLAEGYYLEPTILFGKN
FT                   SMRVFQEEIFGPVLAVTTFKTMEDALEIANDTEYGLGAGVWSRNGNVAYRMGRGIQAGR
FT                   VWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKCLLVSYSDKPMGLF"
FT   misc_feature    111716..113134
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 5.3e-229"
FT   misc_feature    112421..112444
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    112520..112555
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        113351..114343
FT                   /transl_table=11
FT                   /locus_tag="ECA0095"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo4045 SWALL:Q8Z9Y6 (EMBL:AJ414160) (330 aa) fasta scores:
FT                   E(): 6.6e-88, 65.16% id in 333 aa, and to Escherichia coli
FT                   hypothetical protein YiaH SWALL:YIAH_ECOLI (SWALL:P37669)
FT                   (331 aa) fasta scores: E(): 5.3e-74, 56.49% id in 331 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73015"
FT                   /db_xref="GOA:Q6DB07"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR032905"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB07"
FT                   /protein_id="CAG73015.1"
FT                   /translation="MTDKIGWIDNLRALACMMVVLIHSTTYYITAGGTPGDGYWDVANV
FT                   LNSASRVCVPLFFMISGYLFFGERSAGKKNFLRVGLCLLFYSTVALIYIATLTPINGLN
FT                   SLHHALQKPIFYHLWFFYAIIVIYLLSPLITIKPVSGKYLAVLIILLAVIANPNTGRVG
FT                   FEGFKLLPVNLYIYGDTFYYVLYAALGRALGMLDVPKKVVLAAIPFFIACVALIAMGTK
FT                   HHTLLNDTFTQTFYIYCGPLVFLAAVSLLVVFKYYFSQRILPGFATISRHSLAIYGFHA
FT                   LIIHYLRTHDVMLPDHPVLDIFYVFTIALAASLLLSMALQKIDVRRWVS"
FT   misc_feature    order(113387..113455,113483..113551,113585..113653,
FT                   113690..113758,113777..113830,113858..113917,
FT                   113954..114013,114041..114109,114134..114202,
FT                   114245..114313)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0095 by TMHMM2.0 at aa 13-35, 45-67, 79-101, 114-136,
FT                   143-160, 170-189, 202-221, 231-253, 262-284 and 299-321"
FT   CDS_pept        complement(114374..115831)
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="ECA0096"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="Similar to Escherichia coli xylulose kinase XylB
FT                   SWALL:XYLB_ECOLI (SWALL:P09099) (484 aa) fasta scores: E():
FT                   7.7e-141, 73.81% id in 485 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73016"
FT                   /db_xref="GOA:Q6DB06"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB06"
FT                   /protein_id="CAG73016.1"
FT                   /translation="MYIGIDLGTSGVKAILLDETGEVIASHSAALSISRPHPLWSEQAP
FT                   EDWWQATDQALQALAATHSLRAVKALGLTGQMHGATLLDAHQNILRPAILWNDGRSAAQ
FT                   CRTLEQLVPTSRQITGNLMMPGFTAPKLKWVQENESDIFRQIDKVLLPKDYLRWRLTGE
FT                   FASDMSDAAGTLWLDVAKRDWSDALLEACSLSREHMPTLYEGNQITGYLRPDIASRWGM
FT                   DPVPVIAGGGDNAAGAIGVGLYQTGQAMLSLGTSGVYFAVSDGFLSNPQHAVHSFCHAL
FT                   PNTWHLMSVMLSAASCLDWVARLTHAESVPALLQEVASMPADDTITPVWFLPYLSGERT
FT                   PHNNPDAKGAFWGLTHQHGRAELAKAVLEGVGFALADGMDALHMTGLKPDSITLIGGGA
FT                   RSDYWRQMLADISGQTLEYRTGGDVGPALGAARLAQIAMHPHTPLAELLPPLPMEQVHQ
FT                   PNTQRHADYAERRRTFKTLYQQLSPLM"
FT   misc_feature    complement(114428..115105)
FT                   /note="HMMPfam hit to PF02782, DE FGGY family of
FT                   carbohydrate kinases, C-terminal domain, score 2.7e-82"
FT   misc_feature    complement(114725..114787)
FT                   /note="PS00445 FGGY family of carbohydrate kinases
FT                   signature 2."
FT   misc_feature    complement(115112..115831)
FT                   /note="HMMPfam hit to PF00370, DE FGGY family of
FT                   carbohydrate kinases, N-terminal domain, score 2.4e-118"
FT   misc_feature    complement(115418..115456)
FT                   /note="PS00933 FGGY family of carbohydrate kinases
FT                   signature 1."
FT   CDS_pept        complement(115898..117217)
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="ECA0097"
FT                   /product="putative D-xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="Similar to Escherichia coli xylose isomerase XylA
FT                   SWALL:XYLA_ECOLI (SWALL:P00944) (440 aa) fasta scores: E():
FT                   1.5e-155, 82.42% id in 438 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73017"
FT                   /db_xref="GOA:Q6DB05"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB05"
FT                   /protein_id="CAG73017.1"
FT                   /translation="MQAYFEQIEKVRYEGSQSSNPFAFRHYNPDQEILGKRMADHLRFA
FT                   VAYWHTFCWNGSDMFGVGSFARPWQQSGDALELAKRKADIAFEFFQKLSVPYYCFHDVD
FT                   VAPEGNSLKEYLHNIAVITDVLAEKQQDSGVKLLWGTANCFTNPRYGAGAATNPDPDVF
FT                   AWAATQVFTAMNATKTLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHK
FT                   IGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNVEANHATLAGHSFHH
FT                   EIATAVALGVFGSVDANRGDPQLGWDTDQFPNSVEENTLIMYEILKAGGFTTGGLNFDA
FT                   KVRRQSTDRYDLFHAHIGAMDTMALALKAAARMIEDDKLNQLVAKRYAGWNGELGQQIL
FT                   QGNASLESLAQYAESHQLAPQHQSGQQELLENLVNRHLFG"
FT   misc_feature    complement(115907..117133)
FT                   /note="HMMPfam hit to PF00259, DE Xylose isomerase, score
FT                   3.6e-259"
FT   misc_feature    complement(116504..116527)
FT                   /note="PS00172 Xylose isomerase signature 1."
FT   misc_feature    complement(116891..116920)
FT                   /note="PS00173 Xylose isomerase signature 2."
FT   CDS_pept        117691..118689
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /gene_synonym="xylT"
FT                   /locus_tag="ECA0098"
FT                   /product="D-xylose-binding periplasmic protein"
FT                   /note="Similar to Escherichia coli D-xylose-binding
FT                   periplasmic protein precursor XylF or XylT or b3566
FT                   SWALL:XYLF_ECOLI (SWALL:P37387) (330 aa) fasta scores: E():
FT                   2e-88, 77.87% id in 330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73018"
FT                   /db_xref="GOA:Q6DB04"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB04"
FT                   /protein_id="CAG73018.1"
FT                   /translation="MMKVNHFLLSACAIFTLACQPGFAKDVKIGMAIDDLRLERWQKDR
FT                   DLFVEQAKKQGADVFVQSANGNEATQISQIENMINRGVDVLVIIPYNGQVLGNVIAEAK
FT                   REGIKVLAYDRMINNADVDFYISFDNEKVGELQAKYLVDKVPGGNYFLMGGSPVDNNAK
FT                   LFRQGQMKVLTPLIESGKIKVVGDQWVDAWLPENALKIMENALTANSNKIDAVVASNDA
FT                   TAGGAIQALAAQGLAGKVAISGQDADLAAIKRIVAGTQTMTVYKPISKLAKDAADIAVA
FT                   LGAGKTPESNAKLNNGLKDIPSFLLTPIPVDKSNIDSTIIADGFHKKADVY"
FT   misc_feature    117691..117762
FT                   /note="Signal peptide predicted for ECA0098 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 24 and 25"
FT   misc_feature    117715..117747
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    117766..118635
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   2.8e-05"
FT   CDS_pept        118825..120366
FT                   /transl_table=11
FT                   /gene="xylG"
FT                   /locus_tag="ECA0099"
FT                   /product="D-xylose transport ATP-binding protein"
FT                   /note="Similar to Escherichia coli D-xylose transport
FT                   ATP-binding protein XylG SWALL:XYLG_ECOLI (SWALL:P37388)
FT                   (513 aa) fasta scores: E(): 6.2e-151, 78.55% id in 513 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73019"
FT                   /db_xref="GOA:Q6DB03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DB03"
FT                   /protein_id="CAG73019.1"
FT                   /translation="MPHLLEMKNITKAFGAVKAVDNVSLTLEAGQVLSLCGENGSGKST
FT                   LMKVLCAIYPHGSYDGQIIFSGDELRANHIRDTEQKGIAIIHQELALVKEMTVLENMFL
FT                   GNEWTRFGVMDYDNMYLRCQRMLEQVKLAVDPNTKVGELGLGQQQLVEIAKALNKQVRL
FT                   LVLDEPTASLTERETGILLEIIQDLRDHGIACIYISHKLNEVKAISDVICVIRDGKHIG
FT                   TRPAAELSEDHIIAMMVGRELTELYPNEPHVIGEEVLRVEHLTAWHPVNRHIRRVDDVS
FT                   FALHRGEILGIAGLVGSGRTETVQCLFGAYRGRWQGDIFIDGKPVTISNCQQAMAQGIA
FT                   MVPEDRKKDGIVPVMGVAQNMTLAALDQFTGPLSMLDDAREQDIIRQSLANLKVKTSSP
FT                   ELAIARLSGGNQQKAVLAKCLLLNPRILILDEPTRGIDIGAKYEIYKLINALVKQHIAV
FT                   IVISSELPEVLGLSDRVLVMHQGRIKADLINRDLTQEQVMEAALRSEHRAENIAV"
FT   misc_feature    118912..119478
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   6.3e-44"
FT   misc_feature    118933..118956
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    119683..120267
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   6.6e-24"
FT   misc_feature    120040..120084
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        120344..121525
FT                   /transl_table=11
FT                   /gene="xylH"
FT                   /locus_tag="ECA0100"
FT                   /product="xylose transport system permease"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri xylose
FT                   transport system permease protein XylH SWALL:XYLH_ECOLI
FT                   (SWALL:P37389) (393 aa) fasta scores: E(): 3.6e-116, 82.39%
FT                   id in 392 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73020"
FT                   /db_xref="GOA:Q6DB02"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB02"
FT                   /protein_id="CAG73020.1"
FT                   /translation="MLKTSQSEQQHVAGSVSMLQRLKSINLQVYVMIAAIIAIMLFFTY
FT                   MTDGAYLSARNLSNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGAAAIFDVW
FT                   FGWPLPLTIVVTLALGLLLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIGITNGTTVS
FT                   PTSEAMSQIGQSYLPSGIGFMFGAIGLMVFIGWQWRRRSSRARLGLPINPPAGDVGRQT
FT                   VTALVVLGAIYLLNDYRGVPTPVLVLTLLMLGGIFLATRTAFGRRIYAVGGNIDAARLS
FT                   GVNVERTKMAVFAINGLMVAVAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGG
FT                   IGSVAGAVMGAFIMASLDNGMSMLDVPTFWQYVVKGGILLLAVWMDTATKRRV"
FT   misc_feature    order(120413..120481,120524..120583,120596..120664,
FT                   120674..120742,120761..120829,120872..120931,
FT                   121070..121138,121214..121282,121319..121387,
FT                   121445..121498)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0100 by TMHMM2.0 at aa 24-46, 61-80, 85-107, 111-133,
FT                   140-162, 177-196, 243-265, 291-313, 326-348 and 368-385"
FT   misc_feature    120500..121519
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 0.00031"
FT   CDS_pept        121662..122840
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="ECA0101"
FT                   /product="xylose operon regulatory protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 xylose operon regulatory
FT                   protein XylR SWALL:XYLR_ECOLI (SWALL:P37390) (392 aa) fasta
FT                   scores: E(): 2.5e-127, 81.02% id in 390 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73021"
FT                   /db_xref="GOA:Q6DB01"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB01"
FT                   /protein_id="CAG73021.1"
FT                   /translation="MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDF
FT                   RCRIDNIKEWLGDGVIADFDDGEIKRLLQDVNVPLVGVGGSYHQPEDYPPVHYIATDNY
FT                   ALVESAFMHLKDKGLNRFAFYGLPASGGKGWAQEREHAFRQLVAAEKYQGVVYQGMETS
FT                   PDNWQYAQNRLADWVQGLPPQTGIIAVTDSRARHLLQVCEHLNIAVPEKLCVIGIDNED
FT                   LIRYLSRVALSSVAQGTRQMGYRAAKLLHQLLLNQVDLPLQRILVPPVRVVERRSTDYR
FT                   SVHDPAVIQAMHFIRYHACKGIKVEQVLDAVGISRSNLEKRFKDEVGQTIHGVIHAEKL
FT                   DRARNLLISTSLSIGEISLMCGYPSLPYFYAVFKKGYDITPKEYRERYGEGY"
FT   misc_feature    121674..122489
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   0.41"
FT   misc_feature    122532..122669
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 1.5e-05"
FT   misc_feature    122568..122633
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1108.000, SD 2.96 at aa 303-324, sequence
FT                   IKVEQVLDAVGISRSNLEKRFK"
FT   misc_feature    122676..122804
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    122688..122819
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 4.1e-11"
FT   CDS_pept        complement(122910..123485)
FT                   /transl_table=11
FT                   /locus_tag="ECA0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium putative
FT                   intracellular protease/amidase AraH or stm1931 SWALL:Q8ZNU7
FT                   (EMBL:AE008786) (185 aa) fasta scores: E(): 1.4e-44, 64.86%
FT                   id in 185 aa, and to Yersinia pestis Thij/Pfpi-family
FT                   thiamine biogenesis protein ypo0845 SWALL:Q8ZHP5
FT                   (EMBL:AJ414145) (192 aa) fasta scores: E(): 1.8e-29, 47.59%
FT                   id in 187 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73022"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DB00"
FT                   /protein_id="CAG73022.1"
FT                   /translation="MSKKVAVLLAPGFEEAEAIMVIDVLHRMKIEVTMLSCHDRLELHS
FT                   YHNIRMFADALLERNQDTLFDAVVIPGGPQGTVNLAANPMVVEFIRRHDDAGKLICPLC
FT                   SAAARVLGGNKLLKGRRYVCSGDLWQDVTDGVYVNEKVVEDGNLISGKGLGVSFDFAFT
FT                   IATRLTGDKEDANFQVEHIDYDYWRVPA"
FT   misc_feature    complement(122979..123479)
FT                   /note="HMMPfam hit to PF01965, DE DJ-1/PfpI family, score
FT                   1.1e-23"
FT   CDS_pept        complement(123731..123943)
FT                   /transl_table=11
FT                   /locus_tag="ECA0103"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Possible false
FT                   CDS."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ9"
FT                   /protein_id="CAG73023.1"
FT                   /translation="MTEHRPKGLTLRAIQNEHVLSCNSNYLGYQLSRHTIMLRHTLMIV
FT                   RALCTSHGPVDDQKSTRSPMHIYAK"
FT   CDS_pept        124086..125432
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="ECA0104"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   argininosuccinate synthase ArgG or b3172 or c3929
FT                   SWALL:ASSY_ECOLI (SWALL:P22767) (446 aa) fasta scores: E():
FT                   1.2e-162, 91.89% id in 444 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73024"
FT                   /db_xref="GOA:Q6DAZ8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAZ8"
FT                   /protein_id="CAG73024.1"
FT                   /translation="MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANL
FT                   GQPDEDDYDEIPRRAMEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTAGVTYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFI
FT                   DELGGRQEMSEFMSQAGFGYKMSAEKAYSTDSNILGATHEAKDLEFLNSSVKIVNPIMG
FT                   VKFWDENVKVPAEEVTIRFERGHPVALNGKTFTDDIELMLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQYHANGRQLGRFLYQGRWFDSQ
FT                   ALMLRDSSQRWIASAITGEVTLELRRGNDYSIMNTVSDNLTYKPERLTMEKGDSVFSPD
FT                   DRIGQLTMRNLDITDTREKLFNYAETGLLSSSASTGLPQVGQLQDKTEK"
FT   misc_feature    124128..125339
FT                   /note="HMMPfam hit to PF00764, DE Arginosuccinate synthase,
FT                   score 8.6e-209"
FT   misc_feature    124134..124160
FT                   /note="PS00564 Argininosuccinate synthase signature 1."
FT   misc_feature    124470..124505
FT                   /note="PS00565 Argininosuccinate synthase signature 2."
FT   CDS_pept        125689..126339
FT                   /transl_table=11
FT                   /gene="expI"
FT                   /gene_synonym="carI"
FT                   /gene_synonym="hslI"
FT                   /locus_tag="ECA0105"
FT                   /product="N-acylhomoserine lactone synthesis protein"
FT                   /note="Similar to Erwinia carotovora autoinducer synthesis
FT                   protein CarI or HslI SWALL:CARI_ERWCA (SWALL:P33880) (216
FT                   aa) fasta scores: E(): 1.1e-85, 97.22% id in 216 aa, and to
FT                   Erwinia carotovora autoinducer synthesis protein ExpI
FT                   SWALL:EXPI_ERWCA (SWALL:P33882) (217 aa) fasta scores: E():
FT                   9.2e-65, 72.94% id in 207 aa, and to Erwinia chrysanthemi
FT                   AhlI SWALL:Q8KUJ8 (EMBL:AF448800) (212 aa) fasta scores:
FT                   E(): 6.5e-54, 62.26% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73025"
FT                   /db_xref="GOA:Q6DAZ7"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ7"
FT                   /protein_id="CAG73025.1"
FT                   /translation="MLEIFDVNHTLLSETKSEELFTLRKETFKDRLNWAVQCTDGMEFD
FT                   QYDNNNTTYLFGIKDNTVICSLRFIETKYPNMITGTFFPYFKEINIPDGNYLESSRFFV
FT                   DKSRAKDILGNEYPISSMLFLSMINYSRDKGYDGIYTIVSHPMLTILKRSGWGISVVEQ
FT                   GLSEKEEKVYLVFLPVDDENQEALARRINRSGTFMSNELKQWPLRLPAAIAQA"
FT   misc_feature    125710..126252
FT                   /note="HMMPfam hit to PF00765, DE Autoinducer synthetase,
FT                   score 1.7e-132"
FT   misc_feature    125755..125832
FT                   /note="PS00949 Autoinducers synthetases family signature."
FT   CDS_pept        complement(126323..127051)
FT                   /transl_table=11
FT                   /gene="expR"
FT                   /locus_tag="ECA0106"
FT                   /product="quorum-sensing transcriptional regulator"
FT                   /note="Similar to Pectobacterium carotovorum subsp.
FT                   betavasculorum LuxR homolog EcbR SWALL:O30346
FT                   (EMBL:AF001050) (242 aa) fasta scores: E(): 3.8e-85, 93.38%
FT                   id in 242 aa, and to Erwinia chrysanthemi transcriptional
FT                   activator protein EchR SWALL:ECHR_ERWCH (SWALL:Q46967) (250
FT                   aa) fasta scores: E(): 3.6e-54, 58.61% id in 244 aa, and to
FT                   Erwinia carotovora transcriptional activator protein ExpR
FT                   SWALL:EXPR_ERWCA (SWALL:Q47189) (245 aa) fasta scores: E():
FT                   1.5e-56, 61.57% id in 244 aa. Also similar to ECA1561
FT                   (67.839%% in 199 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73026"
FT                   /db_xref="GOA:Q6DAZ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ6"
FT                   /protein_id="CAG73026.1"
FT                   /translation="MSPLFTNSEIISRVIKEHFNKNLDHYDGVKFSFMVLNKKNPSQMI
FT                   IISSYPDEWVNLYKENKYQHIDPVVLASFNKISPFSWEKSLVINTRLQLAKIFDLSKKY
FT                   DIINGYTFVLHDHGDNLAMLSIIVDNSYPDDVETFIEERKDIFQMLLIEAYEKIISLCK
FT                   EMIGNKKQLNNKEIFSQRENEILYWASMGKTYLEVAIILGIKTSTVKFHIGNVVKKLGV
FT                   LNAKHAIRLGVELQLIKPVQ"
FT   misc_feature    complement(126332..126529)
FT                   /note="HMMPfam hit to PF00196, DE Bacterial regulatory
FT                   proteins, luxR family, score 1.7e-08"
FT   misc_feature    complement(126395..126478)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(126410..126475)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1350.000, SD 3.78 at aa 150-171, sequence
FT                   KTYLEVAIILGIKTSTVKFHIG"
FT   misc_feature    complement(126572..126922)
FT                   /note="HMMPfam hit to PF03472, DE Autoinducer binding
FT                   domain, score 4.2e-30"
FT   CDS_pept        complement(127317..128513)
FT                   /transl_table=11
FT                   /gene="pmeB"
FT                   /locus_tag="ECA0107"
FT                   /product="pectin methylesterase"
FT                   /EC_number="3.1.1.11"
FT                   /note="Similar to Erwinia chrysanthemi pectinesterase B
FT                   precursor PemB SWALL:PMEB_ERWCH (SWALL:Q47474) (433 aa)
FT                   fasta scores: E(): 8.6e-100, 65.48% id in 394 aa, and to
FT                   Erwinia carotovora pectinesterase b pemB SWALL:PMEB_ERWCA
FT                   (SWALL:P55743) (178 aa) fasta scores: E(): 7.6e-61, 91.47%
FT                   id in 176 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73027"
FT                   /db_xref="GOA:Q6DAZ5"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ5"
FT                   /protein_id="CAG73027.1"
FT                   /translation="MKKTTYPGTVSRPILSAQEADRFTLPDYFTLRGHDGHADVWQPAP
FT                   IEVDPATPWVVGPQVGVDGATYANIQQAVNAALQAQQGRAHIDIKVLPGSYIGTVYLPA
FT                   DSPPLTLFGAGEQPDNVVIQLALDSMFSPATYQKTVNPHGEYQPGDPAWYMYDLCASKQ
FT                   NATIDTLCAAVVWSQSDNFQMKNLTVVNSLLDSVDSRAHQAVALRTDGDKVQLERVRLI
FT                   GRQDTFFVNTSNLHNEYVTDRYSRVYIKDSYIEGDVDYVFGRATAVFNRVHFHTVSSRG
FT                   AKDIHVFAPDSMPWVQYGFLAVKCRFTGDEGFSRERKAKLGRAWDQGARQTGYQPGLTA
FT                   NGQLVIRDSTIDASYDREQPWGAAATTARPFVGNTDSARNLDDMHFNRLWEYNNIDKA"
FT   misc_feature    complement(127326..128513)
FT                   /note="HMMPfam hit to PF01095, DE Pectinesterase, score
FT                   8.8e-11"
FT   misc_feature    complement(127725..127754)
FT                   /note="PS00503 Pectinesterase signature 2."
FT   CDS_pept        complement(128542..128991)
FT                   /transl_table=11
FT                   /locus_tag="ECA0108"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Shigella flexneri conserved hypothetical
FT                   protein YdgC SWALL:AAN43211 (EMBL:AE015184) (111 aa) fasta
FT                   scores: E(): 9.5e-27, 65.42% id in 107 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7 hypothetical
FT                   protein YdgC SWALL:YDGC_ECOLI (SWALL:P52110) (111 aa) fasta
FT                   scores: E(): 9.5e-27, 65.42% id in 107 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73028"
FT                   /db_xref="GOA:Q6DAZ4"
FT                   /db_xref="InterPro:IPR009707"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ4"
FT                   /protein_id="CAG73028.1"
FT                   /translation="MPRIEISSCAVTLFHTGTFSLFSVHSRCLIKPEVILMSLFIKSVI
FT                   GALIVLLISVLAKSRNYYIAGLVPLFPTFALIAHYIVGTERGLDALRTTILFGIWSVIP
FT                   YLAYLISLYYFTGWMKLPQALLAAVVCWSVSAALLIKIWTWYQGN"
FT   misc_feature    complement(order(128554..128622,128647..128715,
FT                   128743..128811,128824..128892,128920..128973))
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0108 by TMHMM2.0 at aa 7-24, 34-56, 61-83, 93-115 and
FT                   124-146"
FT   CDS_pept        129082..130098
FT                   /transl_table=11
FT                   /locus_tag="ECA0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c1689 SWALL:AAN80156 (EMBL:AE016760) (347 aa) fasta scores:
FT                   E(): 6e-85, 68.73% id in 323 aa, and to Yersinia pestis
FT                   hypothetical y2334 SWALL:AAM85893 (EMBL:AE013835) (179 aa)
FT                   fasta scores: E(): 2.2e-47, 73.83% id in 172 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73029"
FT                   /db_xref="GOA:Q6DAZ3"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ3"
FT                   /protein_id="CAG73029.1"
FT                   /translation="MLKTQSHAFTQGLVPLKIISTGSALPAQRVTSAELDVRLNKPAGY
FT                   VESRSGIIYRHHADNHASQAELGVAALNDALARGVIPPASIDLLLFASAIPIQALPYSA
FT                   SHLLKASSLPKGTACFDINSSCVSFISALQVAAGLLNTGAYRRIAIVSTELASRGIDWD
FT                   DEESSLIFGDGAACAIVERGDGRSGIAACLLETYPKGNELCQIRAGGTLRNPRAGMELH
FT                   DFLFHMQGKRLFRQASALIEGYLQRLLDASGFTLEQMAAVVPHQASHLSLEHMRKRLAI
FT                   PTERLIDIYRYHGNQVAASIPTALHHAIVTQRLPEGEPAMLVGTAAGLTLGGMVLIP"
FT   CDS_pept        130095..131123
FT                   /transl_table=11
FT                   /locus_tag="ECA0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   SWALL:AAM85892 (EMBL:AL031866) (338 aa) fasta scores: E():
FT                   1.2e-77, 59.64% id in 342 aa, and to Escherichia coli O6
FT                   hypothetical protein YbjS SWALL:AAN80157 (EMBL:AE016760)
FT                   (338 aa) fasta scores: E(): 9.2e-76, 58.43% id in 332 aa,
FT                   and to Yersinia pestis putative nucleotide di-p-sugar
FT                   epimerase or dehydratase y2825 SWALL:AAM86376
FT                   (EMBL:AE013886) (341 aa) fasta scores: E(): 8.4e-58, 48.19%
FT                   id in 332 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73030"
FT                   /db_xref="GOA:Q6DAZ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ2"
FT                   /protein_id="CAG73030.1"
FT                   /translation="MKVFVTGATSGLGRNAVEWLLQAGHQVLACGRDRTVGQQLDMLGA
FT                   QFICIDLVETSVEQYRSLMAGCDVVWHCAAKSSPWGQYDDFYQNNTEVAARLAEAAGQL
FT                   GIPRFVHISTPAIYFDYQHHLNIDESYRAARFANHYAQTKFLAEERLHALTSRYPQTTY
FT                   VILRPRGLFGPHDRVILPRVLEQISVGGGVLRLPRGGEALLDLTFVGNVVEAMALASQR
FT                   TGLVSGSTYNITNHEPARLADMLAQLLVGQLGMNYRVKAVPYPLLHAVAGGMELFSRFS
FT                   RKEPLLTRYSAGAVNFDMTLSAEKAQQELGYQPRFSLQQGIELTGSWFNTHLAQRSTDG
FT                   HG"
FT   CDS_pept        131116..131922
FT                   /transl_table=11
FT                   /locus_tag="ECA0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 putative GumP homolog
FT                   c1691 SWALL:AAN80158 (EMBL:AE016760) (268 aa) fasta scores:
FT                   E(): 3.6e-70, 63.43% id in 268 aa, and to Yersinia pestis
FT                   hypothetical y2332 SWALL:AAM85891 (EMBL:AE013835) (283 aa)
FT                   fasta scores: E(): 2.2e-69, 62.68% id in 268 aa, and to
FT                   Xanthomonas axonopodis GumP protein SWALL:Q8PJG2
FT                   (EMBL:AE011897) (282 aa) fasta scores: E(): 8.9e-25, 35.71%
FT                   id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73031"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ1"
FT                   /protein_id="CAG73031.1"
FT                   /translation="MANISTFEVGYCLHPGCMALRGAGWKVCRFPARVWMLESHGKRWL
FT                   WDTGYAQHFTDATRSGLFQLYRRMTPVHFETKDALIHQLHAQGIQPADIDGLIISHFHG
FT                   DHIAGLQDFPTVPFICSALGWQQTRNLRGFAALKRAFVPALIPEHFEQSLQFVENFPLT
FT                   DLPAALAPFTQGYVLPGSDKEIVLVPLPGHAVGHLGAFVLTETGWVLLASDAAWSPHSY
FT                   REGRGPSRLANLVMDDPKAYYQTLDQLHQLHLNGQVEIRLCHEGDL"
FT   CDS_pept        131919..133205
FT                   /transl_table=11
FT                   /locus_tag="ECA0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis putative coenzyme
FT                   synthetase ypo1981 SWALL:Q8ZF14 (EMBL:AJ414150) (428 aa)
FT                   fasta scores: E(): 3.7e-117, 67.37% id in 423 aa, and to
FT                   Escherichia coli O6 hypothetical protein c1692
FT                   SWALL:AAN80159 (EMBL:AE016760) (428 aa) fasta scores: E():
FT                   1.3e-111, 65.48% id in 423 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73032"
FT                   /db_xref="InterPro:IPR012685"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAZ0"
FT                   /protein_id="CAG73032.1"
FT                   /translation="MIPLMTIWHYFRASRLSFSTRQALERHQQRQLSRFARRVLACSPY
FT                   FHTYCHLPITSWPMMDKAVMMAEFDRMNTAGLKRDDLLACARRSEDDRDFTPNVNGFSV
FT                   GLSSGTSGQRGLFVVSPREQQIWAGGMLAKMLPDGLRAGERVALFLRADNNLYHSVDNR
FT                   WLSLSFYDLFAPFAEHFSRLETWSPSIIVAPAQVLRELALAVRRGELNLSVKKVISVAE
FT                   VLEPQDKQLLQQVFGQVGEVYQATEGFLASTCEHGTLHLNEEFIHIEPQWLDDERFTPV
FT                   ITDFTRSTQPIVRYRLDDVLVKQKAPCACGRVTMAIARIEGRSDDSLRLPNNSGEPQTV
FT                   FADLCSRIIANALPLHADYLLVQHGEAALHLSAACSLPELEACRDSLSQQFALQGIDTS
FT                   RLRWQLTAGEIAPEFTQKRRRITRLKEEA"
FT   CDS_pept        133202..133855
FT                   /transl_table=11
FT                   /locus_tag="ECA0113"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c1693 SWALL:AAN80160 (EMBL:AE016760) (204 aa) fasta scores:
FT                   E(): 5.5e-40, 58.69% id in 184 aa, and to Ralstonia
FT                   solanacearum probable transmembrane protein rsp0404
FT                   SWALL:Q8XSR3 (EMBL:AL646078) (220 aa) fasta scores: E():
FT                   9.5e-09, 31.25% id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73033"
FT                   /db_xref="GOA:Q6DAY9"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY9"
FT                   /protein_id="CAG73033.1"
FT                   /translation="MMRFPQRTMLLRLKALLFGWGSVGVVYQLSAQFQGQGTVLSPSMV
FT                   DEWIPFSASAIWLYLSFFIIIPLSYLSCPITRLAGLRRATQFTALIAGAVYLIFPTTMV
FT                   YPQVVGDDISARLLQLLQRIDSPQNCLPSLHIALTVLAVWAMSDSQQKVKTGLYFLWGA
FT                   AIAFSILQLRRHLFIDLVTGAMLAGIVGWIFLRSREAVKVISPSTLPNNKRHQE"
FT   misc_feature    133202..133291
FT                   /note="Signal peptide predicted for ECA0113 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.679) with cleavage site
FT                   probability 0.393 between residues 30 and 31"
FT   misc_feature    order(133238..133306,133364..133423,133460..133528,
FT                   133571..133639,133664..133717,133727..133786)
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0113 by TMHMM2.0 at aa 13-35, 55-74, 87-109, 124-146,
FT                   155-172 and 176-195"
FT   misc_feature    133361..133810
FT                   /note="HMMPfam hit to PF01569, DE PAP2 superfamily, score
FT                   0.017"
FT   CDS_pept        133860..134975
FT                   /transl_table=11
FT                   /locus_tag="ECA0114"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c1694 SWALL:AAN80161 (EMBL:AE016760) (374 aa) fasta scores:
FT                   E(): 9.6e-86, 56.09% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73034"
FT                   /db_xref="GOA:Q6DAY8"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY8"
FT                   /protein_id="CAG73034.1"
FT                   /translation="MIDLALPIVFMLVVVIGEALVLQWMQREKVNWHDVVFNLNSGHIM
FT                   LWLFRSVEIFCYGYVAAHFSFGWVETWPPVLMWLFAILAWDFGFYWLHRLHHTFGVLWA
FT                   VHVVHHQGEHFNLSLGVRNSWYSSLTSIPFFLILALLGVPLYVFVTVSILHYSVQLFNH
FT                   NAMTPKLGWLEKVLVTPAHHRVHHVNDRAYADKNFGGTFIFWDKLFGSFCPQLPDTPFR
FT                   YGAGKETPSKNPFLASNLPFLSYLKLSVRRTRQATFHCTPTALIAGSMLLFALVVGYVY
FT                   LYGYGYDSANLSQAVLFLLLVTGAVALGGISEGRRWGIYVWLLVVLLFPAVFLVYLGWE
FT                   ALYWKIAMLMLALHGLAMMVGWGQRPIAVGE"
FT   misc_feature    order(133878..133937,133995..134063,134082..134135,
FT                   134259..134327,134637..134705,134733..134792,
FT                   134811..134870,134880..134948)
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0114 by TMHMM2.0 at aa 7-26, 46-68, 75-92, 134-156,
FT                   260-282, 292-311, 318-337 and 341-363"
FT   CDS_pept        134972..136117
FT                   /transl_table=11
FT                   /locus_tag="ECA0115"
FT                   /product="putative fatty acid desaturase"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c1695 SWALL:AAN80162 (EMBL:AE016760) (363 aa) fasta scores:
FT                   E(): 7.8e-66, 45.87% id in 364 aa, and to Synechocystis sp.
FT                   linoleoyl-coA desaturase des6 or sll0262 SWALL:LLCD_SYNY3
FT                   (SWALL:Q08871) (359 aa) fasta scores: E(): 1.5e-18, 28.49%
FT                   id in 365 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73035"
FT                   /db_xref="GOA:Q6DAY7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY7"
FT                   /protein_id="CAG73035.1"
FT                   /translation="MKMNDALPAKLYPAKGEQAFHRALQRETSAYLRANHDHRFADRGQ
FT                   FVKAGLLFLCGIVCYVLCLVQQEAWSFFLSYFSFIMLSMLLNIIVNHDASHNTFFRSHT
FT                   LNRVVGRIVTLPLGIDPDYWRWRHVDFHHLYPNVEHYDLDTEENGVFRQTPFQRHRSYM
FT                   RYQHLYWPLVAAFSLPYIAWIFDWADRLGKTPVNARVAQSGRGGWLIFIGSKIGHILLV
FT                   LVIPIMVGGAHGISPGIVLLSYVFGQMLASLLVVFLLLGTHWAEAEFYAVADAENMPQG
FT                   WYQHNFATACDWLPTPRWLGHWTGGLNLHLTHHLFPGWHHRHYPALAGILRRIAAEHGM
FT                   NYRCITYRELLDSQRRFLKSMGEGYDRRTAQRTEQSRLEEE"
FT   misc_feature    order(135107..135166,135176..135244,135473..135526,
FT                   135596..135664,135683..135751)
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0115 by TMHMM2.0 at aa 46-65, 69-91, 168-185, 209-231
FT                   and 238-260"
FT   misc_feature    135176..135976
FT                   /note="HMMPfam hit to PF00487, DE Fatty acid desaturase,
FT                   score 1.1e-05"
FT   CDS_pept        136117..137208
FT                   /transl_table=11
FT                   /locus_tag="ECA0116"
FT                   /product="putative fatty acid desaturase"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c1695 SWALL:AAN80162 (EMBL:AE016760) (363 aa) fasta scores:
FT                   E(): 4.1e-77, 54.33% id in 346 aa, and to Synechocystis sp.
FT                   linoleoyl-coA desaturase des6 or sll0262 SWALL:LLCD_SYNY3
FT                   (SWALL:Q08871) (359 aa) fasta scores: E(): 1.3e-20, 28.57%
FT                   id in 364 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73036"
FT                   /db_xref="GOA:Q6DAY6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY6"
FT                   /protein_id="CAG73036.1"
FT                   /translation="MLAPLKPLRYEQGRDLALHRALMKAANAYLAETGDHRFANAGFIG
FT                   KMLFLVALCLTFYGFSLQQTTLLGFAGCYFAFIFTAMFLAVNVVHDASHNVFFRRSWAN
FT                   RLLNIVVSIPLGMDSDCWRVRHVIFHHAHVNVQHYDLDIEENGVLRQSPYHRFRFFMRA
FT                   QRYYWPMVASLTFPCIIWFFDWLDRAGKTQVTRNMTLQGAKGWGVFLLSKVLHALLALA
FT                   IPYWLLSPTPISFGSLLLVYLLSQMLSSLIFVVLILGSHWAKGTFYQAPEDGLFKHGRY
FT                   QHAFSTTVDWHTRPAWLGYWLGQLNMHLTHHLFPNWNHRHYPALSKIIADVAPRHGIDY
FT                   QCITLKAILVEQQRFLKKMGTGR"
FT   misc_feature    order(136228..136296,136315..136383,136612..136671,
FT                   136732..136800,136828..136896)
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0116 by TMHMM2.0 at aa 38-60, 67-89, 166-185, 206-228
FT                   and 238-260"
FT   misc_feature    136336..137115
FT                   /note="HMMPfam hit to PF00487, DE Fatty acid desaturase,
FT                   score 1.2e-06"
FT   CDS_pept        137275..138204
FT                   /transl_table=11
FT                   /locus_tag="ECA0117"
FT                   /product="putative exported protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein Xac2610 SWALL:Q8PJC5 (EMBL:AE011901) (267 aa) fasta
FT                   scores: E(): 6.7e-11, 30.18% id in 159 aa, and to Yersinia
FT                   pestis putative exported protein ypo0702 or y3476
FT                   SWALL:AAM87024 (EMBL:AJ414144) (331 aa) fasta scores: E():
FT                   0.00098, 27.43% id in 113 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73037"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY5"
FT                   /protein_id="CAG73037.1"
FT                   /translation="MRYLSLAVSSLLFFFTSSVWAMDCSKASTDTEKMICASSRLQQLD
FT                   AVLNKAYQGYVKKADKAQARQEQRTWLAERDRCKDDVCLGNEMVSRIQALSGSENISVI
FT                   TQASGQWDFILSVATCNLDSSYSTCEGPGTLDIFKKGSGDLFQRITMENLFIELNNKGE
FT                   VTANLVEVYGENNSGLVIDDANFDHHADIMLRNGNNGAYGGPSYDVYLFDVEKQQFTQN
FT                   APLTELASSNLGLFDIDEKSKTITTFTKSGCCWHQWSAYQMANNKPVLIVETTEAYSEE
FT                   KQAMVATTRELVSGKWKVKEEIVKIDEQ"
FT   misc_feature    137275..137337
FT                   /note="Signal peptide predicted for ECA0117 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.987 between residues 21 and 22"
FT   CDS_pept        138613..140052
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /gene_synonym="ald"
FT                   /locus_tag="ECA0118"
FT                   /product="aldehyde dehydrogenase A"
FT                   /EC_number="1.2.1.22"
FT                   /note="Similar to Escherichia coli aldehyde dehydrogenase A
FT                   AldA or Ald or b1415 SWALL:ALDA_ECOLI (SWALL:P25553) (478
FT                   aa) fasta scores: E(): 6.2e-137, 75.05% id in 473 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73038"
FT                   /db_xref="GOA:Q6DAY4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY4"
FT                   /protein_id="CAG73038.1"
FT                   /translation="MSTTQKRMYINGEFVENRSGKWIDVVNPATEQVISQVPEGSADDA
FT                   KRAIDAAEAAQPSWEALPAVERGVWLHKIAAGIREREAELTDTIIAEGGKTHGLAQTEV
FT                   LFTADYLDYMAEWARRYEGEIIQSDRPNENIFVFRKAIGVTTGILPWNFPFFLIARKAA
FT                   PALITGNTIVIKPSEITPNNAVIFAEIIHKIGLPKGVINFVTGYGPTVGQELAGNPKVG
FT                   MVSLTGSVAAGIATMTAAAQNVTKVSLELGGKAPAIVMDDADLDLAVKAIVSSRVINSG
FT                   QVCNCAERVYVQKGIYDEFIIRIKAAMEQVTFGNTAEKKTLDMGPLISAAALQRVEDKV
FT                   AKAVSQGAKVLLGGKSESGTGYFYPPTLLVNVTQEMPIMHEEVFGPVLPVATFDTLEDA
FT                   IAMANDSEYGLTSSIYTQNINTAMKALKGLKFGETYINRENFEAMQGFHAGWRKSGVGG
FT                   ADGKHGLQEYLQTHVAYLQFH"
FT   misc_feature    138649..140046
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 6.4e-214"
FT   misc_feature    139357..139380
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    139441..139476
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    139765..139890
FT                   /note="HMMPfam hit to PF01468, DE GA module, score 1.2"
FT   CDS_pept        140268..141428
FT                   /transl_table=11
FT                   /gene="lctD"
FT                   /gene_synonym="lldD"
FT                   /locus_tag="ECA0119"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="Similar to Escherichia coli L-lactate dehydrogenase
FT                   LldD or LctD or b3605 SWALL:LLDD_ECOLI (SWALL:P33232) (396
FT                   aa) fasta scores: E(): 7.3e-119, 84.33% id in 383 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73039"
FT                   /db_xref="GOA:Q6DAY3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAY3"
FT                   /protein_id="CAG73039.1"
FT                   /translation="MIISASTDYRAAAQRRLPPFLFHYIDGGAYGEHTLRRNTADLADI
FT                   ALRQRILKNMSDLSLETQLFGEKLAMPVVLAPVGLTGMYARRGEVQAARAAAQKGIPFT
FT                   LSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRSALERAQAAGVKTLVFTVDMPTPGA
FT                   RYRDAHSGMSGPNAAARRMLQAVTHPQWAWDVGLNGKPHDLGNVSAYRGKPTTLEDYIG
FT                   WLAANFDPSISWQDLAWIREFWKGPMIIKGILDPEDAKEAVRFGADGIVVSNHGGRQLD
FT                   GVLSTAHALPAIADAVKGDITILADSGIRSGLDVVRMIALGADGVMLGRAFVYALAAAG
FT                   EAGVVNLLNLIEKEMRVAMTLTGAKSIADITSDSLVQVTQRRLDGL"
FT   misc_feature    140304..141398
FT                   /note="HMMPfam hit to PF01070, DE FMN-dependent
FT                   dehydrogenase, score 2.1e-220"
FT   misc_feature    141084..141104
FT                   /note="PS00557 FMN-dependent alpha-hydroxy acid
FT                   dehydrogenases active site."
FT   CDS_pept        141449..142765
FT                   /transl_table=11
FT                   /locus_tag="ECA0120"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2651 SWALL:Q9I0I7 (EMBL:AE004694) (352 aa) fasta
FT                   scores: E(): 9e-64, 51.32% id in 339 aa, and to Brucella
FT                   suis membrane protein, putative bra0460 SWALL:AAN33654
FT                   (EMBL:AE014544) (352 aa) fasta scores: E(): 1.5e-54, 44.5%
FT                   id in 346 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73040"
FT                   /db_xref="GOA:Q6DAY2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY2"
FT                   /protein_id="CAG73040.1"
FT                   /translation="MILSPRFLMAFVGGWLFPVLQMPHFVLYFESRLNEGEIVVNIKGL
FT                   TKGFFILILFVVTLAFFDILAPYYSAILWAAVLAIIFHPLKSKIRQKLNDRNGLASLLT
FT                   VLIIFLIVFIPLGIIVSSLVVEINGVYTRLQDSNTQFPVVLAELFQHLPKWARHFLTEH
FT                   NLDNAAKIQQELSQVALKGGQYLAGSVLLIGKGTFTFFIGFGVMLYLLFFLLKDGSYLV
FT                   NLILESLPLSTHVKHHLLVKFAAVSRATVKGTVVVAIVQGTLGGIAFSIAGIEGSLLWG
FT                   SLMAFLSLIPAVGSAIIWVPAAIFLFATDMLWQAIFIVAFFVLVIGVVDNILRPLLVGK
FT                   DTKMPDYLILIATLGGMEIYGINGFVIGPLIAALFIACWNILSGRDNQENIEGISEDFI
FT                   EEGRQHPNVVKPEESEVLEGQVVEGQAAEGQSIERKTTE"
FT   misc_feature    order(141467..141535,141593..141694,141752..141820,
FT                   142019..142087,142208..142276,142304..142372,
FT                   142391..142459,142523..142591)
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0120 by TMHMM2.0 at aa 7-29, 49-82, 102-124, 191-213,
FT                   254-276, 286-308, 315-337 and 359-381"
FT   misc_feature    141578..142597
FT                   /note="HMMPfam hit to PF01594, DE Domain of unknown
FT                   function DUF20, score 5.4e-53"
FT   CDS_pept        complement(142830..143192)
FT                   /transl_table=11
FT                   /locus_tag="ECA0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm1636 SWALL:Q9CKI1 (EMBL:AE006200) (121 aa) fasta
FT                   scores: E(): 1.9e-09, 30.7% id in 114 aa, and to Xylella
FT                   fastidiosa hypothetical protein Xf2198 SWALL:Q9PBE6
FT                   (EMBL:AE004033) (133 aa) fasta scores: E(): 1.4e-05, 36.14%
FT                   id in 83 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73041"
FT                   /db_xref="InterPro:IPR007670"
FT                   /db_xref="InterPro:IPR023138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY1"
FT                   /protein_id="CAG73041.1"
FT                   /translation="MNDNDIFDAVTASAYGLSMGAIWQHIAVECRENPRTYTQRQTLFF
FT                   DLIEHLIVAGKIRLASKGEYLQGEPKYQVDQLREAFPSDVFDDEFDDVDEFGLWFFAKS
FT                   PAGVVWITPEGQEVWT"
FT   CDS_pept        complement(143224..143610)
FT                   /transl_table=11
FT                   /locus_tag="ECA0122"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73042"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAY0"
FT                   /protein_id="CAG73042.1"
FT                   /translation="MAISLYYTARRKKSLSQKEISAVKEIVQRHSVNDQIEKYLTTGTG
FT                   LNWESFDFALNVKIGNVFRKGIVLSGSTKLPDSEEEAIWIGVQHWCQCLSEIRGALTHC
FT                   EWHVAVDDRTIPWSHEVNAYDPTR"
FT   CDS_pept        143719..144270
FT                   /transl_table=11
FT                   /locus_tag="ECA0123"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX9"
FT                   /protein_id="CAG73043.1"
FT                   /translation="MVMLGKILLIGVSAALLSGCSVATYSNKLEDYQGTDRVGMTFDNR
FT                   NLDYIRVYPNTDRCINIDAPENGYTNNAIGFQTKLNNKELGFPEIPETPTMIREFWVSA
FT                   KNNIAVRMIAGNGGFRTVTFKPVVGNYYYITGEFAGPYSARRLEVYEVFKTEKGYYDRR
FT                   LVKDLMLKNCGQFTSSMQKF"
FT   misc_feature    143719..143787
FT                   /note="Signal peptide predicted for ECA0123 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.988) with cleavage site
FT                   probability 0.427 between residues 23 and 24"
FT   misc_feature    143746..143778
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(144322..144879)
FT                   /transl_table=11
FT                   /locus_tag="ECA0124"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX8"
FT                   /protein_id="CAG73044.1"
FT                   /translation="MRYLVLPFMLLALTGCQAITTFDKYATMRLYEVYEADNLSACDYK
FT                   PKFRDCTVDKRSFNVKISDDKSKIALVVRTEYAYFGFTRDDFARQTQPLRDFLIWTEDP
FT                   AAKDKQITQLRKAGNVGGSLYDNREVQYQFDYLHTRADIPLLVVKPGENADFYGLTIDE
FT                   VKNLLSVMDAWYAGTFSGKQLT"
FT   misc_feature    complement(144826..144879)
FT                   /note="Signal peptide predicted for ECA0124 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.900) with cleavage site
FT                   probability 0.815 between residues 18 and 19"
FT   misc_feature    complement(144832..144864)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(144970..145197)
FT                   /transl_table=11
FT                   /locus_tag="ECA0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Anabaena sp. hypothetical protein Asr3468
FT                   asr3468 SWALL:Q8YRH9 (EMBL:AP003593) (83 aa) fasta scores:
FT                   E(): 0.99, 34.28% id in 70 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX7"
FT                   /protein_id="CAG73045.1"
FT                   /translation="MEKVNHHEGKPHFSKIINRVSQASEGHLIAHNAIVPPPVIEQVPR
FT                   IGFMRGQVSAPDNFNDLNKDETIDMFNGKL"
FT   CDS_pept        145496..145804
FT                   /transl_table=11
FT                   /locus_tag="ECA0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c5295 SWALL:AAN83716 (EMBL:AE016771) (163 aa) fasta scores:
FT                   E(): 3.3e-09, 43.82% id in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73046"
FT                   /db_xref="GOA:Q6DAX6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX6"
FT                   /protein_id="CAG73046.1"
FT                   /translation="MMAKRDMYRVLFPKQRRTLTAFGEDLLLAVKRRGFTKKIICDRTG
FT                   FDHKTVNKVFAGDPGVAIGAYLKVMAVLGMEDNFAKLAAHDEVGMKLQNIKLLEGTK"
FT   CDS_pept        145801..147051
FT                   /transl_table=11
FT                   /locus_tag="ECA0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c5297 SWALL:AAN83718 (EMBL:AE016771) (203 aa) fasta scores:
FT                   E(): 3.7e-34, 50.25% id in 199 aa, and to Erwinia amylovora
FT                   hypothetical 47.8 kDa protein SWALL:Q9F814 (EMBL:AF264948)
FT                   (427 aa) fasta scores: E(): 8.3e-14, 27.5% id in 429 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73047"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX5"
FT                   /protein_id="CAG73047.1"
FT                   /translation="MSRSIVEVYASWMPIDTPLLVGHLTFAETSRGGVFSFTYDKHFLA
FT                   SNYRLQIDPLLALHSGELYNDSADKNFRAFLDSSPDRWGRILMQRRAAIECRKGIRASA
FT                   KLTELDYLLGVHDSYRMGGIRFKTAASLDFLDNNTEFSAPPMTSLRELEQAAMNIERDD
FT                   NIDSDDYYRWLKMLISPGSSLGGARPKACVTDSEGHLWIAKFPNQNDTFDVGAWEMVCY
FT                   QLALAAGIDMFPSEIRKFSTEHHTFLTKRFDRVGGKRIHFSSAMTQLQYYDGEQSDGAS
FT                   YLEIAEFLSNNGAQTKADLAQLWRRIVFNIAVSNTDDHLRNHGFLLSDKGWKLSPAYDL
FT                   NPIVGKHGLHLNITDTANELDYALAFEVIDFFRLSREDATRIYDDVMGAVKGWQTVASR
FT                   LGISRNEQLTKQEAFNV"
FT   CDS_pept        complement(147194..147496)
FT                   /transl_table=11
FT                   /locus_tag="ECA0128"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73048"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX4"
FT                   /protein_id="CAG73048.1"
FT                   /translation="MTIINAAVTESSITIFRDLIASLPVEHLSRAQCDDLSAIAAESVE
FT                   GLCHGLQYLSESLPAETSTEHLQQLSAYFSSCAHLLPALMIINEHASSAHTVNLA"
FT   CDS_pept        complement(148811..150391)
FT                   /transl_table=11
FT                   /locus_tag="ECA0129"
FT                   /product="putative deoxycytidylate deaminase"
FT                   /note="Similar to Vibrio cholerae deoxycytidylate
FT                   deaminase-related protein vc0175 SWALL:Q9KVH1
FT                   (EMBL:AE004108) (532 aa) fasta scores: E(): 1.2e-25, 37.32%
FT                   id in 509 aa, and to Listeria monocytogenes competence
FT                   protein SWALL:Q8RT79 (EMBL:AF468456) (176 aa) fasta scores:
FT                   E(): 7.7e-05, 41.42% id in 70 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73049"
FT                   /db_xref="GOA:Q6DAX3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX3"
FT                   /protein_id="CAG73049.1"
FT                   /translation="MRMETKSSASLEKTDDGSFSQVTHGDGDNASELVIGLVGAVGTNL
FT                   DLLKVSITEMLKAYSYEVVEIRISKDIIKELHPIYQTRDNFKIANELMTAGNRLREKSK
FT                   NNAVLSMAISALISSSRVKDINNTPTPNPRKVYIIHSLKHPDEVNLLREVYTNGFYLIG
FT                   VYANEIRRIKYLVDHRYMTEVEAKKLISRDADEDEKWGQHTRDTYELSDFFVNFDNNYD
FT                   RITNQLWRFFDLIFGKPNVSPTFDEYAMSMAYSASLRSADLSRQVGAVLTKNNMILTTG
FT                   ANDIPAFGGGLYWPIDTNDSIEDVPGGKDYTLGYDSNAREKKNIISDILERTLNHINAC
FT                   KEEGIFSNKDKILEIITNSLNKSKIKDITEYGRVVHAEMEAILSCARSEINTNKATIYC
FT                   TTFPCHNCAKHIVASGIEKVIYIEPYPKSKAFDFHIDSITSLENPSDKNKVIFEPFVGV
FT                   GPRCFFNLFSINLGIGYKIKRKDSDGNVVKWERRNGRLRIQMLPSSYIEKELKTADSLN
FT                   NMISQLKGD"
FT   misc_feature    complement(149123..149665)
FT                   /note="HMMPfam hit to PF00383, DE Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region, score
FT                   6.4e-16"
FT   misc_feature    complement(149159..149266)
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT   CDS_pept        complement(150683..151546)
FT                   /transl_table=11
FT                   /locus_tag="ECA0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0043 SWALL:AAM83692 (EMBL:AJ414141) (287 aa) fasta
FT                   scores: E(): 5.3e-83, 86.76% id in 287 aa, and to
FT                   Escherichia coli protein YicC SWALL:YICC_ECOLI
FT                   (SWALL:P23839) (287 aa) fasta scores: E(): 8e-82, 85.01% id
FT                   in 287 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73050"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX2"
FT                   /protein_id="CAG73050.1"
FT                   /translation="MIRSMTAYARREIKGNWGSAAWELRSVNQRYLETYLRLPEQFRSL
FT                   EPVARERIRARLTRGKIECNLRFELDPSAQSALILNEKLAKQLVNAANWVKMQSDEGEI
FT                   NPVDILRWPGVMLAEEQDLDTISTELLKALEGALDDFIAARESEGNALKALIEQRLAGV
FT                   SAEVTKVRAQMPNVLLWQRERLQSKLEDAQVQLENNRLEQELVLMAQRVDVAEELDRLD
FT                   AHVKETYKILKKEEAVGRRLDFMMQEFNRESNTLASKSINADVTASAIELKVLIEQMRE
FT                   QIQNIE"
FT   misc_feature    complement(151082..151543)
FT                   /note="HMMPfam hit to PF03755, DE YicC-like family,
FT                   N-terminal region, score 3.6e-79"
FT   CDS_pept        complement(151645..152553)
FT                   /transl_table=11
FT                   /locus_tag="ECA0131"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa5085 SWALL:Q9HU98
FT                   (EMBL:AE004921) (318 aa) fasta scores: E(): 9.5e-27, 36.15%
FT                   id in 307 aa, and to Salmonella typhimurium, and Salmonella
FT                   typhi positive transcriptional regulator LysR SWALL:Q8XGD5
FT                   (EMBL:AE008838) (311 aa) fasta scores: E(): 1.8e-15, 26.66%
FT                   id in 300 aa, and to Escherichia coli transcriptional
FT                   activator protein LysR SWALL:LYSR_ECOLI (SWALL:P03030) (311
FT                   aa) fasta scores: E(): 3.2e-13, 27.79% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73051"
FT                   /db_xref="GOA:Q6DAX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX1"
FT                   /protein_id="CAG73051.1"
FT                   /translation="MRLRHIEIFQAIVQAGTISGAARLLNVSQPNVSRVLNHAEQQLGF
FT                   SLFERRTQGMIATEEGLRLIPKVQELFSHLQSISSLTEQIKTSKAHSVRLGAAHAFGQM
FT                   IVAPTLVEFHKQAASVNVELVTEHFSTLCQNILQNQLDFALIFGQQVPPELLAEPLFQS
FT                   TMVALLPKNSPINGPVSLEWLCNNNLLMMQHQDPLGQVVHRALRDKALQPAASLYIKTY
FT                   SVIADMVLAGGGAGIVDLFTACRYADQLKIVPIDQPLPFEVTLISRRDNPQSQATLQLK
FT                   QMMKNRCRDIARQHETLLYAA"
FT   misc_feature    complement(151687..152298)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 8.7e-32"
FT   misc_feature    complement(152368..152547)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 4e-15"
FT   misc_feature    complement(152443..152508)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1984.000, SD 5.94 at aa 16-37, sequence
FT                   GTISGAARLLNVSQPNVSRVLN"
FT   CDS_pept        complement(152758..153705)
FT                   /transl_table=11
FT                   /locus_tag="ECA0132"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="Similar to Arabidopsis thaliana L-asparaginase
FT                   at5g08100 or t22d6_40 SWALL:ASPG_ARATH (SWALL:P50287) (315
FT                   aa) fasta scores: E(): 7.9e-38, 44.22% id in 303 aa, and to
FT                   Escherichia coli putative L-asparaginase precursor ybik or
FT                   b0828 SWALL:ASGX_ECOLI (SWALL:P37595) (321 aa) fasta
FT                   scores: E(): 3.2e-73, 65.39% id in 315 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73052"
FT                   /db_xref="GOA:Q6DAX0"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAX0"
FT                   /protein_id="CAG73052.1"
FT                   /translation="MTKPVIVIHGGAGALTRSAMSAEKEQRYLAALSEIVASGQRILAE
FT                   NGSALDAVTEAVRLLEECPLFNAGHGSVFTHAETHELDASIMDGRTLDAGAVSCVSHIR
FT                   NPILAARTVLEASPHVMFTADGAEAFAQQHGLERVEPAFFSTDERRQQLHNAQAGSGRV
FT                   ILDHDGQTDPIDPDRKFGTVGAVALDSAGNLAAATSTGGMTNKQAGRVGDSPIIGAGCY
FT                   ANNQTVAVSCTGTGEVFMRAVAAYDVSALMEYAGMTLQQASDRVVMEKLLQMDGSGGMI
FT                   AVDKEGNIALPFNSEGMYRGYGYVGEEPVADIYR"
FT   misc_feature    complement(152776..153702)
FT                   /note="HMMPfam hit to PF01112, DE Asparaginase, score
FT                   1.6e-125"
FT   misc_feature    complement(153643..153705)
FT                   /note="Signal peptide predicted for ECA0132 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.796) with cleavage site
FT                   probability 0.786 between residues 21 and 22"
FT   CDS_pept        complement(153765..154586)
FT                   /transl_table=11
FT                   /locus_tag="ECA0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1384 SWALL:Q8XZL1 (EMBL:AL646064) (271 aa) fasta
FT                   scores: E(): 4.5e-37, 43.49% id in 269 aa, and to Bacillus
FT                   subtilis dipeptide transport protein DppA or DciaA
FT                   SWALL:DPPA_BACSU (SWALL:P26902) (274 aa) fasta scores: E():
FT                   9.7e-19, 32.84% id in 274 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73053"
FT                   /db_xref="GOA:Q6DAW9"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW9"
FT                   /protein_id="CAG73053.1"
FT                   /translation="MKIFISADIEGIAGVMRPEQCSPGTAEYQLARGLMEQEVNAAIDG
FT                   AFAGGATEVVVADSHAAMVNLRAENIDARARLVQGKPRGYSMVEGLEQQQFDGLMFIGY
FT                   HSAAGEFGVLSHTINGRAFYRVRINGEIMGESDIYAAAGVEQKTPLWLVSGDDTLQNWI
FT                   ARYYPDTDYACVKRAISQHAAESLSTEQARQVIRDAAKAAVEKAHRSLNSRIQAPYRLE
FT                   LMVAKPVLADLFCLLPNIERLDAITVGYTAQSMREITSLLGAFSYLATTQN"
FT   CDS_pept        complement(154589..155671)
FT                   /transl_table=11
FT                   /locus_tag="ECA0134"
FT                   /product="putative peptidase"
FT                   /note="Similar to Rhizobium loti probable D-aminopeptidase
FT                   mlr2477 SWALL:Q98IB6 (EMBL:AP002999) (343 aa) fasta scores:
FT                   E(): 8.8e-55, 52.74% id in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73054"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW8"
FT                   /protein_id="CAG73054.1"
FT                   /translation="MHDYQQQQQALLLKRWKTTRQLGTPRSASGPHNSISDVAGVRVGH
FT                   CTLAAGEVQTGVTAIVPPGENLFTQPLPCGAAVLNGFAKPVGLVQIEELGLLQTPILLS
FT                   NTLATGTLFTTLVRDAISRNPELGRTLPTVNPLALECNDGWLNDIQALAVTEHMTRHAL
FT                   DSATGSFARGSVGAGRGMSCFSLKGGIGTASRLIPELNATLGVLVLANFGTLSALTLDG
FT                   VQMGDAIAPLLPGLAPQQDAGSIIIIMATDAPLDARQLKRIAKRAGAGLGRLGSYWGHG
FT                   SGDIAVAFSTCPQPQPPEDAQLEPLLSAAADATEHAVLDAMLQADAVTGFRGHHRPTLP
FT                   QALDKLAAALSSVGHSPVGN"
FT   misc_feature    complement(154628..155578)
FT                   /note="HMMPfam hit to PF03576, DE Peptidase family T4,
FT                   score 1.6e-74"
FT   CDS_pept        complement(155680..156579)
FT                   /transl_table=11
FT                   /locus_tag="ECA0135"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 dipeptide transport system
FT                   permease protein DppC or b3542 or c4357 or z4959 or ecs4422
FT                   SWALL:DPPC_ECOLI (SWALL:P37315) (300 aa) fasta scores: E():
FT                   5.1e-44, 45.26% id in 285 aa, and to Ralstonia solanacearum
FT                   probable transmembrane ABC transporter protein rsc1382 or
FT                   rs04665 SWALL:Q8XZL3 (EMBL:AL646064) (299 aa) fasta scores:
FT                   E(): 3.3e-62, 57.71% id in 298 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73055"
FT                   /db_xref="GOA:Q6DAW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW7"
FT                   /protein_id="CAG73055.1"
FT                   /translation="MNLPSDPVVAVATLDEETIRSPWRDFVQVFIRNPMALVSSGFVLL
FT                   LVLVAVFAPWLAPWNPMEPDWMALASPPSAAHWMGTDDLGRDVMSRIIYGARISLYIGI
FT                   FSVTLGMLVGIVLGLLAGYYGRWVDTLIMRGSDVLFAFPGMLLAIAVVAILGPGLNNVI
FT                   IAVAVFSVPVFARIVRASTLSLKQAAYVEAVRCAGAPDRIVLMRHILPGTLPNVIVYFT
FT                   MRIGTSILTAAGLSFIGLGPEPDVPEWGNILAMSRSLMMAGAWHVSVFPGLAIFFTVLA
FT                   FNLLGDALRDTLDPKLKS"
FT   misc_feature    complement(order(155722..155790,155863..155931,
FT                   156073..156141,156220..156288,156409..156477))
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0135 by TMHMM2.0 at aa 35-57, 98-120, 147-169, 217-239
FT                   and 264-286"
FT   misc_feature    complement(155806..156036)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 0.066"
FT   CDS_pept        complement(156588..157508)
FT                   /transl_table=11
FT                   /locus_tag="ECA0136"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Escherichia coli hypothetical ABC
FT                   transporter permease protein ylic or b0831 SWALL:YLIC_ECOLI
FT                   (SWALL:P75798) (306 aa) fasta scores: E(): 4.3e-64, 52.94%
FT                   id in 306 aa, and to Ralstonia solanacearum probable
FT                   transmembrane ABC transporter protein rsc1381 or rs04750
FT                   SWALL:Q8XZL4 (EMBL:AL646064) (307 aa) fasta scores: E():
FT                   5.6e-63, 54.6% id in 304 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73056"
FT                   /db_xref="GOA:Q6DAW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW6"
FT                   /protein_id="CAG73056.1"
FT                   /translation="MFAYIVRRLLEMIPVLLVVSLLVFGFIKLLPGDPARIYAGADATI
FT                   EAVETARQQLGLNDPLPQQYVHWLGGLFSGDLGVTYRTQQPVIDVISKSFMPTMWLALA
FT                   GFVWSVLLGLLIGVVSALKRGKWQDWTLMSFAVGGISMPPFWLGLLLIQFVAMPFGVFS
FT                   VSGFNQPSDIILPALTLGASVAAVMARFTRSAFLEVAQEDYVRTARSKGLRNRLVTWKH
FT                   VMRNALIPVITMLGLQFGFLLGGSIVVESVFSWPGLGWLLIESIKTQDQPVIQALVMLF
FT                   VFEFIVINLLVDLLYAVVNPAIRLR"
FT   misc_feature    complement(order(156612..156680,156762..156830,
FT                   156936..156995,157038..157106,157143..157211,
FT                   157428..157496))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0136 by TMHMM2.0 at aa 5-27, 100-122, 135-157, 172-191,
FT                   227-249 and 277-299"
FT   misc_feature    complement(156708..156923)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 0.00033"
FT   misc_feature    complement(156834..156920)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(157527..159068)
FT                   /transl_table=11
FT                   /locus_tag="ECA0137"
FT                   /product="ABC transporter periplasmic binding protein"
FT                   /note="Similar to Salmonella typhi putative ABC transporter
FT                   periplasmic binding protein YliB SWALL:Q8Z863
FT                   (EMBL:AL627268) (512 aa) fasta scores: E(): 1e-78, 41% id
FT                   in 517 aa, and to Escherichia coli putative binding protein
FT                   YliB precursor SWALL:YLIB_ECOLI (SWALL:P75797) (512 aa)
FT                   fasta scores: E(): 5.5e-78, 42.3% id in 513 aa,"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73057"
FT                   /db_xref="GOA:Q6DAW5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW5"
FT                   /protein_id="CAG73057.1"
FT                   /translation="MKPFVRRSAVALGLSLCLAAVAQAQDLRISIYADITGLDPHDTSD
FT                   TLSYSIQSGIFERLFQFDNKMKLVPRLATGYTSNDTATEFVVTLREGITFQDGTPFNAD
FT                   AVKANLDRLADQSKGLKRNSLFNMVQTVTVLSPTQVKIELNKSFGAFVNTLAHPSAVMH
FT                   SPEALKKYPDEAQLRVHPVGTGPFKFTEWQQGKDVKLVKFDNYWQKGWPKVDSVTFYPT
FT                   PEDSTRVASLKSGQVDAVYPLPSDLIGTVQNDSKLAIQRDPSIYQFWLAMNNLRPPLND
FT                   IRVRQALNYAINRDIWLKVGFAGMGVPASSAMAPDVQFFARQSSPNYTYNPEKAKALLK
FT                   EAGYANGLSLKLWTTNRTDYIRSAQFFKQQLEQVGIKVTVTPMDSGMRNAKLFGVKDPK
FT                   EAEFDLFYNGWSPSTGDADWALRPLFATESWVPVAYNVSYYSNPVTDKAITAGLATADT
FT                   DKRAAAYADAQRQIWQDAPVVFLGSPDNVVGKTKNLNGVYMLADGSLIFDQAEFK"
FT   misc_feature    complement(157533..159041)
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 1.3e-81"
FT   misc_feature    complement(158997..159068)
FT                   /note="Signal peptide predicted for ECA0137 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.922 between residues 24 and 25"
FT   CDS_pept        complement(159155..161014)
FT                   /transl_table=11
FT                   /locus_tag="ECA0138"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Similar to Salmonella typhimurium putative ATPase
FT                   components of ABC-type transport system, containing
FT                   duplicated atpase domain YliA SWALL:Q8ZQM4 (EMBL:AE008735)
FT                   (623 aa) fasta scores: E(): 1.3e-118, 57% id in 607 aa, and
FT                   to Escherichia coli hypothetical ABC transporter
FT                   ATP-binding protein YliA SWALL:YLIA_ECOLI (SWALL:P75796)
FT                   (629 aa) fasta scores: E(): 5.6e-117, 55.66% id in 609 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73058"
FT                   /db_xref="GOA:Q6DAW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW4"
FT                   /protein_id="CAG73058.1"
FT                   /translation="MHAGAATAPGNAPRPVLEIDDLSVSFSGRSGTHQALKGISFTVNK
FT                   GEVVAVVGESGSGKSVTSLAVMGLLADSANIERGALRFTARDGKQHDLLSMKAEARRKL
FT                   RGRDLAMIFQEPMTSLNPVLKVGDQLTEALLDHKICDAASADKKARELLHKVRIADVDR
FT                   VMKSYPHSLSGGMRQRVMIAQALACDPQLLIADEPTTALDVTVQARILQILRDLQQQSD
FT                   MSVLFITHDMGVVAEIADRVVVMYRGEIVEQGTVEQIFAAPQHPYTQSLLAAVPKLGDM
FT                   RDSLWPKRFPLLGQAADPQESEQVTARYDAEPLLDIRGLSVYYPMRSGIFSTITHHVHA
FT                   VEQIDFNVWPGETLAIVGESGCGKSTTGRALLRLVQSEAESIHFQGNEISQMKERDFQP
FT                   LRREMQMVFQDPYASLNPRLTVGFTIAEPLLLHGLVKSLEEATPQVQALLKSVGLLPEH
FT                   ARRYPHEFSGGQRQRIAIARAMALQPQVIIADEAVSALDVSIQAQVVNLMMDLQKKTGV
FT                   SWIFISHDMAVVERIANRVAVMYLGQIVEIGPRQSVFNDPQHPYTRRLLASVPIADPTR
FT                   RGARQFDDSEIPSPLRKAGEVVAKMRYREVAPQHWVADNESAA"
FT   misc_feature    complement(159389..159964)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.1e-57"
FT   misc_feature    complement(159575..159619)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(159920..159943)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(160271..160879)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.2e-55"
FT   misc_feature    complement(160457..160501)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(160835..160858)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(161071..162039)
FT                   /transl_table=11
FT                   /locus_tag="ECA0139"
FT                   /product="putative mandelate racemase / muconate
FT                   lactonizing enzyme family protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   YcjG SWALL:AAN80263 (EMBL:AE016760) (335 aa) fasta scores:
FT                   E(): 6.9e-54, 47.35% id in 321 aa, and to Yersinia pestis
FT                   putative mandelate racemase / muconate lactonizing protein
FT                   ypo2341 SWALL:Q8ZE43 (EMBL:AJ414152) (324 aa) fasta scores:
FT                   E(): 5.4e-52, 47.33% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73059"
FT                   /db_xref="GOA:Q6DAW3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW3"
FT                   /protein_id="CAG73059.1"
FT                   /translation="MMRHMQIETVNLPLARPMAAENGTRHAVTVIRVALEEKGFIGQGE
FT                   CTPAAHYGESADSVCRQLSAIREAIENGLTIEQLQQNLSPGAARNALDCALWRLNTALE
FT                   KQTLWQRVGIHPPTSVVCAQTLALDSVEKMATAASNAVSHGALLLKIKLDRELILEKVA
FT                   AIRAAAPNARLIIDARASWSGLDLHSLSTALLPYQVAMIEQPLPVGKDEDLQRFAHPIP
FT                   ICADESCRHSGDIVGLRRRYDMINIKLDKCGGLTEALAMVREAHFHGLRIMVGCTLGSS
FT                   MAMEAALPVAADAEHVDLDGPIWLAADSSPYLTYNLGRIWL"
FT   misc_feature    complement(161077..161697)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01188, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   3.7e-18"
FT   misc_feature    complement(161701..162039)
FT                   /note="HMMPfam hit to PF02746, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   9.3e-05"
FT   CDS_pept        162282..162998
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="ECA0140"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="Similar to Escherichia coli ribonuclease PH Rph or
FT                   b3643 SWALL:RNPH_ECOLI (SWALL:P03842) (238 aa) fasta
FT                   scores: E(): 8.2e-78, 85.71% id in 238 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73060"
FT                   /db_xref="GOA:Q6DAW2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAW2"
FT                   /protein_id="CAG73060.1"
FT                   /translation="MRPTGRSAQQVRPLTFTRHYTKHAEGSVLVEFGDTKVLCNATVEE
FT                   GVPRFLKGQGQGWVTAEYGMLPRATHSRNAREAAKGKQGGRTLEIQRLIARSLRAAIDL
FT                   KVLGEYTITLDCDVLQADGGTRTASITGACVALADALNQMVANGKLKKNPMKGMVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMTEDGRMVEVQGTAEGEPFSHEELLTLLALAR
FT                   GGIDTIVQAQKAALAD"
FT   misc_feature    162309..162710
FT                   /note="HMMPfam hit to PF01138, DE 3' exoribonuclease
FT                   family, domain 1, score 1.3e-53"
FT   misc_feature    162627..162665
FT                   /note="PS01277 Ribonuclease PH signature."
FT   misc_feature    162750..162953
FT                   /note="HMMPfam hit to PF03725, DE 3' exoribonuclease
FT                   family, domain 2, score 3.6e-21"
FT   CDS_pept        163345..163986
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ECA0141"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   orotate phosphoribosyltransferase PyrE or b3642 or c4466
FT                   SWALL:PYRE_ECOLI (SWALL:P00495) (212 aa) fasta scores: E():
FT                   1.4e-70, 89.62% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73061"
FT                   /db_xref="GOA:Q6DAW1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAW1"
FT                   /protein_id="CAG73061.1"
FT                   /translation="MKAYQRQFIEFALSKQVLKFGEFTLKSGRISPYFFNAGLFNTGRD
FT                   LALLGRFYAAALVDSGVEFDLLFGPAYKGIPIATTAAVALAEHHDRDLPYCFNRKEAKD
FT                   HGEGGSLVGSPLQGRVMLVDDVITAGTAIRESMEIIGAHGATLAGVMIALDRQERGRAD
FT                   LSAIQEVERDYQCKVISIITLKDLIAYLAEKPEMAAHLDAVKAYREQYGI"
FT   misc_feature    163438..163899
FT                   /note="HMMPfam hit to PF00156, DE Phosphoribosyl
FT                   transferase domain, score 6.1e-30"
FT   misc_feature    163507..163539
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   misc_feature    163702..163740
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        complement(164389..164985)
FT                   /transl_table=11
FT                   /gene="ttK"
FT                   /locus_tag="ECA0142"
FT                   /product="TetR-family transcriptional regulator"
FT                   /note="Similar to Yersinia pestis TetR-family regulatory
FT                   protein Ttk or ypo0046 or y0095 SWALL:Q8ZJP6
FT                   (EMBL:AJ414141) (198 aa) fasta scores: E(): 1.3e-69, 92.89%
FT                   id in 197 aa, and to Escherichia coli, and Shigella
FT                   flexneri Ttk protein SWALL:TTK_ECOLI (SWALL:P06969) (198
FT                   aa) fasta scores: E(): 1.4e-63, 84.26% id in 197 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73062"
FT                   /db_xref="GOA:Q6DAW0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAW0"
FT                   /protein_id="CAG73062.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLTTRINLILQDEKETFNRLRLILLLILGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIESQLRQVLREHKLRDGKGFQHDETLLASQLL
FT                   AFCEGMLSRFIRSEFRYRPTQEFDTRWPLLAAQLN"
FT   misc_feature    complement(164800..164943)
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 2.7e-08"
FT   misc_feature    complement(164812..164904)
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT   misc_feature    complement(164827..164892)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1905.000, SD 5.68 at aa 32-53, sequence
FT                   ITTAKLAANVGVSEAALYRHFP"
FT   CDS_pept        complement(165111..165569)
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /gene_synonym="dnaS"
FT                   /gene_synonym="sof"
FT                   /locus_tag="ECA0143"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Escherichia coli deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut or DnaS or Sof or
FT                   b3640 SWALL:DUT_ECOLI (SWALL:P06968) (151 aa) fasta scores:
FT                   E(): 9.8e-49, 82.66% id in 150 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73063"
FT                   /db_xref="GOA:Q6DAV9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV9"
FT                   /protein_id="CAG73063.1"
FT                   /translation="MMKKIDVKIVDPRVGQQFPLPTYATPGSAGLDLRACLDQAIELKA
FT                   GETTLIPTGLAIHIADTGLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNR
FT                   GQQTFTVEPGERIAQMVFVPVVQAEFNLVEDFVGSERGEGGFGHSGRS"
FT   misc_feature    complement(165120..165524)
FT                   /note="HMMPfam hit to PF00692, DE dUTPase, score 4.7e-51"
FT   CDS_pept        complement(165547..166824)
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="ECA0144"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   DNA/pantothenate metabolism flavoprotein Dfp or b3639 or
FT                   c4463 SWALL:DFP_ECOLI (SWALL:P24285) (406 aa) fasta scores:
FT                   E(): 2.3e-115, 77.03% id in 405 aa, and to Yersinia pestis
FT                   flavoprotein affecting synthesis of DNA and pantothenate
FT                   metabolism Dfp SWALL:AAM83687 (EMBL:AE013609) (443 aa)
FT                   fasta scores: E(): 2.4e-119, 76.41% id in 424 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73064"
FT                   /db_xref="GOA:Q6DAV8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAV8"
FT                   /protein_id="CAG73064.1"
FT                   /translation="MTTLLTFNRTMMMTEFSSLNALSGKRIVLGISGGIAAYKCPELVR
FT                   RLRDGGADVRVVMTSAAKAFITPLTLQAVSGYPVSDDLLDPAAEASMGHIELGKWADLV
FT                   ILAPATADLIARVAAGMANDLLSTICLATSAPIAVVPAMNQQMYRAEPTQDNLRTLAAR
FT                   GLPIWGPDSGSQACGDVGPGRMIDPMDIVGLAQRHFSAINDLQHLNILVTAGPTREALD
FT                   PVRFITNHSSGKMGFAIAQAAAARGANVTLVSGPVSLATPQGVTRIDVGSALEMEHAVM
FT                   EHAAQQQIVIGCAAVADYRAKHIADEKIKKQNQQGDEMTLTLVKNPDIIAGVAAMTKNR
FT                   PYVVGFAAETQNVEEYARQKLARKKLDLICANNVSLSGHGFNSETNALHLFWQGGNTPL
FT                   PQCDKRLLGQKLIDEIISRYDEKNRR"
FT   misc_feature    complement(166399..166752)
FT                   /note="HMMPfam hit to PF02441, DE Flavoprotein, score
FT                   3.5e-47"
FT   CDS_pept        166978..167643
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ECA0145"
FT                   /product="DNA repair protein"
FT                   /note="Similar to Escherichia coli DNA repair protein RadC
FT                   or b3638 SWALL:RADC_ECOLI (SWALL:P25531) (222 aa) fasta
FT                   scores: E(): 1.1e-50, 58.14% id in 215 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73065"
FT                   /db_xref="GOA:Q6DAV7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV7"
FT                   /protein_id="CAG73065.1"
FT                   /translation="MGWEKGLAPREKLVRLGAESLTDAELLAIFLRTGLPGVHVMQLAE
FT                   NLLAQFGSLYQLMTAEQSAFHNARGVGISKYTQIKAIAELSRRLFFSRLAKEDAMLNPE
FT                   ATGQYLQLLLSRREREVFLVLFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANA
FT                   AALILAHNHPSGKAEPSQADRAITEQIVKACLLLEIRVLDHLVIGHGEFVSFAERGWI"
FT   misc_feature    167485..167502
FT                   /note="PS01302 DNA repair protein radC family signature."
FT   CDS_pept        167881..168117
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="ECA0146"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri 50S
FT                   ribosomal protein L28 RpmB or b3637 or c4461 or z5061 or
FT                   ecs4512 or sf3676 SWALL:RL28_ECOLI (SWALL:P02428) (77 aa)
FT                   fasta scores: E(): 3.3e-29, 93.5% id in 77 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73066"
FT                   /db_xref="GOA:Q6DAV6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV6"
FT                   /protein_id="CAG73066.1"
FT                   /translation="MSRVCQVTGKRPVAGNNRSHALNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLADLRTRGEKY"
FT   misc_feature    167887..168069
FT                   /note="HMMPfam hit to PF00830, DE Ribosomal L28 family,
FT                   score 4.6e-35"
FT   CDS_pept        168129..168296
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="ECA0147"
FT                   /product="50S ribosomal protein L33"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, Salmonella typhimurium,
FT                   Salmonella typhi, and Shigella flexneri 50S ribosomal
FT                   protein L33 SWALL:RL33_ECOLI (SWALL:P02436) (54 aa) fasta
FT                   scores: E(): 1.6e-19, 96.29% id in 54 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73067"
FT                   /db_xref="GOA:Q6DAV5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV5"
FT                   /protein_id="CAG73067.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   misc_feature    168144..168287
FT                   /note="HMMPfam hit to PF00471, DE Ribosomal protein L33,
FT                   score 5.3e-24"
FT   misc_feature    168189..168248
FT                   /note="PS00582 Ribosomal protein L33 signature."
FT   CDS_pept        168516..169325
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="ECA0148"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="Similar to Escherichia coli formamidopyrimidine-DNA
FT                   glycosylase MutM or FpG or b3635 SWALL:FPG_ECOLI
FT                   (SWALL:P05523) (269 aa) fasta scores: E(): 2.3e-83, 76.11%
FT                   id in 268 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73068"
FT                   /db_xref="GOA:Q6DAV4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV4"
FT                   /protein_id="CAG73068.1"
FT                   /translation="MPELPEVETSRRGISPYLVGHTILYAEVRNARLRWPVSAEILSLS
FT                   DEPVLSVRRRAKYLLIELTHGWIIVHLGMSGSLRILPEYSEPEKHDHVDLVMDSGKVLR
FT                   YTDPRRFGAWLWTDSLETSSVLAHLGPEPLEAEFFADYLYQASRGKKTAIKQWIMDNKV
FT                   VVGVGNIYASESLFAAGIHPDRAAGSLNENDADVLVRVIKQVLQLSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELRVYGRNGEPCRTCGTPIETAKHGQRSTFFCRRCQV"
FT   misc_feature    168516..169319
FT                   /note="HMMPfam hit to PF01149, DE Formamidopyrimidine-DNA
FT                   glycosylase, score 7.8e-140"
FT   misc_feature    169245..169319
FT                   /note="PS01242 Formamidopyrimidine-DNA glycosylase
FT                   signature."
FT   CDS_pept        169392..170366
FT                   /transl_table=11
FT                   /locus_tag="ECA0149"
FT                   /product="putative sugar transferase"
FT                   /note="Similar to Yersinia pestis putative sugar
FT                   transferase RafQ SWALL:Q8ZJC7 (EMBL:AJ414141) (326 aa)
FT                   fasta scores: E(): 8.7e-82, 60.06% id in 323 aa, and to
FT                   Serratia marcescens putative heptosyliii transferase WaaQ
FT                   SWALL:Q9X979 (EMBL:U52844) (337 aa) fasta scores: E():
FT                   7.2e-12, 26.23% id in 343 aa, and to Escherichia coli WaaQ
FT                   SWALL:Q9R9D5 (EMBL:AF019746) (340 aa) fasta scores: E():
FT                   3.2e-08, 23.25% id in 301 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73069"
FT                   /db_xref="GOA:Q6DAV3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAV3"
FT                   /protein_id="CAG73069.1"
FT                   /translation="MQRILLIRIDFLGDMVCTTALIHSLKRKWPAAEIHVLANKYNSYA
FT                   LEDNPDVEKVHRYVYSKSRERNNRSGLIGSLIDKFLLIMRLRRLNFDFLIIPNGGMNKN
FT                   AIQFARWMNIPDKRWHTAETEFDDRNIENVTNRPIKHEVLAGYDLVPELGVTSTDDLRL
FT                   YVYPNPELKKQWSEKLESNGKANIGLFISNKAHERRWPWENWYSLAKSLGDDFNIIIFS
FT                   NPGENPGQDALNGITVQCVDTETVPDLIAAMSQLDLVVSADSAPVHLGAALQIPVVGLF
FT                   EARPEKYLRWYPIGVNHVLLHSDRCIDSISVTDVKDAVISLIA"
FT   misc_feature    169392..186544
FT                   /note="lipopolysaccharide biosynthetic cluster"
FT   misc_feature    169626..170351
FT                   /note="HMMPfam hit to PF01075, DE Glycosyltransferase
FT                   family 9 (heptosyltransferase), score 0.0015"
FT   CDS_pept        complement(170375..170854)
FT                   /transl_table=11
FT                   /gene="KdtB"
FT                   /gene_synonym="coaD"
FT                   /locus_tag="ECA0150"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri phosphopantetheine
FT                   adenylyltransferase CoaD or KdtB or b3634 or z5058 or
FT                   ecs4509 or sf3673 SWALL:COAD_ECOLI (SWALL:P23875) (159 aa)
FT                   fasta scores: E(): 4.1e-45, 74.05% id in 158 aa, and to
FT                   Serratia marcescens phosphopantetheine adenylyltransferase
FT                   CoaD or KdtB SWALL:COAD_SERMA (SWALL:Q9X980) (161 aa) fasta
FT                   scores: E(): 1.4e-47, 79.11% id in 158 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73070"
FT                   /db_xref="GOA:Q6DAV2"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAV2"
FT                   /protein_id="CAG73070.1"
FT                   /translation="MTTKAIYPGTFDPLTNGHLDLLTRAARLFDHVVLAIAASPSKNTL
FT                   FTLDERVALANDATQHLSNVEVIGFSDLMVHFAQQQKANILVRGLRAVADFEYELQLAK
FT                   MNHHLMPTLESVFLMPSEEWSFISSSLVKEVARHGGDVTHFLPDAIVRALLEKLH"
FT   misc_feature    complement(170453..170851)
FT                   /note="HMMPfam hit to PF01467, DE Cytidylyltransferase,
FT                   score 6.8e-43"
FT   CDS_pept        complement(170891..172168)
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="ECA0151"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7
FT                   3-deoxy-D-manno-octulosonic-acid transferase KdtA or WaaA
FT                   or b3633 or c4457 or z5057 or ecs4508 SWALL:KDTA_ECOLI
FT                   (SWALL:P23282) (425 aa) fasta scores: E(): 2.7e-134, 78.11%
FT                   id in 425 aa, and to Serratia marcescens
FT                   3-deoxy-manno-octulosonic acid transferase WaaA
FT                   SWALL:Q54434 (EMBL:U52844) (425 aa) fasta scores: E():
FT                   5.2e-136, 81.17% id in 425 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73071"
FT                   /db_xref="GOA:Q6DAV1"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAV1"
FT                   /protein_id="CAG73071.1"
FT                   /translation="MLQTLYTIILYLIQPLIWIRLWLRGRKAPAYRRRWGERYGFCAEK
FT                   VKPDGIMLHSVSVGETLAAIPLVRALRHRYPNLPITVTTMTPTGSERVRSAFGDTVYHV
FT                   YLPYDLPCALKRFFDQVRPKIVIIMETELWPNLIAELHKREIPLVIANARLSERSAAGY
FT                   KKIGKLMRHILQRITLVAAQNQEDGNRFIALGLKRSSLKVTGSLKFDISVTPELAARAI
FT                   TLRRQWAPHRPVWIATSTHEGEEAIVLAAHRRLLATYPDLLLILVPRHPERFSTTQALA
FT                   ESMGFNYTLRSSGEQPSANTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAA
FT                   AHAIPVLMGPHTFNFKDICNKLDQADGLITVTDADSLGKEVGKLLADEDYRLYYGRHAV
FT                   EVLHQNQGALQMLLTLLEPYLPQRTQ"
FT   misc_feature    complement(170966..171478)
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 3.5e-08"
FT   CDS_pept        complement(172396..173259)
FT                   /transl_table=11
FT                   /locus_tag="ECA0152"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to Paracoccidioides brasiliensis putative
FT                   mannosyltransferase SWALL:Q96WZ3 (EMBL:AF374353) (357 aa)
FT                   fasta scores: E(): 0.00027, 26.86% id in 201 aa, and to
FT                   Pasteurella piscicida capsular polysaccharide SWALL:Q8VW69
FT                   (EMBL:AB074290) (315 aa) fasta scores: E(): 1, 22.46% id in
FT                   187 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73072"
FT                   /db_xref="GOA:Q6DAV0"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAV0"
FT                   /protein_id="CAG73072.1"
FT                   /translation="MMKIPKKIHQIYTKGIHDLPEEILVSVGKLKDLNPGWEYFFYDEK
FT                   SIIGYIHKHYGKEMLNIYLSINPKYGVAKADLFRYLLIYIEGGVYLDIKSSCSIPLDQV
FT                   IKDDCEILLCSWDNKECGCDRNMGIHKELGFLKCGEYQQWNIISASGSPYIKSAIDEVI
FT                   HRLKTYKPWIYGVGMKGVLNTTGPVPFSVGIERINKTEFFHHEENYRNIGLKYRNVTEE
FT                   TIRKLNKNHYSKLKDSIVTLEGKDKLYYKLWLLFFYPLQRLKKNIINESKFVIRKMKRI
FT                   SRKTSQ"
FT   CDS_pept        complement(173307..174074)
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /locus_tag="ECA0153"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Serratia marcescens lipopolysaccharide
FT                   core biosynthesis glycosyl transferase KdtX
FT                   SWALL:KDTX_SERMA (SWALL:Q54435) (257 aa) fasta scores: E():
FT                   3.5e-66, 65.72% id in 248 aa, and to Yersinia
FT                   enterocolitica glucosyl-transferase WaaE SWALL:Q8RSW8
FT                   (EMBL:AY075041) (257 aa) fasta scores: E(): 3.5e-66, 65.72%
FT                   id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73073"
FT                   /db_xref="GOA:Q6DAU9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU9"
FT                   /protein_id="CAG73073.1"
FT                   /translation="MNKKLSILIITKNESELIAECLQSVSWADEIIVVDSGSTDNTVEI
FT                   AHQYGANVYQHDDWSGYGKQRQRAQKYANGGYIFFIDADERVTPELRQSIENLLLKPDM
FT                   DDKIVYSCARKNLFLGRFMKHSGWYPDKVIRLYANQRYKYNDNSVHESLDCGDAPVLHL
FT                   SGDLKHLTCRDFSVFQEKQLRYASAWAKERHERRKSCYYIEIFTHSAFSFLKTWLFRCG
FT                   FLDGKQGLLLAFVNAQYTFNKYTELWSLNNKNK"
FT   misc_feature    complement(173418..174059)
FT                   /note="HMMPfam hit to PF00535, DE Glycosyl transferase,
FT                   score 5e-23"
FT   misc_feature    174158..174682
FT                   /note="HMMPfam hit to PF01755, DE Glycosyltransferase
FT                   family 25 (LPS biosynthesis protein), score 1e-36"
FT   CDS_pept        174161..174907
FT                   /transl_table=11
FT                   /gene="waaX"
FT                   /locus_tag="ECA0154"
FT                   /product="putative beta1,4-galactosyltransferase"
FT                   /note="Similar to Edwardsiella tarda putative
FT                   beta1,4-galactosyltransferase WaaX SWALL:AAL82722
FT                   (EMBL:AY078508) (251 aa) fasta scores: E(): 9.1e-32, 40.96%
FT                   id in 249 aa, and to Escherichia coli putative
FT                   beta1,4-galactosyltransferase WaaX SWALL:Q9ZIS2
FT                   (EMBL:AF019747) (257 aa) fasta scores: E(): 2.4e-09, 26.89%
FT                   id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73074"
FT                   /db_xref="GOA:Q6DAU8"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU8"
FT                   /protein_id="CAG73074.1"
FT                   /translation="MKVFVVNLDKDKDKKEKIKNECRNAELDYEIISAVDGRELSYNEL
FT                   KSKVHPVSLNYLSKGEIGCVLSHQRIYKRILDDDIDYALILEDDVELSQDIKVFLKEFL
FT                   SVKDKNKGDVFLLYPSGLRFLNRRINVSHDYFFYEAYNSSCAHGYIISNKAAKKLIRIN
FT                   TPIILVADAWLWFYQISLLKVYVLNKELVRAYDVDKSLSTIETERSLLLDEKEKHQMQI
FT                   IKKQPLYYLIKYYHKYIRRLFINKDK"
FT   CDS_pept        174978..175163
FT                   /transl_table=11
FT                   /locus_tag="ECA0155"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73075"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU7"
FT                   /protein_id="CAG73075.1"
FT                   /translation="MMLFFYYFISIDMFSQIYAYGVNVKYLIKNIFFRKVSVFSIKPNN
FT                   FYWVGGADLFYLRVIE"
FT   CDS_pept        complement(175283..176065)
FT                   /transl_table=11
FT                   /locus_tag="ECA0156"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU6"
FT                   /protein_id="CAG73076.1"
FT                   /translation="MTKKDTYDVDNVKIVTLYWDNIDIRLVNSQRKVFEKFGYHIEQQN
FT                   IHDMDHGVWMTDILDNTPENDVVIIIDIDCIPLNENAVKKAIASARNGHIYGCAQSANH
FT                   IDHNYIYAAPMFLALTGKTWRGVGRPNLLADAEFDVGGKLTLAAKDSGYTVDLVYPTNY
FT                   AVPKWLLGDSHVYGLFTIYNNDYLHIFESRNKHLIECFIDIANEIISKEEFIDYRKYII
FT                   KASSESHKKFLENYIDKKSIISKIKKELKRFKKRHLAL"
FT   CDS_pept        complement(176214..177230)
FT                   /transl_table=11
FT                   /gene="waaJ"
FT                   /gene_synonym="rfaJ"
FT                   /locus_tag="ECA0157"
FT                   /product="lipopolysaccharide 1,2-glucosyltransferase"
FT                   /EC_number="2.4.1.58"
FT                   /note="Similar to Escherichia coli lipopolysaccharide
FT                   1,2-glucosyltransferase RfaJ or WaaJ or b3626
FT                   SWALL:RFAJ_ECOLI (SWALL:P27129) (338 aa) fasta scores: E():
FT                   4.4e-63, 49.69% id in 330 aa, and to Salmonella typhimurium
FT                   lipopolysaccharide 1,2-glucosyltransferase RfaJ or WaaJ or
FT                   stm3717 SWALL:RFAJ_SALTY (SWALL:P19817) (336 aa) fasta
FT                   scores: E(): 5.6e-66, 53.98% id in 326 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73077"
FT                   /db_xref="GOA:Q6DAU5"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR013645"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU5"
FT                   /protein_id="CAG73077.1"
FT                   /translation="MVFSSHIDVLSVFEKRHQSIADNNTLNVAYGIDKNYAVGCGISVA
FT                   SILINNNINFTFHIFSDDFDDEFIKKIEIIAEKFKTKIVLYKINSEMLKTLPCTDIWSH
FT                   AMYFRLLAFSHLSDKISSLLYLDADVMCKGSLAQLSTLDTAPHVAAVIRDLPETQKKSA
FT                   SRLKITTLEGEYFNSGVLFVNLKIWNELDLTQKIFEKLINGDEAIQYPDQDVMNILLHN
FT                   NVIFLPREYNTIYSIKNELNDPSHKKYKEVIKDDTVLIHYTGITKPWHKWANYPSTSYF
FT                   QHAQKESPWSFKDLKDADTFVEMKKKYKHLLKKGKYLSGLICAFKYLINKHYRKNVN"
FT   misc_feature    complement(176337..177119)
FT                   /note="HMMPfam hit to PF01501, DE Glycosyl transferase
FT                   family 8, score 2.2e-77"
FT   CDS_pept        complement(177284..178294)
FT                   /transl_table=11
FT                   /gene="waaI"
FT                   /gene_synonym="rfaI"
FT                   /locus_tag="ECA0158"
FT                   /product="lipopolysaccharide 1,3-galactosyltransferase"
FT                   /EC_number="2.4.1.44"
FT                   /note="Similar to Escherichia coli lipopolysaccharide
FT                   1,3-galactosyltransferase RfaI or WaaI or b3627
FT                   SWALL:RFAI_ECOLI (SWALL:P27128) (339 aa) fasta scores: E():
FT                   7.7e-60, 44.21% id in 337 aa, and to Salmonella typhimurium
FT                   lipopolysaccharide 1,3-galactosyltransferase RfaI or WaaI
FT                   or stm3718 SWALL:RFAI_SALTY (SWALL:P19816) (337 aa) fasta
FT                   scores: E(): 2e-64, 48.21% id in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73078"
FT                   /db_xref="GOA:Q6DAU4"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR013645"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU4"
FT                   /protein_id="CAG73078.1"
FT                   /translation="MYFDKEKVIKNVHSFSYSKKNAELNIAFGTDEKFIYGCAIAIAST
FT                   LLKNQDHSLSFHVFTDKISDGDKAKFQEMAKEYNTTINIYIVDCSWLKTLPETKLWSYA
FT                   IYFRFIIADYFYKTLDKVLYLDADIICNGSLKELITLDLSNHIAAVVLDGDSHWWKNRA
FT                   QKLQQPELSNGYFNSGVLLIEISNWNQAAITENSMRFLVDPDMKEVITHPDQDVLNILL
FT                   ARQFYQLDNKYNTQFSINYELKYSHGESAPTPISNETVFIHYIGPTKPWHKWAANYACT
FT                   KYFLKAKENSPWKNEPLLDAVTASNMRYCAKHQFHNGDIIRGTLSILSYLYKKAF"
FT   misc_feature    complement(177392..178189)
FT                   /note="HMMPfam hit to PF01501, DE Glycosyl transferase
FT                   family 8, score 2.9e-74"
FT   CDS_pept        complement(178361..179479)
FT                   /transl_table=11
FT                   /gene="waaG"
FT                   /gene_synonym="rfaG"
FT                   /gene_synonym="pcsA"
FT                   /locus_tag="ECA0159"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /note="Similar to Escherichia coli lipopolysaccharide core
FT                   biosynthesis protein Rfag or WaaG or pcsa or b3631
FT                   SWALL:RFAG_ECOLI (SWALL:P25740) (374 aa) fasta scores: E():
FT                   1.2e-87, 58.69% id in 368 aa, and to Salmonella typhimurium
FT                   lipopolysaccharide core biosynthesis protein Rfag or WaaG
FT                   or stm3722 SWALL:O68269 (EMBL:AF026386) (374 aa) fasta
FT                   scores: E(): 1.5e-89, 60.05% id in 368 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73079"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU3"
FT                   /protein_id="CAG73079.1"
FT                   /translation="MKIAFCVYKYFPFGGLQRDFLSIAQTCQKQGHDIRVYTSEWQGDK
FT                   PEGFDIVLVPISGLGNHTRHRHFSDWIHNHLQQRPVDRVVGFSKMPGLDFYYAAEGCTA
FT                   EKAVQEKGFFYRLTPRYRGYAALERDVFDKNSHTRMLMLTPRQIAHFQKHYGTQDERFF
FT                   MLPPGISQDRKYSAHSPDTRSQFRQQHHLDENGFVLLQVGSDFKRKGVGRSLTAIASLP
FT                   QELRQRVTLLVVGQDDPKPFKQQAEQLGIGKQIQFFSGRDDIPDFMAAADLLLHPAHQE
FT                   AAGIVLLEAIAAGLPILVTDACGYASYIERSQAGQVIPEPFSQTALNHELLHALSQPET
FT                   LKQWAQNARHFADTEDIYSLPEKAAQLIIESI"
FT   misc_feature    complement(178427..178936)
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 4.5e-37"
FT   misc_feature    complement(178475..178504)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        complement(179476..180546)
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /gene_synonym="rfaQ"
FT                   /locus_tag="ECA0160"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase rfaq"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Escherichia coli lipopolysaccharide core
FT                   biosynthesis glycosyl transferase RfaQ or WaaQ or b3632
FT                   SWALL:RFAQ_ECOLI (SWALL:P25742) (344 aa) fasta scores: E():
FT                   1.3e-65, 52.69% id in 334 aa, and to Salmonella typhimurium
FT                   lipopolysaccharide core biosynthesis, modification of
FT                   heptose region of core RfaQ or stm3723 SWALL:O68270
FT                   (EMBL:AF026386) (344 aa) fasta scores: E(): 1.2e-64, 51.79%
FT                   id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73080"
FT                   /db_xref="GOA:Q6DAU2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU2"
FT                   /protein_id="CAG73080.1"
FT                   /translation="MKEESLPPKKILILKLRYHGDMLLTTPLISTLKANYPNAKIDVLL
FT                   YQDTMPILSANPEIHQLYGLKRKTSTLLEKIRNFTEIWQTLKQNNYDLIVNLADQWPIA
FT                   LLVKLLGCRSIALDRGNNLKGKIWRLFFDTCVPPVGAHIVEQNLYLLTPLKLPASNTCF
FT                   KLSLHYRQEDAQSIANQRPTLLTQRYVVIQPTTRQYYKYWDNDKFAQVIDYLKTKNLEV
FT                   VLTCGPSEDDLNVVRDIHSQCMHKPDMTFAGKTSFLELAALIDNAVLYIGVDSAPMHMA
FT                   AALNTPLVCLFGPTDYKLWRPWCEHYKQIWAGEYQQMPAQQNYDQTVKYLSCIPAQAVI
FT                   QASEHMLKASQEENTL"
FT   misc_feature    complement(179554..180312)
FT                   /note="HMMPfam hit to PF01075, DE Glycosyltransferase
FT                   family 9 (heptosyltransferase), score 1e-36"
FT   CDS_pept        complement(180543..181769)
FT                   /transl_table=11
FT                   /gene="waaL2"
FT                   /gene_synonym="rfaL2"
FT                   /locus_tag="ECA0161"
FT                   /product="O-antigen ligase"
FT                   /note="Similar to Escherichia coli O-antigen ligase RfaL or
FT                   WaaL or b3622 SWALL:RFAL_ECOLI (SWALL:P27243) (419 aa)
FT                   fasta scores: E(): 2.7e-28, 30.54% id in 406 aa. Also
FT                   similar to ECA0162 (36.735% id. in 392 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73081"
FT                   /db_xref="GOA:Q6DAU1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU1"
FT                   /protein_id="CAG73081.1"
FT                   /translation="MNLLTNEKTIKVFSSLIYTSLIISLIAMIFDVKLASKIFNTIGII
FT                   SAILLFINKREIKKESMLIPLSILFLCVTNLIWEQLYKNSGSEIIGLYHSYHNVMKILF
FT                   LGSSLTLFVMTFSSKHPLTKNALNIIYTIPFFLVLYYLLSEPEVRFSISDKIATSSAYM
FT                   ISFIGILTSQVILLKTEKRNLFFYFINHIIFFTIIVLSGTRAAILAYPLLSAIVLIPAI
FT                   LKDKKINLKLIILYIMVNIVCLVACQKTIMSRSENLISDINMYNQSNSESSVGARIAMY
FT                   RSGLTSFIHAPMGQSAESRQLDIQKQAEQNPSLSGAALLTGIHLHNELIEAISLKGIIG
FT                   GMALLLLYASLFYFSSFILKDYALTSLTLSLVIYGLSDVIFYGKNATTVWIVTYCLSIL
FT                   LVKRNRGVQ"
FT   misc_feature    complement(order(180567..180635,180693..180761,
FT                   181029..181088,181146..181214,181239..181298,
FT                   181341..181394,181428..181496,181524..181592,
FT                   181611..181670,181680..181736))
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0161 by TMHMM2.0 at aa 12-30, 34-53, 60-82, 92-114,
FT                   126-143, 158-177, 186-208, 228-247, 337-359 and 379-401"
FT   CDS_pept        complement(182261..183544)
FT                   /transl_table=11
FT                   /gene="waaL1"
FT                   /gene_synonym="rfaL1"
FT                   /locus_tag="ECA0162"
FT                   /product="O-antigen ligase"
FT                   /note="Similar to Escherichia coli O-antigen ligase RfaL or
FT                   WaaL or b3622 SWALL:RFAL_ECOLI (SWALL:P27243) (419 aa)
FT                   fasta scores: E(): 1.2e-28, 29.22% id in 414 aa, and to
FT                   Serratia marcescens lipid a core:surface polymer ligase
FT                   WaaL SWALL:Q936B4 (EMBL:U52844) (413 aa) fasta scores: E():
FT                   1.1e-39, 33.76% id in 385 aa. Also similar to ECA0161
FT                   (36.735% id. in 392 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73082"
FT                   /db_xref="GOA:Q6DAU0"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAU0"
FT                   /protein_id="CAG73082.1"
FT                   /translation="MISLPTVNKYMLNELRYELGKTPSISSAVALTAIFPGCLLTLAIM
FT                   PFSSVLAGWFFYLTGSLSVFYVVTHLRTVIAAKRLLLIPLCLLAIGLTNLIWYHQYYQP
FT                   DSLFSYVYNAYKTSAHAGILGAFILLTALHITQQKQKLSLFYTIAICVLTLGYAFYQSL
FT                   FSGMHRIGLVFGTATSAAYFLTFIGALSAQALLKLDSAYKYYLYLGHFLLVTIAIFLTE
FT                   TRAAIFVYPIVGATILLSEVRHNKRLFIKALIGSSATILLCLFLFQETIHQRANDLIND
FT                   VHSYSMNNSRTSVGARIAMYQSGTEAGEEALLGQSAEQRSERIIAQAEQKPSLAGAVEY
FT                   LNVHLHNEVIDAFSLKGLPGAILLILLYVSLFYFSFFVLRSHLSAALLFALIMYGLSDV
FT                   ILYSRDMLIAWLMAFCLGTTLNVKWLKN"
FT   misc_feature    complement(order(182270..182329,182342..182395,
FT                   182408..182476,182732..182800,182819..182872,
FT                   182882..182935,182969..183037,183065..183121,
FT                   183140..183196,183239..183307,183341..183394,
FT                   183404..183472))
FT                   /note="12 probable transmembrane helices predicted for
FT                   ECA0162 by TMHMM2.0 at aa 25-47, 51-68, 80-102, 117-135,
FT                   142-160, 170-192, 204-221, 225-242, 249-271, 357-379,
FT                   384-401 and 406-425"
FT   misc_feature    complement(183389..183544)
FT                   /note="Signal peptide predicted for ECA0162 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.753) with cleavage site
FT                   probability 0.673 between residues 52 and 53"
FT   CDS_pept        complement(183541..184524)
FT                   /transl_table=11
FT                   /gene="waaC"
FT                   /gene_synonym="rfaC"
FT                   /locus_tag="ECA0163"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Escherichia coli lipopolysaccharide
FT                   heptosyltransferase-1 RfaC or WaaC or Rfa-2 or b3621
FT                   SWALL:RFAC_ECOLI (SWALL:P24173) (319 aa) fasta scores: E():
FT                   6.6e-89, 71.47% id in 319 aa, and to Serratia marcescens
FT                   heptosyltransferase i WaaC SWALL:Q936B6 (EMBL:U52844) (321
FT                   aa) fasta scores: E(): 8.9e-98, 76.25% id in 320 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73083"
FT                   /db_xref="GOA:Q6DAT9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT9"
FT                   /protein_id="CAG73083.1"
FT                   /translation="MRVLIVKTSSMGDVLHTLPALTDAMQAIPGIQFDWAVEEGFAQIP
FT                   SWHPAVSRVIPVAIRRWRKNWFSAPIRQERAEFKHQLRQYRYDVVIDAQGLIKSALLVT
FT                   RLANGKKHGLDCKSAREPLASWFYNYRHPISRRQHAVERIRELFAASLGYKKPIERGDY
FT                   AIAQRFLSQPLADANRYLVFLHATTRDEKHWPEAHWRELIALLASSGLHIKLPWGAEHE
FT                   HQRALRLAEGFPHVDVLPRLTLQQVAEVLAGASAIVSVDTGLSHLTAALDRPNITLYGP
FT                   TDPGLIGGYGMNQVVEMSERQQMETIPASLVHQKLEKLIELPASGE"
FT   misc_feature    complement(183574..184302)
FT                   /note="HMMPfam hit to PF01075, DE Glycosyltransferase
FT                   family 9 (heptosyltransferase), score 8e-96"
FT   CDS_pept        complement(184521..185588)
FT                   /transl_table=11
FT                   /gene="waaF"
FT                   /gene_synonym="rfaF"
FT                   /locus_tag="ECA0164"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Escherichia coli ADP-heptose--LPS
FT                   heptosyltransferase II RfaF or WaaF or b3620
FT                   SWALL:RFAF_ECOLI (SWALL:P37692) (348 aa) fasta scores: E():
FT                   6.2e-108, 74.41% id in 344 aa, and to Serratia marcescens
FT                   heptosyltransferase II WaaF SWALL:Q936B7 (EMBL:U52844) (348
FT                   aa) fasta scores: E(): 7e-115, 79.36% id in 344 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73084"
FT                   /db_xref="GOA:Q6DAT8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT8"
FT                   /protein_id="CAG73084.1"
FT                   /translation="MKILVIGPSWVGDMMMSHSLYRTLKAEHPEAVIDVMAPAWCRPLL
FT                   ARMPEVNQALAMPLGHGALELGERRRLGVSLRDAGYDRAYVLPNSFKSALVPFFANIPQ
FT                   RTGWRGEMRYGLLNDLRVLDKTAFPLMVQRYAALAYDRSRIHRAEDLPQPLLWPQLQVN
FT                   QAEIADITQAFDLSDERPIIGFCPGAEFGPAKRWPHYHYAALAQSLIKRGYQIALFGSA
FT                   NDSSACDDILQGLTEDARQHCANLAGKTSLEQAVVLIAACHAVISNDSGLMHVAAALHR
FT                   PLVALYGPSSPDFTPPLSHQAEVIRLITGYHRVRKGDAEQGYHQSLIDIQPERVLSALD
FT                   KHLILGVNRVPGADA"
FT   misc_feature    complement(184617..185384)
FT                   /note="HMMPfam hit to PF01075, DE Glycosyltransferase
FT                   family 9 (heptosyltransferase), score 2.5e-103"
FT   CDS_pept        complement(185612..186544)
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /gene_synonym="htrM"
FT                   /locus_tag="ECA0165"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ADP-L-glycero-D-manno-heptose-6-epimerase RfaD or
FT                   HtrM or b3619 or z5046 or ecs4497 SWALL:RFAD_ECOLI
FT                   (SWALL:P17963) (310 aa) fasta scores: E(): 2.1e-106, 84.41%
FT                   id in 308 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73085"
FT                   /db_xref="GOA:Q6DAT7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAT7"
FT                   /protein_id="CAG73085.1"
FT                   /translation="MIIVTGGAGFIGSNIVKSLNDIGYRDILVVDNLKDGTKFVNLVDL
FT                   DIADYVDKEDFVASIVAGDDLGDIEAVFHEGACSSTTEWDGKYMMDNNYQYSKDVLHYC
FT                   LDRSIPFLYASSAATYGGRNDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPEAESQIC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINQGENPKLFSGSENFKRDFIYVGDVAAVNL
FT                   WFWQNGVSGIFNCGTGRAESFQAVADATLAFHNKGGVEYIEFPEKLKGRYQAYTQADLT
FT                   NLRAAGYDKPFKTVAEGVAEYMTWLNRTV"
FT   CDS_pept        186786..187982
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="ECA0167"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri 2-amino-3-ketobutyrate
FT                   coenzyme A ligase Kbl or b3617 or z5044 or ecs4495 or
FT                   sf3657 SWALL:KBL_ECOLI (SWALL:P07912) (398 aa) fasta
FT                   scores: E(): 8e-123, 78.58% id in 397 aa, and to Yersinia
FT                   pestis 2-amino-3-ketobutyrate coenzyme A ligase Kbl or
FT                   ypo0059 SWALL:Q8ZJN3 (EMBL:AJ414141) (403 aa) fasta scores:
FT                   E(): 9.5e-125, 79.89% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73086"
FT                   /db_xref="GOA:Q6DAT6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT6"
FT                   /protein_id="CAG73086.1"
FT                   /translation="MPAAFYQQLTTQIMAARTEGVFKEERIITSAQQAEIEVMDSDRLL
FT                   NFCANNYLGLADSPELIVAAKAGLDSHGFGMASVRFICGTQDIHKQLERKLADFLGMED
FT                   VILYSSCFDANGGLFETLMGPEDAIISDALNHASIIDGIRLSKARRYRYANNDMSQLEA
FT                   QLQLARAEGARHIMIATDGVFSMDGVIADLQGVCDLADRYDALVMVDDSHAVGFVGEQG
FT                   RGTHEHCGVMDRVDIITGTLGKALGGASGGYTAGKREVIDWLRQRSRPYLFSNSLAPAI
FT                   VTASLKVLDLLEYVGERRDRLWKNARLFREKMTAAGFTLAGADHAIIPVMLGEAQLAQD
FT                   FAQALQREGVYVAGFFYPVVPLGQARIRTQMSAAHTSQQIEFAVEAFIRVGKRLGVII"
FT   misc_feature    187005..187949
FT                   /note="HMMPfam hit to PF00155, DE Aminotransferase class I
FT                   and II, score 6.7e-69"
FT   misc_feature    187506..187535
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        187993..189078
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="ECA0168"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="Similar to Escherichia coli L-threonine
FT                   3-dehydrogenase Tdh or b3616 SWALL:TDH_ECOLI (SWALL:P07913)
FT                   (341 aa) fasta scores: E(): 8.8e-116, 86.21% id in 341 aa,
FT                   and to Yersinia pestis threonine 3-dehydrogenase Tdh
FT                   SWALL:Q8ZJN2 (EMBL:AJ414141) (341 aa) fasta scores: E():
FT                   2.5e-116, 85.33% id in 341 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73087"
FT                   /db_xref="GOA:Q6DAT5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAT5"
FT                   /protein_id="CAG73087.1"
FT                   /translation="MKALAKLRPEEGIWMMDAPMPELGHNDIMIKIRKSAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEIVAIGQEVNGFHIGDRVSGEGHITCGYCRNCRAGRR
FT                   HLCRNAIGVGVNRPGSFAEYLVIPAYNAFRIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGMMAAAVCRHVGARNVVITDVNAYRLELASKMGATRAVNVAEEKLTD
FT                   VMIELGMTEGFDIGLEMSGAPSAFRAMLKAMNHGGRIAMLGIPHEPMSIDWGEVIFKGL
FT                   FIKGIYGREMFETWYKMSALIQSGLDLSPIITHRFHIDEFQKGFDAMRSGQSGKVILNW
FT                   DEAYTRHTSSCMCVDCATRHT"
FT   misc_feature    188011..189012
FT                   /note="HMMPfam hit to PF00107, DE Zinc-binding
FT                   dehydrogenase, score 1.5e-101"
FT   misc_feature    188176..188220
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   CDS_pept        complement(189183..190130)
FT                   /transl_table=11
FT                   /locus_tag="ECA0169"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella typhimurium putative
FT                   periplasmic protein YigQ or stm3706 SWALL:Q8ZL54
FT                   (EMBL:AE008872) (320 aa) fasta scores: E(): 3.9e-70, 66.01%
FT                   id in 306 aa, and to Escherichia coli hypothetical protein
FT                   YibQ precursor SWALL:YIBQ_ECOLI (SWALL:P37691) (319 aa)
FT                   fasta scores: E(): 3.1e-68, 66.55% id in 293 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73088"
FT                   /db_xref="GOA:Q6DAT4"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT4"
FT                   /protein_id="CAG73088.1"
FT                   /translation="MSYLTKTPLLALSLFALSPLALAGKLSIVIDDFGYRPHNENQILA
FT                   MPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAPMSKQPLERDTLRPDMSSDEIQ
FT                   LIIRQSVSNVPYAVGLNNHMGSAMTASLPGMQKVMQALSAYQLYFLDSMTIGSSQSSQA
FT                   AAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRSGSAIAIGHPHPSTIRVLQQML
FT                   PTLDADIVLVRPSQLLNEPTQHYEPQPQKPSKARNPFRGIPQCQVKQPPEPIKDDVFFR
FT                   LVSSSIRDSAPVLFIKHRWQTWIAPADTETHKQP"
FT   misc_feature    complement(190062..190130)
FT                   /note="Signal peptide predicted for ECA0169 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 23 and 24"
FT   CDS_pept        complement(190133..191434)
FT                   /transl_table=11
FT                   /locus_tag="ECA0170"
FT                   /product="putative exported peptidase"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   y0078 SWALL:AAM83673 (EMBL:AE013608) (456 aa) fasta scores:
FT                   E(): 2.5e-78, 71.87% id in 416 aa, and to Salmonella typhi
FT                   hypothetical protein Sty4090 SWALL:Q8Z2F1 (EMBL:AL627280)
FT                   (427 aa) fasta scores: E(): 9.5e-72, 67.49% id in 403 aa,
FT                   and to Escherichia coli hypothetical protein YibP
FT                   SWALL:YIBP_ECOLI (SWALL:P37690) (419 aa) fasta scores: E():
FT                   3.5e-71, 66.5% id in 403 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73089"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT3"
FT                   /protein_id="CAG73089.1"
FT                   /translation="MSKNALFEQSRVVCSADRQLSALHRLLTRCASALCVGILLLPALS
FT                   QAEDNQAQLKTLQQDIAAKEKSVQAQQKQRSTLVQQLKKQEQSISQASRQLHETRNTLS
FT                   TLNKELTSLSASIAKLQSQQDKQQTLLSRQLDAAFRQGQHSALQLMLSGEESQRNERIL
FT                   AYFGYLNEARQKSINELQQTRVELANQRRQLEQKQTQQKTLLSDQQQQQQTLEQAQSDR
FT                   KKTLSTLESSLEKDQQQLTELRQNETRLRDQIARAEREAKARAEREAREAAKVRAKEEQ
FT                   AKRSGSSYKPTEGERSLMARTGGLGRPSGQAIWPVNGRIEHRFGEPLQGELRWKGLVIT
FT                   APEGTEVKAIADGTVLMADWLQGYGLVVVVQHGKGDMSLYGYNQSALVSVGAQVKAGQP
FT                   IALVGTSGGQSQAGLYFEIRRQGQAVNPQPWLGR"
FT   misc_feature    complement(190145..190393)
FT                   /note="HMMPfam hit to PF01551, DE Peptidase family M23/M37,
FT                   score 3.6e-30"
FT   misc_feature    complement(191111..191176)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1163.000, SD 3.15 at aa 87-108, sequence
FT                   QSISQASRQLHETRNTLSTLNK"
FT   misc_feature    complement(191294..191434)
FT                   /note="Signal peptide predicted for ECA0170 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.943) with cleavage site
FT                   probability 0.932 between residues 47 and 48"
FT   CDS_pept        191679..192110
FT                   /transl_table=11
FT                   /locus_tag="ECA0171"
FT                   /product="putative rhodanese-related sulfurtransferases"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo0065 SWALL:Q8ZJM9 (EMBL:AJ414141) (144 aa) fasta scores:
FT                   E(): 1.2e-36, 69.78% id in 139 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi YibN SWALL:Q8XEX1
FT                   (EMBL:AE008872) (143 aa) fasta scores: E(): 6e-34, 67.62%
FT                   id in 139 aa, and to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hypothetical protein YibN
FT                   SWALL:YIBN_ECOLI (SWALL:P37688) (143 aa) fasta scores: E():
FT                   1.8e-33, 66.18% id in 139 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73090"
FT                   /db_xref="GOA:Q6DAT2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAT2"
FT                   /protein_id="CAG73090.1"
FT                   /translation="MQEIMPFVSKNPILSIAWVALLVAVIVLTVKSKLSNVKEVVRGEA
FT                   IRLINKEDAVVVDIRNRDDYRRGHIASAFNLLPNDIKNGSVGELEKHKSQPIIVVCANG
FT                   LSSREAADNLHKAGFERVQVLKDGLAGWSGENLPLVRGK"
FT   misc_feature    191679..191765
FT                   /note="Signal peptide predicted for ECA0171 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.650) with cleavage site
FT                   probability 0.292 between residues 29 and 30"
FT   misc_feature    191799..192083
FT                   /note="HMMPfam hit to PF00581, DE Rhodanese-like domain,
FT                   score 9.8e-17"
FT   CDS_pept        192299..192775
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="ECA0172"
FT                   /product="protein-export protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   protein-export protein SecB or b3609 or c4432 or z5036 or
FT                   ecs4487 or sf3648 SWALL:SECB_ECOLI (SWALL:P15040) (155 aa)
FT                   fasta scores: E(): 3.2e-55, 88.6% id in 158 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73091"
FT                   /db_xref="GOA:Q6DAT1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAT1"
FT                   /protein_id="CAG73091.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPKAPQVFQQEWQPEVKLDLD
FT                   TASSQLADDIYEVVLRVTVTASLGEETAFLCEVQQGGIFTVGGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQTEGEGEGAAQHQDA"
FT   misc_feature    192299..192736
FT                   /note="HMMPfam hit to PF02556, DE Preprotein translocase
FT                   subunit SecB, score 1.4e-94"
FT   CDS_pept        192775..193794
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="ECA0173"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   glycerol-3-phosphate dehydrogenase [NAD(P)+] GpsA or b3608
FT                   or c4430 or z5035 or ecs4486 or sf3647 SWALL:GPDA_ECOLI
FT                   (SWALL:P37606) (339 aa) fasta scores: E(): 9.3e-104, 86.26%
FT                   id in 335 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73092"
FT                   /db_xref="GOA:Q6DAT0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAT0"
FT                   /protein_id="CAG73092.1"
FT                   /translation="MNASDASMTVIGAGSYGTALAITLARNGHRVVLWGHNPTHIQALQ
FT                   AARCNQAFLPDVPFPDSLQLETNLAHALAASRNVLVVVPSHVFGDVLRQLKPHLRADAR
FT                   IVWATKGLEAETGRLLQDVAREALGETIPLAVVSGPTFAKELAAGMPTAIALASPDSEF
FT                   ADDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGAALGADPTTFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVQSAQDSIG
FT                   QVVEGYRNTKEVLALAQRYGVEMPITEQLWQVLYCGKDAREAALSLLGRTRKDETAKL"
FT   misc_feature    192775..192837
FT                   /note="Signal peptide predicted for ECA0173 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.623) with cleavage site
FT                   probability 0.613 between residues 21 and 22"
FT   misc_feature    192787..193755
FT                   /note="HMMPfam hit to PF01210, DE NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase, score 2.1e-163"
FT   misc_feature    193348..193413
FT                   /note="PS00957 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase signature."
FT   CDS_pept        193935..194756
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="ECA0174"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri serine
FT                   acetyltransferase CysEor b3607 or c4429 or z5034 or ecs4485
FT                   or sf3646 SWALL:CYSE_ECOLI (SWALL:P05796) (273 aa) fasta
FT                   scores: E(): 5.1e-90, 86.08% id in 273 aa, and to Yersinia
FT                   pestis serine acetyltransferase CysE SWALL:Q8ZJM4
FT                   (EMBL:AJ414141) (273 aa) fasta scores: E(): 1.5e-92, 89.37%
FT                   id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73093"
FT                   /db_xref="GOA:Q6DAS9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS9"
FT                   /protein_id="CAG73093.1"
FT                   /translation="MSTEELALVWTNIKAEARSLADCEPMLASFFHATLLKHENLGSAL
FT                   SYMLANKLANSIMPAIAIREVVEEAYSADPHMIVSAARDIQAVCLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWSQDRKALAVYFQNQISVSFGVDIHPAARIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGCGAKIGA
FT                   GSVVLQSVPPHTTAAGVPARIVGRPESDKPAMDMDQYFNGINRGFEYGDGI"
FT   misc_feature    194337..194390
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (three repeats), score 7.5e+02"
FT   misc_feature    194433..194486
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (three repeats), score 37"
FT   misc_feature    194511..194564
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (three repeats), score 51"
FT   misc_feature    194538..194624
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    194565..194618
FT                   /note="HMMPfam hit to PF00132, DE Bacterial transferase
FT                   hexapeptide (three repeats), score 36"
FT   CDS_pept        195065..195718
FT                   /transl_table=11
FT                   /gene="pagP"
FT                   /locus_tag="ECA0175"
FT                   /product="putative antimicrobial peptide resistance and
FT                   lipid A acylation protein"
FT                   /note="Similar to Erwinia chrysanthemi PagP protein PagP
FT                   SWALL:CAD33239 (EMBL:AJ489253) (206 aa) fasta scores: E():
FT                   1e-57, 74.15% id in 178 aa, and to Salmonella typhimurium
FT                   PagP SWALL:Q9ZHL7 (EMBL:AF057021) (186 aa) fasta scores:
FT                   E(): 7.4e-49, 65.14% id in 175 aa, and to Escherichia coli
FT                   CrcA protein crca or b0622 SWALL:CRCA_ECOLI (SWALL:P37001)
FT                   (186 aa) fasta scores: E(): 3.4e-48, 66.45% id in 158 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73094"
FT                   /db_xref="GOA:Q6DAS8"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAS8"
FT                   /protein_id="CAG73094.1"
FT                   /translation="MYLKRILITLSLITLPIVPCLSYAAESISNVGINNTGSTANLAPA
FT                   AADANVSASDKHEESWWQRSKNNLSTTWNAPQSHDIYIPTITWHNRWTYDKEKTDRYNE
FT                   KPWGAGYGVSRLDKDGDWHGLYIMAFKDSYNKWEPIGGYGYEKRWRPTSDQDFQLGLGF
FT                   TAGFTMRDNWNYIPIPVLLPLASISYSKLSFQATYIPGTYNNGNVFFAWFRWQI"
FT   misc_feature    195065..195136
FT                   /note="Signal peptide predicted for ECA0175 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.960 between residues 24 and 25"
FT   CDS_pept        196154..196633
FT                   /transl_table=11
FT                   /locus_tag="ECA0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2962 SWALL:Q8ZCM0 (EMBL:AJ414154) (161 aa) fasta scores:
FT                   E(): 2e-36, 56.6% id in 159 aa, and to Escherichia coli O6
FT                   conserved hypothetical protein c3767 SWALL:AAN82211
FT                   (EMBL:AE016766) (159 aa) fasta scores: E(): 4.5e-35, 55.34%
FT                   id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73095"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS7"
FT                   /protein_id="CAG73095.1"
FT                   /translation="MANNIYLTLTGNQQGEISAECGTVDSIGNKYQIGHRDQIFVLQFD
FT                   HSISRNQNINHQPITFCKPIDKSSPLLGNAISNNEKLELLFDFYRTAQTGTQEKYYSVK
FT                   LLGAVIRKIAVSYPHALTHAENQPEEMISIAYQSIDWQHHIAGTGGYSLWEEKVY"
FT   CDS_pept        196650..197366
FT                   /transl_table=11
FT                   /locus_tag="ECA0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c3766 SWALL:AAN82210 (EMBL:AE016766) (245 aa) fasta scores:
FT                   E(): 1.6e-60, 62.39% id in 234 aa. No other database
FT                   matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS6"
FT                   /protein_id="CAG73096.1"
FT                   /translation="MAGDIIVRNKFCDISKVRFRKWDEIDVIFWKFGKSNPERKSGGYY
FT                   LNAYKDAYIQYNKERIIKYANQAGILPELLGGVAWIESGGMPEEYKFQVFEIKRFLKLK
FT                   SSPENKTSFGSVAMQIQVAARTLGLNPDILTTRDQLELATCLMEDDFNLWIVAQHLRDM
FT                   ILYDYPSVAALYLTDEQYMMAGIRYNRGIQRKLSEFIRFIDAKPERGSAEFDYISYGVR
FT                   LLQIRNHIRKLLELNT"
FT   CDS_pept        197367..197699
FT                   /transl_table=11
FT                   /locus_tag="ECA0178"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YgiZ SWALL:YGIZ_ECOLI (SWALL:Q46867) (110 aa) fasta scores:
FT                   E(): 4.5e-13, 38.88% id in 108 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73097"
FT                   /db_xref="GOA:Q6DAS5"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS5"
FT                   /protein_id="CAG73097.1"
FT                   /translation="MNISKEKVVDAISMVGYFVFAYVVMELLSINKYDWMMESGDSICS
FT                   IPHQPLSNRILQAGVAALLLITPLFIALARNIFIKNRYKIAYYIVGILCIALYGGWLFL
FT                   GRFALC"
FT   misc_feature    order(197403..197456,197529..197588,197625..197693)
FT                   /note="3 probable transmembrane helices predicted for
FT                   ECA0178 by TMHMM2.0 at aa 13-30, 55-74 and 87-109"
FT   CDS_pept        197935..198834
FT                   /transl_table=11
FT                   /locus_tag="ECA0179"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo3790 SWALL:Q8ZAL1 (EMBL:AJ414159) (299 aa) fasta scores:
FT                   E(): 2.1e-95, 75.08% id in 297 aa, and to Escherichia coli,
FT                   and Escherichia coli O157:H7 hypothetical membrane protein
FT                   YigM SWALL:YIGM_ECOLI (SWALL:P27849) (299 aa) fasta scores:
FT                   E(): 2.9e-81, 65.31% id in 297 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73098"
FT                   /db_xref="GOA:Q6DAS4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS4"
FT                   /protein_id="CAG73098.1"
FT                   /translation="MPLLIITTILWAFSFSLIGEYLAGQVDSWFSAMFRLTAAAVVFLP
FT                   FLRWRGYAPRVIFLYMLVGACQLGIMYLFVFQAYLYLTVPEFLLFTVMTPLYVTLIYDL
FT                   LARHRLRWGYVMSALLAVFGAAVIHYHGVSEHFWWGFLLVQVANVCFASGQVGYKRLME
FT                   IHPVPQHCAFSWFYLGAAIVTIAAWLLFGNMDKLPTTTLQWGVLAWLGIGASGVGYFMW
FT                   NYGATQVDAGTLSIMNNFHVPAGLLVNFAIWHKTPDWLSFIVGTAIITSSLWVHQHWVV
FT                   KRPLRTANDHKRADAQNE"
FT   misc_feature    order(197941..198000,198028..198081,198100..198168,
FT                   198181..198249,198268..198327,198340..198408,
FT                   198442..198510,198538..198606,198625..198693,
FT                   198709..198777)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0179 by TMHMM2.0 at aa 7-26, 36-53, 60-82, 87-109,
FT                   116-135, 140-162, 174-196, 206-228, 235-257 and 263-285"
FT   misc_feature    197959..198324
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 0.023"
FT   misc_feature    198379..198765
FT                   /note="HMMPfam hit to PF00892, DE Integral membrane protein
FT                   DUF6, score 4.4e-06"
FT   CDS_pept        complement(198740..199675)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="ECA0180"
FT                   /product="transcriptional activator protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri transcriptional activator
FT                   protein MetR or b3828 or z5349 or ecs4758 or sf3906
FT                   SWALL:METR_ECOLI (SWALL:P19797) (317 aa) fasta scores: E():
FT                   7.2e-105, 85.8% id in 310 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73099"
FT                   /db_xref="GOA:Q6DAS3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS3"
FT                   /protein_id="CAG73099.1"
FT                   /translation="MIEFKHLRTLQALRNTGSLAAAAAALHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTPQGEILLQLAEQVLPQIQQALQACHEPHQTTLRLAIECHSCIQWL
FT                   TPALDEFHQHWPQVVMDFKSGVTFDPQPALQQGELDLVMTSDIMPRSGLHYSPLFDFEV
FT                   RLVLAPEHPLAKKEKIEPEDFSAETLMIYPVQRQRLDVWRHFLQPAGISPALKSVDNTL
FT                   LLIQMVAARMGIAALPHWVVESFERQGLIVTKSLGDGLWSRLYAAVRDGEQRQPVIDAF
FT                   TRSARQHACDHLPFVKDASRPNAGVPTART"
FT   misc_feature    complement(198806..199426)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 5.7e-43"
FT   misc_feature    complement(199487..199666)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.1e-22"
FT   misc_feature    complement(199532..199624)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(199562..199627)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1707.000, SD 5.00 at aa 17-38, sequence
FT                   GSLAAAAAALHQTQSALSHQFS"
FT   misc_feature    complement(199574..199675)
FT                   /note="Signal peptide predicted for ECA0180 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.952) with cleavage site
FT                   probability 0.609 between residues 34 and 35"
FT   CDS_pept        199780..202044
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="ECA0181"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocystei
FT                   ne methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="Similar to Escherichia coli
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase MetE or b3829 SWALL:METE_ECOLI
FT                   (SWALL:P25665) (752 aa) fasta scores: E(): 0, 87.18% id in
FT                   749 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73100"
FT                   /db_xref="GOA:Q6DAS2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAS2"
FT                   /protein_id="CAG73100.1"
FT                   /translation="MAIVNHTLGFPRVGLRRELKKAQESYWAGNATQEELLTVGRELRA
FT                   RHWQQQKDAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNEDGSVDLDTLFRIGRGRA
FT                   PTGQPAAAAEMTKWFNTNYHYMVPEFTKGQQFKLTWTQLLDEVDEALALGHKVKPVLLG
FT                   PVTYLWLGKVKGEQFDRLSLLQDILPVYQQVLAELTKRGIEWVQIDEPALALELSQEWL
FT                   AAFKPAYDALQGQVKLLLTTYFDSVSQNLETIKALPVQGLHIDLVHGKDDAATLSAQLP
FT                   ANWVLSLGVINGRNVWRADLSNWFERLQPLVGTRDLWLGSSCSLLHSPIDLSVEVRLDD
FT                   EVKSWFAFAIQKCAELSLLSQALNSGNGQALEAYSAPIRARRTSTRVNNVAVAQRLAAI
FT                   TAQDSQRQNVYSVRADAQRERFNLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGNNYR
FT                   TGIAEHIKQAVAEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCV
FT                   KPPVIIGDVSRPEAITVEWAKYAQSLTDKPMKGMLTGPVTILCWSFPREDVTRETIAKQ
FT                   IALALRDEVADLEAAGIGIIQIDEPALREGLPLHRSDWDAYLAWAVDAFRLNAAVAKDD
FT                   TQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEEFEYPNEIGPGVYDIH
FT                   SPNVPSVEWMEALLKKAAQRIPAERLWVNPDCGLKTRGWPETRQALANMVQAAQRLRET
FT                   Q"
FT   misc_feature    201055..202026
FT                   /note="HMMPfam hit to PF01717, DE Methionine synthase,
FT                   vitamin-B12 independent, score 3.9e-229"
FT   CDS_pept        202590..204218
FT                   /transl_table=11
FT                   /locus_tag="ECA0182"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Salmonella typhi methyl-accepting
FT                   chemotaxis protein II CheM SWALL:Q8Z3M1 (EMBL:AL627278)
FT                   (522 aa) fasta scores: E(): 6.8e-69, 46.3% id in 514 aa,
FT                   and to Escherichia coli methyl-accepting chemotaxis protein
FT                   I Tsr or Ched SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa)
FT                   fasta scores: E(): 3.5e-50, 41.89% id in 549 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73101"
FT                   /db_xref="GOA:Q6DAS1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS1"
FT                   /protein_id="CAG73101.1"
FT                   /translation="MNLANWRIGYRLGGGFAILILMLFAVSIFSLSKLSNFQDGARDIV
FT                   KEVYPQTVDANNLIDNVNGHFVAYLQMMLVSGQEQRQGYVDRIMAYRKEIGRLLDNLES
FT                   NASGERSRKQIETIRVLRAEFIKSGDKIISDALAGNNDVAVEEFNSNLNAIQRKYRDSV
FT                   KQLVNYQDDAMNTSVEAMAEVYNSTRMILLIILALGAVFGALVAWAITRSVTRPIEQAL
FT                   QVADRVAQGDLISRITVTSKDETGLLLQSLDRMNTSLSLIVGQVRDGAETISTAASQIT
FT                   AGNQDLSSRTEEQASSLEETAASMEQLASTIKNTAENTQQATEIANKATGAAKQSGDVM
FT                   VSVTQKMRGIRDSSQRMAEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RSLAQRSATAAREIKDLIDDSVSKIREGMELVDTAEETMGGLTAHVKDVHGIISEISQA
FT                   SREQSDGINQMNLAIGQIDTTTQQNAALVEESASAALSLQSQASVLADAVSAFKIPSYS
FT                   HGNAGSYESVPMSTPTLSLALARKE"
FT   misc_feature    202590..202679
FT                   /note="Signal peptide predicted for ECA0182 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.935) with cleavage site
FT                   probability 0.534 between residues 30 and 31"
FT   misc_feature    order(202617..202685,203160..203219)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0182 by TMHMM2.0 at aa 10-32 and 191-210"
FT   misc_feature    203163..203372
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   1.8e-09"
FT   misc_feature    203433..204131
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 7.5e-93"
FT   CDS_pept        204906..206567
FT                   /transl_table=11
FT                   /locus_tag="ECA0183"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Salmonella typhi methyl-accepting
FT                   chemotaxis protein II CheM SWALL:Q8Z3M1 (EMBL:AL627278)
FT                   (522 aa) fasta scores: E(): 2.2e-70, 47.66% id in 514 aa,
FT                   and to Escherichia coli methyl-accepting chemotaxis protein
FT                   I Tsr or Ched SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa)
FT                   fasta scores: E(): 1.2e-52, 42.03% id in 559 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73102"
FT                   /db_xref="GOA:Q6DAS0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAS0"
FT                   /protein_id="CAG73102.1"
FT                   /translation="MNLANWRIGYRLGAGFAILIVMLFVVSIFSLSKLSGFQDSARSIV
FT                   KDVYPQTVDANNLIDNVTSILVAYQRLMLVSDSVQIQTNVTRVNEYRQEIGRLLDKLER
FT                   QTVEERSVTQLRAIRAIRTEFLKSGDKIISEVVAGNREAAIEEFNNNLNVVQRQYRDAV
FT                   KQLVNYQDDAMDTSVEAMAEVYSNTRMILLLILALGAVFGALIAWSITRSVIRPIQQAL
FT                   QVADRVAQGDLTSRITITSKDETGLLLQSLDHMNTSLSSIVGQVRDGAETISSAASQIA
FT                   AGNQDLSSRTEEQASSLEETAASMEQLTSTIKNTAENTQQATDIANKASSAAKQSGDVM
FT                   VSVTQKMRGIRDSSQRMAEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RSLAQRSATAAREIKDLIDDSVSKIQEGMSLVDNAEETMSGLTGYVRDVNEIISEISQA
FT                   SREQSDGINQMNLAIGQIDTTTQQNAALVEESASAALSLQAQASVLAEAVSTFKLLSYG
FT                   NGKTASYASAPTRTPTLSLAPAAAKNQSNNDNWTTF"
FT   misc_feature    204906..204995
FT                   /note="Signal peptide predicted for ECA0183 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.879) with cleavage site
FT                   probability 0.270 between residues 30 and 31"
FT   misc_feature    order(204933..205001,205476..205535)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0183 by TMHMM2.0 at aa 10-32 and 191-210"
FT   misc_feature    205482..205688
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score 4e-11"
FT   misc_feature    205749..206447
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 1.1e-92"
FT   CDS_pept        complement(206657..207484)
FT                   /transl_table=11
FT                   /locus_tag="ECA0184"
FT                   /product="putative carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="Similar to Pseudomonas putida, and Pseudomonas sp.
FT                   carboxymethylenebutenolidase ClcD SWALL:CLCD_PSEPU
FT                   (SWALL:P11453) (236 aa) fasta scores: E(): 2.2e-10, 28.31%
FT                   id in 226 aa, and to Escherichia coli putative
FT                   carboxymethylenebutenolidase YsgA or b3830 SWALL:DLHH_ECOLI
FT                   (SWALL:P56262) (271 aa) fasta scores: E(): 2.4e-74, 67.03%
FT                   id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73103"
FT                   /db_xref="GOA:Q6DAR9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAR9"
FT                   /protein_id="CAG73103.1"
FT                   /translation="MKTDEQTTFKHLPQRLSPAVEPQSFSIITTDSVGIIASETTIPSQ
FT                   GEQLPAYIARPANHDGPLPIVLVVQEIFGVHQHIQDVCRRLAKQGYMAIAPELYFRQGD
FT                   PSQYNDIQQILTELVHKVPDTQVLSDLDHTANWAIKQGGDASKLAITGFCWGGRITWLY
FT                   AAHNPQLKAAVAWYGKFTGEKTLNSPKNPVDIATELEAPVLGLYGAKDGSIPLEHVDIM
FT                   RQALRAANATAEIIVYPDAGHAFHADYRPSYHEESARDGWQRMLAWFQKNGVA"
FT   misc_feature    complement(206666..207340)
FT                   /note="HMMPfam hit to PF01738, DE Dienelactone hydrolase
FT                   family, score 3.8e-98"
FT   CDS_pept        207819..208589
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="ECA0185"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /note="Similar to Escherichia coli uridine phosphorylase
FT                   Udp or b3831 SWALL:UDP_ECOLI (SWALL:P12758) (252 aa) fasta
FT                   scores: E(): 5.5e-80, 83.33% id in 252 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73104"
FT                   /db_xref="GOA:Q6DAR8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAR8"
FT                   /protein_id="CAG73104.1"
FT                   /translation="MSTSDVFHLGLVKNDLQGATLAIVPGDPERVEKIARLMDNPVHLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRVGTTGAIQPGINV
FT                   GDVLVTTAAVRLDGASLHFAPMEFPAVADFGCTTALVDAAKASGIALHVGITASSDTFY
FT                   PGQERYDTFSGRVVRRFRGSMEEWQSMGVLNYEMESATLLTMCASQGLKAGMIAGIIVN
FT                   RTQQEIPDVATMKLAETNVIKVLLDATRRLLAAE"
FT   misc_feature    207876..208565
FT                   /note="HMMPfam hit to PF01048, DE Phosphorylase family,
FT                   score 2.3e-100"
FT   misc_feature    208014..208061
FT                   /note="PS01232 Purine and other phosphorylases family 1
FT                   signature."
FT   CDS_pept        208739..209521
FT                   /transl_table=11
FT                   /locus_tag="ECA0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3785 or y0445 SWALL:AAM84034 (EMBL:AJ414158) (276 aa)
FT                   fasta scores: E(): 7.8e-34, 58.9% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73105"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAR7"
FT                   /protein_id="CAG73105.1"
FT                   /translation="MTEPTLLHPSLLPLDGGINFRDLGGNRAADGRLIRHGKLFRSGSL
FT                   DLLSQADCEHLAGVPISHVVDYRDVDEIAQKPDILWTGANYHAYPANPLRHEVTANLDS
FT                   LGSDVLAAFDSRAFMLELYRRLPFNNSAYKQLVSLLLRPDEGGLVQHCAVGKDRTGIGS
FT                   ALVMFALGADEQTVMEDYLLTDTTLTPFRQQLLAHLSETLNEKALGQFSYVLSVQEEFI
FT                   VTALQAIYERHGSIDSWLEVEYGLDNRARNYLQDKYLA"
FT   CDS_pept        complement(209609..212248)
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /gene_synonym="glu"
FT                   /locus_tag="ECA0187"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="Similar to Escherichia coli phosphoenolpyruvate
FT                   carboxylase Ppc or Glu or b3956 SWALL:CAPP_ECOLI
FT                   (SWALL:P00864) (883 aa) fasta scores: E(): 0, 81.65% id in
FT                   883 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73106"
FT                   /db_xref="GOA:Q6DAR6"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAR6"
FT                   /protein_id="CAG73106.1"
FT                   /translation="MNEQYSAMRSNVSMLGTLLGDTIKEALGENILDKVETIRKLSKSS
FT                   RAGNEKHRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPAQL
FT                   SSAFKRLKESKDLSERDIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDH
FT                   NDLADYERNQVMRRLRQLIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLR
FT                   ELDEQLEQAFGYRLPVDAVPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLR
FT                   DIQVLVSELSMSECTPELLELAGGSEVQEPYRAIMKSLRSQLSCTLSYLEARLTGEERL
FT                   PPKDLLITNEQLWEPLHACYQSLKTCGMGIIADGSLLDTLRRVRCFGVPLVRIDVRQES
FT                   TRHTDALAEITRYLGLGDYESWSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTC
FT                   RVIAKAPQGSIAAYVISMARTPSDVLAVQLLLKEAGCPFALPVAPLFETLDDLNNADDV
FT                   MTQLLSIDWYRGFIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALT
FT                   LFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPDVTISSLALYT
FT                   GAILEANLLPPPEPKQEWHEVMDELSRVSCDMYRGYVRENPDFVPYFRAATPELELGKL
FT                   PLGSRPAKRRPNGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQKVVDDGKQEQLEEM
FT                   CRNWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVEEKLWPLGKQLRDQLAADINIVLAI
FT                   SNDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQKQPDADLELALMVTIAGV
FT                   AAGMRNTG"
FT   misc_feature    complement(209615..212248)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00311, DE Phosphoenolpyruvate
FT                   carboxylase, score 4e-232"
FT   misc_feature    complement(210602..210640)
FT                   /note="PS00393 Phosphoenolpyruvate carboxylase active site
FT                   2."
FT   misc_feature    complement(211814..211849)
FT                   /note="PS00781 Phosphoenolpyruvate carboxylase active site
FT                   1."
FT   CDS_pept        complement(212763..214136)
FT                   /transl_table=11
FT                   /locus_tag="ECA0188"
FT                   /product="PTS system, IIabc component"
FT                   /note="Similar to Erwinia chrysanthemi PTS system,
FT                   beta-glucoside-specific IIabc component ArbF
FT                   SWALL:PTBA_ERWCH (SWALL:P26207) (631 aa) fasta scores: E():
FT                   2.9e-43, 32.79% id in 436 aa, and to Escherichia coli PTS
FT                   system, beta-glucoside-specific IIabc component BglF or
FT                   BglC or BglS or b3722 SWALL:PTBA_ECOLI (SWALL:P08722) (625
FT                   aa) fasta scores: E(): 6.4e-43, 31.15% id in 459 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73107"
FT                   /db_xref="GOA:Q6DAR5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAR5"
FT                   /protein_id="CAG73107.1"
FT                   /translation="MGKNEVIQSIIKLVGGNENINKAWHCMTRLRFDLVDESKVQTDAI
FT                   KNLPGILGAQHQSEQFQIIIGPQVNEYYELLNAQLSPTATAQPDAPKQKKGLISLFMDT
FT                   VSGVFGPIVPAIAGAGMIKGLLAGLIALKVVSAKTDTVIVIDLIASGVFYFLPFFLAIS
FT                   AARIFKTNEYLAAAVAACLMYPSLMEAAKALASNSPNAVSAFYFVGVLPIPVFNYAASV
FT                   IPVIFSVLALSYIHRWVDRIMPSILKTVFTPTLTLFIAALVSLTVIGPFGIYLGKLLAL
FT                   FIQSLFDVSSIFAGFVVGAIRPVAILTGMHHAMTPIALQNFSNQGFDMLMPMMCMANMA
FT                   IAGATFAIYFHAKTRQDKSVVLSAGVSALLGITEPALFGVLTKYKKAFISATVASSIAS
FT                   AFIAYFGVRLYGYILSSIFSLPAYIGPYFSYAVSGMAIAIVLSFTLTYILVVRASKQS"
FT   misc_feature    complement(order(212784..212852,212910..212978,
FT                   212991..213059,213087..213155,213216..213284,
FT                   213312..213380,213441..213509,213552..213620,
FT                   213645..213713,213756..213824))
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0188 by TMHMM2.0 at aa 105-127, 142-164, 173-195,
FT                   210-232, 253-275, 285-307, 328-350, 360-382, 387-409 and
FT                   429-451"
FT   misc_feature    complement(212949..213824)
FT                   /note="HMMPfam hit to PF02378, DE Phosphotransferase
FT                   system, EIIC, score 7.6e-22"
FT   misc_feature    complement(214014..214115)
FT                   /note="HMMPfam hit to PF00367, DE phosphotransferase
FT                   system, EIIB, score 7.5e-13"
FT   misc_feature    complement(214029..214082)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   CDS_pept        214457..215656
FT                   /transl_table=11
FT                   /locus_tag="ECA0189"
FT                   /product="putative mandelate racemase / muconate
FT                   lactonizing enzyme"
FT                   /note="Similar to Escherichia coli RspA or b1581
FT                   SWALL:RSPA_ECOLI (SWALL:P38104) (404 aa) fasta scores: E():
FT                   1e-20, 36.07% id in 402 aa, and to Streptomyces coelicolor
FT                   SpaA or sco7629 or sc10f4.02 SWALL:P95726 (EMBL:X94190)
FT                   (413 aa) fasta scores: E(): 6.1e-23, 39.03% id in 415 aa.
FT                   Also similar to ECA0917 (starvation sensing protein, RspA)
FT                   (36.070% id. in 402 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73108"
FT                   /db_xref="GOA:Q6DAR4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAR4"
FT                   /protein_id="CAG73108.1"
FT                   /translation="MLPTIITDIECLVTRPDRHNLVTVVVHTNKNVTGYGCATFQQRPL
FT                   AVKAMVDEYLKPLLLGRDANHIEDLWHMMMVNAYWRNGPVINNAVAGVDMALWDIKGKL
FT                   ADMPLYHLFGGKSRDAIAAYSHAASDTLDGLYQEVERLYAQGYRHIRCQLGFYGGNPDA
FT                   LHSTRQPTEGAYYDQDQYMANTLAMFRALREKYGDRFHILHDVHERLFPNQAVQFAKAV
FT                   EVYRPYFIEDILPPAQNEWLAQIRSQSAVPLATGELFNNPAEWQNLVINRQVDFIRCHV
FT                   SQIGGITPALKLGAFCQNFGVRLAWHCPPDMTPIGAAVNIHLNIHLHNAAIQEFVAYPE
FT                   NTRKVFPQAVEPENGYLYPIERPGIGVGIDLDAARQFPVVYRPHEWTQSRLPDGTMHTP
FT                   "
FT   misc_feature    214466..214798
FT                   /note="HMMPfam hit to PF02746, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   1.3e-25"
FT   misc_feature    214721..214798
FT                   /note="PS00908 Mandelate racemase / muconate lactonizing
FT                   enzyme family signature 1."
FT   misc_feature    214802..215590
FT                   /note="HMMPfam hit to PF01188, DE Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   1.5e-38"
FT   CDS_pept        complement(215662..216387)
FT                   /transl_table=11
FT                   /locus_tag="ECA0190"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="Similar to Bacillus halodurans transcriptional
FT                   regulator bh3917 SWALL:Q9K616 (EMBL:AP001520) (261 aa)
FT                   fasta scores: E(): 6.3e-11, 26.81% id in 220 aa, and to
FT                   Escherichia coli fatty acyl responsive regulator FarR
FT                   SWALL:FARR_ECOLI (SWALL:P13669) (240 aa) fasta scores: E():
FT                   1.8e-09, 26.81% id in 220 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73109"
FT                   /db_xref="GOA:Q6DAR3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAR3"
FT                   /protein_id="CAG73109.1"
FT                   /translation="MRQPMKKKDFIAQDLLSKIYQHTDPLPEKLPPERQLAEEYGVSRF
FT                   TIRQALEKLASIGAIHMVQGSGNFINQGVRSNPLVYNSITEKKFTQISSRLLSLHKRLP
FT                   NREEQQVFAISDNAFIWEFSRLRYVDNRKVQIEISKMPAADFPEMSQKIIEGSIQQYVL
FT                   SKGYAISHYLTHYQAVNVTKAQAELLGCKKGTAAMHILNRGILQGGRVYESSDIIDIDY
FT                   TCTYVIPLNLDNLAFRQSP"
FT   misc_feature    complement(216178..216357)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 8.9e-14"
FT   misc_feature    complement(216226..216300)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(216232..216297)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1671.000, SD 4.88 at aa 31-52, sequence
FT                   PPERQLAEEYGVSRFTIRQALE"
FT   CDS_pept        complement(216430..217581)
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="ECA0191"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="Similar to Escherichia coli acetylornithine
FT                   deacetylase ArgE or b3957 SWALL:ARGE_ECOLI (SWALL:P23908)
FT                   (383 aa) fasta scores: E(): 2.1e-137, 83.02% id in 383 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73110"
FT                   /db_xref="GOA:Q6DAR2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAR2"
FT                   /protein_id="CAG73110.1"
FT                   /translation="MKMNLPPFIELYRALIATPSISATDSALDQSNHTLINLLAGWFGD
FT                   IGFHVEVQPVPGTLNKFNMLARIGEGKGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNK
FT                   LYGLGTADMKGFFAFILDALRDIDPTKLTKPLYVLATADEETTMAGAKYFSESTQIRPD
FT                   CAIIGEPTSLQPVRAHKGHMSNAIRIQGQSGHSSDPSRGVNAIELMHEAISHLLVLRNT
FT                   LQERYHNPIFHIPYPTMNLGHIHGGDAANRICGCCELHMDIRPLPGITLNDLDGLLSEA
FT                   LAPVSQRWPGRLTISELHPPIPGYECPPDHRLISVVENLLGTKTEIVNYCTEAPFIQTL
FT                   CPTLVLGPGSIEQAHQPDEYIDTAFIKPTRELISQVIHHFCHH"
FT   misc_feature    complement(216583..217548)
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 1.9e-70"
FT   misc_feature    complement(217141..217254)
FT                   /note="PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 2."
FT   misc_feature    complement(217330..217359)
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 1."
FT   CDS_pept        217784..218788
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ECA0192"
FT                   /product="putative N-acetyl-gamma-glutamyl-phosphate
FT                   reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="Similar to Escherichia coli
FT                   N-acetyl-gamma-glutamyl-phosphate reductase ArgC or b3958
FT                   SWALL:ARGC_ECOLI (SWALL:P11446) (334 aa) fasta scores: E():
FT                   5.4e-105, 77.24% id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73111"
FT                   /db_xref="GOA:Q6DAR1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAR1"
FT                   /protein_id="CAG73111.1"
FT                   /translation="MLNTLIVGASGYTGAELALYLNRHPQMNITALMVSAQSVDAGKLI
FT                   SDLHPQLKGIIDIPVKPLTDAEEAAKGVDVVFLATDHKVSHDLAPIFLAAGCTVFDLSG
FT                   AFRVQDAEFYRRYYGFEHQHTDWLAKAVYGLAEWRAESVKQAQLIAVPGCYPTAAQLAL
FT                   KPLLDAQLLNSAQWPVINAVSGVSGAGRKASLTSSFCEVSLQPYGIFNHRHEPEISTHL
FT                   GTPVIFTPHLGNFARGILETITCRLQPGVTQQDVAEAYHNAYHDKPLVRLYDKGVPALK
FT                   SVVGLPFCDIGFAVDGEHLIVVATEDNLLKGAAAQAVQCMNIRFGFPETQSLI"
FT   misc_feature    217784..218233
FT                   /note="HMMPfam hit to PF01118, DE Semialdehyde
FT                   dehydrogenase, NAD binding domain, score 2.2e-48"
FT   misc_feature    218228..218278
FT                   /note="PS01224 N-acetyl-gamma-glutamyl-phosphate reductase
FT                   active site."
FT   misc_feature    218258..218716
FT                   /note="HMMPfam hit to PF02774, DE Semialdehyde
FT                   dehydrogenase, dimerisation domain, score 3e-33"
FT   CDS_pept        218826..219599
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ECA0193"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 acetylglutamate kinase ArgB or b3959 or z5517 or
FT                   ecs4888 SWALL:ARGB_ECOLI (SWALL:P11445) (258 aa) fasta
FT                   scores: E(): 9.4e-75, 85.6% id in 257 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73112"
FT                   /db_xref="GOA:Q6DAR0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAR0"
FT                   /protein_id="CAG73112.1"
FT                   /translation="MNPLIIKLGGVLLDSEEALERLFTALVAYRQEHQRPLVIVHGGGC
FT                   LVDELMKKLSLPVVKKNGLRVTPADQIDIITGALAGSANKTLLSWAKKHDINAVGLCLG
FT                   DGDSTTVTQLDESLGFVGKAEAGSPALLNTLLSAGYLPVVSSIGITAQGDLMNVNADQA
FT                   ATALAQTLGADLILLSDVSGILDGKGQRIAEMTAEKAEQLIAQGIITDGMIVKVNAALD
FT                   AARALGRPVDIASWRHAEQLPALFSGVAIGTRILA"
FT   misc_feature    218829..219530
FT                   /note="HMMPfam hit to PF00696, DE Amino acid kinase family,
FT                   score 2.5e-39"
FT   CDS_pept        219661..221034
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="ECA0194"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="Similar to Escherichia coli argininosuccinate lyase
FT                   ArgH or b3960 SWALL:ARLY_ECOLI (SWALL:P11447) (457 aa)
FT                   fasta scores: E(): 1.4e-155, 85.52% id in 456 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73113"
FT                   /db_xref="GOA:Q6DAQ9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAQ9"
FT                   /protein_id="CAG73113.1"
FT                   /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIVGSIGWSKALV
FT                   TVNVLSEQEQQQLEQALDALLVEVQADPEMILQSDAEDIHSWVELRLIEKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQIAELLLSVRQLRQALVTTAEANQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYHEMLTRDESRLEDTLKRLDVSPLGCGALAGTAYPIDREQLADWLGFASAT
FT                   RNSLDTVSDRDHVLELLSNASIGMVHLSRFAEDLIFFNSGEAAFVELSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWHDCLM
FT                   MAGLVLEGIQVKRPRCKEAAEQGYANSTELADYLVAKGVPFREAHHIVGEAVVEAIRQG
FT                   KALEALPLADLQKFSAVIGDDVYPILALQSCLDKRAAQGGVSPQQVAKAISDAKQRLA"
FT   misc_feature    219676..220956
FT                   /note="HMMPfam hit to PF00206, DE Lyase, score 2.1e-176"
FT   misc_feature    220486..220515
FT                   /note="PS00163 Fumarate lyases signature."
FT   CDS_pept        221269..222798
FT                   /transl_table=11
FT                   /gene="rmuC"
FT                   /locus_tag="ECA0195"
FT                   /product="DNA recombination protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri DNA recombination protein
FT                   RmuC or b3832 or z5354 or ecs4762 or sf3910
FT                   SWALL:RMUC_ECOLI (SWALL:P27850) (475 aa) fasta scores: E():
FT                   3.2e-96, 72.13% id in 427 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73114"
FT                   /db_xref="GOA:Q6DAQ8"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAQ8"
FT                   /protein_id="CAG73114.1"
FT                   /translation="MDISIFYGLGGGAVGLLIGWLIASLIQQQKLSQHDTEQRLLAQTL
FT                   QQTQLSLSEQQQAKQQDEQRLRQNELELRTVHAQLSASHEKLQQLGELRTECVQLNQEL
FT                   RTLREINSAQEAELREVTIRLEETRMAAEEKQRLLASSEQRLTTQFENLANRIFEHSGR
FT                   KVDEQNKQSLDKLLMPLRDQLDGFRRQVQDSFGAEARERHTLAHEIRNLQQLNAQMAHE
FT                   AINLTKALKGDNKTQGNWGEVVLSRVLEASGLREGYEYQTQVSVQTGTNSRLQPDVIVR
FT                   LPQGKDVVIDAKMSLVAYERYFNSDDDVERSAALNEHLLSVRSHIRQLSSKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLVAIDRQPELINEALKNNIMLVSPTTLLVALRTINNLWRYEQQ
FT                   SRNAQQIAEKASRLYDKLRLFVDDMEALGQSLDKAQGTYRQAMNKLSSGRGNLIGQAEG
FT                   FRALGVEIKRTISPSLAEKAMAHEHTEHDELLGSIAPETASPTVKTEGEGA"
FT   misc_feature    221281..221349
FT                   /note="1 probable transmembrane helix predicted for ECA0195
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    221689..222741
FT                   /note="HMMPfam hit to PF02646, DE RmuC family, score
FT                   1.5e-183"
FT   CDS_pept        222967..223722
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="ECA0196"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri ubiquinone/menaquinone
FT                   biosynthesis methyltransferase UbiE or b3833 or z5355 or
FT                   ecs4763 or sf3911 SWALL:UBIE_ECOLI (SWALL:P27851) (251 aa)
FT                   fasta scores: E(): 4.5e-76, 78.88% id in 251 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73115"
FT                   /db_xref="GOA:Q6DAQ7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAQ7"
FT                   /protein_id="CAG73115.1"
FT                   /translation="MASEQEKTADFGFRTVAKDEKEVMVAEVFHSVAAKYDLMNDLMSF
FT                   GIHRIWKRFTIECSGVRRNQRVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVG
FT                   REKLRNKGIIDNINYVQANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPG
FT                   GRLLVLEFSKPVIKQLSTIYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLK
FT                   GMMSDAGFDSVNYFNLTGGIVALHRGFKF"
FT   misc_feature    223006..223716
FT                   /note="HMMPfam hit to PF01209, DE ubiE/COQ5
FT                   methyltransferase family, score 1.1e-150"
FT   misc_feature    223072..223119
FT                   /note="PS01183 ubiE/COQ5 methyltransferase family signature
FT                   1."
FT   misc_feature    223438..223482
FT                   /note="PS01184 ubiE/COQ5 methyltransferase family signature
FT                   2."
FT   CDS_pept        223735..224358
FT                   /transl_table=11
FT                   /locus_tag="ECA0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3780 SWALL:Q8ZAM0 (EMBL:AJ414158) (210 aa) fasta scores:
FT                   E(): 1.8e-42, 56.65% id in 203 aa, and to Escherichia coli,
FT                   and Shigella flexneri hypothetical protein YigP
FT                   SWALL:YIGP_ECOLI (SWALL:P27852) (201 aa) fasta scores: E():
FT                   1.2e-35, 48.78% id in 205 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73116"
FT                   /db_xref="GOA:Q6DAQ6"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAQ6"
FT                   /protein_id="CAG73116.1"
FT                   /translation="MLITSFLTATLETALNQLLFHDAFSCDRSMKSARQRLQGKTLQIE
FT                   LAELDVPLVLVFNEQRLDVVSQWDELADCRLKTRVPVLMKLRDRQQLSSLMRSGELIIE
FT                   GDIQVVQQFIVLCDLAECDPAEWLSPYLGDIVAQGLSQTAQKTLSFLRRSLHQQQNFLS
FT                   ETLTEEWRLAPGKLENAWFHEETVALDKSVDTLSERLAKLEALR"
FT   CDS_pept        224355..225995
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /locus_tag="ECA0198"
FT                   /product="probable ubiquinone biosynthesis protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri probable ubiquinone
FT                   biosynthesis protein UbiB or AarF or b3835 or z5357 or
FT                   ecs4765 or sf3913 SWALL:UBIB_ECOLI (SWALL:P27854) (546 aa)
FT                   fasta scores: E(): 1e-186, 81.5% id in 546 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73117"
FT                   /db_xref="GOA:Q6DAQ5"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAQ5"
FT                   /protein_id="CAG73117.1"
FT                   /translation="MTPSELRRLYSIVRVLLSYGLDELIPKMRLTFPLRVGRRLLFWLP
FT                   NRHRNMPLGERLRLALQELGPVWIKFGQMMSTRRDLFPPAIADQLAMLQDKVEPFDGKL
FT                   AREQIELAMEGIPLEEWFDDFDIKPLASASIAQVHTARLKSTGKEIVIKVIRPDILPVI
FT                   KADMRLMKRLAGWLPRLLPDGRRLRPREVVMEYEKTLLDELNLLREAANAIQLRRNFEN
FT                   SPMLYVPEIYSDYCRESMLVMERIYGIPVSDVDALKANGTDMKLLAERGVQVFFTQVFR
FT                   DSFFHADMHPGNIFISYDHPEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKV
FT                   AELHVDSGWVPPDTNVADFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQ
FT                   PQLVLLQKTLLYIEGVGRQLYPQLDLWKTAKPFLESWLKQQVGLPAVFRALKEKAPFWA
FT                   EKLPEIPELFYDGLRQHKMLKQSVDKLAYELRTQQARQGQSRYLLGIGATLLIGGTLLL
FT                   ISRVEADMVPTGLIAAGIVAWIIGWRRTR"
FT   misc_feature    224688..225050
FT                   /note="HMMPfam hit to PF03109, DE ABC1 family, score
FT                   6.5e-52"
FT   misc_feature    order(225849..225917,225927..225980)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0198 by TMHMM2.0 at aa 499-521 and 525-542"
FT   CDS_pept        226078..226338
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /gene_synonym="mttA1"
FT                   /locus_tag="ECA0199"
FT                   /product="sec-independent protein translocase"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   sec-independent protein translocase protein TatA or MttA1
FT                   or b3836 or c4785 or z5358 or ecs4766 or sf3914
FT                   SWALL:TATA_ECOLI (SWALL:O65938) (89 aa) fasta scores: E():
FT                   2.5e-17, 64.83% id in 91 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73118"
FT                   /db_xref="GOA:Q6DAQ4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAQ4"
FT                   /protein_id="CAG73118.1"
FT                   /translation="MGGISLWNLLIIAVIVILLFGTNKLRTLGSDLGASIKGFKKAMGD
FT                   DQPSTNADKAQPDADFSTKSIADNQSDAKQGDTKSQHKEQV"
FT   misc_feature    226087..226140
FT                   /note="1 probable transmembrane helix predicted for ECA0199
FT                   by TMHMM2.0 at aa 4-21"
FT   misc_feature    226087..226248
FT                   /note="HMMPfam hit to PF02416, DE mttA/Hcf106 family, score
FT                   6.8e-09"
FT   CDS_pept        226342..226935
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /gene_synonym="mttA2"
FT                   /locus_tag="ECA0200"
FT                   /product="sec-independent protein translocase"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri sec-independent protein
FT                   translocase protein TatB or MttA2 or b3838 or z5359 or
FT                   ecs4767 or sf3915 SWALL:TATB_ECOLI (SWALL:O69415) (171 aa)
FT                   fasta scores: E(): 4.4e-22, 52.82% id in 195 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73119"
FT                   /db_xref="GOA:Q6DAQ3"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAQ3"
FT                   /protein_id="CAG73119.1"
FT                   /translation="MFDIGFGELLLVMVLGLIVLGPERLPVAVRTVASWIRTLRSLAST
FT                   VQNELSQELKLQEFQESLKKVEKASLQNLSPELKASMDELKDAAEAMKRGYTETPSPQK
FT                   SDDPKKSGDHSATVEPQSNIPLNDPEAAYDGVIEAETAVRPADSQQKPENAAVAENHND
FT                   GRHATSDEAVGNNNVKPEQSQPSAASARQPSDSR"
FT   misc_feature    226351..226551
FT                   /note="HMMPfam hit to PF02416, DE mttA/Hcf106 family, score
FT                   0.00081"
FT   CDS_pept        226939..227694
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /gene_synonym="mttB"
FT                   /locus_tag="ECA0201"
FT                   /product="sec-independent protein translocase protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 sec-independent protein translocase protein TatC or
FT                   MttB or b3839 or z5360 or ecs4768 SWALL:TATC_ECOLI
FT                   (SWALL:P27857) (258 aa) fasta scores: E(): 1.5e-78, 79.83%
FT                   id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73120"
FT                   /db_xref="GOA:Q6DAQ2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAQ2"
FT                   /protein_id="CAG73120.1"
FT                   /translation="MADEDTQPLISHLIELRKRLLNSIICVLAVFVVLVYFANDIYQVV
FT                   SAPLIKQLPVGASMIATDVASPFFTPIKLTMIVSVFVAAPLVLYQVWAFVAPALYKHER
FT                   RLMMPLLVSSSLLFYSGMAFAYFVVFPLAFGFFAKTAPVGVLIATDINNYLDFVMALFM
FT                   AFGISFEVPVAIVLLCWSGVVTPEDLKKKRPYILVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YLLFEIGVFFARFYVGKGRRRTETEEPLQ"
FT   misc_feature    226990..227601
FT                   /note="HMMPfam hit to PF00902, DE Sec-independent protein
FT                   translocase protein (TatC), score 3.9e-94"
FT   misc_feature    order(226996..227064,227158..227226,227284..227352,
FT                   227410..227478,227515..227574,227584..227652)
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0201 by TMHMM2.0 at aa 20-42, 74-96, 116-138, 158-180,
FT                   193-212 and 216-238"
FT   CDS_pept        227773..228555
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /gene_synonym="mttC"
FT                   /locus_tag="ECA0202"
FT                   /product="deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /note="Similar to Escherichia coli deoxyribonuclease TatD
FT                   or MttC or b3840/b3841 SWALL:TATD_ECOLI (SWALL:P27859) (260
FT                   aa) fasta scores: E(): 1.4e-75, 69.23% id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73121"
FT                   /db_xref="GOA:Q6DAQ1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAQ1"
FT                   /protein_id="CAG73121.1"
FT                   /translation="MFDIGVNLTSSQFEKDREQVVIRAKLAGVSGILITGTNAQESHQA
FT                   MLLAQAYPDYCWSTAGVHPHDASQWNDAIAEQLHQMANAACVVSIGECGLDFNRNFSTP
FT                   EEQEQAFSAQLAIAAELSMPVFLHCRDAHPRFISLLTPWLSQLPAAVVHCFTGNRHELD
FT                   ECLAAGLMIGITGWVCDERRGLELRALLPHIPADRLLVETDAPYLLPRDLRPKPASRRN
FT                   EPCYLPHIIRQIAEWRGEDATWLGQTTDENARRVFRLA"
FT   misc_feature    227788..228546
FT                   /note="HMMPfam hit to PF01026, DE TatD related DNase, score
FT                   5e-99"
FT   misc_feature    228340..228390
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT   CDS_pept        228573..229595
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ECA0203"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Similar to Pseudomonas aeruginosa
FT                   delta-aminolevulinic acid dehydratase HemB or PA5243
FT                   SWALL:HEM2_PSEAE (SWALL:Q59643) (337 aa) fasta scores: E():
FT                   5.1e-86, 71.69% id in 325 aa, and to Yersinia pestis
FT                   delta-aminolevulinic acid dehydratase HemB SWALL:Q8ZAM5
FT                   (EMBL:AJ414158) (340 aa) fasta scores: E(): 6.8e-115,
FT                   90.29% id in 340 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73122"
FT                   /db_xref="GOA:Q6DAQ0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAQ0"
FT                   /protein_id="CAG73122.1"
FT                   /translation="MSNAFPGTFPGRRMRRIRRHDFSRRLVAENQLTVNDLIYPVFVME
FT                   GTNHRQEVPSMPGVYRMTIDVLLKEAEEIAKLGVPVLSLFPVIESDKKSLYAEEAYNPD
FT                   GLVPRTIRALKGAVPELGLLTDVALDPYTTHGQDGIIDEDGYVINDVTKEILVRQALSH
FT                   AEAGAEIIAPSDMMDGRIGAIRDTLEAQNLINTQIMAYSAKYASCYYGPFRDAVGSASN
FT                   LKGGNKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEQPVVMESLLCFKRAGADGVLTYFAKRVAQWLHDQHMQR
FT                   "
FT   misc_feature    228582..229574
FT                   /note="HMMPfam hit to PF00490, DE Delta-aminolevulinic acid
FT                   dehydratase, score 2.1e-198"
FT   misc_feature    229326..229364
FT                   /note="PS00169 Delta-aminolevulinic acid dehydratase active
FT                   site."
FT   CDS_pept        complement(229656..230144)
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="ECA0204"
FT                   /product="transcriptional activator"
FT                   /note="Similar to Erwinia chrysanthemi transcriptional
FT                   activator RfaH SWALL:Q9ZEL8 (EMBL:AJ132239) (162 aa) fasta
FT                   scores: E(): 9.6e-51, 81.48% id in 134 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7
FT                   transcriptional activator RfaH or HlyT or SfrB or b3842 or
FT                   z5362 or ecs4770 SWALL:RFAH_ECOLI (SWALL:P26614) (162 aa)
FT                   fasta scores: E(): 1.2e-43, 69.57% id in 161 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73123"
FT                   /db_xref="GOA:Q6DAP9"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAP9"
FT                   /protein_id="CAG73123.1"
FT                   /translation="MEAWYLLYCKRGQLLRAKEHLERQEVTCVSPMIALDKIVRGKRTE
FT                   VCEPLFPNYLFVEFDPERIHTTTISATRGVSNFVRFGALPATIPQQVIDELSLRPMQVI
FT                   IDPLTPQSGDSVVITDGIFSGLQAIYSEPDGEARSMLLLNMLNKQVRQSIDNREFRKA"
FT   CDS_pept        230345..231841
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="ECA0205"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD or b3843
FT                   or c4790 SWALL:UBID_ECOLI (SWALL:P26615) (497 aa) fasta
FT                   scores: E(): 4.4e-187, 88.64% id in 493 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73124"
FT                   /db_xref="GOA:Q6DAP8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAP8"
FT                   /protein_id="CAG73124.1"
FT                   /translation="MNSMKYRDLREFLSLLEERGELKRITQPIDPYLEMTEIADRTLRA
FT                   EGPALLFENPKGYDMPVLCNLFGTPKRVALGMGQEEVSALRDVGKLLAFLKEPEPPKGF
FT                   RDLVDKMPKFRQVLNMPTKRLFSAPCQEQIWQGDDVDLRRIPVMQCWPEDAAPLITWGL
FT                   TVTRGPHKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQENPGQRFPVAVALG
FT                   ADPATILGAVTPVPDTLSEYAFAGLLRGHKTEVVKCLSSDLEVPASAEIVLEGYIEPGE
FT                   MAAEGPYGDHTGYYNEVDHFPVFTVTHITQRQNAIYHSTYTGRPPDEPAVLGVALNEVF
FT                   VPILQKQFPEIVDFYLPPEGCSYRLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVI
FT                   VCDDDINARDWKDVIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNK
FT                   WPGETQREWGHPIKKDPQVCARIDEIWDELAIFSDREPRR"
FT   misc_feature    230381..231655
FT                   /note="HMMPfam hit to PF01977, DE
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase, score 1e-240"
FT   CDS_pept        231891..232592
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="ECA0206"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /EC_number="1.5.1.29"
FT                   /EC_number="1.16.1.3"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 NAD(P)H-flavin reductase Fre
FT                   or FlrD or FadI or FsrC or UbiB or b3844 or c4791 or z5365
FT                   or ecs4772 SWALL:FRE_ECOLI (SWALL:P23486) (232 aa) fasta
FT                   scores: E(): 5.8e-71, 75.86% id in 232 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73125"
FT                   /db_xref="GOA:Q6DAP7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAP7"
FT                   /protein_id="CAG73125.1"
FT                   /translation="MTTLSCKVTSVEAITDTVYRVRLLPEAPFSFRAGQYLMVVMGDRD
FT                   KRPFSLASTPMDKNFIELHIGASELNLYAMAVMERIHKEKNLTVDIPHGEAWLREESTR
FT                   PLVLIAGGTGFSYVRSILLTALAQQPDRDISIYWGGRESQHLYDLTELEGFAAKHANLR
FT                   VVPVVEQPEEGWDGRTGTVLSAVLQDYGSLAEQDIYIAGRFEMAKIARERFCNERGALV
FT                   AHMFSDAFSFI"
FT   misc_feature    232197..232529
FT                   /note="HMMPfam hit to PF00175, DE Oxidoreductase
FT                   NAD-binding domain, score 5.6e-37"
FT   CDS_pept        complement(232686..233849)
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /gene_synonym="oldA"
FT                   /locus_tag="ECA0207"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="Similar to Escherichia coli 3-ketoacyl-CoA thiolase
FT                   FadA or OldA or b3845 SWALL:THIK_ECOLI (SWALL:P21151) (387
FT                   aa) fasta scores: E(): 1.1e-124, 82.38% id in 386 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73126"
FT                   /db_xref="GOA:Q6DAP6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAP6"
FT                   /protein_id="CAG73126.1"
FT                   /translation="MEKVVIVDAVRTPMGRSKGGAFRQVRAEDLSAHLMRSLLSRNTAL
FT                   DAREIDDIYWGCVQQALEQGFNVARNAALLAEIPVSVPATTVNRLCGSSMQALHDAARA
FT                   IMVGDANVCLIGGVEHMGHVPMNHGVDFHPGLSRTIAKAAGMMGLTAEMLARMHNISRE
FT                   MQDQFAARSHQRAYHATQSGAFRHEIVPTAGHDADGALQRFDYDEVIRPDTTIDSLAAL
FT                   KPAFDPVNGTVTAGSSSALSDGASAMLIMSESRAASLGLPVRARIRAMAVVGCDPSIMG
FT                   YGPVPATKLALKRAGLSLADIGIFELNEAFAAQTLPCIKDLGLLEQLDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLINLMESRDAQFGVATMCIGLGQGIATVFERA"
FT   misc_feature    complement(232692..233075)
FT                   /note="HMMPfam hit to PF02803, DE Thiolase, C-terminal
FT                   domain, score 4e-76"
FT   misc_feature    complement(232707..232748)
FT                   /note="PS00099 Thiolases active site."
FT   misc_feature    complement(232803..232853)
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    complement(233088..233849)
FT                   /note="HMMPfam hit to PF00108, DE Thiolase, N-terminal
FT                   domain, score 2.6e-134"
FT   misc_feature    complement(233373..233438)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1151.000, SD 3.11 at aa 138-159, sequence
FT                   RTIAKAAGMMGLTAEMLARMHN"
FT   misc_feature    complement(233535..233591)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   CDS_pept        complement(233861..236050)
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /gene_synonym="oldB"
FT                   /locus_tag="ECA0208"
FT                   /product="fatty oxidation complex alpha subunit [includes:
FT                   enoyl-CoA hydratase; delta(3)-cis-delta(2)-trans-enoyl-CoA
FT                   isomerase; 3-hydroxyacyl-CoA dehydrogenase;
FT                   3-hydroxybutyryl-CoA epimerase]"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="Similar to Escherichia coli fatty oxidation complex
FT                   alpha subunit [includes: enoyl-CoA hydratase;
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase; 3- hydroxybutyryl-CoA
FT                   epimerase] FadB or OldB or b3846 SWALL:FADB_ECOLI
FT                   (SWALL:P21177) (729 aa) fasta scores: E(): 4.2e-210, 75.99%
FT                   id in 729 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73127"
FT                   /db_xref="GOA:Q6DAP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAP5"
FT                   /protein_id="CAG73127.1"
FT                   /translation="MLYQGESLYLNWLEDGIAELVFSAPGSVNTLDTRTVASLGKALDV
FT                   LAEQPNLKGLLLRSDKPAFIVGADITEFLSLFAAPAEKLHEWLVFANSIFNRLEDLPVP
FT                   TLSAINSYALGGGCECVLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGADSA
FT                   LEIIAAGKDVSAADALKVGLVQAVVANEKLIPAAIKMLKQAINGELDWLGYRRPKLEAL
FT                   KLNKIEAMMSFTTAKAMVLQTAGKHYPAPMLAVKTIEAAATMTRDEALQLETQHFVQLA
FT                   RSNEARALVGIFLNDQYVKGKAKKLVGETPVPQQAAVLGAGIMGGGIAYQSAFKGVPIR
FT                   MKDINEKPLALGMNEAAKLLNKQMERGKLDGMKMATILANIHPTLDYAGFERTDIVVEA
FT                   VVENPKIKASVLAETESHISESTILASNTSTIPIAVLAAALKRPQNFCGMHFFNPVHRM
FT                   PLVEIIRGPKTSDSTIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDG
FT                   ADFREIDNAMEKKFGWPMGPAYLLDVVGIDTAHHAQAVMAEGFPQRMAKDYRDAIDVLF
FT                   EHQRFGQKNGQGFYRYQTDSKGKQRKEQDDAVDALLKNISQPKKAFSAEEIIARMMIPM
FT                   INEVARCLEEGIVASPAEADMALVYGLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLG
FT                   AIYQVPDGLQQKARSNEGYYPSVAPHADVSHGQPA"
FT   misc_feature    complement(234275..234565)
FT                   /note="HMMPfam hit to PF00725, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 1.6e-37"
FT   misc_feature    complement(234500..234574)
FT                   /note="PS00067 3-hydroxyacyl-CoA dehydrogenase signature."
FT   misc_feature    complement(234569..235123)
FT                   /note="HMMPfam hit to PF02737, DE 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain, score 1.4e-101"
FT   misc_feature    complement(235484..235999)
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 1.1e-75"
FT   CDS_pept        236236..237567
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ECA0209"
FT                   /product="proline dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="Similar to Escherichia coli Xaa-Pro dipeptidase PepQ
FT                   or b3847 SWALL:PEPQ_ECOLI (SWALL:P21165) (443 aa) fasta
FT                   scores: E(): 1.2e-139, 76.74% id in 443 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73128"
FT                   /db_xref="GOA:Q6DAP4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAP4"
FT                   /protein_id="CAG73128.1"
FT                   /translation="MEKLASLYHHHLATLQTRAQAVLARHKLDALLIHSGELLTVFLDD
FT                   HDYPFKVNPQFKAWVPVTQVPNCWLWIDGVNPPKLWFYSPVDYWHSVAPVPESFWTAGV
FT                   EIAVLRNADDIGQLLPAQRERVAYIGYAPQRAQDLGIRADNINPQGVLDYLHYHRAYKT
FT                   DYELACMREAQKTAVIGHRAAHEAFLSGMSEFDINLAYLTATGHRDIDVPYGNIIALNE
FT                   HAAVLHYTQLDHQVPSDVRSFLIDAGAEYNGYAADLTRTYSAQSDGAFAQLIKDLNQEM
FT                   LALIDTMQAGVRYTDYHIQMHQRIAKLLKSHQLVRDISEEAMVEQGLTLPFLPHGLGHP
FT                   LGLQVHDVAGFMQDDRGTHLAAPTQHPYLRCTRVLEPGMVMTIEPGIYFIESLLAPWRE
FT                   GECSQHFDWQKIDALKPFGGIRIEDNIVIHEGRVENMTRDLNLA"
FT   misc_feature    236713..237537
FT                   /note="HMMPfam hit to PF00557, DE metallopeptidase family
FT                   M24, score 3.2e-76"
FT   misc_feature    237238..237276
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature."
FT   CDS_pept        237567..238178
FT                   /transl_table=11
FT                   /locus_tag="ECA0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein YigZ SWALL:Q8X8I0 (EMBL:AE005615) (205 aa) fasta
FT                   scores: E(): 1.9e-44, 63.86% id in 202 aa, and to
FT                   Escherichia coli hypothetical protein YigZ SWALL:YIGZ_ECOLI
FT                   (SWALL:P27862) (204 aa) fasta scores: E(): 2.9e-44, 63.86%
FT                   id in 202 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73129"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAP3"
FT                   /protein_id="CAG73129.1"
FT                   /translation="MHVYPILTAPVSFSEEIKKSRFTTILAATPGIDAAKAFIQHVREE
FT                   HASAGHHCWAFVAGAPDDSQQLGFSDDGEPSGTAGKPMLSQLMGSGIGEITAVVVRYYG
FT                   GIPLGTGGLVKAYGGGVQQALKLISLQEKVLQKEYDLQCDYALLPQIESLIFQLGGKIL
FT                   HSEYGMDVVLRFSIPVRGTEEAATKLRDLSRGALHLLPIP"
FT   misc_feature    237615..237953
FT                   /note="HMMPfam hit to PF01205, DE Uncharacterized protein
FT                   family UPF0029, score 6.9e-52"
FT   misc_feature    237804..237893
FT                   /note="PS00910 Uncharacterized protein family UPF0029
FT                   signature."
FT   CDS_pept        238222..239673
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="ECA0211"
FT                   /product="Trk system potassium uptake protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri Trk system potassium uptake
FT                   protein TrkH or b3849 or z5371 or ecs4777 or sf3925
FT                   SWALL:TRKH_ECOLI (SWALL:P21166) (483 aa) fasta scores: E():
FT                   2e-172, 89.02% id in 483 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73130"
FT                   /db_xref="GOA:Q6DAP2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAP2"
FT                   /protein_id="CAG73130.1"
FT                   /translation="MHLRAITRIVGQLVILFSGTMVIPGLVALIYRDGAGRAFTQTFIV
FT                   ALAIGIMLWLPNRKQKHELKSREGFLIVVLFWTVLGSVGALPFLFAEHPNLGVTDAFFE
FT                   SFSGLTTTGATTLVGLDSLPKAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKENKMRPRIADTAKTLWLIYLLLTIACAVALWLAGMPVFDAIGHSFSTVSVGG
FT                   FSTHDASIGYFNSPTINTIIAIFLLISGCNFGLHFALLSGRSLKVYWRDPEFRMFIFVQ
FT                   LSLVAVCTIVLWFHHVYDSGMQTINQAFFQVVSMATTAGFTTDSIASWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGHRALPERILEAVWG
FT                   FFSAYALVFIVSMLAVIATGVDDFSAFAAVAATLNNLGPGLGVVAENFTSMNDTAKWIL
FT                   ILTMLFGRLEVFTLLVLFTPTFWRE"
FT   misc_feature    order(238246..238314,238324..238392,238426..238494,
FT                   238618..238686,238774..238842,238933..239001,
FT                   239038..239106,239197..239265,239410..239478,
FT                   239491..239550,239587..239655)
FT                   /note="11 probable transmembrane helices predicted for
FT                   ECA0211 by TMHMM2.0 at aa 9-31, 35-57, 69-91, 133-155,
FT                   185-207, 238-260, 273-295, 326-348, 397-419, 424-443 and
FT                   456-478"
FT   misc_feature    238261..239472
FT                   /note="HMMPfam hit to PF00115, DE Cytochrome C and Quinol
FT                   oxidase polypeptide I, score 0.46"
FT   misc_feature    238408..239664
FT                   /note="HMMPfam hit to PF02386, DE Cation transport protein,
FT                   score 4.1e-159"
FT   CDS_pept        239695..240234
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="ECA0212"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 protoporphyrinogen oxidase
FT                   HemG or b3850 or c4797 or z5372 or ecs4778 SWALL:HEMG_ECOLI
FT                   (SWALL:P27863) (181 aa) fasta scores: E(): 8.5e-44, 62.14%
FT                   id in 177 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73131"
FT                   /db_xref="GOA:Q6DAP1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAP1"
FT                   /protein_id="CAG73131.1"
FT                   /translation="MKALIVFSSRDGQTRAIASYIANTLKGTLECDVVNVLNANDIDLG
FT                   QYDQVLIGASIRYGRFHPAVNQFIHKHLASLRQLPSAFFSVNLTARKPEKRTIQTNAYT
FT                   RKFLLNSPWQPDLCCVFAGALRYPRYRWFDRVMIQLIMRMTGGETDSTKEVEYTDWQQV
FT                   ARFAQDFAQLAAKNPA"
FT   misc_feature    239707..239757
FT                   /note="PS00201 Flavodoxin signature."
FT   rRNA            240628..242170
FT                   /note="16S rRNA"
FT   tRNA            242245..242321
FT                   /note="tRNA Ile anticodon GAT, Cove score 88.37"
FT   tRNA            242364..242439
FT                   /note="tRNA Ala anticodon TGC, Cove score 86.08"
FT   rRNA            242656..245563
FT                   /note="23S rRNA"
FT   rRNA            245691..245810
FT                   /note="5S rRNA"
FT   CDS_pept        245968..247005
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="ECA0213"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.1.1.158"
FT                   /note="Similar to Escherichia coli
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase MurB or b3972
FT                   SWALL:MURB_ECOLI (SWALL:P08373) (342 aa) fasta scores: E():
FT                   1.5e-91, 63.71% id in 339 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73132"
FT                   /db_xref="GOA:Q6DAP0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAP0"
FT                   /protein_id="CAG73132.1"
FT                   /translation="MAPSVISLRSHNSFSLSVSASCIKVADTQDKLIEEWRVASASQEP
FT                   VLLLGEGSNVLFLEDFLGTILLNRLKGIDIREESDGWYLHVGAGENWHQLVEYTLKCGI
FT                   TGLENLALIPGCVGSAPIQNIGAYGIELQHVCDYVELLDLTEGKTIHLTTEECQFGYRE
FT                   SIFKHQYRYGFAITAVGIFLKKEWNPVLNYGDLAKLNPATVTPQQVFDSVCHMRRSKLP
FT                   DPVVTGNAGSFFKNPIVTKQHADSILREYPNMPQYLQADGNVKLAAGWLIDQCKLKGFQ
FT                   LGGAAVHEQQALVLINKSNAKGSDIVELARYVRNQVAAKFSIQLEPEVRFIAAHGEVNA
FT                   IEVLS"
FT   misc_feature    246001..246033
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    246025..246492
FT                   /note="HMMPfam hit to PF01565, DE FAD binding domain, score
FT                   0.0013"
FT   misc_feature    246583..246966
FT                   /note="HMMPfam hit to PF02873, DE
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal
FT                   domain, score 2.7e-58"
FT   CDS_pept        247002..247961
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /gene_synonym="bioR"
FT                   /gene_synonym="dhbB"
FT                   /locus_tag="ECA0214"
FT                   /product="bira bifunctional protein [includes: biotin
FT                   operon repressor; biotin--[acetyl-CoA-carboxylase]
FT                   synthetase]"
FT                   /EC_number="6.3.4.15"
FT                   /note="Similar to Escherichia coli BirA bifunctional
FT                   protein [includes: biotin operon repressor;
FT                   biotin--[acetyl-CoA-carboxylase] synthetase] BirA or BioR
FT                   or DhbB or b3973 SWALL:BIRA_ECOLI (SWALL:P06709) (321 aa)
FT                   fasta scores: E(): 1.7e-92, 73.5% id in 317 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73133"
FT                   /db_xref="GOA:Q6DAN9"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAN9"
FT                   /protein_id="CAG73133.1"
FT                   /translation="MKDITVPLKLIKILSDGDFYSGEVLGEMMGMSRAAINKHIQTIRD
FT                   WGIDVFTVTGKGYSLPVTMQLLDEEIILKHLPEGGVTVLPVVDSTNQYILERLDTLSSG
FT                   DACLAEYQQSGRGRRGRQWFSPFGANLYLSLYWRLEQGPAAAVGVSLVIGIVMAEVLHK
FT                   LGADGVRVKWPNDLYLKDRKLAGILVELTGKTGDAANLVIGAGINLQMREPAPDTINQG
FT                   WINLQEAGIDINRNTLASTLISELRGALAVFELEGLEPFISRWERLDNYFNRPVRLIIG
FT                   NREIYGVDRGIDSQGALLLENDGLITSYIGGEISLRGV"
FT   misc_feature    247059..247124
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1475.000, SD 4.21 at aa 20-41, sequence
FT                   YSGEVLGEMMGMSRAAINKHIQ"
FT   misc_feature    247236..247646
FT                   /note="HMMPfam hit to PF03099, DE Biotin/lipoate A/B
FT                   protein ligase family, score 8.2e-37"
FT   misc_feature    247812..247952
FT                   /note="HMMPfam hit to PF02237, DE Biotin protein ligase C
FT                   terminal domain, score 2.7e-08"
FT   CDS_pept        complement(247989..248939)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /gene_synonym="rts"
FT                   /gene_synonym="panK"
FT                   /locus_tag="ECA0215"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 pantothenate kinase CoaA or
FT                   Rts or PanK or b3974 or c4933 or z5545 or ecs4901
FT                   SWALL:COAA_ECOLI (SWALL:P15044) (316 aa) fasta scores: E():
FT                   2.3e-100, 83.22% id in 316 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73134"
FT                   /db_xref="GOA:Q6DAN8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN8"
FT                   /protein_id="CAG73134.1"
FT                   /translation="MSNRDQSLATPYLQFNRSQWAALRDSVPLTLTEEEIVKLKGINED
FT                   LSLDEVAEIYLPLSRLLNFYINSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKSTT
FT                   ARVLQALLSRWPEHRSVELITTDGFLHPNKVLKERDLMKKKGFPQSYDMHSLVKFVSDI
FT                   KSGTHQVTAPTYSHLTYDIVPNNNKVLEQPDILILEGLNVLQSGMDYPHDPHRVFVSDF
FT                   VDFSIYVDAPETLLQPWYINRFLKFRQGAFSNPNSYFHNYAKLTEEEAVGIASQLWKEI
FT                   NGLNLKENILPTRERASLIMTKSANHAVECVRLRK"
FT   misc_feature    complement(248031..248672)
FT                   /note="HMMPfam hit to PF00485, DE Phosphoribulokinase /
FT                   Uridine kinase family, score 3.9e-05"
FT   misc_feature    complement(248634..248657)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   tRNA            249788..249863
FT                   /note="tRNA Thr anticodon TGT, Cove score 92.56"
FT   tRNA            249879..249963
FT                   /note="tRNA Tyr anticodon GTA, Cove score 67.63"
FT   tRNA            250093..250167
FT                   /note="tRNA Gly anticodon TCC, Cove score 63.22"
FT   tRNA            250174..250249
FT                   /note="tRNA Thr anticodon GGT, Cove score 94.75"
FT   CDS_pept        250357..251541
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="ECA0216"
FT                   /product="elongation factor Tu"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 elongation factor Tu
FT                   SWALL:EFTU_ECOLI tufA or b3339 or c4111 or z4697 or ecs4190
FT                   (SWALL:P02990) (393 aa) fasta scores: E(): 6e-138, 95.42%
FT                   id in 393 aa. Identical to ECA4035 (TufB) (100.000% id. in
FT                   394 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73135"
FT                   /db_xref="GOA:Q6CZW6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CZW6"
FT                   /protein_id="CAG73135.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPFMIVFMNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDIPVIRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREEIERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   misc_feature    250384..250968
FT                   /note="HMMPfam hit to PF00009, DE Elongation factor Tu GTP
FT                   binding domain, score 6.5e-95"
FT   misc_feature    250411..250434
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    250507..250554
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT   misc_feature    251002..251238
FT                   /note="HMMPfam hit to PF03144, DE Elongation factor Tu
FT                   domain 2, score 3.5e-28"
FT   misc_feature    251248..251535
FT                   /note="HMMPfam hit to PF03143, DE Elongation factor Tu
FT                   C-terminal domain, score 6.5e-60"
FT   CDS_pept        251779..252162
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /gene_synonym="prlG"
FT                   /locus_tag="ECA0217"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 preprotein translocase SecE
FT                   subunit SecE or PrlG or b3981 or c4936 or z5554 or ecs4904
FT                   SWALL:SECE_ECOLI (SWALL:P16920) (127 aa) fasta scores: E():
FT                   7.8e-42, 91.33% id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73136"
FT                   /db_xref="GOA:Q6DAN6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAN6"
FT                   /protein_id="CAG73136.1"
FT                   /translation="MSANTEAQDSGRSLEVIKWLVVGALLVVAIVGNYYYREFSLPLRA
FT                   LAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   misc_feature    order(251821..251880,251899..251967,252058..252126)
FT                   /note="3 probable transmembrane helices predicted for
FT                   ECA0217 by TMHMM2.0 at aa 15-34, 41-63 and 94-116"
FT   misc_feature    251977..252147
FT                   /note="HMMPfam hit to PF00584, DE SecE/Sec61-gamma subunits
FT                   of protein translocation complex, score 3.2e-25"
FT   misc_feature    251989..252075
FT                   /note="PS01067 Protein secE/sec61-gamma signature."
FT   CDS_pept        252164..252709
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="ECA0218"
FT                   /product="transcription antitermination protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri transcription
FT                   antitermination protein NusG or b3982 or z5555 or ecs4905
FT                   or sf4055 SWALL:NUSG_ECOLI (SWALL:P16921) (181 aa) fasta
FT                   scores: E(): 5.8e-70, 97.77% id in 180 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73137"
FT                   /db_xref="GOA:Q6DAN5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAN5"
FT                   /protein_id="CAG73137.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMEDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFAQVEKG"
FT   misc_feature    252179..252310
FT                   /note="HMMPfam hit to PF02357, DE Transcription termination
FT                   factor nusG, score 8.5e-21"
FT   misc_feature    252545..252658
FT                   /note="HMMPfam hit to PF00467, DE KOW motif, score 1.6e-10"
FT   misc_feature    252653..252682
FT                   /note="PS01014 Transcription termination factor nusG
FT                   signature."
FT   CDS_pept        252872..253300
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /gene_synonym="relC"
FT                   /locus_tag="ECA0219"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, Salmonella typhimurium, and
FT                   Salmonella typhi 50S ribosomal protein L11 RplK or RelC or
FT                   b3983 or c4939 or z5556 or ecs4906 or stm4149 or stmf1.8 or
FT                   sty3736 or t3478 SWALL:RL11_ECOLI (SWALL:P02409) (141 aa)
FT                   fasta scores: E(): 1.3e-44, 90.07% id in 141 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73138"
FT                   /db_xref="GOA:Q6DAN4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN4"
FT                   /protein_id="CAG73138.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESIEKGLPTPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSA
FT                   QVREIAETKAADMTGSDVDAMVRSIAGTARSMGLVVED"
FT   misc_feature    252893..253072
FT                   /note="HMMPfam hit to PF03946, DE Ribosomal protein L11,
FT                   N-terminal domain, score 1.8e-36"
FT   misc_feature    253085..253291
FT                   /note="HMMPfam hit to PF00298, DE Ribosomal protein L11,
FT                   RNA binding domain, score 1.7e-35"
FT   misc_feature    253250..253294
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00359 Ribosomal protein L11 signature."
FT   CDS_pept        253304..254008
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="ECA0220"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 50S ribosomal protein L1 RplA
FT                   or b3984 or c4940 or z5557 or ecs4907 SWALL:RL1_ECOLI
FT                   (SWALL:P02384) (233 aa) fasta scores: E(): 1.5e-71, 92.7%
FT                   id in 233 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73139"
FT                   /db_xref="GOA:Q6DAN3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN3"
FT                   /protein_id="CAG73139.1"
FT                   /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAEFVGMEDLADQI
FT                   KKGEMGFDVVIASPDAMRVVGQLGQLLGPRGLMPNPKVGTVTPNVAEAVNNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDSDKLKENLESLLVALKKAKPSQAKGVYIKKVSLSTTMGAGV
FT                   SIDQSGLNAVAN"
FT   misc_feature    253346..253966
FT                   /note="HMMPfam hit to PF00687, DE Ribosomal protein
FT                   L1p/L10e family, score 1.1e-125"
FT   misc_feature    253664..253720
FT                   /note="PS01199 Ribosomal protein L1 signature."
FT   CDS_pept        254326..254823
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="ECA0221"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri 50S
FT                   ribosomal protein L10 RplJ or b3985 or c4941 or z5558 or
FT                   ecs4908 or sf4058 SWALL:RL10_ECOLI (SWALL:P02408) (164 aa)
FT                   fasta scores: E(): 3.1e-53, 95.12% id in 164 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73140"
FT                   /db_xref="GOA:Q6DAN2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN2"
FT                   /protein_id="CAG73140.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKDFAKANA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEALARLMSTMKEAAAGKLVRTLAAVRDAKE
FT                   AA"
FT   misc_feature    254332..254628
FT                   /note="HMMPfam hit to PF00466, DE Ribosomal protein L10,
FT                   score 2.1e-36"
FT   misc_feature    254410..254451
FT                   /note="PS01109 Ribosomal protein L10 signature."
FT   CDS_pept        254890..255255
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="ECA0222"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri 50S
FT                   ribosomal protein L7/L12 RplL or b3986 or c4943 or z5559 or
FT                   ecs4909 or sf4059 SWALL:RL7_ECOLI (SWALL:P02392) (120 aa)
FT                   fasta scores: E(): 8.3e-31, 91.66% id in 120 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73141"
FT                   /db_xref="GOA:Q6DAN1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN1"
FT                   /protein_id="CAG73141.1"
FT                   /translation="MSITKDQILEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGP
FT                   AEVAEEKTEFDVVLKAIGANKVAVIKAVRSATGLGLKEAKDLVESAPAVMKEGVSKDDA
FT                   ESLKKSLEEAGAEVEVK"
FT   misc_feature    255049..255249
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00542, DE Ribosomal protein L7/L12
FT                   C-terminal domain, score 3.2e-37"
FT   CDS_pept        255584..259612
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /gene_synonym="groN"
FT                   /gene_synonym="nitB"
FT                   /gene_synonym="rif"
FT                   /gene_synonym="ron"
FT                   /gene_synonym="stl"
FT                   /gene_synonym="stv"
FT                   /gene_synonym="tabD"
FT                   /locus_tag="ECA0223"
FT                   /product="DNA-directed RNA polymerase, beta-subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   DNA-directed RNA polymerase beta chain RpoB or GroN or NitB
FT                   or Rif or Ron or Stl or Stv or TabD or b3987 or c4944 or
FT                   z5560 or ecs4910 or sf4060 SWALL:RPOB_ECOLI (SWALL:P00575)
FT                   (1342 aa) fasta scores: E(): 0, 94.56% id in 1342 a"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73142"
FT                   /db_xref="GOA:Q6DAN0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAN0"
FT                   /protein_id="CAG73142.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QHGLEAAFRSVFPIKSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALGYSTAQILD
FT                   LFFDKIVYEINGNKLQMDLVPERLRGETASFDIEANGKVYIEKGRRITARHIRQLEKDS
FT                   IERIEVPVEYIAGKVLSKDYIDESTGELIGAANMELSLDLLAKLSQSGHKRIETLFTND
FT                   LDHGAYMSETVRVDPSSDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRENVVTDEIHYLSAIEEGNFVIAQANTNLDEEGRFIDELVT
FT                   CRNKGESSLFSRDQVEYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIRVNDDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTIID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFGRIHAVLVSGGVEADKL
FT                   DKLPRERWLELGLTDEDKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKQHEEVTKLREFIQRAYDLGDDLRQKVDLSTFSD
FT                   EEVMRLAENLKKGMPIATPVFDGAKEKEIKELLQMGGIPTSGQITLYDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEEK"
FT   misc_feature    255815..259480
FT                   /note="HMMPfam hit to PF00562, DE RNA polymerase Rpb2,
FT                   domain 6, score 0"
FT   misc_feature    258770..258808
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT   CDS_pept        259736..263959
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /gene_synonym="tabB"
FT                   /locus_tag="ECA0224"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri DNA-directed RNA polymerase
FT                   beta' chain RpoC or TabB or b3988 or z5561 or ecs4911 or
FT                   sf4061 SWALL:RPOC_ECOLI (SWALL:P00577) (1407 aa) fasta
FT                   scores: E(): 0, 92.75% id in 1407 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73143"
FT                   /db_xref="GOA:Q6DAM9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAM9"
FT                   /protein_id="CAG73143.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECEQLREELTETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERVYRAGLASLHARVKVRITEEIKSIEGDVTHQTSIIDTTIGR
FT                   AILWMIVPKGLPFSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQTMYTGFAYAARS
FT                   GASVGIDDMVIPAKKAEIIEEAETEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVIKPGTADILVPRNTLLNEQWCDM
FT                   LEENSVDVVKVRSVVSCQTDFGVCANCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSLKLNNVKFVMNGNGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAVMAKGDGSDVSGGETVANWDPHTMPVVTEVSGFIRFADMIDGQTITR
FT                   QTDDLTGLSSIVVLDSAERTGSGKDLRPALKIVDAKGQDVLIPGTDMPAQYFLPGKTIV
FT                   QLEDGVQIGAGDTLARLPQESSGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVSAGSTEFLEGEQAEMSR
FT                   IKIANRKLEADGKITATFSRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRQASEAPVVPQVSADEASANMAELLNAGFG
FT                   KRDDE"
FT   misc_feature    260438..262228
FT                   /note="HMMPfam hit to PF00623, DE RNA polymerase Rpb1,
FT                   domain 2, score 1.2e-291"
FT   CDS_pept        264271..265668
FT                   /transl_table=11
FT                   /gene="shiA"
FT                   /locus_tag="ECA0225"
FT                   /product="shikimate transporter"
FT                   /note="Similar to Escherichia coli shikimate transporter
FT                   ShiA or b1981 SWALL:SHIA_ECOLI (SWALL:P76350) (438 aa)
FT                   fasta scores: E(): 4.7e-125, 73.57% id in 420 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73144"
FT                   /db_xref="GOA:Q6DAM8"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM8"
FT                   /protein_id="CAG73144.1"
FT                   /translation="MDTSTTPTLSQPGGSLPHQDDSLSSDKTLQTQSVSHSQHRAKRAA
FT                   WGSFVGAVVDWYDFLLYGIVAALVFNTEFFPQISPTMGTLAAFGTFGVGFLFRPLGGMV
FT                   FGHFGDKLGRKRMLMITVWMMGISTALIGLLPSFDSIGWWAPALLVTLRAIQGFAVGGE
FT                   WGGAALLAVENAPKKKKAFYSSGVQVGFGVGLLLATGSVSVVSNLTTNEEFTSWGWRLP
FT                   FLFSLILVAIAWWVRNGMDESQEFEANKTLGERAQKLRSFPIMEALRQHPKAFLLIIAL
FT                   RLGELLTMYIVTAFALNYSTTHLGLSRDIFLNIGLLVGAISCVSIPFFAYLADSFGRRR
FT                   IYVTGALIGAVSAVPFFMALESHNTLMILFFAIMLANAAHDMIVSVQQPMFTELFGTAY
FT                   RYSGAGVGYQVASVVGGGFTPFIAVLLVEFMDGSWHAVAAYLAIGCLLSAVVGMGMKAP
FT                   SDDTVPH"
FT   misc_feature    264400..265656
FT                   /note="HMMPfam hit to PF00083, DE Sugar (and other)
FT                   transporter, score 2.1e-27"
FT   misc_feature    order(264406..264474,264517..264585,264622..264675,
FT                   264718..264786,264823..264891,264919..264978,
FT                   265093..265161,265198..265266,265291..265350,
FT                   265363..265422,265483..265551,265564..265632)
FT                   /note="12 probable transmembrane helices predicted for
FT                   ECA0225 by TMHMM2.0 at aa 46-68, 83-105, 118-135, 150-172,
FT                   185-207, 217-236, 275-297, 310-332, 341-360, 365-384,
FT                   405-427 and 432-454"
FT   misc_feature    264733..264810
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   CDS_pept        complement(265739..265930)
FT                   /transl_table=11
FT                   /locus_tag="ECA0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjiS SWALL:YJIS_ECOLI (SWALL:P39390) (54 aa) fasta scores:
FT                   E(): 6.1e-06, 44.44% id in 63 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73145"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM7"
FT                   /protein_id="CAG73145.1"
FT                   /translation="MEFHENRSQKPFRESPFWLMLILPYRLWKAWRVRAQTLKILRNMS
FT                   NDGLKDIGLKRSDLDRFR"
FT   CDS_pept        266104..267540
FT                   /transl_table=11
FT                   /locus_tag="ECA0227"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas putida transcriptional
FT                   regulator, GntR family pp5275 SWALL:AAN70840
FT                   (EMBL:AE016793) (496 aa) fasta scores: E(): 2.2e-120, 61%
FT                   id in 477 aa, and to Escherichia coli hypothetical protein
FT                   YjiR SWALL:YJIR_ECOLI (SWALL:P39389) (470 aa) fasta scores:
FT                   E(): 4.1e-118, 60.55% id in 469 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73146"
FT                   /db_xref="GOA:Q6DAM6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM6"
FT                   /protein_id="CAG73146.1"
FT                   /translation="MTRYQHLAGLLEQRIEQGLYQSGERLPSVRALSTEHGVSISTVQQ
FT                   AYHLLETRQLIMPQPRSGYFVTPRKATPPVPALTRPAQRPVEITQWESVLELVNVRLET
FT                   NVLKFGSGMPDVSQPTIKPLWKEMSRLCQYQDPRVLQYDSVYGVPALREQIARLTVDCG
FT                   CQLNQDDIVITTGCQEALFVAVRAVCQPGDIVAVESPAFPGTMQILRGLDIKAIEIPTD
FT                   SVTGISLEALRLALDQWPVKAVLLVPSCNNPLGFIMPDARKKSLVTLAQHFDIAIIEDD
FT                   AYGELAYEYPRPRAIKSFDEDGRVLLCSSFSKNLAPGLRVGWIAPGRYLERVIHTKYIS
FT                   TGSTVVQPQLAVAEFIRRGHYQPHLRRMRAQYKANLDIFTCWVREYFPSNICVSRPQGG
FT                   FLVWIELPEYFDSLKLAREVRKAGIQIAAGSLFSASGKYRNCIRLNYANRFTEEMREGL
FT                   RIVGSEVAKMMHTLPDQSAP"
FT   misc_feature    266122..266301
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 6.3e-14"
FT   misc_feature    266569..267498
FT                   /note="HMMPfam hit to PF00155, DE Aminotransferase class I
FT                   and II, score 1.4e-06"
FT   CDS_pept        complement(267925..269046)
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="ECA0228"
FT                   /product="thiazole biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiazole biosynthesis
FT                   protein ThiH or b3990 SWALL:THIH_ECOLI (SWALL:P30140) (376
FT                   aa) fasta scores: E(): 2.6e-125, 81.03% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73147"
FT                   /db_xref="GOA:Q6DAM5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM5"
FT                   /protein_id="CAG73147.1"
FT                   /translation="MSVDFQTVWEQLDWDDLTLHINSKTARDVERALTAPHLTRDDFMA
FT                   LISPAASAYLEPLAQRAQQLTRQRFGNTVSFYVPLYLSNLCSNDCTYCGFSMSNHIKRK
FT                   TLDEAEILRECAAIKELGFEHLLLVTGEHQRKVGMDYFRRVFPLIRPLFSSLMIEVQPL
FT                   SQDEYAELKMLGLDGVMVYQETYHPATYQLHHLKGQKQDFHWRLATPDRLGRAGIDKIG
FT                   LGALIGLSNSWRTDCYMVAEHLLHLQQNYWQSRYSISFPRLRPCAGGIEPASLMDEAQL
FT                   MQVICAFRLLSPDIELSLSTRESPFFRDHAIPIAINNVSAFSKTQPGGYADNHPELEQF
FT                   TPHDSRRPEDVAQAIIRAGLQPVWKDWDGYLGR"
FT   CDS_pept        complement(269043..269828)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="ECA0229"
FT                   /product="thiazole biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiazole biosynthesis
FT                   protein ThiG or b3991 SWALL:THIG_ECOLI (SWALL:P30139) (256
FT                   aa) fasta scores: E(): 2.7e-64, 76.58% id in 252 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73148"
FT                   /db_xref="GOA:Q6DAM4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAM4"
FT                   /protein_id="CAG73148.1"
FT                   /translation="MLHIADTILTSRLLTGTGKFATPELMLAALEASGSQLVTMAMKRV
FT                   DLNGGNDAILAPLRQLGIKLLPNTSGAKTADEAVFAARLAREALGTHWLKLEIHPDVKY
FT                   LLPDPIETLKAAEQLVKEGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLQT
FT                   RDFLRIIIEQARIPVIVDAGIGAPSHAADALEMGADGVLVNTAIAVARDPVAMARAFRL
FT                   AVNAGGLARQAGQGNKQFVASATSPLTGFLHQQTEGAER"
FT   CDS_pept        complement(269830..270030)
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /gene_synonym="thiG1"
FT                   /locus_tag="ECA0229A"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="Similar to Escherichia coli this protein ThiS or
FT                   ThiG1 or b3991.1 SWALL:THIS_ECOLI (SWALL:O32583) (66 aa)
FT                   fasta scores: E(): 2.4e-12, 56.06% id in 66 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0229A"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73149"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM3"
FT                   /protein_id="CAG73149.1"
FT                   /translation="MKITLNDEPFECPEAMTVETLLNQINRFQPGTALAINQTIIPHAT
FT                   WSQHQVQDGDDILLFQAIAGG"
FT   CDS_pept        complement(270027..270806)
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="ECA0230"
FT                   /product="thiamine biosynthesis adenylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Similar to Escherichia coli adenylyltransferase ThiF
FT                   or b3992 SWALL:THIF_ECOLI (SWALL:P30138) (251 aa) fasta
FT                   scores: E(): 7e-59, 60.56% id in 246 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73150"
FT                   /db_xref="GOA:Q6DAM2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAM2"
FT                   /protein_id="CAG73150.1"
FT                   /translation="MVTNHPPTPAGLSDSEFMRYSRQLMLEDIGPEGQEKLKAARVLLV
FT                   GLGGLGSPASLYLAAAGVGTLLLADDDSLHISNLQRQILYRTSETDQPKAVLAQRQLQA
FT                   LNPHSEAIAITERLSGDALHNAVSRVDLVLDCSDNMITRHAVNAACVGAGKPLISGSAV
FT                   GFSGQLTVFTPPYHSGCYACLYPDTAEPQRNCRTAGVLGPVVGVIGTLQALEAIKLLAG
FT                   LPSALDGKLRMFNGKQQSWSTLQLTRSPHCPVCGGVA"
FT   misc_feature    complement(270285..270695)
FT                   /note="HMMPfam hit to PF00899, DE ThiF family, score
FT                   1.1e-48"
FT   CDS_pept        complement(270808..271449)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="ECA0231"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Similar to Escherichia coli thiamine-phosphate
FT                   pyrophosphorylase ThiE or b3993 SWALL:THIE_ECOLI
FT                   (SWALL:P30137) (211 aa) fasta scores: E(): 3.1e-50, 72.13%
FT                   id in 201 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73151"
FT                   /db_xref="GOA:Q6DAM1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAM1"
FT                   /protein_id="CAG73151.1"
FT                   /translation="MTDSTPFAPTAQRLGLYPVVDSVEWIERLLGVGVKTIQLRIKDRS
FT                   DEQAETDVIQAIALGSRYQAQLFINDYWTLAVKHQAYGVHLGQEDLDTADLAAIKKAGL
FT                   RLGVSTHYDRELARAVAINPSYIALGHIFPTQTKDMPSAPQGLAELTRHIADLQGRFPT
FT                   VAIGGISIDRVPAVLATGVGSIAVVSAITQAPDWRQATATLLKMIEGREA"
FT   misc_feature    complement(270826..271440)
FT                   /note="HMMPfam hit to PF02581, DE Thiamine monophosphate
FT                   synthase/TENI, score 6.9e-70"
FT   misc_feature    complement(270919..270948)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        complement(271446..273440)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="ECA0232"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiamine biosynthesis
FT                   protein ThiC or b3994 SWALL:THIC_ECOLI (SWALL:P30136) (631
FT                   aa) fasta scores: E(): 0, 87.12% id in 629 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73152"
FT                   /db_xref="GOA:Q6DAM0"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAM0"
FT                   /protein_id="CAG73152.1"
FT                   /translation="MSTEPLSINPLSAKPLSATQEPSTSSKPSRREQRAAAQRFIETLQ
FT                   GTAFPNSKRIYLTGSRDDIGVPMREIQLSPTLLGGSKDDPQYEPNEPIPVYDTSGPYGD
FT                   PAAQPDVHVGLAKLRANWIAERHDTEALSGVSSDFTQQRMADAGLDHLRFEHLPRPLRA
FT                   KAGKRVTQLHYARQGMITPEMEFIAIRENMGRERIRGEVLRQQHPGQSFGALLPENITP
FT                   EFVRQEVAAGRAIIPSNINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWS
FT                   TRWGADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLNWEMFRDT
FT                   LLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKESFLYEHFR
FT                   EICEICAAYDVALSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPG
FT                   HVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCY
FT                   VTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFN
FT                   LALDPQTARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAKQETEAKPIEI
FT                   GMAEMSQEFRSRGSELYHSATSLQAEESK"
FT   misc_feature    complement(271581..272933)
FT                   /note="HMMPfam hit to PF01964, DE ThiC family, score 0"
FT   misc_feature    complement(271905..271937)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_RNA        complement(273556..273693)
FT                   /gene="thi"
FT                   /note="Erwinia_carotovora 273693 273556 RF00059 1 42 57.79
FT                   THI"
FT   CDS_pept        complement(273815..274276)
FT                   /transl_table=11
FT                   /gene="rsd"
FT                   /locus_tag="ECA0233"
FT                   /product="regulator of sigma D"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri regulator of sigma D Rsd or
FT                   b3995 or z5570 or ecs4918 or sf4067 SWALL:RSD_ECOLI
FT                   (SWALL:P31690) (158 aa) fasta scores: E(): 4.1e-31, 59.21%
FT                   id in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73153"
FT                   /db_xref="GOA:Q6DAL9"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAL9"
FT                   /protein_id="CAG73153.1"
FT                   /translation="MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKEA
FT                   LSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQVLALSTQLDFALQNNTQQ
FT                   IMTFYDSHLAAAIDHDNCIEFQQALSSVGEALEERFTLEDNMIKQVYDN"
FT   CDS_pept        274385..275167
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="ECA0234"
FT                   /product="putative NADH pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Escherichia coli NADH pyrophosphatase
FT                   NudC SWALL:NUDC_ECOLI (SWALL:P32664) (257 aa) fasta scores:
FT                   E(): 2.2e-77, 70.42% id in 257 aa, and to Yersinia pestis
FT                   NADH pyrophosphatase NudC SWALL:NUDC_YERPE (SWALL:Q8ZAQ5)
FT                   (260 aa) fasta scores: E(): 1.3e-84, 75.87% id in 257 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73154"
FT                   /db_xref="GOA:Q6DAL8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAL8"
FT                   /protein_id="CAG73154.1"
FT                   /translation="MEQTLKGDETGWWVVSDAVQIWMPQGELPRGTATEWSLQGKTARQ
FT                   IGEWQGQPAWLVCQGRDTDMASVRQLLDQDVGLFQLAGRGVQLAEFYRSHRFCGYCGHE
FT                   MVRSKTELACLCHHCKERYYPQIAPCIIVAIRRGEEILLAQHNRHRGNMYTVLAGFVEV
FT                   GETLEQTVVREVMEESQIQIKNLRYVSSQPWPFPHSLMMAFMADYAGGDIKHDPKELRD
FT                   AGWFRYDQLPQLPPPGTVARRLIEDTVVLCRAYHENEG"
FT   misc_feature    274703..274768
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1187.000, SD 3.23 at aa 107-128, sequence
FT                   RSKTELACLCHHCKERYYPQIA"
FT   misc_feature    274763..275125
FT                   /note="HMMPfam hit to PF00293, DE NUDIX domain, score
FT                   4.8e-24"
FT   misc_feature    274859..274918
FT                   /note="PS00893 mutT domain signature."
FT   CDS_pept        275283..276347
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="ECA0235"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Similar to Escherichia coli uroporphyrinogen
FT                   decarboxylase HemE or b3997 SWALL:DCUP_ECOLI (SWALL:P29680)
FT                   (354 aa) fasta scores: E(): 1.3e-126, 88.66% id in 353 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73155"
FT                   /db_xref="GOA:Q6DAL7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAL7"
FT                   /protein_id="CAG73155.1"
FT                   /translation="MTDLKNDRYLRALLRQPVDITPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRYALDAAILFSDILTIPDAMGLGLYFEAGEGPRFHSPIT
FT                   SHADVVKLPVPDPEQELGYVMNAVRTIRKNLAGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTVIKKMMFAEPKTLHLLLDKLADSVILYLNAQIRAGAQAVMVFDTWGGALSGRDYKEF
FT                   SLHYMHKIVDSLQRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTSDIADARRR
FT                   VGDKVALQGNMDPSMLYADPARIEQEVASILAGFGQGNGHVFNLGHGIHQDVPPEHAGV
FT                   FVEAVHRLSRAYHA"
FT   misc_feature    275292..276326
FT                   /note="HMMPfam hit to PF01208, DE Uroporphyrinogen
FT                   decarboxylase (URO-D), score 1.2e-207"
FT   misc_feature    275346..275375
FT                   /note="PS00906 Uroporphyrinogen decarboxylase signature 1."
FT   misc_feature    275709..275756
FT                   /note="PS00907 Uroporphyrinogen decarboxylase signature 2."
FT   CDS_pept        join(276363..276647,276647..277051)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="ECA0236"
FT                   /product="endonuclease V (pseudogene)"
FT                   /EC_number="3.1.21.7"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 95. The frameshift occurs within a
FT                   polymeric tract of (A)7. Similar to Escherichia coli,
FT                   Escherichia coli O6, and Escherichia coli O157:H7
FT                   endonuclease V Nfi or b3998 or c4955 or z5574 or ecs4921
FT                   SWALL:NFI_ECOLI (SWALL:P32679) (223 aa) fasta scores: E():
FT                   1.4e-68, 74.32% id in 222 aa"
FT                   /db_xref="PSEUDO:CAG73156.1"
FT   variation       276646..276652
FT                   /note="(A)7"
FT   misc_feature    276666..276734
FT                   /note="1 probable transmembrane helix predicted for ECA0236
FT                   by TMHMM2.0 at aa 102-124"
FT   CDS_pept        277129..277719
FT                   /transl_table=11
FT                   /locus_tag="ECA0237"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi hypothetical protein YjaG SWALL:YJAG_SALTY
FT                   (SWALL:Q9L9I2) (196 aa) fasta scores: E(): 2.3e-65, 82.14%
FT                   id in 196 aa, and to Escherichia coli hypothetical protein
FT                   YjaG SWALL:YJAG_ECOLI (SWALL:P32680) (196 aa) fasta scores:
FT                   E(): 3.1e-63, 79.08% id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73157"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL6"
FT                   /protein_id="CAG73157.1"
FT                   /translation="MLRNPIHLRLEKLASWQHVTFMACLCERMYPNYHEFCRQTEFGDA
FT                   MVYRRILDLVWEILVVKDAKVNFDSQLEKLEEAVPAAEDYDLYGVYPAIDACIALGELI
FT                   HSRLSGETLEHTIAISEASIRTVAMLEMTQAGKEMTDDELKVLPAIEEEWDIQWEIFRL
FT                   LAACEERDIELIKGLRSDLREAGSSNIGINLHQ"
FT   misc_feature    277168..277200
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        277924..278196
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="ECA0238"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri DNA-binding
FT                   protein HU-alpha HupA or b4000 or c4957 or z5576 or ecs4923
FT                   or sf4072 SWALL:DBHA_ECOLI (SWALL:P02342) (90 aa) fasta
FT                   scores: E(): 2.3e-28, 96.66% id in 90 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73158"
FT                   /db_xref="GOA:Q6DAL5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL5"
FT                   /protein_id="CAG73158.1"
FT                   /translation="MNKTQLIDVIADKADLSKTQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   misc_feature    277924..278190
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00216, DE Bacterial DNA-binding
FT                   protein, score 5.8e-50"
FT   misc_feature    278059..278118
FT                   /note="PS00045 Bacterial histone-like DNA-binding proteins
FT                   signature."
FT   CDS_pept        278201..278887
FT                   /transl_table=11
FT                   /locus_tag="ECA0239"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo3730 SWALL:Q8ZAR1 (EMBL:AJ414158) (233 aa) fasta scores:
FT                   E(): 7.2e-42, 50.87% id in 230 aa, and to Salmonella typhi
FT                   hypothetical protein sty3714 SWALL:Q8Z330 (EMBL:AL627279)
FT                   (230 aa) fasta scores: E(): 3.3e-30, 38.69% id in 230 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73159"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL4"
FT                   /protein_id="CAG73159.1"
FT                   /translation="MPVKSLSRGAFSPLLLLRRLCGAGLVLIAVVACSSRTAPPDVFSS
FT                   GYVADRGIVRLWRKDDAQDTTALTTVYNPLQGNALVVTRYTFQQDKLREIQRNQLGTQK
FT                   EDMRLRFAEDGTVSFMQRQLAERRESVSDDDVALYQFDAKRMLELSDVLRAGKVMLKQG
FT                   KWLEGQVQSCDGTVVRPDFDRDSREWIAQQKSHATRPLNVAWLEAPEGTQLLLVVEDDV
FT                   CQWQPK"
FT   misc_feature    278201..278311
FT                   /note="Signal peptide predicted for ECA0239 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.974) with cleavage site
FT                   probability 0.582 between residues 37 and 38"
FT   misc_feature    278267..278299
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(278956..280242)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="ECA0240"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Similar to Escherichia coli
FT                   phosphoribosylamine--glycine ligase PurD or b4005
FT                   SWALL:PUR2_ECOLI (SWALL:P15640) (429 aa) fasta scores: E():
FT                   1.2e-130, 79.67% id in 428 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73160"
FT                   /db_xref="GOA:Q6DAL3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL3"
FT                   /protein_id="CAG73160.1"
FT                   /translation="MNILVIGNGGREHALAWKAAQSPLAKQVYVAPGNAGTALEPALTN
FT                   VDISATDVPALVAFAQENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGS
FT                   KAFTKDFLARHNIPSAEYQNFTEVEPALTYVHSKGAPIVIKADGLAAGKGVIVAMTLQE
FT                   AENAIQDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRLRSDLVELCLAGCDGTLDQKDSVWDERPSLGVVLAAGG
FT                   YPDDYNTGDVISGLPQQDAEDGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVVEAQQR
FT                   AYEIAAGIQWQGVFCRKDIGYRAIEREQA"
FT   misc_feature    complement(278971..279255)
FT                   /note="HMMPfam hit to PF02843, DE Phosphoribosylglycinamide
FT                   synthetase, C domain, score 4.6e-48"
FT   misc_feature    complement(279265..279684)
FT                   /note="HMMPfam hit to PF01071, DE Phosphoribosylglycinamide
FT                   synthetase, ATP-grasp (A) domain, score 3.4e-96"
FT   misc_feature    complement(279352..279375)
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature."
FT   misc_feature    complement(279685..279933)
FT                   /note="HMMPfam hit to PF02842, DE Phosphoribosylglycinamide
FT                   synthetase, B domain, score 6.3e-48"
FT   misc_feature    complement(279937..280242)
FT                   /note="HMMPfam hit to PF02844, DE Phosphoribosylglycinamide
FT                   synthetase, N domain, score 2.7e-64"
FT   CDS_pept        complement(280260..281849)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="ECA0241"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Similar to Escherichia coli bifunctional purine
FT                   biosynthesis protein PurH [includes:
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase;
FT                   IMP cyclohydrolase] PurH or b4006 SWALL:PUR9_ECOLI
FT                   (SWALL:P15639) (529 aa) fasta scores: E(): 3.7e-184, 88.84%
FT                   id in 529 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73161"
FT                   /db_xref="GOA:Q6DAL2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAL2"
FT                   /protein_id="CAG73161.1"
FT                   /translation="MQQRRPIRRALLSVSDKAGIVEFAQALSHRGVELLSTGGTARLLA
FT                   DAGLAVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDQDDAIMTQHDIKPIDIVVVN
FT                   LYPFAQTVARENCTLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYTTIINEIDAN
FT                   EGSLTYETRFDLAIKAFEHTAAYDSMIANYFGALVPPYHGDTDKPSGHFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEENIHEASVATSTQLQGKALSYNNIADTDAALECVKEFAEP
FT                   ACVIVKHANPCGVAIGGSILDAYDRAYKTDPTSAFGGIIAFNRELDEETAQAIISRQFV
FT                   EVIIAPSASDAALKVTAAKQNVRVLTSGSWQQRVPALDFKRVNGGLLVQDRDLGMVDTS
FT                   QLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVKGSAMASDAFFPFRDGIDAAAAVGISCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTDMRHFRH"
FT   misc_feature    complement(280467..281441)
FT                   /note="HMMPfam hit to PF01808, DE AICARFT/IMPCHase
FT                   bienzyme, score 1.1e-210"
FT   misc_feature    complement(281454..281822)
FT                   /note="HMMPfam hit to PF02142, DE MGS-like domain, score
FT                   8.9e-55"
FT   rRNA            282456..283998
FT                   /note="16S rRNA"
FT   tRNA            284073..284149
FT                   /note="tRNA Ile anticodon GAT, Cove score 88.37"
FT   tRNA            284192..284267
FT                   /note="tRNA Ala anticodon TGC, Cove score 86.08"
FT   rRNA            284484..287391
FT                   /note="23S rRNA"
FT   rRNA            287519..287638
FT                   /note="5S rRNA"
FT   CDS_pept        complement(287820..288581)
FT                   /transl_table=11
FT                   /gene="aapP"
FT                   /locus_tag="ECA0242"
FT                   /product="L-amino acid ABC transporter ATP-binding protein"
FT                   /note="Similar to Rhizobium leguminosarum general L-amino
FT                   acid transport ATP-binding protein AapP SWALL:AAPP_RHILV
FT                   (SWALL:Q52815) (257 aa) fasta scores: E(): 8.6e-70, 75.1%
FT                   id in 245 aa, and to Escherichia coli hypothetical
FT                   amino-acid ABC transporter ATP-binding protein yhdz yhdz or
FT                   b3271 SWALL:YHDZ_ECOLI (SWALL:P45769) (252 aa) fasta
FT                   scores: E(): 7.3e-81, 85.77% id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73162"
FT                   /db_xref="GOA:Q6DAL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL1"
FT                   /protein_id="CAG73162.1"
FT                   /translation="MNQTALTQSTDHMITLENVNKWYGQFHVLKDINLQVRQGERIVLC
FT                   GPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNNDLRNIEKVRTEVGMVFQHFNLFPHL
FT                   TVLQNCTLAPSWVRHTPKKEAEELAMHYLERVRIAAHAHKFPGQLSGGQQQRVAIARSL
FT                   CMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAQDGMTMLCVTHEMGFAKTVADRVIFMD
FT                   QGEIVEQAPPDIFFSSPRSERTQSFLSQILH"
FT   misc_feature    complement(287910..288467)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.2e-64"
FT   misc_feature    complement(288093..288137)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(288423..288446)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(288590..289684)
FT                   /transl_table=11
FT                   /gene="aapM"
FT                   /locus_tag="ECA0243"
FT                   /product="L-amino acid ABC transporter permease protein"
FT                   /note="Similar to Rhizobium leguminosarum general L-amino
FT                   acid transport system permease protein AapM
FT                   SWALL:AAPM_RHILV (SWALL:Q52814) (384 aa) fasta scores: E():
FT                   6.9e-63, 51.37% id in 364 aa, and to Escherichia coli
FT                   hypothetical amino-acid ABC transporter permease protein
FT                   yhdy or b3270 SWALL:YHDY_ECOLI (SWALL:P45768) (367 aa)
FT                   fasta scores: E(): 1.4e-116, 81.37% id in 349 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73163"
FT                   /db_xref="GOA:Q6DAL0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAL0"
FT                   /protein_id="CAG73163.1"
FT                   /translation="MTMNQYTQNRQPPLLRAMQWARRNLFSSIANSLLTLFCLWLLWIA
FT                   IPPLLNWAIFQANWIGTTRNDCTRDGACWVFIHARFGHFMYGLYPATEVWRINFALAIG
FT                   LLSILPMFLKTIPYRGRYIAVWTVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIA
FT                   AVGIAGALPLGILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEG
FT                   TTIDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQA
FT                   LKMVIPGLVNTIISLFKDTSLVIIIGLFDLFSSIQQATVDPTWLGMSTEGYVFAAMVYW
FT                   IFCFSMSRYSQHLENRFNTGHNSH"
FT   misc_feature    complement(order(288647..288715,288725..288781,
FT                   288794..288862,289025..289093,289154..289222,
FT                   289250..289318,289337..289405,289544..289612))
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0243 by TMHMM2.0 at aa 25-47, 94-116, 123-145, 155-177,
FT                   198-220, 275-297, 302-320 and 324-346"
FT   misc_feature    complement(288701..288937)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 2.1e-21"
FT   CDS_pept        complement(289694..290872)
FT                   /transl_table=11
FT                   /gene="aapQ"
FT                   /locus_tag="ECA0244"
FT                   /product="L-amino acid ABC transporter permease protein"
FT                   /note="Similar to Rhizobium leguminosarum general L-amino
FT                   acid transport system permease protein AapQ
FT                   SWALL:AAPQ_RHILV (SWALL:Q52813) (400 aa) fasta scores: E():
FT                   9e-62, 48.04% id in 383 aa, and to Escherichia coli
FT                   hypothetical amino-acid ABC transporter permease protein
FT                   yhdx or b3269 SWALL:YHDX_ECOLI (SWALL:P45767) (362 aa)
FT                   fasta scores: E(): 2.5e-106, 75.77% id in 355 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73164"
FT                   /db_xref="GOA:Q6DAK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK9"
FT                   /protein_id="CAG73164.1"
FT                   /translation="MLQRPTVKGDLSLTNPAVRAWLYQIVVVIAVLSVAAYLLHNTVTN
FT                   LSQRGITSGFDFLNKSAGFGIVQHLIDYQQGDTYARVFLVGLFNTLLVSALCIVFASIL
FT                   GFTIGLARLSDNWLLRKISNIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQSISAFDIA
FT                   FLSNRGFYLPSPEMGPGTAAFFLSLLITLVVTWSVFRRNQRYHALTGQVRRTWPLTLGL
FT                   LLILCALSHLVFGPAFHWNVPELKGFNFRGGMVLIPELAALTVALSVYTSSFIAEIIRS
FT                   GIQSVSHGQHEAARSLGLPNPVTLRKVILPQALRVIIPPLTSQYLNIVKNSSLAAAIGY
FT                   PDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNLYNRRIALVER"
FT   misc_feature    complement(order(289721..289789,289817..289876,
FT                   290051..290119,290147..290215,290276..290344,
FT                   290561..290629,290756..290824))
FT                   /note="7 probable transmembrane helices predicted for
FT                   ECA0244 by TMHMM2.0 at aa 28-50, 93-115, 188-210, 231-253,
FT                   263-285, 344-363 and 373-395"
FT   misc_feature    complement(289802..290029)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 1.5e-19"
FT   misc_feature    complement(289940..290026)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(290928..291953)
FT                   /transl_table=11
FT                   /gene="aapJ"
FT                   /locus_tag="ECA0245"
FT                   /product="general L-amino ABC transporter binding protein"
FT                   /note="Similar to Rhizobium leguminosarum general L-amino
FT                   acid-binding periplasmic protein AapJ precursor AapJ
FT                   SWALL:AAPJ_RHILV (SWALL:Q52812) (341 aa) fasta scores: E():
FT                   1.9e-78, 57.72% id in 343 aa, and to Escherichia coli
FT                   putative amino-acid ABC transporter binding protein yhdw
FT                   precursor yhdw or b3268 SWALL:YHDW_ECOLI (SWALL:P45766)
FT                   (341 aa) fasta scores: E(): 6.6e-115, 84.45% id in 341 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73165"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK8"
FT                   /protein_id="CAG73165.1"
FT                   /translation="MKRIVISTLVAGASLFAAINQAHAGATLDAIQKKGFVQCGISDGL
FT                   PGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPLTAKERFTALQSGEVDVLSRN
FT                   TTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKELDGATVCIQAGTDTELNVAD
FT                   YFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSKPAEFIVLPEVI
FT                   SKEPLGPVVRRGDEEWFSIVRWTLFAMLNAEEMGVTSKNVDQLAAKPTTPDMSHLLGHE
FT                   GSYGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIKRGLNELWNKGGIQYAPAV
FT                   R"
FT   misc_feature    complement(291159..291845)
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 1.1e-38"
FT   misc_feature    complement(291738..291779)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   CDS_pept        complement(292333..292998)
FT                   /transl_table=11
FT                   /locus_tag="ECA0246"
FT                   /product="putative amino-acid transport system permease
FT                   protein"
FT                   /note="Similar to Rhizobium meliloti putative amino-acid
FT                   transport system permease ABC transporter protein r03276
FT                   SWALL:Q92L15 (EMBL:AL591793) (226 aa) fasta scores: E():
FT                   4.3e-53, 68.8% id in 218 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Shigella flexneri hypothetical
FT                   amino-acid ABC transporter permease protein YecS
FT                   SWALL:AAN43512 (EMBL:AE000284) (222 aa) fasta scores: E():
FT                   1.8e-34, 50% id in 218 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73166"
FT                   /db_xref="GOA:Q6DAK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK7"
FT                   /protein_id="CAG73166.1"
FT                   /translation="MPPWLQLMADSFWSLLSAGLKFTVPLAILSFIFGLALGILIALVR
FT                   LYGPKPLKWLGDFYVWVIRGTPLLVQLFLIFYGLPSAGITLDAFPAALIGFTVSVGAYS
FT                   SEIVRGAILSVPKGQWSAAYSLGMNGRQAIRWVIFPQSVFVSLPPLSNTFISLIKDTSL
FT                   AAVITVPEMFLSAQRIVSVTYEPLILYVEAALIYLMFSTVLSQLQAKLEKYYQRHITH"
FT   misc_feature    complement(order(292387..292455,292525..292593,
FT                   292654..292722,292750..292818,292855..292923))
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0246 by TMHMM2.0 at aa 26-48, 61-83, 93-115, 136-158 and
FT                   182-204"
FT   misc_feature    complement(292456..292668)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 1.6e-14"
FT   CDS_pept        complement(293088..293855)
FT                   /transl_table=11
FT                   /locus_tag="ECA0247"
FT                   /product="putative cystine-binding periplasmic protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   cystine-binding periplasmic protein precursor FliY or b1920
FT                   or c2335 SWALL:FLIY_ECOLI (SWALL:P39174) (266 aa) fasta
FT                   scores: E(): 1.2e-23, 36.01% id in 261 aa, and to
FT                   Lactobacillus fermentum basic surface protein SWALL:O06530
FT                   (EMBL:U97348) (264 aa) fasta scores: E(): 6.2e-28, 37.97%
FT                   id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73167"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK6"
FT                   /protein_id="CAG73167.1"
FT                   /translation="MKKIRFALLTSALLATSVFAHADDLSAIKSAGVIKFGTEGTYAPY
FT                   TYHDKSGQLVGFDVDVGRAVAEKLGVKAQFIEGRWDGLIAGIDAKRYDAVINQVGVTKE
FT                   RQVKYDFSKPYIDSKAVLVVRGDNAAIKDFSDLKGKKSAQSLTSNYSKQATSYGAEIVP
FT                   TDGFNQSLDLVLSGRADATLNDNLSFLDFKKHKPDANVKIAATSKDGEPSAILVRKDQA
FT                   PLVEALNKALDEIKADGTYKTISVRYFGEDVSQ"
FT   misc_feature    complement(293103..293756)
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 6.3e-76"
FT   misc_feature    complement(293649..293690)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   misc_feature    complement(293790..293855)
FT                   /note="Signal peptide predicted for ECA0247 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.986 between residues 22 and 23"
FT   CDS_pept        complement(294012..294410)
FT                   /transl_table=11
FT                   /locus_tag="ECA0248"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Anabaena sp. hypothetical protein Alr2599
FT                   alr2599 SWALL:Q8YTW4 (EMBL:AP003590) (131 aa) fasta scores:
FT                   E(): 1.9e-25, 64.28% id in 112 aa, and to Escherichia coli,
FT                   and Shigella flexneri hypothetical protein YtfH
FT                   SWALL:YTFH_ECOLI (SWALL:P39316) (126 aa) fasta scores: E():
FT                   3.3e-25, 62.38% id in 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73168"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK5"
FT                   /protein_id="CAG73168.1"
FT                   /translation="MTTESSPCFTCADVMAKACPSRTILRDVTSRWGVLVLLALRERTY
FT                   RFSELRRTVGGVSEKMLAQTLQTLEHDGFVLRVSHPVIPPHVDYSLTPMGREVSKLVEG
FT                   LAVWIEDNLPSILHAQNTSNEADSLFTQ"
FT   misc_feature    complement(294060..294332)
FT                   /note="HMMPfam hit to PF01638, DE Transcriptional
FT                   regulator, score 4.3e-30"
FT   misc_feature    294547..294612
FT                   /note="Signal peptide predicted for ECA0249 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 22 and 23"
FT   CDS_pept        294649..295059
FT                   /transl_table=11
FT                   /locus_tag="ECA0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc0616 or rs01517 SWALL:Q8Y1S3 (EMBL:AL646060)
FT                   (156 aa) fasta scores: E(): 1.2e-33, 66.66% id in 135 aa,
FT                   and to Xanthomonas axonopodis hypothetical protein Xac0357
FT                   SWALL:Q8PQG8 (EMBL:AE011661) (179 aa) fasta scores: E():
FT                   1.2e-15, 42.24% id in 116 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73169"
FT                   /db_xref="GOA:Q6DAK4"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK4"
FT                   /protein_id="CAG73169.1"
FT                   /translation="MFTSPNPALNANKQVVYRILRELLDAGHWEKADELLSAEYLQHNP
FT                   NAQSGRDAVVDYFTKVLKVKPQPLPERLNMKIIAVVAESDLVTVLYPRTVRDPKVAGGS
FT                   YTTTWYDTWRIKDGKAVEHWDPALLGEVPDLR"
FT   misc_feature    295144..295215
FT                   /note="Signal peptide predicted for ECA0250 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   CDS_pept        295276..296334
FT                   /transl_table=11
FT                   /locus_tag="ECA0250"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Pseudomonas syringae oxidoreductase,
FT                   aldo/keto reductase family pspto3075 SWALL:Q880S6
FT                   (EMBL:AE016867) (350 aa) fasta scores: E(): 1.5e-90, 66.57%
FT                   id in 350 aa, and to Xanthomonas axonopodis L-fucose
FT                   dehydrogenase xac0158 SWALL:Q8PR11 (EMBL:AE011640) (349 aa)
FT                   fasta scores: E(): 6.9e-73, 52.99% id in 351 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK3"
FT                   /protein_id="CAG73170.1"
FT                   /translation="MLPTRGRVTGTALPLNAPATKDIRYRTPFRFGMGGTQIGNIFAPI
FT                   SDELAHSTLQAAWDGGVRYYDTSPFYGHGLSEHRLGRFLRDKPRDQYLVSTKVGRIFHP
FT                   SRTPLPDSLWADKLNFSYEYDYTAAGARRSVEDSLQRLGLSSIDIVYIHDLSPDNTELP
FT                   TPWTTSFEIARNGAMAELERMRSEGLIKAWGFGINRADAAVMATALDKGPTPDIVLLAC
FT                   QYSIIDHQETLTKTFPALAKKGITVTVGTPLNDGFLGGRNRYHFSNDLPPGVVEKRARL
FT                   ATIADRHGIDIRTAALQFAAAPPIVSAIIPGARAPGQVEANIQSMKVSIPKGFWDELRE
FT                   QKLIAADAPIPT"
FT   misc_feature    295360..296307
FT                   /note="HMMPfam hit to PF00248, DE Aldo/keto reductase
FT                   family, score 2.1e-11"
FT   CDS_pept        296589..297767
FT                   /transl_table=11
FT                   /locus_tag="ECA0251"
FT                   /product="endonuclease/Exonuclease/phosphatase family
FT                   protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73171"
FT                   /db_xref="GOA:Q6DAK2"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK2"
FT                   /protein_id="CAG73171.1"
FT                   /translation="MLLSLSVKETTMKIRIAIYNVENLFHRTAILNLPDSQQIDALLEQ
FT                   VRQLQQLLEQPQYDDALKDKVFRLSIALRPYIDIRTDAGTLGRWKKEEAGTGFRINKSC
FT                   RGRGDWIGEIVFKSQEFSSQQRKNTGKIINLLNADILCAVEVENMDVLRDFNSQVLGKK
FT                   KFSQFVMIDSPNDPRGIDVACLTRYRIVQLRTHIFDAGKQFDPVFSRDCLEVTLDAGLK
FT                   QPIYILCNHFKSQSGQTEQERQRGAQKRRDQSERVAEIVQQTYDLKKDYVVILGDLNED
FT                   SSNPWQSLAPLFSLSDLHPVIDPERPEKERYTYYFSGGKKGARLNQLDYIFLSAPLHQA
FT                   VVEWGVERRGIYNIDKIAAKEGAEPVTPLPEVTSWDTAASDHAALWVEVDIT"
FT   misc_feature    296628..297755
FT                   /note="HMMPfam hit to PF03372, DE
FT                   Endonuclease/Exonuclease/phosphatase family, score 1.1e-09"
FT   CDS_pept        297836..298240
FT                   /transl_table=11
FT                   /locus_tag="ECA0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium putative
FT                   cytoplasmic protein stm4186 SWALL:Q8ZKL3 (EMBL:AE008895)
FT                   (135 aa) fasta scores: E(): 1.8e-24, 51.96% id in 127 aa,
FT                   and to Escherichia coli O157:H7 hypothetical protein Z0414
FT                   SWALL:Q8X3L2 (EMBL:AE005211) (136 aa) fasta scores: E():
FT                   7.2e-22, 48.43% id in 128 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73172"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK1"
FT                   /protein_id="CAG73172.1"
FT                   /translation="MSHKQGLEKYPDALRWAFGDSSELADELLQLVREGHKTASCGSYH
FT                   AFKSEPSPQVGDYNIILDGAGQPSCVIRTRSLTLVRYCDVTAEMAAKEGEGDKSLAFWQ
FT                   QAHQEFFEREGSFAPDMLLVFEEFELVEVL"
FT   CDS_pept        complement(298566..299036)
FT                   /transl_table=11
FT                   /gene="doc"
FT                   /locus_tag="ECA0253"
FT                   /product="putative death on curing protein"
FT                   /note="Similar to Bacteriophage P1 death on curing protein
FT                   Doc SWALL:DOC_BPP1 (SWALL:Q06259) (126 aa) fasta scores:
FT                   E(): 1.5e-05, 37.61% id in 109 aa, and to Escherichia coli
FT                   Doc protein Doc SWALL:Q47172 (EMBL:X98141) (126 aa) fasta
FT                   scores: E(): 1.1e-05, 37.61% id in 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73173"
FT                   /db_xref="GOA:Q6DAK0"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAK0"
FT                   /protein_id="CAG73173.1"
FT                   /translation="MFEFLNMDQVIEIQQDTLASSGPPDRNRLGGALSRVENLHFYESC
FT                   NDIFKLAALYLIAIAKAHAFNDANKRTAFQAAAIFLLMNIDPEIADDPEARSYDLNQSY
FT                   ELVKLTVFAAMDEANLEQTSFALRLLSSYRNDLMDDYDSDYLLPLQSSLSEE"
FT   CDS_pept        complement(299036..299440)
FT                   /transl_table=11
FT                   /locus_tag="ECA0254"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73174"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAJ9"
FT                   /protein_id="CAG73174.1"
FT                   /translation="MKSITYTYMREHLTEVLDELRNGVDFIVTQRGKPDLKLQGNQSAS
FT                   FPEANAGVYSSTPRGGIRVKTGEEVSVFSTPSAHGTVFVSKSGSIRRDSSSEHYEKRQT
FT                   VSQPKKLSFVEAKTRTQKRHAGVIKILGDK"
FT   CDS_pept        complement(299978..300274)
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="ECA0255"
FT                   /product="DNA-binding protein"
FT                   /note="Identical to Erwinia carotovora DNA-binding protein
FT                   Fis SWALL:FIS_ERWCA (SWALL:O52540) (98 aa) fasta scores:
FT                   E(): 1.2e-32, 100% id in 98 aa, and similar to Escherichia
FT                   coli, Escherichia coli O6, Escherichia coli O157:H7,
FT                   Salmonella typhimurium, Salmonella typhi, Shigella
FT                   flexneri, and Serratia marcescens DNA-binding protein Fis
FT                   or b3261 or c4027 or z4621 or ecs4133 or stm3385 or sty3565
FT                   or t3300 or sf3299 SWALL:FIS_ECOLI (SWALL:P11028) (98 aa)
FT                   fasta scores: E(): 6.1e-32, 97.95% id in 98 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73175"
FT                   /db_xref="GOA:Q6DAJ8"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAJ8"
FT                   /protein_id="CAG73175.1"
FT                   /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   misc_feature    complement(299990..300112)
FT                   /note="HMMPfam hit to PF02954, DE Bacterial regulatory
FT                   protein, Fis family, score 2.8e-14"
FT   misc_feature    complement(299996..300061)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1824.000, SD 5.40 at aa 72-93, sequence
FT                   GNQTRAALMMGINRGTLRKKLK"
FT   CDS_pept        complement(300298..301263)
FT                   /transl_table=11
FT                   /locus_tag="ECA0256"
FT                   /product="putative dihydrourdine synthase"
FT                   /note="Similar to Erwinia carotovora Yhdg homolog
FT                   SWALL:O52539 (EMBL:AF040381) (321 aa) fasta scores: E():
FT                   1.4e-125, 99.37% id in 321 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Escherichia coli O157:H7
FT                   hypothetical protein Yhdg SWALL:YHDG_ECOLI (SWALL:P25717)
FT                   (321 aa) fasta scores: E(): 1.6e-111, 87.53% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73176"
FT                   /db_xref="GOA:Q6DAJ7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAJ7"
FT                   /protein_id="CAG73176.1"
FT                   /translation="MHIGQFQLTNRLIAAPMAGISDRPFRALCHAMGAGMTVSEMLSSN
FT                   PEVWRSDKSRLRMVHSDEPGIRAVQIAGCDPDEMAAAARINADSGAQIIDINMGCPAKK
FT                   VNRKMAGSALLQYPDLVKQILSTVVKAVDVPVTLKIRTGWAPEHRNCVEIAKLAEDCGI
FT                   QALTIHGRTRACLFNGFAEYDSIRAVKQAVSIPIIANGDITDPHKARAVLDYTGADALM
FT                   IGRAAQGRPWIFREIQHYLDTGELLAPLPLVEVKRLLIEHIRELHDFYGPGKGFRIARK
FT                   HVSWYIQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
FT   misc_feature    complement(300304..301230)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01207, DE Dihydrouridine synthase
FT                   (Dus), score 3e-153"
FT   misc_feature    complement(300928..300984)
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT   CDS_pept        complement(301621..302355)
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="ECA0257"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="Similar to Erwinia carotovora carbonic anhydrase
FT                   precursor Cah SWALL:CAH_ERWCA (SWALL:O52538) (244 aa) fasta
FT                   scores: E(): 4.3e-93, 95.08% id in 244 aa, and to Neisseria
FT                   gonorrhoeae carbonic anhydrase precursor Cah
FT                   SWALL:CAH_NEIGO (SWALL:Q50940) (252 aa) fasta scores: E():
FT                   3.7e-39, 44.44% id in 243 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73177"
FT                   /db_xref="GOA:Q6DAJ6"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAJ6"
FT                   /protein_id="CAG73177.1"
FT                   /translation="MKGKFSIALMLSACFSASASDSVHWGYEGSGDPAHWGKLSPDFSL
FT                   CETGKNQSPVNIQQALNAQHDPLQLAFQSGTQQIINNGHTVQVNVSSGNTLLLDNETFA
FT                   LQQFHFHAPSENEIDGKQFPLEGHFVYKNADGALTVIALMFQEGAANPQLATAWQQIPA
FT                   HVDQAEDVRTPIAIQALLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQINQF
FT                   SSVMHHANNRPIQPLNGRIIIH"
FT   misc_feature    complement(301627..302283)
FT                   /note="HMMPfam hit to PF00194, DE Eukaryotic-type carbonic
FT                   anhydrase, score 1.5e-22"
FT   misc_feature    complement(301966..302016)
FT                   /note="PS00162 Eukaryotic-type carbonic anhydrases
FT                   signature."
FT   misc_feature    complement(302299..302355)
FT                   /note="Signal peptide predicted for ECA0257 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 19 and 20"
FT   CDS_pept        complement(302533..303420)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="ECA0258"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri ribosomal
FT                   protein L11 methyltransferase PrmA or b3259 or c4024 or
FT                   z4619 or ecs4131 or sf3297 SWALL:PRMA_ECOLI (SWALL:P28637)
FT                   (293 aa) fasta scores: E(): 1e-97, 81.56% id in 293 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73178"
FT                   /db_xref="GOA:Q6DAJ5"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAJ5"
FT                   /protein_id="CAG73178.1"
FT                   /translation="MPWIQLKINTSGKVAEQLGDTMIESGAVSVTFQDTHDTPVFEPLP
FT                   GETRLWGDTDAIALYDAETDMNAVIAMLEQEPLLGVGFKHKIEQLEDKDWEREWMDNFH
FT                   PMQFGKRLWICPSWREIPDPSAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLEGKTII
FT                   DFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQPADL
FT                   SADVVVANILAGPLRELAPLISDLPKAGGHLGLSGVLSTQADGVAEAYADKFTLDPVAE
FT                   REEWCRITGQRHTS"
FT   misc_feature    complement(302938..302961)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(303438..304889)
FT                   /transl_table=11
FT                   /gene="panF"
FT                   /locus_tag="ECA0259"
FT                   /product="sodium/pantothenate symporter"
FT                   /note="Similar to Escherichia coli sodium/pantothenate
FT                   symporter panF or b3258 SWALL:PANF_ECOLI (SWALL:P16256)
FT                   (483 aa) fasta scores: E(): 4.3e-141, 76.79% id in 474 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73179"
FT                   /db_xref="GOA:Q6DAJ4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAJ4"
FT                   /protein_id="CAG73179.1"
FT                   /translation="MQIEILLPLIGYLLLVFGLSVYAYRRRQAGNFLNEYFLGGRSMGG
FT                   FVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQLPTMLLSLGILGKKFAILARR
FT                   YNAITLNDMLYARYKSPLLVWFASISLLIAFIGAMAVQFIGGARLLETAANIPYDIGLL
FT                   IFGVTIALYTTFGGFRASVLNDAMQGIVMLIGTVILLVGVIYAAGGLHSAVDKLQQIDP
FT                   MLVSPQGSGGILSMPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGIIIGTIVIG
FT                   ILMLGMHLAGALGRAVMPNLTIPDQVLPALMVTVLPPLAAGIFLAAPMAAIMSNINAHL
FT                   LQASATIIKDLYLSVRPEQIHNERRIKILSSVTTLLLGLLVLLASLRPPEMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWERANAAGALSAMFTGAICYTLLASFNLQLAGYHPIVPSLLL
FT                   SLMAFMIGNRFGHNPPAPVAASSSL"
FT   misc_feature    complement(order(303483..303551,303564..303632,
FT                   303651..303719,303732..303788,303894..303962,
FT                   304005..304073,304131..304199,304257..304325,
FT                   304344..304412,304455..304523,304608..304676,
FT                   304713..304781,304818..304877))
FT                   /note="13 probable transmembrane helices predicted for
FT                   ECA0259 by TMHMM2.0 at aa 5-24, 37-59, 72-94, 123-145,
FT                   160-182, 189-211, 231-253, 273-295, 310-332, 368-386,
FT                   391-413, 420-442 and 447-469"
FT   misc_feature    complement(303594..304784)
FT                   /note="HMMPfam hit to PF00474, DE Sodium:solute symporter
FT                   family, score 6.2e-166"
FT   misc_feature    complement(304821..304889)
FT                   /note="Signal peptide predicted for ECA0259 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.664) with cleavage site
FT                   probability 0.645 between residues 23 and 24"
FT   CDS_pept        complement(305290..306633)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="ECA0260"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="Similar to Escherichia coli biotin carboxylase AccC
FT                   or FabG or b3256 SWALL:ACCC_ECOLI (SWALL:P24182) (449 aa)
FT                   fasta scores: E(): 6.7e-155, 91.72% id in 447 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73180"
FT                   /db_xref="GOA:Q6DAJ3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAJ3"
FT                   /protein_id="CAG73180.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLA
FT                   DETVCIGPAPSTKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIG
FT                   PRADTIRLMGDKVSAISAMKKAGVPCVPGSDGPLDGDMDKNRAFGKRIGYPVIIKASGG
FT                   GGGRGMRVVRSDKELEQSINMTRAEAKAAFNNDMVYMEKYLENPRHVEIQVMADGQGNA
FT                   VYLAERDCSMQRRHQKVVEEAPAPGITDELRRNIGERCAKACIDINYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQKDVKVRGHAVECRIN
FT                   AEDPNSFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYGETREIAI
FT                   SRMKNALAELIIDGIKTNIELQMKIMSDENFQRGGTNIHYLEKKLGLQ"
FT   misc_feature    complement(305311..305628)
FT                   /note="HMMPfam hit to PF02785, DE Biotin carboxylase
FT                   C-terminal domain, score 8.3e-65"
FT   misc_feature    complement(305647..306291)
FT                   /note="HMMPfam hit to PF02786, DE Carbamoyl-phosphate
FT                   synthase L chain, ATP binding domain, score 5.3e-120"
FT   misc_feature    complement(305755..305778)
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    complement(306130..306174)
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT   misc_feature    complement(306295..306633)
FT                   /note="HMMPfam hit to PF00289, DE Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain, score 3.2e-56"
FT   CDS_pept        complement(306645..307112)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="ECA0261"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri biotin
FT                   carboxyl carrier protein of acetyl-CoA carboxylase AccB or
FT                   FabE or b3255 or c4011 or z4615 or ecs4127 or sf3293
FT                   WALL:BCCP_ECOLI (SWALL:P02905) (156 aa) fasta scores: E():
FT                   3.3e-38, 83.43% id in 157 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73181"
FT                   /db_xref="GOA:Q6DAJ2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAJ2"
FT                   /protein_id="CAG73181.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAAVNYPMMQ
FT                   QAYATPMMQPQPALAAAVAPAPVEAVAAPAAISGHIVRSPMVGTFYRTPSPDAKSFVEV
FT                   GQRVNVGDTLCIVEAMKMMNQIEADKAGVVKAILVENGQPVEFDEPLVVIE"
FT   misc_feature    complement(306651..306875)
FT                   /note="HMMPfam hit to PF00364, DE Biotin-requiring enzyme,
FT                   score 1.4e-36"
FT   misc_feature    complement(306729..306782)
FT                   /note="PS00188 Biotin-requiring enzymes attachment site."
FT   CDS_pept        complement(307137..307589)
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="ECA0262"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="Similar to Actinobacillus pleuropneumoniae
FT                   3-dehydroquinate dehydratase AroQ SWALL:AROQ_ACTPL
FT                   (SWALL:P43877) (154 aa) fasta scores: E(): 2.9e-37, 70% id
FT                   in 140 aa, and to Yersinia pestis 3-dehydroquinate
FT                   dehydratase AroQ or ypo3660 or y0207 SWALL:AROQ_YERPE
FT                   (SWALL:Q8ZAX1) (150 aa) fasta scores: E(): 6.6e-51, 84.66%
FT                   id in 150 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73182"
FT                   /db_xref="GOA:Q6DAJ1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAJ1"
FT                   /protein_id="CAG73182.1"
FT                   /translation="MAENFHILLLNGPNLNLLGTREPDKYGNTTLADIVSELETQAQAL
FT                   NVKFSHLQSNAEHVLIDTIHQARGNTDFILINPAAFTHTSVALRDALLAVAIPFIEIHL
FT                   SNVHAREPFRHHSYLSDVAVGVICGLGADGYQYALQTAVKRLSTSN"
FT   misc_feature    complement(307146..307577)
FT                   /note="HMMPfam hit to PF01220, DE Dehydroquinase class II,
FT                   score 4.8e-89"
FT   misc_feature    complement(307509..307562)
FT                   /note="PS01029 Dehydroquinase class II signature."
FT   CDS_pept        complement(307844..308443)
FT                   /transl_table=11
FT                   /locus_tag="ECA0263"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella typhi hypothetical protein
FT                   YedZ SWALL:YEDZ_SALTI (SWALL:Q8Z3D4) (199 aa) fasta scores:
FT                   E(): 9.2e-62, 76.88% id in 199 aa, and to Escherichia coli
FT                   O157:H7 hypothetical protein YedZSWALL:YEDZ_ECO57
FT                   (SWALL:Q8XB73) (211 aa) fasta scores: E(): 2.4e-58, 74.87%
FT                   id in 195 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73183"
FT                   /db_xref="GOA:Q6DAJ0"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAJ0"
FT                   /protein_id="CAG73183.1"
FT                   /translation="MRLTLQHINRLKVLLHLAGFLPLLWLILSVDQGWFSADPAKDIQH
FT                   FTGRMALKLLLATLLVTPLARYGKQPLLIRCRRLLGLWCFFWATLHLVSYALLELGLDH
FT                   LALLGKELISRPYLTLGIISWLILLALAVTSPQIMMRKLGSQWQKLHNFVYLVAILTPI
FT                   HYLWSVKTLSPQPILYALAALILLLLRYKKFRQWWR"
FT   misc_feature    complement(order(307877..307930,307943..307996,
FT                   308030..308098,308141..308209,308243..308311,
FT                   308339..308407))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0263 by TMHMM2.0 at aa 13-35, 45-67, 79-101, 116-138,
FT                   150-167 and 172-189"
FT   CDS_pept        complement(308480..309481)
FT                   /transl_table=11
FT                   /locus_tag="ECA0264"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3662 SWALL:Y0G2_YERPE (SWALL:Q8ZAW9) (366 aa) fasta
FT                   scores: E(): 2.7e-113, 81.08% id in 333 aa, and to
FT                   Escherichia coli hypothetical protein YedY SWALL:YEDY_ECOLI
FT                   (SWALL:P76342) (334 aa) fasta scores: E(): 6.1e-108, 76.94%
FT                   id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73184"
FT                   /db_xref="GOA:Q6DAI9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAI9"
FT                   /protein_id="CAG73184.1"
FT                   /translation="MHKHRKPTEADVTPESLFYQRRRVLKALGISAAALSLPLSAQADL
FT                   LAWFKGSDKPKAPPGKPLTFSQPTDWKLDLPLTPEDKVTGYNNFYEFGLDKADPAANAG
FT                   GLKTDGWTIKIDGDVAKPLTLDIDDLLKRFPLEERIYRFRCVEAWSMVIPWVGFELAKL
FT                   IKFAEPTSNARYVAFQTLHDPEQMPGQKDRFMGGGLDYPYVEGLRMDEAMNPLALLAVG
FT                   VYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRLTRERPPCTWNLAAPDEYGFYANVN
FT                   PHVDHPRWSQATERVIGSGGLLNVERQPTLLFNGYAEQVASLYRGLNLRDNF"
FT   misc_feature    complement(308681..309310)
FT                   /note="HMMPfam hit to PF00174, DE Oxidoreductase
FT                   molybdopterin binding domain, score 0.015"
FT   misc_feature    complement(308801..308824)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(309353..309481)
FT                   /note="Signal peptide predicted for ECA0264 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.849 between residues 43 and 44"
FT   CDS_pept        complement(309653..310630)
FT                   /transl_table=11
FT                   /locus_tag="ECA0265"
FT                   /product="putative zinc-binding oxidoreductase"
FT                   /note="Similar to Yersinia pestis probable zinc-binding
FT                   dehydrogenase ypo3663 SWALL:Q8ZAW8 (EMBL:AJ414158) (325 aa)
FT                   fasta scores: E(): 2.4e-87, 71.6% id in 324 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73185"
FT                   /db_xref="GOA:Q6DAI8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI8"
FT                   /protein_id="CAG73185.1"
FT                   /translation="MQALVLEQSDGLTHAQIREIDAEQLPAGDVTVDISWSGINYKDAL
FT                   AITGKGKIIRNFPMVPGIDFVGTVRHSDSDRFTVGQPVILTGWGVGENHWGGLAQQARV
FT                   KSDWLVPLPASLDARNAMILGTAGFTAMLCVMALEDGGITPESGDIIVTGASGGVGSTA
FT                   VALLAELGYQVTAVSGRADNTEYLKKLGAKQVLDRSEFTESPRPLEKQRWAGAVDTVGD
FT                   NVLATLLAQMDYNATVAACGLAGGIALPTTVMPFILRNVRLQGVDSVMAPLARRQQAWD
FT                   RLATILPESFYQQVTQEIGLEDVPAVAAALLDNKVTGRTLVKIS"
FT   misc_feature    complement(309659..310606)
FT                   /note="HMMPfam hit to PF00107, DE Zinc-binding
FT                   dehydrogenase, score 4.3e-37"
FT   misc_feature    complement(310232..310279)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   CDS_pept        311016..312953
FT                   /transl_table=11
FT                   /locus_tag="ECA0266"
FT                   /product="putative signaling membrane protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo3664 SWALL:Q8ZAW7 (EMBL:AJ414158) (638 aa) fasta scores:
FT                   E(): 3.6e-144, 55.91% id in 642 aa, and to Escherichia coli
FT                   O6 hypothetical protein YhdA SWALL:AAN82448 (EMBL:AE016767)
FT                   (646 aa) fasta scores: E(): 1.8e-137, 52.85% id in 649 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73186"
FT                   /db_xref="GOA:Q6DAI7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI7"
FT                   /protein_id="CAG73186.1"
FT                   /translation="MGFTTRFSILIVLLTLLAIFLMFFSSIFSLCYYSQLRTEQQLREV
FT                   TASIDQALLVQSPENIQYWLPGMMKTAGIVALEIQDNDSPLYSIQLPEAGWERTHLYHE
FT                   VEFPLMHHTNMEIALKYVDPLIGLPRFVVSTLSVLLAAGLMLLMLYFSIRWLRHQAAGQ
FT                   EELEKRAQRILKGERESVMQGSVREWPVNTSGALDQLLSDLVEAREERGRVDTLIRAFA
FT                   AQDAETGLSNRLFFDNQLTTQLEDGEEVGTHGIVMMIRVPDFETLQETHGYSNVLQEYR
FT                   FTLVNLLSTFVMRYPSALLARYFSSDFTVLLPHRTLKEANAIATQLVKAIDILPACPLI
FT                   DREEVLHIGICAYRGGQSAEQVMESVEDATRNAVLQGGNSWCVFDRQVPDKSRGSVKWR
FT                   TLLEQTLARGGPRLYQKPAVTKEGVVHHREMMSRIYDGEQELLAAEYMPLVQQLGLATS
FT                   YDRQLVARIVDLSANWPGETLGLPVSVDSLLQKPFLRWLKEILLQCPKTQRQCILFELA
FT                   EADVCQYIGRLRPVLNLILGLGCRLAVTQAGLTLVSTTYIKSLPVEIIKLHPGLVRSLE
FT                   RRPENQLFVQSLTEACKGTQTRVFAAGVRTKEEWRMLLGKGVYGGQGDFFATSVLVTDE
FT                   LKKYSPQHRV"
FT   misc_feature    311016..311117
FT                   /note="Signal peptide predicted for ECA0266 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.595 between residues 34 and 35"
FT   misc_feature    order(311043..311111,311406..311474)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0266 by TMHMM2.0 at aa 10-32 and 131-153"
FT   misc_feature    311667..312155
FT                   /note="HMMPfam hit to PF00990, DE GGDEF domain, score
FT                   6.2e-14"
FT   misc_feature    312195..312917
FT                   /note="HMMPfam hit to PF00563, DE EAL domain, score
FT                   2.1e-37"
FT   CDS_pept        313270..314313
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /gene_synonym="envB"
FT                   /gene_synonym="rodY"
FT                   /locus_tag="ECA0267"
FT                   /product="rod shape-determining protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Salmonella typhimurium, Salmonella typhi, and Shigella
FT                   flexneri rod shape-determining protein MreB or EnvB or RodY
FT                   or b3251 or c4006 or stm3374 or sty3554 or t3289 or sf3289
FT                   SWALL:MREB_ECOLI (SWALL:P13519) (347 aa) fasta scores: E():
FT                   1.7e-117, 97.11% id in 347 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73187"
FT                   /db_xref="GOA:Q6DAI6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI6"
FT                   /protein_id="CAG73187.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIILNEPSVVAIRQDR
FT                   AGSQKSVAAVGHDAKQMLGRTPGNIVAIRPMKDGVIADFQVTEKMLQHFIKQVHSDSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESALGAGAREVFLIEEPMAAAIGAGMPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEI
FT                   GSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMAALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   CDS_pept        314487..315470
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="ECA0268"
FT                   /product="rod shape-determining protein"
FT                   /note="Similar to Escherichia coli rod shape-determining
FT                   protein MreC or b3250 SWALL:MREC_ECOLI (SWALL:P16926) (367
FT                   aa) fasta scores: E(): 5e-93, 79.38% id in 325 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73188"
FT                   /db_xref="GOA:Q6DAI5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI5"
FT                   /protein_id="CAG73188.1"
FT                   /translation="MKPLFSRGPSLQLRLFLAVVTAIVVIVADSRLGSFVKIRTYMDTT
FT                   VSPFYFLANGPRQALDNMSASLATREQLGLENTALRQELLMKNSDLLLLGQLKQENARL
FT                   RELLGSPLRQDEQKMVTQVMSAGTDPYSDQVVIDKGQANGVYEGQPVISDKGVVGQVVA
FT                   VGQFTSRVLLICDVSHALPIQVLRNDIRVIAAGNGCTDDLQLEHLPNNTDIRVGDVLVT
FT                   SGLGGRFPEGYPVGVVSSVKADTQRAYTIIQARPTAGLQRLRYLLLLWGVENNANTSLP
FT                   PAEVHRVANERLMQMMPQVLPSPDEMGPPLPPDVATPAVEPQRGRQ"
FT   misc_feature    314523..314591
FT                   /note="1 probable transmembrane helix predicted for ECA0268
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        315467..315955
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="ECA0269"
FT                   /product="rod shape-determining protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 rod shape-determining protein
FT                   MreD or b3249 or c4003 or z4607 or ecs4121 SWALL:MRED_ECOLI
FT                   (SWALL:P16927) (162 aa) fasta scores: E(): 9.2e-51, 74.69%
FT                   id in 162 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73189"
FT                   /db_xref="GOA:Q6DAI4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI4"
FT                   /protein_id="CAG73189.1"
FT                   /translation="MNRYRRHGNWIIWLSFLIAMVLQIMPWPDEIYMFRPSWLTLFLIY
FT                   WVMALPHRVNVGTGFVLGLIMDLILGSTLGVRALALSIVAYLVAFKFQLFRNMALWQQA
FT                   LIVMLLSLLMDLTVFWAEFLVINVSFRPETFWNSVVDGVLWPWLFLLMRKIRRQFTVQ"
FT   misc_feature    order(315485..315544,315587..315655,315668..315736,
FT                   315779..315847)
FT                   /note="4 probable transmembrane helices predicted for
FT                   ECA0269 by TMHMM2.0 at aa 7-26, 41-63, 68-90 and 105-127"
FT   CDS_pept        315964..316557
FT                   /transl_table=11
FT                   /locus_tag="ECA0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis maF-like protein ypo3668
FT                   SWALL:Y0G8_YERPE (SWALL:P58636) (197 aa) fasta scores: E():
FT                   1.1e-50, 71.42% id in 196 aa, and to Escherichia coli
FT                   O157:H7 maF-like protein YhdE SWALL:YHDE_ECO57
FT                   (SWALL:P58629) (197 aa) fasta scores: E(): 2.4e-48, 68.87%
FT                   id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73190"
FT                   /db_xref="GOA:Q6DAI3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAI3"
FT                   /protein_id="CAG73190.1"
FT                   /translation="MTQLYLASASPRRRELLTQLDIPFSVLNVAVKEQRLPEEAAEVYV
FT                   RRLAHEKATAGVAAAPSDLPVLGADTIVVLNGQVLEKPQDETHAAEMLGQLSGKQHQVM
FT                   TAVALADKDDILSCLVITDVVFRPLSQQDIERYIASGEPMDKAGAYGIQGKGGCFVRSL
FT                   NGSYYAVVGLPLVETDELFSNFAALRSARGKHDC"
FT   misc_feature    315967..316539
FT                   /note="HMMPfam hit to PF02545, DE Maf-like protein, score
FT                   3.1e-77"
FT   CDS_pept        316547..318016
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /gene_synonym="rng"
FT                   /locus_tag="ECA0271"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   ribonuclease G CafA or Rng or b3247 or c4001 or z4605 or
FT                   ecs4119 or sf3285 SWALL:RNG_ECOLI (SWALL:P25537) (488 aa)
FT                   fasta scores: E(): 4.9e-168, 90.36% id in 488 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73191"
FT                   /db_xref="GOA:Q6DAI2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI2"
FT                   /protein_id="CAG73191.1"
FT                   /translation="MTAELLVNVTPSETRVAYIDGGILQEIHIERDAKRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEVERDRLKKTVADYCD
FT                   DDGGFIIRTAAEGIGEEELSQDAAFLKRLWGKVMERKKRNQSKCKLYGEVALAQRILRD
FT                   FAGAALDRIRIDSRLTYEALLEFTSEYIPEMTRKLEHYAGKQPIFDLFDVENEIQRSLD
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLDETIFNTNTEATQAIARQLRLRNL
FT                   GGIIIIDFIDMNNEEHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESIEH
FT                   VLCHECPTCHGRGTVKTVESVCYEIMREIVRVHHAYDTDRFLVYASPAVGEALRSEESH
FT                   ALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
FT   misc_feature    316649..316912
FT                   /note="HMMPfam hit to PF00575, DE S1 RNA binding domain,
FT                   score 3.5e-19"
FT   CDS_pept        318058..321888
FT                   /transl_table=11
FT                   /locus_tag="ECA0272"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo3670 SWALL:Q8ZAW2 (EMBL:AJ414158) (1307 aa) fasta
FT                   scores: E(): 0, 56.76% id in 1300 aa, and to Escherichia
FT                   coli O6 hypothetical protein YhdP SWALL:AAN82440
FT                   (EMBL:AE016767) (1266 aa) fasta scores: E(): 2e-213, 54.68%
FT                   id in 1282 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73192"
FT                   /db_xref="GOA:Q6DAI1"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI1"
FT                   /protein_id="CAG73192.1"
FT                   /translation="MRRLPGILVITGATLVVMVALLVSGLRLVLPQLDHFRPQLVAWAQ
FT                   SAAGVPLEIGSMTGRWESFGPTLEIEKFRTSLPESDWQVDRITLALDVWQSLLHGRWQF
FT                   RDLTFHQLKLDLNSQFTGQQQDSKLMESGKVSDLFLRQFDHFDLRDSQITFLTPSGSRA
FT                   ELSIPQLTWLNSDKRHRAEGLISLSSFNGQHGVVQMRMDLRDEQGLLGNGTFYLQADNI
FT                   DMKPWLSRWMKNNTGLESADFSLAAWLNVRDGGIHSGDVRLNQGTASWGEGSDAHRLNV
FT                   DDMTLHVSRQENGWQVDVPTLNLATDGVAWPKGRLSALWLPKNEHMLGPDRQEELRIRA
FT                   SNLALERVSTLLPLLSGTTPALKARWDELQPMGTLNSVAVDIPLQQPERSRFHANWQDV
FT                   SWKQWKLLPGVDHFSGSARGSVERGQVSVALKQSTLPYVDMFRAPLEIKQASGTIDWRN
FT                   DAQGLSLWSHGLDVQAKSLWANGDFRYEQPVKQEPKLDILAGIRLTDAADAWRYYPELF
FT                   MGTDLVDYLSGALKGGRVDNATLIFAGNPQHFPYTHSEGQFEVWVPVKDATFEFQPGWP
FT                   ALTPLDINLDFANNGLWMFAPQIWLGKVEGKNISAVIPDYEKEMLLIDGELDGPGPEVG
FT                   NYFHQTPLKSSLGTALDELKIGGPVKGTLHLDIPLVGDDVRASGDIALNNNSLYIKPLD
FT                   TTINNLTGKFRYENGNLRSETLQANWLNQPMAVNFTTEEQAKAFLVNVGLQGDWQPALL
FT                   PGLPASASKALSGAANWKSTVAVNLPHSGKTTYDVDVQADLNKVSSHLPNPLNKPAGEN
FT                   MPLEVKASGDLNGFTMQGRVGKDNRFNSQWLLKGDTVTLARASWQNAAATAPALPEDSA
FT                   LVLDLPPLDAESWLGLLPSLRASTSSEGKKAHSSLRFPEAVTLRTPELQLLGQQWHDLE
FT                   ITRKNTLGGSEVQAKGREIDGKVEIPNRGMWRSDINYLYYNPQWKGNEATNPVALAEKK
FT                   SPLNDPSISFEDWPSLAVNCRQCWIIGQNMGRIQGTMLPEKEKLTLTDGIIDTGKARLT
FT                   VNGSWQENAEGVRTALKGRLTGDSLEQNANWFGVDSPLKAGSFDVDYDLYWRGTPWAPD
FT                   IASLSGILHTRIGKGEIAEVGAGQAGQLLRLLSFDALMRKLRFDFSDTFGRGFYFDSIS
FT                   STAWIKDGVLHTDDMLIDGLEADIAMKGDLDLAKRQVNMEAVIAPEISATVGVATAFAV
FT                   NPVVGAAVFAASKVLAPLWNKISLIRYQISGSLDQPKIQEVLREPNKKKGE"
FT   misc_feature    318058..318144
FT                   /note="Signal peptide predicted for ECA0272 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.905) with cleavage site
FT                   probability 0.442 between residues 29 and 30"
FT   CDS_pept        321945..323390
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="ECA0273"
FT                   /product="putative modulator of DNA gyrase"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Shigella flexneri TldD protein or b3244 or c3999 or
FT                   sf3283 SWALL:TLDD_ECOLI (SWALL:P46473) (481 aa) fasta
FT                   scores: E(): 9.6e-150, 82.53% id in 481 aa, and to
FT                   Salmonella typhimurium, and Salmonella typhi suppresses
FT                   inhibitory activity of csra tldd or stm3368 or sty3548
FT                   SWALL:Q8XFQ3 (EMBL:AE008855) (481 aa) fasta scores: E():
FT                   5.5e-150, 82.74% id in 481 aa. Also similar to ECA1268
FT                   (55.297% id. in 472 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73193"
FT                   /db_xref="GOA:Q6DAI0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAI0"
FT                   /protein_id="CAG73193.1"
FT                   /translation="MSLSFVSEQLLTANKLNLDDLAAVLGSLNERRLDYADLYFQSSYH
FT                   ESWVLEDRIIKDGSYNIDQGVGIRAIDGEKTGFAYADQITLNALHQSAQAARSIVREQG
FT                   TGKARTLGAVSHRALYPTLNPLDSLTREDKIALLQRADTVARAADTRVQEVSASLTGVY
FT                   ELVLVAATDGTLAADVRPLVRLSISVLVEEEGKRERGGSGGGTRGGYEYFWEVTDGEPR
FT                   VDAWAKEAVRMALVNLSAVAAPAGPMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF
FT                   SGQMGKLVASELCTVVDDGTLTGRRGSLSMDDEGVPGQYNILIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIISSVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEKGRITTPVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLESLTVGGTA"
FT   misc_feature    322044..322940
FT                   /note="HMMPfam hit to PF01523, DE Putative modulator of DNA
FT                   gyrase, score 4.4e-108"
FT   CDS_pept        complement(323494..324087)
FT                   /transl_table=11
FT                   /locus_tag="ECA0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xanthomonas campestris hypothetical
FT                   protein Xcc1623 SWALL:Q8PA66 (EMBL:AE012263) (199 aa) fasta
FT                   scores: E(): 1.7e-15, 38.65% id in 194 aa. No other
FT                   significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73194"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH9"
FT                   /protein_id="CAG73194.1"
FT                   /translation="MKIFKVGDTQAALCNTCQSYETATFQLKDVPLSDNSGVVRQVLVG
FT                   VCDRCGNVAIIPHQSTPMIKKALDVQRKALESRVPAHMIDILNLASCELGGEPDFIPTL
FT                   MKYYLHTLAADHAAAKDIPRFLQSDLAKGKSEKRLSLKGRHVATDIDVLKTTTNISSTT
FT                   DLLKGIVLKIKEDVLVQRDEIHIKQLKSIIAAVS"
FT   CDS_pept        complement(324097..324435)
FT                   /transl_table=11
FT                   /locus_tag="ECA0275"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH8"
FT                   /protein_id="CAG73195.1"
FT                   /translation="MDNVRINSYNTGEGMGFKNAKKQLIVCLQSGNVLHEARGNISTKN
FT                   LLAIGQISITELIDIIYKSTGTSYSSSPHHFAAHVDVHIIRCRYRGVPWYIKWYFTEPD
FT                   CVFISVHH"
FT   CDS_pept        complement(324544..325479)
FT                   /transl_table=11
FT                   /gene="tdrA"
FT                   /locus_tag="ECA0276"
FT                   /product="putative temperature-dependent LysR-family
FT                   regulator A"
FT                   /note="Similar to Serratia marcescens putative
FT                   temperature-dependent regulator A TdrA SWALL:Q8VUI0
FT                   (EMBL:AB077386) (303 aa) fasta scores: E(): 1.9e-100, 82.5%
FT                   id in 303 aa, and to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hypothetical transcriptional
FT                   regulator yhcs or b3243 or c3998 or z4602 or ecs4116
FT                   SWALL:YHCS_ECOLI (SWALL:P45691) (309 aa) fasta scores: E():
FT                   2.1e-97, 80.06% id in 311 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73196"
FT                   /db_xref="GOA:Q6DAH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH7"
FT                   /protein_id="CAG73196.1"
FT                   /translation="MERLKSMSVFARVVECGSFTAAARQLQMSVSAVSQTVSKLEDELQ
FT                   IKLLNRSTRSIGLTEAGKIYYHGCRRMLHEAHEVHEQLYAFNNTPIGTLRIGSSSTMAQ
FT                   NVLSTMTAAMLKEYPGLSVNLVTGIPAPDLIADGLDIVIRVGALQDSTLFSKRLGSMPM
FT                   VVCAAKSYLAQHGTPDKPADMVNFSWLEYSVRPDSEFELIAPEGISTRVTPQGRFVTND
FT                   PQTLVRWLKIGAGIAYIPLMWIVDEINRGEIEILFNRYHSDPRPVYALYTRKDNLPLKV
FT                   QVCINYMTEYFKNVALTYQGYRQDHGEDKK"
FT   misc_feature    complement(324601..325221)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.4e-40"
FT   misc_feature    complement(325291..325470)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5.9e-24"
FT   misc_feature    complement(325336..325428)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(325366..325431)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1487.000, SD 4.25 at aa 17-38, sequence
FT                   GSFTAAARQLQMSVSAVSQTVS"
FT   CDS_pept        326099..326302
FT                   /transl_table=11
FT                   /locus_tag="ECA0277"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Serratia marcescens hypothetical 7.8 kDa
FT                   protein yhcR SWALL:Q8RQS4 (EMBL:AB080601) (67 aa) fasta
FT                   scores: E(): 3.5e-20, 80.64% id in 62 aa, and to Yersinia
FT                   pestis putative membrane protein ypo3684 or y0179
FT                   SWALL:Q8ZAV0 (EMBL:AJ414158) (67 aa) fasta scores: E():
FT                   5.7e-20, 76.56% id in 64 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73197"
FT                   /db_xref="GOA:Q6DAH6"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAH6"
FT                   /protein_id="CAG73197.1"
FT                   /translation="MSSLPVMVLFGLSFPPVFFVLMVSLTLFFVVNRLLQPTGIYDFVW
FT                   HPALFNSALFCCLFYLLFRYGL"
FT   misc_feature    order(326117..326185,326228..326287)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0277 by TMHMM2.0 at aa 7-29 and 44-63"
FT   CDS_pept        326310..327275
FT                   /transl_table=11
FT                   /locus_tag="ECA0278"
FT                   /product="putative HlyD family secretion protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi putative membrane located multidrug resistance
FT                   protein YhcQ SWALL:Q8XF83 (EMBL:AE008855) (310 aa) fasta
FT                   scores: E(): 2.7e-81, 70.35% id in 307 aa, and to Yersinia
FT                   pestis putative HlyD family secretion protein ypo3685
FT                   SWALL:Q8ZAU9 (EMBL:AJ414158) (311 aa) fasta scores: E():
FT                   1.8e-80, 69.35% id in 310 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73198"
FT                   /db_xref="GOA:Q6DAH5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAH5"
FT                   /protein_id="CAG73198.1"
FT                   /translation="MKSFFLTLFRQQAALTKKLSRVVITLVIVLCAIVAIFRVWAFYTE
FT                   SPWTRDAKFTADVVAIAPDVSGLLTDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAEAD
FT                   VAYYQALVTEKRRESGRRARLGVSAMSQENIDQSNNALETATHQLAKAQAVMSLAKLEL
FT                   DRTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRRGYRA
FT                   EITPLGSEKIFYGTVDSVAAGINNSSNSANTKGLANVDSNLEWVRLAQRVPVKIRLDRQ
FT                   MGDLYPAGTTATVVVTGEQVNNDKKPSPLIRLLYRLREFG"
FT   misc_feature    326310..326432
FT                   /note="Signal peptide predicted for ECA0278 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.869) with cleavage site
FT                   probability 0.694 between residues 41 and 42"
FT   misc_feature    326367..326435
FT                   /note="1 probable transmembrane helix predicted for ECA0278
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    326478..327197
FT                   /note="HMMPfam hit to emacsPF00529, DE HlyD family
FT                   secretion protein, score 1.2e-22"
FT   CDS_pept        327287..329275
FT                   /transl_table=11
FT                   /locus_tag="ECA0279"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo3686 WALL:Q8ZAU8 (EMBL:AJ414158) (651 aa) fasta scores:
FT                   E(): 1.3e-179, 70.1% id in 649 aa, and to Escherichia coli
FT                   hypothetical protein YhcP SWALL:YHCP_ECOLI (SWALL:P46481)
FT                   (655 aa) fasta scores: E(): 1.7e-167, 65.37% id in 644 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73199"
FT                   /db_xref="GOA:Q6DAH4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAH4"
FT                   /protein_id="CAG73199.1"
FT                   /translation="MKTSSLTGSLFFTTPKFARLRFAFKLSFAIVLSLFLGFHLQLETP
FT                   RWSVLTAAIVAAGPAFAAGGEPFSGAIRHRGMLRIIGTFIGCIGALVIIIATVRAPVVM
FT                   LMLCCIWAGLCTWVSSLVKVENAYIFGLAGYTALIIIVSTQGTPLLTPQFAVERCSEIV
FT                   LGIVCAILADLLFSPRSIKQDVDRSIGELLVDQYRLLQLSMSGTEKEAIDAAWHALVRK
FT                   TTALSGMRSSLMLESSRWQNSNRRLTSLHTQSLMMITQACETYLILQDVPTPVKSSLKM
FT                   VLDQPVESLRDVHCRVKALRHLIAADSRDVPPTLIDWVGAATRYLLLAKGVQANGRLNT
FT                   IEADVLNSDVEIKAPSAETHHAMINGLRTGVATALGCLFWLSTGWTSGSVCMVMIAVVT
FT                   SLAMRLPNPQMMAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGGMAFFLGLE
FT                   VQKRRLGSLGALASTINILVLDNPMTFNVSQFLDSAIGQIIGCFLALMVIMLIRDNTKA
FT                   HTGRTLLNRFVYGAVSALTTNRARRKENHLPALYQQLFLLLNRFPDDIAKYRLALWLII
FT                   MHQRLRTLDIPQNAALSAFHRQIRATAEQVISARRDATRSRYFAQLLDELERYQQMLTE
FT                   QQLPPSVTAPVGRLTGILRDYQHALSN"
FT   misc_feature    327287..327472
FT                   /note="Signal peptide predicted for ECA0279 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.985 between residues 62 and 63"
FT   misc_feature    order(327344..327412,327425..327493,327512..327580,
FT                   327590..327649,327668..327736,328424..328492,
FT                   328529..328588,328598..328657,328676..328723,
FT                   328766..328819)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0279 by TMHMM2.0 at aa 20-42, 47-69, 76-98, 102-121,
FT                   128-150, 380-402, 415-434, 438-457, 464-479 and 494-511"
FT   CDS_pept        329415..330869
FT                   /transl_table=11
FT                   /locus_tag="ECA0280"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Escherichia coli succinate-semialdehyde
FT                   dehydrogenase [NADP+] GabD or b2661 SWALL:GABD_ECOLI
FT                   (SWALL:P25526) (482 aa) fasta scores: E(): 8.3e-102, 55.41%
FT                   id in 480 aa, and to Photorhabdus luminescens Orf17
FT                   SWALL:AAO17183 (EMBL:AF346500) (490 aa) fasta scores: E():
FT                   6e-104, 57.74% id in 478 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73200"
FT                   /db_xref="GOA:Q6DAH3"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH3"
FT                   /protein_id="CAG73200.1"
FT                   /translation="MSGNHLQDHELFKTGYFVAGKWQQGAATFEVVNPATGESIARVAK
FT                   AGKKETQAAIDAAHAAFPAWKRKTAKERSEILYRWYELILENKRYLAELMTAEQGKPVQ
FT                   EAEGEVVYAANFIQWFAEQGKRVNGEIIPPAKPGSKIYATREPVGVVVAITPWNFPLAM
FT                   LTRKLGPALAAGCTGVIKPANNTPLSAFALLALAQQAGVPDGVLNGVAGDTQAISDTVM
FT                   ASDKVRKISFTGSTAVGKTLVRNAADTMKKVSMELGGNAPYIVFDDADIQAAVKGAIAN
FT                   RFRNAGQVCVSANRFYIQDGVYDEFVSLLAEEVKKLKVGNGMDDGVVLGPLIDEAAVEK
FT                   VEKHVNDAVEKGGKALVGGKRHKLGHSFFEPTVIVDANEAMLLAQEETFGPVAPCFRFK
FT                   TEEEVIQRANNTPFGLAAYFYSQNLQRVFRVAEALESGMIGINECAVSTELAPFGGVKE
FT                   SGLGREGSVLGLDEFLEVKTWHVGGL"
FT   misc_feature    329475..330863
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 2.8e-192"
FT   misc_feature    330114..330137
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    330177..330200
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        complement(330968..331519)
FT                   /transl_table=11
FT                   /locus_tag="ECA0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   Ypo3691 SWALL:Q8ZAU5 (EMBL:AJ414158) (182 aa) fasta scores:
FT                   E(): 5.9e-48, 80.55% id in 180 aa, and to Escherichia coli,
FT                   and Escherichia coli O157:H7 hypothetical protein Yjga
FT                   SWALL:YJGA_ECOLI (SWALL:P26650) (183 aa) fasta scores: E():
FT                   6.6e-46, 77.77% id in 180 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73201"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAH2"
FT                   /protein_id="CAG73201.1"
FT                   /translation="MKQKPEDWLNDVPDNQEDDEDDEIIWVSKSEIKRDAEALKDLGAE
FT                   LVDLGKNALEKIPLDDDLRAAVELAQRITREGRRRQLQLIGKLLRARDPEPIQIALDKL
FT                   NNRHNQQVALFHKLEQLRDRLITEGDDVIPEILALYSHADRQQLRSLVRNAQKEKAANK
FT                   PPKAARQIFQYLRELAETTN"
FT   CDS_pept        331816..333156
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /gene_synonym="tldE"
FT                   /locus_tag="ECA0282"
FT                   /product="putative modulator of DNA gyrase"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 PmbA protein PmbA or TldE or b4235 or z5845 or
FT                   ecs5212 SWALL:PMBA_ECOLI (SWALL:P24231) (450 aa) fasta
FT                   scores: E(): 3.2e-146, 84.3% id in 446 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73202"
FT                   /db_xref="GOA:Q6DAH1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH1"
FT                   /protein_id="CAG73202.1"
FT                   /translation="MTITTQVAEQRKALELAVAQALELASAGSDAAEVAVSKTTGISVS
FT                   TRYGDVENVEFNSDGALGITVYHQQRKGSASSTDLSPDAIARTVQAALDIARYTSVDPF
FT                   AGPADRDLLAFDAPDLDLFHPTELDADRGIELAARAEQAALQADKRITNTEGGSFNSHY
FT                   GVKVFGNSHGLLKSYCSSRHSMSSCVIAEVNGNMERDYAYTIGRALEDLRSPEWVGEEC
FT                   ARRTLSRLSPRKLPTMQAPVMFSAEVATGLFGHLVGAISGGSVYRKSTFLLDKLGQQIL
FT                   PEWLTIEEHPHLLKGLASTPFDSEGVRTQARDIVKAGVLQTWLMTSYSARKLGMQSTGH
FT                   AGGIHNWRIAGQGLDFNGMLKQMGKGLLVTELMGQGVSGVTGDYSRGASGFWVENGEIQ
FT                   YPVSEITIAGNLKDMLRNIVTVGNDIETRSNIQCGSVLLPEMKIAGE"
FT   misc_feature    331903..332784
FT                   /note="HMMPfam hit to PF01523, DE Putative modulator of DNA
FT                   gyrase, score 7e-93"
FT   misc_feature    332374..332418
FT                   /note="PS00310 Lysosome-associated membrane glycoproteins
FT                   duplicated domain signature."
FT   CDS_pept        complement(333228..333638)
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECA0283"
FT                   /product="putative regulator of nucleoside diphosphate
FT                   kinase"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri regulator
FT                   of nucleoside diphosphate kinase Rnk or b0610 or c0698 or
FT                   z0754 or ecs0649 or sf0528 SWALL:RNK_ECOLI (SWALL:P40679)
FT                   (136 aa) fasta scores: E(): 1.4e-27, 60.44% id in 134 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73203"
FT                   /db_xref="GOA:Q6DAH0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAH0"
FT                   /protein_id="CAG73203.1"
FT                   /translation="MTKPNLTISELDAERLDKLLEQPAFADSDIAQALNDELDRAEILP
FT                   SASIPSHVVTMNSRVRFRDLNTNEEHIRTLVYPAAVKDSKEPLSVMAPLGAALLGMHVG
FT                   SAITWQLPNGEETRIEVLELLYQPEAAGEYHR"
FT   CDS_pept        complement(333803..334075)
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /gene_synonym="npr"
FT                   /gene_synonym="rpoR"
FT                   /locus_tag="ECA0284"
FT                   /product="phosphocarrier protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   phosphocarrier protein PtsO or Npr or RpoR or b3206 or
FT                   c3966 or z4569 or ecs4085 or sf3246 SWALL:PTSO_ECOLI
FT                   (SWALL:P33996) (90 aa) fasta scores: E(): 5.4e-26, 83.33%
FT                   id in 90 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73204"
FT                   /db_xref="GOA:Q6DAG9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG9"
FT                   /protein_id="CAG73204.1"
FT                   /translation="MTVRQTVEIKNKLGMHARPAMKLFELVQSFDAEVILRNDSGTEAE
FT                   ASSVIAMLMLDSAKGRLIEVEATGQDEEQALAAVIGLFEAGFDED"
FT   misc_feature    complement(333818..334072)
FT                   /note="HMMPfam hit to PF00381, DE PTS HPr component
FT                   phosphorylation site, score 1.2e-31"
FT   misc_feature    complement(334013..334036)
FT                   /note="PS00369 PTS HPR component histidine phosphorylation
FT                   site signature."
FT   CDS_pept        complement(334107..334964)
FT                   /transl_table=11
FT                   /locus_tag="ECA0285"
FT                   /product="putative P-loop ATPase family protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3586SWALL:AAM83752 (EMBL:AJ414157) (284 aa) fasta
FT                   scores: E(): 2.9e-105, 96.46% id in 283 aa, and to
FT                   Escherichia coli, Escherichia coli O6, Escherichia coli
FT                   O157:H7, and Shigella flexneri hypothetical protein Yhbj
FT                   SWALL:YHBJ_ECOLI (SWALL:P33995) (284 aa) fasta scores: E():
FT                   9.3e-105, 95.42% id in 284 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73205"
FT                   /db_xref="GOA:Q6DAG8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAG8"
FT                   /protein_id="CAG73205.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELANTLA
FT                   ARNISAAVSIDVRNMPESPEIFEHAMEQLPPSFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVASFLDRHTEVHNFIYQT
FT                   RSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RKPS"
FT   misc_feature    complement(334119..334964)
FT                   /note="HMMPfam hit to PF03668, DE P-loop ATPase protein
FT                   family, score 2.2e-211"
FT   misc_feature    complement(334920..334943)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(335126..335599)
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /gene_synonym="rpoP"
FT                   /locus_tag="ECA0286"
FT                   /product="putative nitrogen regulatory protein"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   nitrogen regulatory IIA protein PtsN or RpoP
FT                   SWALL:PTSN_ECOLI (SWALL:P31222) (163 aa) fasta scores: E():
FT                   1.3e-46, 80.12% id in 156 aa, and to Yersinia pestis
FT                   phosphotransferase system enzyme IIA PtsN SWALL:AAM83751
FT                   (EMBL:AE013615) (164 aa) fasta scores: E(): 6.1e-48, 81.01%
FT                   id in 158 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73206"
FT                   /db_xref="GOA:Q6DAG7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG7"
FT                   /protein_id="CAG73206.1"
FT                   /translation="MSHDSVLQLSTVLRPECTRSTVHCQSKKRALEIISELAAKQLNIP
FT                   SQIIFDAILTRERMGSTGIGGGIAIPHGKLEDDNALGAIGVFIQLEQPIAFDAIDNQAV
FT                   DLLFALLVPAEQCKTHLHTLSLVAKRLADKTVCRRLRAAQSDEELYQIMTEAD"
FT   misc_feature    complement(335132..335569)
FT                   /note="HMMPfam hit to PF00359, DE
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 3.6e-50"
FT   misc_feature    complement(335381..335431)
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT   CDS_pept        complement(335696..335983)
FT                   /transl_table=11
FT                   /locus_tag="ECA0287"
FT                   /product="putative sigma(54) modulation protein"
FT                   /note="Similar to Klebsiella pneumoniae probable sigma(54)
FT                   modulation protein SWALL:RP5M_KLEPN (SWALL:P17161) (95 aa)
FT                   fasta scores: E(): 7e-26, 76.84% id in 95 aa, and to
FT                   Escherichia coli, Escherichia coli O6, Escherichia coli
FT                   O157:H7, and Shigella flexneri probable sigma (54)
FT                   modulation protein Yhbh SWALL:RP5M_ECOLI (SWALL:P31221) (95
FT                   aa) fasta scores: E(): 2.4e-25, 77.89% id in 95 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73207"
FT                   /db_xref="GOA:Q6DAG6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG6"
FT                   /protein_id="CAG73207.1"
FT                   /translation="MQLNITGHHIEITEPLRDFVNGKFAKLEQYFDRINQVNVVLRVEK
FT                   VQQIAEATLHVNGGELHATSEAEDMYAAIDLLIDKLARQLNKHKDKLKQH"
FT   misc_feature    complement(335702..335980)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02482, DE Sigma 54 modulation
FT                   protein / S30EA ribosomal protein, score 1.2e-51"
FT   CDS_pept        complement(336007..337440)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="ECA0288"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="Similar to Escherichia coli RNA polymerase sigma-54
FT                   factor RpoN or GlnF or NtrA or b3202 SWALL:RP54_ECOLI
FT                   (SWALL:P24255) (477 aa) fasta scores: E(): 1.9e-147, 83.22%
FT                   id in 477 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73208"
FT                   /db_xref="GOA:Q6DAG5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG5"
FT                   /protein_id="CAG73208.1"
FT                   /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESNP
FT                   LLEQTDQHDEIESFEKADSDSLDTGEALEQRDMPEELPLDATWDEIYSAGTPSGTGSDY
FT                   RDEELPIYQGETTQTLQDYLMWQVELTPFSDTDAAIATSIVDAVDNTGYLTVPLGDILD
FT                   SIGDDDVTLEEVEAVLKRVQRFDPVGVAARDLRDCLLVQLSQFDDSTPRLAEARLIVSD
FT                   HLDLLANHDFRSLIRVTRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDVLVRKV
FT                   QGIWAVELNTDSVPRLQINQQYAALGNSVRNDSDGQFIRSNLQEARWLIKSLESRNDTL
FT                   LKVTRCIVEQQKDFFDQGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHSPRGIFEL
FT                   KYFFSSHVNTDSGGEASSTAIRALVKKLIAAENPVKPLSDSKLTALLSDQGIIVARRTV
FT                   AKYRESLSIPPSNQRKQLI"
FT   misc_feature    complement(336016..337428)
FT                   /note="HMMPfam hit to PF00309, DE Sigma-54 factor,
FT                   Activator interacting domain (AID), score 7.4e-252"
FT   misc_feature    complement(336055..336078)
FT                   /note="PS00718 Sigma-54 factors family signature 2."
FT   misc_feature    complement(336283..336348)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1825.000, SD 5.40 at aa 361-382, sequence
FT                   MVLADIAQAVDMHESTISRVTT"
FT   misc_feature    complement(336292..336351)
FT                   /note="PS00717 Sigma-54 factors family signature 1."
FT   misc_feature    complement(337306..337425)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   CDS_pept        complement(337490..338215)
FT                   /transl_table=11
FT                   /locus_tag="ECA0289"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri probable
FT                   ABC transporter ATP-binding protein YhbG SWALL:AAN44707
FT                   (EMBL:D12938) (241 aa) fasta scores: E(): 2.5e-76, 90.87%
FT                   id in 241 aa, and to Salmonella typhimurium, and Salmonella
FT                   typhi putative ABC superfamily Yhbg SWALL:Q8XFR6
FT                   (EMBL:AE008852) (241 aa) fasta scores: E(): 1.1e-75, 90.04%
FT                   id in 241 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73209"
FT                   /db_xref="GOA:Q6DAG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG4"
FT                   /protein_id="CAG73209.1"
FT                   /translation="MATLTAENLAKAYKGRKVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDEGRIVIDDDDISLLPLHERALRGIGYLPQEASIFRRLSVYDNLMAVLQ
FT                   IRKDLTTEQQEDRANELMEEFHIIHLRDSLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVLDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGNLIAHGSPT
FT                   EILADEQVKRVYLGEGFRL"
FT   misc_feature    complement(337577..338131)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.9e-61"
FT   misc_feature    complement(337760..337804)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(338087..338110)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(338219..338791)
FT                   /transl_table=11
FT                   /locus_tag="ECA0290"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri protein
FT                   Yhbn precursor SWALL:YHBN_ECOLI (SWALL:P38685) (185 aa)
FT                   fasta scores: E(): 3.8e-45, 72.67% id in 183 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73210"
FT                   /db_xref="GOA:Q6DAG3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG3"
FT                   /protein_id="CAG73210.1"
FT                   /translation="MKSKTNNLMRNTLIASSLFAVSISTFAVTGDSNQPIHIDSAQQSL
FT                   DMQGNTVTFTGNVVVKQGTIEVKADKVVVTRPQGGQGSEVVEGYGNPVTFYQMQDNGKP
FT                   VKGHAQKIRYELATDFLVLTGNAYLEQQDSNVKGDRITYLVKQQQMEATSDKGKRVTTV
FT                   LVPSQLQDKENKSQPSRSQQPQPRVTE"
FT   misc_feature    complement(338285..338746)
FT                   /note="HMMPfam hit to PF03968, DE OstA-like protein, score
FT                   7.2e-54"
FT   misc_feature    complement(338711..338791)
FT                   /note="Signal peptide predicted for ECA0290 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.621 between residues 27 and 28"
FT   CDS_pept        complement(338772..339338)
FT                   /transl_table=11
FT                   /locus_tag="ECA0291"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi putative inner membrane protein YrbK SWALL:Q8XGY6
FT                   (EMBL:AE008852) (191 aa) fasta scores: E(): 6e-45, 64.21%
FT                   id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73211"
FT                   /db_xref="GOA:Q6DAG2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG2"
FT                   /protein_id="CAG73211.1"
FT                   /translation="MSKTKRWLTAFLALLVLILIGWNIADDDTVVAPDANDPAVPVYTS
FT                   EKTNTQVYSPAGKLSYRLISEKAEYFNDEQLSWFTTPVATLFNEQGTATWSVRADRAKL
FT                   TKDKMLYLYGHVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSSGMK
FT                   MRGNLRNKTAELIEKVKTSYEIQNQ"
FT   misc_feature    complement(339264..339338)
FT                   /note="Signal peptide predicted for ECA0291 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.960) with cleavage site
FT                   probability 0.756 between residues 25 and 26"
FT   CDS_pept        complement(339335..339901)
FT                   /transl_table=11
FT                   /locus_tag="ECA0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3578 SWALL:Q8ZB47 (EMBL:AJ414157) (187 aa) fasta scores:
FT                   E(): 5.4e-54, 77.12% id in 188 aa, and to Escherichia coli,
FT                   and Escherichia coli O157:H7 hypothetical protein YrbI
FT                   SWALL:YRBI_ECOLI (SWALL:P45396) (188 aa) fasta scores: E():
FT                   8.5e-54, 74.46% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73212"
FT                   /db_xref="GOA:Q6DAG1"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG1"
FT                   /protein_id="CAG73212.1"
FT                   /translation="MSETRAQTDTCYGPVDQQVLDKAREVRLLICDVDGVMSDGLIYMG
FT                   NHGEELKAFNVRDGYGIRCLLTSGIEVAIITGRSAKLLEDRCKTLGINHLYQGQSDKVL
FT                   AFNDLLDKLSVTANQVAYIGDDMIDWPVMAQVGLSVAVTDAHPLLLPRADYVTRIAGGR
FT                   GAVRELCDLILFSQDKLEHAKGLSI"
FT   CDS_pept        complement(339921..340994)
FT                   /transl_table=11
FT                   /locus_tag="ECA0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3577 SWALL:Q8ZB48 (EMBL:AJ414157) (328 aa) fasta scores:
FT                   E(): 2e-101, 81.59% id in 326 aa, and to Escherichia coli
FT                   hypothetical protein Yrbh SWALL:YRBH_ECOLI (SWALL:P45395)
FT                   (328 aa) fasta scores: E(): 2e-95, 78.08% id in 324 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73213"
FT                   /db_xref="GOA:Q6DAG0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAG0"
FT                   /protein_id="CAG73213.1"
FT                   /translation="MSQFEQDAHLKQQSDRALSDHELQADHTRQKTHELPAHFDFQQAG
FT                   KQVLSIERDGLAQLDQYIDDNFTLACKNIFHCKGKVVVMGMGKSGHIGCKIAATFASTG
FT                   TPAFFVHPGEASHGDLGMVTPHDIVIAISNSGESHEILSLIPVLKRQKVFLICMTSAPE
FT                   STMGKAADIHLCVHVPQEACPLGLAPTTSTTATLVMGDALAVALLQARGFTAEDFALSH
FT                   PGGALGRKLLLRVSDIMHSGDEIPHVPHDASLRDALVEITRKNLGMTVICEADMKIQGI
FT                   FTDGDLRRIFDMNIDLNSARIADVMTAGGIRVAPQTLAVDALNLMQSRHITSVLVAEND
FT                   RLVGIVHMHDMLRAGVV"
FT   misc_feature    complement(339927..340085)
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score
FT                   6.3e-10"
FT   misc_feature    complement(340119..340280)
FT                   /note="HMMPfam hit to PF00571, DE CBS domain, score
FT                   3.1e-06"
FT   misc_feature    complement(340377..340781)
FT                   /note="HMMPfam hit to PF01380, DE SIS domain, score
FT                   6.7e-38"
FT   CDS_pept        complement(341009..341977)
FT                   /transl_table=11
FT                   /locus_tag="ECA0294"
FT                   /product="putative sodium/calcium exchanger protein"
FT                   /note="Similar to Yersinia pestis putative sodium/calcium
FT                   exchanger protein ypo3576 SWALL:Q8ZB49 (EMBL:AJ414157) (324
FT                   aa) fasta scores: E(): 1.8e-83, 71.69% id in 318 aa, and to
FT                   Escherichia coli hypothetical protein YrbG SWALL:YRBG_ECOLI
FT                   (SWALL:P45394) (325 aa) fasta scores: E(): 3.3e-71, 59.81%
FT                   id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73214"
FT                   /db_xref="GOA:Q6DAF9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF9"
FT                   /protein_id="CAG73214.1"
FT                   /translation="MLFATLLLFVGLLLLVYGADRLVYGAAVLARSLGLPPFVIGITIV
FT                   GFGTSLPELIVSVTAALNDQNDMAVGNVLGSNITNILLIIGCAALIRPLTVHSAILRRE
FT                   LPLMLSVTLLCGVLLHDSYLSRADGMMLLFAAILCLVLILRMAQQAQREGGDSLTREQL
FT                   AELPQDDSNQMVAVLWLILGMIILPMAARMVVDNATVIARYFDVSELTIGLTILAIGTS
FT                   LPELATAIVGTLKKEDDIALGNLIGSNIFNIAIVLGVPALLSPGALNPQIFQRDYWVML
FT                   AASVLLTALCLSKKRRIGQGAGALLCCAFIAYLTVLFRFSS"
FT   misc_feature    complement(341015..341425)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01699, DE Sodium/calcium exchanger
FT                   protein, score 8.7e-41"
FT   misc_feature    complement(order(341018..341077,341096..341149,
FT                   341177..341245,341282..341350,341393..341452,
FT                   341546..341599,341690..341758,341795..341863,
FT                   341906..341974))
FT                   /note="9 probable transmembrane helices predicted for
FT                   ECA0294 by TMHMM2.0 at aa 2-24, 39-61, 74-96, 127-144,
FT                   176-195, 210-232, 245-267, 277-294 and 301-320"
FT   misc_feature    complement(341525..341941)
FT                   /note="HMMPfam hit to PF01699, DE Sodium/calcium exchanger
FT                   protein, score 1.7e-44"
FT   misc_feature    complement(341924..341977)
FT                   /note="Signal peptide predicted for ECA0294 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.984) with cleavage site
FT                   probability 0.924 between residues 18 and 19"
FT   CDS_pept        342391..343203
FT                   /transl_table=11
FT                   /locus_tag="ECA0295"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hypothetical ABC transporter
FT                   ATP-binding protein YrbF SWALL:YRBF_ECOLI (SWALL:P45393)
FT                   (269 aa) fasta scores: E(): 2.1e-73, 77.69% id in 269 aa,
FT                   and to Yersinia pestis putative ABC transporter ATP-binding
FT                   protein ypo3575 SWALL:AAM83740 (EMBL:AJ414157) (272 aa)
FT                   fasta scores: E(): 7.8e-78, 85% id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73215"
FT                   /db_xref="GOA:Q6DAF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF8"
FT                   /protein_id="CAG73215.1"
FT                   /translation="MNHEATNLVEIRGLSFRRGEREIFTDITLNVPKGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLSPDSGEIWFDGENIPALSRSELYNARKKMSMLFQSGALFTDLNVFD
FT                   NVAWPLREHTQLPESLLRSIVMMKLEAVGLRGAAELMPAELSGGMARRAALARAIALDP
FT                   QLIMFDEPFVGQDPITLGTLVKLIDELNHALGVTCVVVSHDVPEVMSIADYAYIVADKR
FT                   VIAEGTADQLRANDDPQVRQFLDGIADGPVPFRFPAGDYKTSLLGSGG"
FT   misc_feature    342490..343053
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   7.5e-52"
FT   misc_feature    342511..342534
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    342823..342867
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        343211..343993
FT                   /transl_table=11
FT                   /locus_tag="ECA0296"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo3574 SWALL:Q8ZB51 (EMBL:AJ414157) (260 aa) fasta scores:
FT                   E(): 1.8e-88, 88.84% id in 260 aa, and to Escherichia coli,
FT                   Escherichia coli O6, Escherichia coli O157:H7, and Shigella
FT                   flexneri hypothetical protein YrbE SWALL:AAN44700
FT                   (EMBL:U18997) (260 aa) fasta scores: E(): 2.7e-84, 85.38%
FT                   id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73216"
FT                   /db_xref="GOA:Q6DAF7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF7"
FT                   /protein_id="CAG73216.1"
FT                   /translation="MLLRTLASLGRQGISASASFGRAGLMLFNALVGKPEFRKQWPLLV
FT                   KQLYSVGVQSLLIIIVSGLFIGMVLGLQGYIILTTYSAEASLGMMVALSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVVAPRFWAGLISMPLLAVIFV
FT                   AVGIWGGALVGVDWKGIDSGFFWSAMQGAVDWRQDVLNCVIKSIVFAITVTWIALFNGY
FT                   DAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   misc_feature    343247..343984
FT                   /note="HMMPfam hit to PF02405, DE Domain of unknown
FT                   function DUF140, score 6.3e-126"
FT   misc_feature    order(343373..343441,343469..343537,343652..343720,
FT                   343799..343867,343925..343984)
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0296 by TMHMM2.0 at aa 55-77, 87-109, 148-170, 197-219
FT                   and 239-258"
FT   CDS_pept        343998..344564
FT                   /transl_table=11
FT                   /gene="vpsC"
FT                   /locus_tag="ECA0297"
FT                   /product="putative exported protein"
FT                   /note="Similar to Shigella flexneri VpsC SWALL:Q9RHA1
FT                   (EMBL:AF053073) (183 aa) fasta scores: E(): 5.2e-45, 68.64%
FT                   id in 185 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein yrbd precursor yrbd or b3193
FT                   or z4556 or ecs4072 SWALL:YRBD_ECOLI (SWALL:P45391) (183
FT                   aa) fasta scores: E(): 1.1e-45, 69.18% id in 185 aa.
FT                   Shigella flexneri VpsC protein is involved in virulence
FT                   protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73217"
FT                   /db_xref="GOA:Q6DAF6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF6"
FT                   /protein_id="CAG73217.1"
FT                   /translation="MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGNEPTYRLYAT
FT                   FDNIGGLKARSPIRIGGVVIGRVADISLDEKTYLPRVAMDIQQRYDHIPDTSSLAIRTS
FT                   GLLGEQYLALNMGFEDEDMGTTILKDSGVIQDTKSAMVLEDLIGQFLYKSGGNSEDNAG
FT                   QSGTEPGADPAAMPEHNNESVPSHP"
FT   misc_feature    343998..344054
FT                   /note="Signal peptide predicted for ECA0297 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.812) with cleavage site
FT                   probability 0.333 between residues 19 and 20"
FT   misc_feature    344016..344075
FT                   /note="1 probable transmembrane helix predicted for ECA0297
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    344025..344468
FT                   /note="HMMPfam hit to PF02470, DE mce related protein,
FT                   score 3.1e-41"
FT   CDS_pept        344577..345206
FT                   /transl_table=11
FT                   /locus_tag="ECA0298"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   protein yrbc precursor yrbc or b3192 or sf3232
FT                   SWALL:AAN44698 (EMBL:U18997) (211 aa) fasta scores: E():
FT                   1e-62, 76.77% id in 211 aa, and to Shigella flexneri YrbC
FT                   SWALL:AAF21249 (EMBL:AF053073) (211 aa) fasta scores: E():
FT                   1e-62, 76.77% id in 211 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73218"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF5"
FT                   /protein_id="CAG73218.1"
FT                   /translation="MFKRLLMVALLVVAPLANAADQTNPYRLMNEAAEKTFNRLKSEQP
FT                   KIKQSPDYLRTVVREELLPYVQVRYAGALVLGRYYKDSTPAQRDAYFKAFEAYLEQAYG
FT                   QALAMYNGQNYQIAPEQPLGNADIVSIRVTIVDNGGRPPVRLDFQWRKNSKTGNWQAYD
FT                   MIAEGVSMITTKQNEWASILRQKGVDGLTQQLESSAKQTITLDQKK"
FT   misc_feature    344577..344633
FT                   /note="Signal peptide predicted for ECA0298 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 19 and 20"
FT   CDS_pept        345220..345510
FT                   /transl_table=11
FT                   /locus_tag="ECA0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis putative anti-sigma B
FT                   factor antagonist ypo3571 SWALL:Q8ZB54 (EMBL:AJ414157) (100
FT                   aa) fasta scores: E(): 3.9e-18, 60.41% id in 96 aa, and to
FT                   Escherichia coli, and Shigella flexneri hypothetical
FT                   protein yrbb yrbb or b3191 or sf3231 SWALL:YRBB_ECOLI
FT                   (SWALL:P45389) (97 aa) fasta scores: E(): 4.6e-11, 40.62%
FT                   id in 96 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73219"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF4"
FT                   /protein_id="CAG73219.1"
FT                   /translation="MANALNWQVQESTLALTGDLDRETLLPFWQQRESLLAGKTTLDVS
FT                   GLNRVDSAGLALLMHVYQQPSSGGEIAIVGASDRLKTLIALYNLNEIIPVS"
FT   misc_feature    345229..345498
FT                   /note="HMMPfam hit to PF01740, DE STAS domain, score 7e-07"
FT   CDS_pept        345645..345899
FT                   /transl_table=11
FT                   /locus_tag="ECA0300"
FT                   /product="putative bolA family protein"
FT                   /note="Similar to Yersinia pestis bolA-like protein ypo3570
FT                   SWALL:AAM83735 (EMBL:AJ414157) (87 aa) fasta scores: E():
FT                   9.3e-29, 88.09% id in 84 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Shigella flexneri protein YrbA
FT                   SWALL:YRBA_ECOLI (SWALL:P43781) (84 aa) fasta scores: E():
FT                   2.9e-27, 84.52% id in 84 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73220"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF3"
FT                   /protein_id="CAG73220.1"
FT                   /translation="MENNEIKDVLMNTLALEEAHVSGDGSHFQVIAVGGLFAGMSRVKK
FT                   QQAVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLNGF"
FT   misc_feature    345645..345869
FT                   /note="HMMPfam hit to PF01722, DE BolA-like protein, score
FT                   6.3e-35"
FT   CDS_pept        345980..347242
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="ECA0301"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Shigella flexneri udp-N-acetylglucosamine
FT                   1-carboxyvinyltransferase murA or murZ or b3189 or c3947 or
FT                   sf3229 SWALL:MURA_ECOLI (SWALL:P28909) (419 aa) fasta
FT                   scores: E(): 1.4e-140, 90.4% id in 417 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73221"
FT                   /db_xref="GOA:Q6DAF2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAF2"
FT                   /protein_id="CAG73221.1"
FT                   /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLGQLGARVERNGSVHVDASDVNVFCAPYDLVKTMRASIWALGPLVARF
FT                   GQGQVSLPGGCAIGARPVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDKVSV
FT                   GATVTIMSAATLAEGTTIIENAAREPEIVDTANFLNTLGAKISGAGSDKITIEGVARLG
FT                   GGVYRVVPDRIETGTFLVAAAVSRGQIICRNTRPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGKRPKAVTFRTSPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIR
FT                   MGAQAEIESNTVICHGVDKLSGAQVMATDLRASASLVLAGCIAEGVTTVDRIYHIDRGY
FT                   DRIEDKLRALGANIERVKEHE"
FT   misc_feature    345995..347197
FT                   /note="HMMPfam hit to PF00275, DE EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase), score
FT                   2.2e-179"
FT   CDS_pept        complement(347351..348448)
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /gene_synonym="hhoB"
FT                   /gene_synonym="htrH"
FT                   /locus_tag="ECA0302"
FT                   /product="exported protease"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 protease DegS precursor DegS or HhoB or HtrH or
FT                   b3235 or z4594 or ecs4108 SWALL:DEGS_ECOLI (SWALL:P31137)
FT                   (355 aa) fasta scores: E(): 9.1e-73, 58.51% id in 364 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73222"
FT                   /db_xref="GOA:Q6DAF1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF1"
FT                   /protein_id="CAG73222.1"
FT                   /translation="MLAKLLRSALFGALVAGIILAVLPFVGSGTSFLKSNDRNTDGSPV
FT                   SYHQGVNRATPAVVNIYNRVANTEKPSEVAIHPLGSGVIMNEKGYILTNKHVINNVQQI
FT                   QIELSDGRLYEARVIGSDSLTDLSVLQIDGVNLPVIPMNPDRLPHVGDVVMAIGNPYNL
FT                   GQTVTQGVISATGRVSLSAYGQQRSQVGRQNLLQTDASINHGNSGGALVNTLGELVGIN
FT                   TLSFDKSSNGETPEGISFAIPVALATKVMGKLIRDGRVVRGYIGINGVQLENFENSTLT
FT                   NNRDAQGRLTGILVQTIDPGGPADKAGIHIEDVIVSVNNKPARSIIETMEQVSEIRPGT
FT                   VIPVTIERANKQITLQMTIQEFPTQ"
FT   misc_feature    complement(347402..347689)
FT                   /note="HMMPfam hit to PF00595, DE PDZ domain (Also known as
FT                   DHR or GLGF), score 8.7e-14"
FT   misc_feature    complement(347696..348277)
FT                   /note="HMMPfam hit to PF00089, DE Trypsin, score 1.2e-17"
FT   misc_feature    complement(348350..348448)
FT                   /note="Signal peptide predicted for ECA0302 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.989) with cleavage site
FT                   probability 0.471 between residues 33 and 34"
FT   CDS_pept        complement(348586..349956)
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /gene_synonym="hhoA"
FT                   /locus_tag="ECA0303"
FT                   /product="exported protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Similar to Escherichia coli protease degq precursor
FT                   degq or hhoa or b3234 SWALL:DEGQ_ECOLI (SWALL:P39099) (455
FT                   aa) fasta scores: E(): 9.7e-110, 70.67% id in 457 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73223"
FT                   /db_xref="GOA:Q6DAF0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAF0"
FT                   /protein_id="CAG73223.1"
FT                   /translation="MKKTSLLFSALAMSIGLTLSTLPAANAALPSVVQGQQTPSLAPML
FT                   EKVLPAVVSVHVEGTQVQRQRVPEEFKFFFGPNFPTDKQNSRPFEGLGSGVIIDAAKGY
FT                   VLTNNHVINNADKIRVQLNDGREYDAKLIGRDEQTDIALLQLNDAKNLVSVKMADSDQL
FT                   RVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALVNL
FT                   NGELIGINTAILAPGGGNIGIGFAIPSNMAQNLAQQLVEFGEVKRGLLGIKGSEMTSEM
FT                   AKAFNVDAQRGAFVSEVLPKSAASKAGIKAGDVLTTLDGKPISSFAELRAKVGTTAPGK
FT                   TVKIGLLRDGKPQEVSVVLDNSTSASTSAETLSPSLQGASLINGQLKDGSKGVQIDNVA
FT                   KDTPAAQVGLQKGDIIIGVNRERIENITQLRKLLEAKPSVLALNIVRGEETIYLLLR"
FT   misc_feature    complement(348616..348840)
FT                   /note="HMMPfam hit to PF00595, DE PDZ domain (Also known as
FT                   DHR or GLGF), score 5.3e-13"
FT   misc_feature    complement(348910..349185)
FT                   /note="HMMPfam hit to PF00595, DE PDZ domain (Also known as
FT                   DHR or GLGF), score 4e-18"
FT   misc_feature    complement(348934..348957)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(349189..349731)
FT                   /note="HMMPfam hit to PF00089, DE Trypsin, score 2.3e-21"
FT   misc_feature    complement(349876..349956)
FT                   /note="Signal peptide predicted for ECA0303 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.799 between residues 27 and 28"
FT   CDS_pept        complement(350194..350598)
FT                   /transl_table=11
FT                   /locus_tag="ECA0304"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo3565 SWALL:AAM83730 (EMBL:AJ414157) (134 aa) fasta
FT                   scores: E(): 1.5e-41, 87.97% id in 133 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 hypothetical protein YhcB SWALL:YHCB_ECOLI
FT                   (SWALL:P39436) (134 aa) fasta scores: E(): 5.6e-34, 80.31%
FT                   id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73224"
FT                   /db_xref="GOA:Q6DAE9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE9"
FT                   /protein_id="CAG73224.1"
FT                   /translation="MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQVLQNELEKSKTEL
FT                   EDYRQELVGHFARSAELLDNMADDYRQLYQHMAKSSNNLLPNVPGQDNPFKYRLTESEA
FT                   DNDQAPVNMPPRDYSDGASGLLRGERPLRK"
FT   misc_feature    complement(350527..350586)
FT                   /note="1 probable transmembrane helix predicted for ECA0304
FT                   by TMHMM2.0 at aa 5-24"
FT   CDS_pept        350815..351966
FT                   /transl_table=11
FT                   /locus_tag="ECA0305"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   Ypo3564 SWALL:Q8ZB60 (EMBL:AJ414157) (375 aa) fasta scores:
FT                   E(): 8.3e-107, 71.88% id in 377 aa, and to Escherichia
FT                   coli, and Escherichia coli O157:H7 hypothetical protein
FT                   Yhcm SWALL:YHCM_ECOLI (SWALL:P46442) (375 aa) fasta scores:
FT                   E(): 1.6e-98, 65.6% id in 378 aa, and to Salmonella typhi
FT                   putative ATP/GTP-binding protein sty3526 SWALL:Q8Z3E8
FT                   (EMBL:AL627278) (374 aa) fasta scores: E(): 3e-97, 63.9% id
FT                   in 374 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73225"
FT                   /db_xref="GOA:Q6DAE8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE8"
FT                   /protein_id="CAG73225.1"
FT                   /translation="MATPQTTRQQTTPLALYQQALSAGEYQPDEVQRQTVVRLEAIHQA
FT                   LCERAADDDVEASGRVGKWRSWLGLRDKRESEPVQGLYMWGGVGRGKTWLMDMFFHSLP
FT                   AERKMRLHFHRFMLRVHEELNQFQGQENPLEKVADGFKAETDVLCFDEFFVSDITDAML
FT                   LAELLRALFARGITLVATSNIPPDDLYRNGLQRARFIPAIELIKQHCEVRNVDAGVDYR
FT                   LRTLTQAHLYLSPLNEETSAAMQQMFTRLTGKKLQTPGPVLEVNHRPLATLGVSDGVLA
FT                   ADFHTLCTEARSQNDYIALSRLYHTMLLHNVTVMETKEENTARRFLALVDECYDRRIKL
FT                   IISAQASMFDIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLA"
FT   misc_feature    350869..351954
FT                   /note="HMMPfam hit to PF03969, DE AFG1-like ATPase, score
FT                   7.6e-136"
FT   misc_feature    351070..351093
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        352201..352629
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ECA0306"
FT                   /product="50S ribosomal subunit protein L13"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, Salmonella typhimurium,
FT                   Salmonella typhi, and Shigella flexneri 50S ribosomal
FT                   protein L13 SWALL:AAN44735 (EMBL:X02130) (167 aa) fasta
FT                   scores: E(): 1.4e-54, 97.27% id in 147 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73226"
FT                   /db_xref="GOA:Q6DAE7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAE7"
FT                   /protein_id="CAG73226.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDANGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNADKVAVTGNKRTDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQPQVLDI"
FT   misc_feature    352243..352623
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00572, DE Ribosomal protein L13,
FT                   score 7e-86"
FT   misc_feature    352513..352581
FT                   /note="PS00783 Ribosomal protein L13 signature."
FT   CDS_pept        352645..353037
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ECA0307"
FT                   /product="30S ribosomal protein S9"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 30s ribosomal protein S9 RpsI
FT                   SWALL:RS9_ECOLI (SWALL:P02363) (129 aa) fasta scores: E():
FT                   1.1e-43, 96.12% id in 129 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi 30S ribosomal protein S9
FT                   RpsI SWALL:RS9_SALTY (SWALL:Q8XFX5) (129 aa) fasta scores:
FT                   E(): 3.3e-44, 96.89% id in 129 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73227"
FT                   /db_xref="GOA:Q6DAE6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAE6"
FT                   /protein_id="CAG73227.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGNIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   misc_feature    352672..353031
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00380, DE Ribosomal protein S9/S16,
FT                   score 5.4e-70"
FT   misc_feature    352849..352905
FT                   /note="PS00360 Ribosomal protein S9 signature."
FT   CDS_pept        353367..354008
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /gene_synonym="ssp"
FT                   /gene_synonym="pog"
FT                   /locus_tag="ECA0308"
FT                   /product="stringent starvation protein a"
FT                   /product="stringent starvation protein A"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri stringent
FT                   starvation protein A SspA or Ssp or Pog or b3229 or c3982
FT                   or z4587 or ecs4102 or sf3269 SWALL:SSPA_ECOLI
FT                   (SWALL:P05838) (211 aa) fasta scores: E(): 6.2e-67, 84.61%
FT                   id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73228"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE5"
FT                   /protein_id="CAG73228.1"
FT                   /translation="MAVAANKRSVMTLFSGQSDIFSHQVRIVLAEKGVSVEIELVDMDN
FT                   LPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLMMH
FT                   RIESDWYSLLRKMTHGNAQEADAARKQLREELLAIAPVFNETPYFMSEEFSLVDCYLAP
FT                   LLWRLPQLGIELSGSGAKELKGYMTRVFERDAFLASLTEVEREMRLQTRG"
FT   misc_feature    353388..353609
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 1.9e-23"
FT   misc_feature    353616..353948
FT                   /note="HMMPfam hit to PF00043, DE Glutathione
FT                   S-transferase, C-terminal domain, score 2.1e-14"
FT   CDS_pept        354014..354517
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ECA0309"
FT                   /product="stringent starvation protein B"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 stringent starvation protein B SspB or b3228 or
FT                   z4586 or ecs4101 SWALL:SSPB_ECOLI (SWALL:P25663) (165 aa)
FT                   fasta scores: E(): 3e-39, 71.42% id in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73229"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE4"
FT                   /protein_id="CAG73229.1"
FT                   /translation="MALSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDITLPDVMVPMEF
FT                   ARDGQIVLNIAPRAVGGLELADDSVRFNARFGGVPRQVHVPMAAVMAIYARENGAGTMF
FT                   ESEPAYESAGEYEGFQEGAPSSGTVMSIVDSSPDSEAPDDGSGSDDEPPPPPKGGRPSL
FT                   RVVK"
FT   CDS_pept        complement(354581..355354)
FT                   /transl_table=11
FT                   /gene="budC"
FT                   /locus_tag="ECA0310"
FT                   /product="acetoin reductase"
FT                   /EC_number="1.1.1.5"
FT                   /note="Similar to Klebsiella terrigena acetoin reductase
FT                   BudC SWALL:BUDC_KLETE (SWALL:Q04520) (241 aa) fasta scores:
FT                   E(): 1.3e-51, 69.06% id in 236 aa, and to Klebsiella
FT                   pneumoniae acetoin reductase BudC SWALL:BUDC_KLEPN
FT                   (SWALL:Q48436) (256 aa) fasta scores: E(): 1.8e-73, 82.28%
FT                   id in 254 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73230"
FT                   /db_xref="GOA:Q6DAE3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE3"
FT                   /protein_id="CAG73230.1"
FT                   /translation="MTVEVALVTGGGQGIGRAIALRLAADGFAVAIVDYNQETARSVAQ
FT                   EIEKSGGQAIALQADVADREAVFAAVAEAKKHFGDFNVIVNNAGVAPSTLIEDITPEVV
FT                   DRVYNINVKGVIWGIQAALDAFKSLGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGL
FT                   TQTAARDLAPLGITVNGYCPGIVKTPMWDEIDRKISESAGKPRGYATEEFAKRITLGRL
FT                   SEPEDVAACVSYLASHDSDYMTGQSLLIDGGMVFN"
FT   misc_feature    complement(354593..355351)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 2.1e-93"
FT   misc_feature    complement(354851..354937)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(355618..357036)
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ECA0311"
FT                   /product="glutamate synthase [NADPH] small chain"
FT                   /EC_number="1.4.1.13"
FT                   /note="Similar to Escherichia coli glutamate synthase
FT                   [NADPH] small chain GltD or AspB or b3213 SWALL:GLTD_ECOLI
FT                   (SWALL:P09832) (471 aa) fasta scores: E(): 5e-153, 85.56%
FT                   id in 471 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73231"
FT                   /db_xref="GOA:Q6DAE2"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE2"
FT                   /protein_id="CAG73231.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQAD
FT                   RCLSCGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYINDKAIEMGWKPSVANVIPTGKRVAIIGAGPAGLACAD
FT                   VLARSGVQAVVFDRHPEIGGLLTFGIPSFKLEKEVMVKRREIFTEMGIEFRLNTEVGKD
FT                   VQMKALLDEYDAVFLGVGTYQSMRGGLDNEDAQGVYDALPFLIANTKQLMGFEAATDEP
FT                   YISMQGRRVVVLGGGDTAMDCVRTSIRQAATHVTCAYRRDEENMPGSKREVKNAREEGV
FT                   EFKFNLQPLSVEVNGAGKVCGVKMARTALGVPDANGRRRPEIVEGSEHVLEADAVIMAF
FT                   GFRPHKMAWLAEHDVKLDDQGRIVAPESCDNAFQTSNPKIFAGGDAVRGSDLVVTAIAE
FT                   GRKAADGIMNYLEV"
FT   misc_feature    complement(355675..356595)
FT                   /note="HMMPfam hit to PF00070, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.9e-30"
FT   CDS_pept        complement(357046..361542)
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ECA0312"
FT                   /product="glutamate synthase [NADPH] large chain"
FT                   /EC_number="1.4.1.13"
FT                   /note="Similar to Escherichia coli glutamate synthase
FT                   [NADPH] large chain precursor GltB or AspB SWALL:GLTB_ECOLI
FT                   (SWALL:P09831) (1517 aa) fasta scores: E(): 0, 86.75% id in
FT                   1495 aa, and to Yersinia pestis glutamate synthase, large
FT                   subunit GltB SWALL:AAM83722 (EMBL:AE013613) (1535 aa) fasta
FT                   scores: E(): 0, 90.25% id in 1498 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73232"
FT                   /db_xref="GOA:Q6DAE1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE1"
FT                   /protein_id="CAG73232.1"
FT                   /translation="MRVTQSLGRFTNMLYDASQERDNCGFGLIAHIEGEPSHKVVRTAI
FT                   HALARMQHRGAILADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLAKNYAVGMMFLNQDE
FT                   ELARATRRIVEEELQNETLSVLGWREVPTNPDVLGEIALSSMPRIEQIFVNAPAGWRQR
FT                   DMERRLFMARRRIEKRIEDKEFYVCSFSNLVTIYKGLCMPADLPRFYLDLADLRLESAI
FT                   CLFHQRFSTNTVPRWPLAQPFRYLAHNGEINTIAGNRQWARARAYKFKTPLIPDLQDAA
FT                   PFVNETGSDSSSLDNMLELFLSGGMDIIRAMRLLVPPAWQNNPDMDPELRSFFDFNSMH
FT                   MEPWDGPAGIVMSDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEK
FT                   GRVGPGELMVIDTRSGRILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEELPDEQVGSR
FT                   EFNDELLETYQKQYGYSSEELDQIIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYF
FT                   RQQFAQVTNPPIDPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFTQL
FT                   TSQDELHYRADTLDLTFDPSQQTLQQTIEKLCDEAESKVRDGAVLLVLSDRGISESRLP
FT                   VPAPMAVGAVQRRLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLA
FT                   RMVDNHTIDKPYRAVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHKDVST
FT                   QCFLGVVSRIGGANYSDFEQDLLNLSKRAWLKRKTLEQGGLLKFVHGGEYHAYNPDIVT
FT                   TLQTAVKSGEYSDYEQYAKLVNERPVATLRDLLALRPQEGAAIAIDNVEPATEMFKRFD
FT                   TAAMSIGALSPEAHESLAEAMNGLGGFSNSGEGGEDPARYGTNKVSRIKQVASGRFGVT
FT                   PAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSI
FT                   EDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLS
FT                   SVKYAGCPWELGLVETQQALVSNGLRHKIRLQVDGGLKTGLDIVKAAILGAESFGFGTG
FT                   PMVALGCKYLRICHLNNCATGVATQDEKLRRDHYHGLPERVTNYFHFIAHETRVLMAEL
FT                   GVSRLVDLIGRTDLLVELDGFSAKQNKLDLSPLLHAAQPQPGKALHCTESNLSFDKGLL
FT                   NKELLAQAQPHIDAKQGKALYFDIRNTDRSVGATLSGAIAEKHGDQGLAGDPIKAHFSG
FT                   TAGQSFGVWNAGGLELKLIGDANDYVGKGMAGGSISVRPPVGSAFRSHEASIIGNTCLY
FT                   GATGGKLFAAGRAGERFAVRNSGCITVVEGIGDNGCEYMTGGIVCVLGRTGVNFGAGMT
FT                   GGFAYVLDEDGEFRKRVNPELVEVLDVEELAIHEEHLRGLITEHVQNTGSHRGEEILAN
FT                   WPIWAPKFALVKPKSSDVKALLGHRSRSAAELRVQAQ"
FT   misc_feature    complement(357217..357810)
FT                   /note="HMMPfam hit to PF01493, DE Domain of unknown
FT                   function DUF14, score 2.1e-102"
FT   misc_feature    complement(358036..359133)
FT                   /note="HMMPfam hit to PF01645, DE Conserved region in
FT                   glutamate synthase, score 1.4e-234"
FT   misc_feature    complement(358201..358233)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(361354..361377)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        362158..363087
FT                   /transl_table=11
FT                   /locus_tag="ECA0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein YhcC SWALL:YHCC_ECOLI
FT                   (SWALL:P45476) (309 aa) fasta scores: E(): 2.4e-105, 82.23%
FT                   id in 304 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73233"
FT                   /db_xref="GOA:Q6DAE0"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAE0"
FT                   /protein_id="CAG73233.1"
FT                   /translation="MQLQKLINMFGGNLQRRYGEKIHKLTLHGGFNCPNRDGTLGRGGC
FT                   TFCNVASFADEQMQQRSIAQQLEAQAGKVNRAKRYLAYFQAYTSTYAEVQVLESMYQEA
FT                   LKQAEMVGLCVGTRPDCVPDAVLDLLSRYHDRGYEVWLELGLQSACDKTLHRINRGHDF
FT                   ACYQETTRRARERGLKVCSHLIVGLPGEDAQRCLTTLEQVVETGVEGIKLHPLHIVEGS
FT                   TMAKAWRAGRLPELALERYVETAGEMIRHTPPDVIYHRISASARRPTLLAPLWCENRWT
FT                   GMVELDRYLQTHGVQGSALGMPYRYAGV"
FT   CDS_pept        363219..365588
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="ECA0314"
FT                   /product="aerobic respiration control sensor protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   aerobic respiration control sensor protein ArcB or b3210 or
FT                   sf3250 SWALL:ARCB_ECOLI (SWALL:P22763) (778 aa) fasta
FT                   scores: E(): 8.6e-180, 75.88% id in 788 aa, and to Yersinia
FT                   pestis aerobic respiration control sensor/response
FT                   regulatory protein ArcB SWALL:Q8ZB69 (EMBL:AJ414157) (778
FT                   aa) fasta scores: E(): 3.6e-190, 80.71% id in 788 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73234"
FT                   /db_xref="GOA:Q6DAD9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD9"
FT                   /protein_id="CAG73234.1"
FT                   /translation="MKQIRLLAQYYVDLMVKLGLVRFSLLLASVLVLLAMVVQMAVTLL
FT                   LSGEVENIDVVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVAKLEEMRHRDLEL
FT                   NVQLQENIAQLNQEIADRIKAEEARVLVMSRLKEEMSRREQAQIELEQQSALLRSFLDA
FT                   SPDLVYYRNEEKEFSGCNRAMELLVGKSQKQLIGLTPQDVYAPDIAEKVMETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRMGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTQLDLEQQKYLKTIHVSAITLGNIFNDVIE
FT                   MDKQERRKVQLDNQPIDFTGFLVDLENLGGLLAEQKGLKLIMDQHQPLPQKVITDGTRL
FT                   RQILWNLLSNAVKFTPKGEKGEKGEIVVRVWHEKGDRLRFEVEDSGMGIPADELEKIFA
FT                   MYYQVKDQHGGKPATGSGIGLAVSKRLAQNMGGDIHVSSSQGKGSCFTLTVIAPSADEA
FT                   GSGLEDDDDLPLPALHVLLVEDIELNVVVARSVLEKLGNSVDVAMTGQEALDMFDPDEF
FT                   DLVLLDIQLPDMTGLDVARQLRSRYGKRSLPPLVALTANVLKDKREYLDAGMDDVLSKP
FT                   LSVPALTAVIKQHWDTHTVWTEESVVEEGDEMAKVKEDLLDIPMLEQYLDLVGPKLIHQ
FT                   SLEMFEQMMPGYLAILDSNMTARDQKGITEEGHKIKGAAGSVGLRHLQQIAQQIQTSSL
FT                   PAWWDNVQEWIDELKHDWRHDVQVLRDWVAKAEKES"
FT   misc_feature    363219..363341
FT                   /note="Signal peptide predicted for ECA0314 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.530 between residues 41 and 42"
FT   misc_feature    order(363276..363344,363381..363449)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0314 by TMHMM2.0 at aa 20-42 and 55-77"
FT   misc_feature    363681..363875
FT                   /note="HMMPfam hit to PF00989, DE PAS domain, score
FT                   1.4e-07"
FT   misc_feature    363897..364025
FT                   /note="HMMPfam hit to PF00785, DE PAC motif, score 0.096"
FT   misc_feature    364062..364259
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 6.3e-18"
FT   misc_feature    364398..364754
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 2.3e-39"
FT   misc_feature    364812..365177
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 3.2e-30"
FT   CDS_pept        complement(365700..365939)
FT                   /transl_table=11
FT                   /locus_tag="ECA0315"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73235"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD8"
FT                   /protein_id="CAG73235.1"
FT                   /translation="MKMYSSWVLVAVVSCSVKTRISALASLQTLRSKCRCMFSLVLAHN
FT                   SRTPASAGVIFFYRMKTCKAPHSLSSFNRKHRSI"
FT   misc_feature    complement(365895..365927)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        366062..366715
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /gene_synonym="elb2"
FT                   /locus_tag="ECA0316"
FT                   /product="enhancing lycopene biosynthesis protein 2 (sigma
FT                   cross-reacting protein 27a)"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   enhancing lycopene biosynthesis protein 2 ElbB or Elb2 or
FT                   b3209 or sf3249 SWALL:ELBB_ECOLI (SWALL:P26428) (217 aa)
FT                   fasta scores: E(): 1.6e-57, 68.2% id in 217 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73236"
FT                   /db_xref="GOA:Q6DAD7"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD7"
FT                   /protein_id="CAG73236.1"
FT                   /translation="MKRVGIVLSGCGVYDGSEIHEAVLTLLALDRAGAQAVCFAPDKPQ
FT                   LQVVNHLTGDVTGENRNVLAESARIVRGKIQPLSTANAQDLDALIVPGGFGAAKNLSDF
FT                   STQGSACQIDETLQLLTQEIYKQNKPIGFICISPALLPTILGIPVRVTIGNDIDTAEAV
FT                   EEMGGIHVVCPVDDIVVDEEHKIVTTPAYMLASSISEAAQGIDKLVARVLALTE"
FT   misc_feature    366080..366682
FT                   /note="HMMPfam hit to PF01965, DE DJ-1/PfpI family, score
FT                   2.2e-17"
FT   CDS_pept        366712..367449
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="ECA0317"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="Similar to Klebsiella pneumoniae monofunctional
FT                   biosynthetic peptidoglycan transglycosylase MtgA
FT                   SWALL:MTGA_KLEPN (SWALL:Q48465) (242 aa) fasta scores: E():
FT                   4.1e-68, 69.69% id in 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73237"
FT                   /db_xref="GOA:Q3V7N8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V7N8"
FT                   /protein_id="CAG73237.1"
FT                   /translation="MRWSRGRGGGLLTWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFS
FT                   AVMVDRQVSAWLKGEFAYVAHSDWVAMDDIAPAMALAVMAAEDQKFPQHWGFDVDAIGQ
FT                   ALKHNERNTQRVRGASTLSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRIITV
FT                   YLNIAEFGPGVFGVEAAARRYFNKSASKLTASESALLAAVLPNPIRFRANAPSGYVIQR
FT                   QQWILRQMRQMGGDAFLRDNNLN"
FT   misc_feature    366712..366849
FT                   /note="Signal peptide predicted for ECA0317 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.874) with cleavage site
FT                   probability 0.389 between residues 46 and 47"
FT   misc_feature    366769..366837
FT                   /note="1 probable transmembrane helix predicted for ECA0317
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    366853..367359
FT                   /note="HMMPfam hit to PF00912, DE Transglycosylase, score
FT                   3.9e-71"
FT   CDS_pept        367521..368813
FT                   /transl_table=11
FT                   /locus_tag="ECA0318"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo3473 SWALL:Q8ZBE3 (EMBL:AJ414157) (408 aa) fasta scores:
FT                   E(): 3.4e-43, 35.81% id in 363 aa, and to Yersinia pestis
FT                   hypothetical protein ypo3468 SWALL:AAM84304 (EMBL:AJ414157)
FT                   (388 aa) fasta scores: E(): 7.9e-44, 37.78% id in 397 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73238"
FT                   /db_xref="GOA:Q6DAD6"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD6"
FT                   /protein_id="CAG73238.1"
FT                   /translation="MRLRHWSGLLVVLCCMASVARAGTELKTSPSDNPYAFLQQPQLSV
FT                   VKQQLQQKTEKPQTRMAYEQLISEADRALKIDNPSVTEKKSTPPSGSKHDYLSLSAYWW
FT                   PDPDKADGLPWIRRDGQVNPASKDEETDGVRLAKFTAQTQALTLAWYFSGKQTYADKAM
FT                   SMIRTWFIDPATRMNPNLDFAQGVPGIAPGRGSGVLDGRYFSTRIVDSLIMLRHAPGWT
FT                   PQDEQQMQKWMSDYLHWLQTSKLGKKEATAKNNHGSWYTVQVAGIAWYLGKIDVVKSMA
FT                   QLQREKLDHQFQPDGAQPEELARTRSFHYSYFNLQAITDMAILASRVGENIWQYQTPKG
FT                   SSVIKALDFMAPYLDENKAWPRKTMDRQSNRLIPLLLQADRDLKTPRYQTQIKQAGFAE
FT                   LLTGEASARDKEPSHISVETRRSLWLLNPAK"
FT   misc_feature    367521..367586
FT                   /note="Signal peptide predicted for ECA0318 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.973 between residues 22 and 23"
FT   CDS_pept        complement(368956..369528)
FT                   /transl_table=11
FT                   /locus_tag="ECA0319"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo3551 SWALL:Q8ZB73 (EMBL:AJ414157) (191 aa) fasta scores:
FT                   E(): 2.2e-47, 73.82% id in 191 aa, and to Escherichia coli
FT                   lipoprotein EcfH SWALL:AAL01382 (EMBL:AF407015) (191 aa)
FT                   fasta scores: E(): 5.6e-46, 71.72% id in 191 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73239"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD5"
FT                   /protein_id="CAG73239.1"
FT                   /translation="MRISSAFAVLSIALLLQGCVGVVAVGSAVATKTATDPRTVGTQVD
FT                   DGTLEVRVTNAISKDEQLKKDARIIATAYQGKVLLTGQTPSTEMASRAKQIALGVEGAV
FT                   EVYNEIRQGTPVSMGTASMDTWITTKVRSQILASDTVKSSNVKVTTENGEVFLLGLVTQ
FT                   REGTSAAEIASKVGGVKHVTTAFTYLQ"
FT   misc_feature    complement(369439..369528)
FT                   /note="Signal peptide predicted for ECA0319 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.546 between residues 30 and 31"
FT   misc_feature    complement(369472..369504)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(369540..370130)
FT                   /transl_table=11
FT                   /locus_tag="ECA0320"
FT                   /product="putative phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="Similar to Aneurinibacillus thermoaerophilus
FT                   phosphoheptose isomerase GmhA SWALL:Q9AGY7 (EMBL:AF324836)
FT                   (198 aa) fasta scores: E(): 1.2e-21, 40.41% id in 193 aa,
FT                   and to Salmonella typhi probable phosphoheptose isomerase
FT                   sty3449 SWALL:Q8Z3I7 (EMBL:AL627278) (196 aa) fasta scores:
FT                   E(): 1.2e-66, 91.83% id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73240"
FT                   /db_xref="GOA:Q6DAD4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAD4"
FT                   /protein_id="CAG73240.1"
FT                   /translation="MLDRIKVCFTESIQTQIAAAEALPDAISRGAIAMVQSLLNGNKIL
FT                   CCGNGTSAANSQHFAASMINRFEAERPSLPAIALNADNVVLTAIANDRLHEEIYAKQVR
FT                   ALGQAGDVLLAISTRGNSRDIVKAVESAVTRDMTIVALTGYDGGELAGLLGPQDVEIRI
FT                   PSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
FT   misc_feature    complement(369552..370028)
FT                   /note="HMMPfam hit to PF01380, DE SIS domain, score
FT                   4.6e-42"
FT   CDS_pept        complement(370172..370414)
FT                   /transl_table=11
FT                   /locus_tag="ECA0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3549 or y0119 SWALL:YZ49_YERPE (SWALL:Q8ZB75) (117 aa)
FT                   fasta scores: E(): 9.5e-22, 76.31% id in 76 aa, and to
FT                   Salmonella typhimurium hypothetical protein yran or stm3265
FT                   SWALL:YRAN_SALTY (SWALL:Q8ZLU3) (131 aa) fasta scores: E():
FT                   1.6e-17, 61.84% id in 76 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73241"
FT                   /db_xref="GOA:Q6DAD3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD3"
FT                   /protein_id="CAG73241.1"
FT                   /translation="MIMRDRHIWVFVEVRYRRNAHFGDAAASITRRKQQRLLHAAAVWL
FT                   AQRGASFDTVDCRFDVLAITGEQLNWIPNAFAAQG"
FT   misc_feature    complement(370220..370414)
FT                   /note="HMMPfam hit to PF02021, DE Uncharacterised protein
FT                   family UPF0102, score 2.1e-07"
FT   CDS_pept        complement(370525..372543)
FT                   /transl_table=11
FT                   /locus_tag="ECA0322"
FT                   /product="putative exported protein"
FT                   /note="Similar to Shigella flexneri putative glycosylase
FT                   Yram or sf3188 SWALL:AAN44655 (EMBL:AE015330) (688 aa)
FT                   fasta scores: E(): 5.9e-116, 52.47% id in 686 aa, and to
FT                   Yersinia pestis putative glycosylase y0118 SWALL:AAM83712
FT                   (EMBL:AE013612) (689 aa) fasta scores: E(): 4.8e-55, 59.61%
FT                   id in 676 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73242"
FT                   /db_xref="GOA:Q6DAD2"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD2"
FT                   /protein_id="CAG73242.1"
FT                   /translation="MLPFHFVRTQAGRAIPVLLAALFLAGCPSQAPQSPPPEVQGKADA
FT                   SSDYYLQQMQQSSDNNKADWQLLAIRSLLQEGKVPQASQQFSTLPEKLSAAQKQEQQLL
FT                   SAELSVTQNNMDAAKAALSQLDVGALSDPQKQRYYQTQIKTAQGRPSIELLRAYISQEP
FT                   LLKGDEHQINLDQTWLALTQMSPQESGSLLINANENVLQGWVDLLNNYQNNRESPDQLQ
FT                   SAIQDWQTRYPHHPAAKTLPTQLNQVINYQPSSVNSIALLLPLNGQAQVFANAIQQGFN
FT                   AAKNGQIATASVSAPAASATDTTQNGQVTTSPDGQSIQSPAPYSDQAVASTTPAPEAQT
FT                   TGAGLSSSLPVKVYDTSSQPLANILTQAQQDGASLVIGPLLKNEVDQLANSQSPLNILA
FT                   LNQPEHVENSPNICYFALSPEDEARDAAKFIHQQGKQQPLVLAPRGALGDRIVNAFAQA
FT                   WNQQSGTSSLQQRFGNTAELKQAINSGAGLSLSGQPVNVSQQQAQPSTTIGGLTIPSQV
FT                   QPTSSSSVSGNIDAVYIIATPDELALIKPMIDMRTTSRARPALYASSRSFQAGLGPDFR
FT                   LEMEGLQFSDIPLLAGANPALMQQVSSQFKNDYSLVRLYAMGMDAWTLASHFGEMRQIP
FT                   GHQISGATGMLSAGPDCTINRQLTWQQYRQGQLVPVL"
FT   misc_feature    complement(372451..372543)
FT                   /note="Signal peptide predicted for ECA0322 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.850) with cleavage site
FT                   probability 0.688 between residues 31 and 32"
FT   misc_feature    complement(372463..372495)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        372605..373492
FT                   /transl_table=11
FT                   /locus_tag="ECA0323"
FT                   /product="putative tetrapyrrole methylase"
FT                   /note="Similar to Yersinia pestis putative tetrapyrrole
FT                   methylase ypo3547 SWALL:AAM83711 (EMBL:AJ414157) (299 aa)
FT                   fasta scores: E(): 2.8e-92, 84.12% id in 296 aa, and to
FT                   Escherichia coli O6 hypothetical protein Yral
FT                   SWALL:AAN82340 (EMBL:AE016767) (287 aa) fasta scores: E():
FT                   2.4e-90, 83.27% id in 287 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73243"
FT                   /db_xref="GOA:Q6DAD1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD1"
FT                   /protein_id="CAG73243.1"
FT                   /translation="MNQDQQADISASTLYIVPTPIGNLGDITQRALAVLASVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKADVLLAKLQSGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSASGLASDRFCYEGFLPAKTKGRKDKLRELGEEP
FT                   RTLIFYESTHRLLDSLQDISEVLGAERYVVLAREITKTWESIHGAPVGELLAWVKEDQN
FT                   RRKGEMVLIVEGHKIDESVLSSEALRTLALLRAELPLKKAAALAAEIHGVKKNALYRYG
FT                   LEQEGDSGESGDDK"
FT   misc_feature    372641..373246
FT                   /note="HMMPfam hit to PF00590, DE Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases, score 1.1e-62"
FT   misc_feature    372875..372910
FT                   /note="PS01296 Uncharacterized protein family UPF0011
FT                   signature."
FT   misc_RNA        373579..373881
FT                   /note="Erwinia_carotovora 373579 373881 RF00010 1 60 369.22
FT                   RNaseP_bact_a"
FT                   /note="RNA subunit of RNase P"
FT   CDS_pept        374208..374462
FT                   /transl_table=11
FT                   /locus_tag="ECA0325"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Erwinia pyrifoliae putative plasmid
FT                   stability protein StbD stbD SWALL:AAN04532 (EMBL:AY123045)
FT                   (84 aa) fasta scores: E(): 8.7e-27, 88.09% id in 84 aa, and
FT                   to Morganella morganii stability protein StbD SWALL:Q9ZH43
FT                   (EMBL:AF072126) (83 aa) fasta scores: E(): 9.5e-18, 63.95%
FT                   id in 86 aaand to Escherichia coli IncF plasmid RepFIB
FT                   replicon SWALL:Q60256 (EMBL:M26308) (83 aa) fasta scores:
FT                   E(): 7.6e-10, 43.59% id in 78 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAD0"
FT                   /protein_id="CAG73244.1"
FT                   /translation="MAFNILTNTAASITELKRDPMGTVRSAEGETIAILNRNEPAFYCV
FT                   PPAVFAYLMELAEDAELGHTVDERMSEIVDAKEISLDDL"
FT   CDS_pept        374452..374739
FT                   /transl_table=11
FT                   /locus_tag="ECA0326"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Erwinia pyrifoliae putative plasmid
FT                   stability protein StbE SWALL:AAN04531 (EMBL:AY123045) (95
FT                   aa) fasta scores: E(): 1.7e-31, 90.32% id in 93 aa, and to
FT                   Morganella morganii stability protein StbE SWALL:Q9ZH42
FT                   (EMBL:AF072126) (93 aa) fasta scores: E(): 1.3e-19, 62.06%
FT                   id in 87 aa, and to Escherichia coli, and Shigella flexneri
FT                   hypothetical RelE protein SWALL:RELE_ECOLI (SWALL:P07008)
FT                   (95 aa) fasta scores: E(): 2.5e-15, 53.76% id in 93 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73245"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC9"
FT                   /protein_id="CAG73245.1"
FT                   /translation="MTYKLKFVPSAMKEWKKLGHPVREQFKKKLAERLDNPRVPSAQLH
FT                   GRKDQYKIKLKSAGYRLVYLVQDDTITVMVMGVGKREGNQIYSDTKGRST"
FT   CDS_pept        374918..375703
FT                   /transl_table=11
FT                   /locus_tag="ECA0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0659 SWALL:Q8ZI55 (EMBL:AJ414144) (260 aa) fasta scores:
FT                   E(): 3.4e-92, 84.55% id in 259 aa, and to Escherichia coli
FT                   hypothetical protein YgiD SWALL:YGID_ECOLI (SWALL:P24197)
FT                   (271 aa) fasta scores: E(): 4.1e-81, 72.41% id in 261 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73246"
FT                   /db_xref="GOA:Q6DAC8"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC8"
FT                   /protein_id="CAG73246.1"
FT                   /translation="MNNTSRMPALFLGHGSPMNVLESNAYTQAWQTLGETLPRPKAIIA
FT                   VSAHWYTRGTAVTAMEKPRTIHDFGGFPQALFDTQYPAPGSPELAARIQQVLAPYPVTA
FT                   DQSQWGLDHGSWGVLIKMYPNADIPVVQLSVDGTQPAEYHYELGRKLAALRDEGFMIVA
FT                   SGNVVHNLRMAKWDGDAEPYPWAVSFNQFVRDNLTYQGDDHPLVNFMQHDGAALSNPTP
FT                   DHYFPLLYVLGSWDGKEAISIPVDGLEMGSLSMLSVQVG"
FT   CDS_pept        complement(375772..376932)
FT                   /transl_table=11
FT                   /locus_tag="ECA0328"
FT                   /product="putative glutathionylspermidine synthase"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0660 SWALL:Q8ZI54 (EMBL:AJ414144) (386 aa) fasta scores:
FT                   E(): 1e-145, 87.27% id in 385 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Escherichia coli O157:H7
FT                   hypothetical protein YgiC SWALL:YGIC_ECOLI (SWALL:P24196)
FT                   (386 aa) fasta scores: E(): 1.4e-133, 78.49% id in 386 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73247"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC7"
FT                   /protein_id="CAG73247.1"
FT                   /translation="MKRIDITARPDWQEKATEFGFRFHTMYGEPYWSEEAYYQFTLAQI
FT                   EELEETTAELHQMCLQVVEKVISSDALLTKFRIPKHTWEFVRHSWRTNQPSLYSRLDLA
FT                   YDGKSPAKLLENNADTPTSLYEAAFFQWLWLEDQTNAGNLPQNADQYNSIQEKLIERFE
FT                   ELKLNHGFGLLHFACCQDTEEDRGTVQYLQDCALEAGLPSEFLYIEEIGLGEKGQFTDP
FT                   ENQVISNLFKLYPWEFMLREVFSTKLEDAGVRWLEPAWKSIISNKALLPMLWEMFPNHP
FT                   NLLPAYFAEDEHPKLDSYVIKPLFSREGANIQIVENGKEIASADGPYGEEGMIVQQYHQ
FT                   LPKFGDSYTLIGSWLVNDQPCGIGVREDRALITQDLSRFYPHTILD"
FT   misc_feature    complement(375778..376926)
FT                   /note="HMMPfam hit to PF03738, DE Glutathionylspermidine
FT                   synthase, score 1.1e-167"
FT   CDS_pept        complement(376944..377618)
FT                   /transl_table=11
FT                   /locus_tag="ECA0329"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo0661 or y3517 SWALL:Q8ZI53 (EMBL:AJ414144) (228 aa)
FT                   fasta scores: E(): 2.1e-59, 77.68% id in 233 aa, and to
FT                   Salmonella typhimurium, and Salmonella typhi putative inner
FT                   membrane protein ygib or stm3187 or sty3365 SWALL:Q8XGZ1
FT                   (EMBL:AE008846) (223 aa) fasta scores: E(): 3.8e-57, 74.56%
FT                   id in 228 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73248"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAC6"
FT                   /protein_id="CAG73248.1"
FT                   /translation="MKRTKNINQETFRKEWRTHRLAPVALAVSAVFFLAGCEQTDETVS
FT                   LYQNADDCSSANPSMAAQCTTAYNNALKEAEKTAPKYATKEDCVAEFGEAQCTQTPAPA
FT                   QAGMAAEPQQSGGMSWMPLMAGYMMGRMMGGGAGFAQQPLFSPKTPASPANGQFVDAAG
FT                   KNYGNAATGRTMTVPKTALAPKPATTSTITRGGFGETVAKQNSMQRSSASSNSSSSRSM
FT                   GG"
FT   misc_feature    complement(377511..377618)
FT                   /note="Signal peptide predicted for ECA0329 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.663) with cleavage site
FT                   probability 0.344 between residues 36 and 37"
FT   CDS_pept        complement(377889..379289)
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /gene_synonym="mtcB"
FT                   /gene_synonym="mukA"
FT                   /gene_synonym="refI"
FT                   /locus_tag="ECA0330"
FT                   /product="outer membrane protein"
FT                   /note="Similar to Escherichia coli outer membrane protein
FT                   TolC precursor TolC or MtcB or MukA or RefI or b3035
FT                   SWALL:TOLC_ECOLI (SWALL:P02930) (495 aa) fasta scores: E():
FT                   4.1e-124, 75.32% id in 466 aa, and to Erwinia chrysanthemi
FT                   outer membrane protein TolC SWALL:Q93AG1 (EMBL:AF421372)
FT                   (472 aa) fasta scores: E(): 2.3e-128, 77.89% id in 466 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73249"
FT                   /db_xref="GOA:Q6DAC5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC5"
FT                   /protein_id="CAG73249.1"
FT                   /translation="MQMKKLLPLLIGLSLGGFSAMSQAENLLQVYQQAKSTNPDLRSSA
FT                   ATRDAAFEKINESRSPLLPQLGLGADYTYNRGYRDSKGVNSDVKGASLQLTQTLFDMSK
FT                   WRALTLQEKQAGIEDVTYQTAQQNLMLNTATAYFNVLRAIDSLSYINAQKQAIYRQLDQ
FT                   TTQRFNVGLVAITDVQNARAQYDSVLANEVLTRNTLDNALESLRQITGNFYPQLAGLNI
FT                   ERFSTQKPEAVNNLLKEAENRNLNLLSARLSQDLAREQIRSAETGYMPTLDLTASTGVS
FT                   DTRYSGSRTQNSNSFNDTDAGQHRVGINFTLPLYSGGATNSQVKQAQHSYVSSSELLES
FT                   AHRSVIQTVRSSFNNISASISSINAYKQAEVSAQSSLDAMEAGYQVGTRTIVDVLDATT
FT                   TLYNAKQQLSSARYDYLINQLNIKSAQGTLSETDLQALNASLGQPVSTTPTVTDNTAPQ
FT                   ATTASAQR"
FT   misc_feature    complement(377976..378593)
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 1.7e-49"
FT   misc_feature    complement(378624..379211)
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 1.2e-36"
FT   misc_feature    complement(379218..379289)
FT                   /note="Signal peptide predicted for ECA0330 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.914 between residues 24 and 25"
FT   CDS_pept        379620..380252
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="ECA0331"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri ADP-ribose
FT                   pyrophosphatase NudF or b3034 or c3780 or z4391 or ecs3922
FT                   or sf3074 SWALL:ADPP_ECOLI (SWALL:P36651) (209 aa) fasta
FT                   scores: E(): 8.2e-61, 79.1% id in 201 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73250"
FT                   /db_xref="GOA:Q6DAC4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC4"
FT                   /protein_id="CAG73250.1"
FT                   /translation="MASSVSGPVTFTKDDVEIIARETLYDGFFSLERYRFRHRLFNGGM
FT                   SGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSASPWLFELVAGMIEPGES
FT                   HEDVARREAEEEAGLRVGRCRPIINYLASPGGTSERLAVMVGEVDTRMAKGIHGLAEEN
FT                   EDIRVHVVSREQSYQWVEAGIVDNAASVIALQWLALHHEELKREWVG"
FT   misc_feature    379785..380210
FT                   /note="HMMPfam hit to PF00293, DE NUDIX domain, score
FT                   8.2e-17"
FT   CDS_pept        380254..380688
FT                   /transl_table=11
FT                   /locus_tag="ECA0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   hypothetical protein YqiB SWALL:AAN44551 (EMBL:D16557) (140
FT                   aa) fasta scores: E(): 1.6e-47, 80% id in 140 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73251"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC3"
FT                   /protein_id="CAG73251.1"
FT                   /translation="MMKRYTPDFPAMMRLCETNFMQLRRLLPKVDEVGEIAVYHVDNAV
FT                   YQLTILESTRYTSLVEIKQTAPAVSYWSLPMMSVRLYHDALVAEVCASQQIFRFKARYD
FT                   YPNKKLHQRDEKHQINQFLADWLKYCLAYGSMSIPVFDTQ"
FT   CDS_pept        380920..381747
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="ECA0333"
FT                   /product="cAMP phosphodiesterase"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 Icc protein Icc or b3032 or z4389 or ecs3920
FT                   SWALL:ICC_ECOLI (SWALL:P36650) (275 aa) fasta scores: E():
FT                   2.1e-82, 70.54% id in 275 aa, and to Yersinia pestis Icc
FT                   protein homologue Icc or ypo0666 SWALL:Q8ZI48
FT                   (EMBL:AJ414144) (275 aa) fasta scores: E(): 4.8e-92, 76.72%
FT                   id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73252"
FT                   /db_xref="GOA:Q6DAC2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC2"
FT                   /protein_id="CAG73252.1"
FT                   /translation="MESLLTLPVASGARVRILQITDTHLFAGEHETLLGINTYRSYHAV
FT                   LDAIKARQDAFDLIVATGDLAQDHTLQAYHHFSRAIAQIPAPCVWLPGNHDFQPAMVDA
FT                   LADAGIAPSKHVLLGDKWQIILLDSQVFGVPHGELSEYQLEWLERSLKSQPDRFTLLLL
FT                   HHHPHPSGCTWLDQHSLRNAHNLSAVLDRYPQVNTVLCGHIHQEMDFDWHGRRLLATPS
FT                   TCVQFKPHCTNFTIDNMAPGWRYLDLLPDGRLETEVYRLSGSEFLPDMDSDGY"
FT   misc_feature    380962..381540
FT                   /note="HMMPfam hit to PF00149, DE Calcineurin-like
FT                   phosphoesterase, score 1.4e-18"
FT   CDS_pept        381747..382328
FT                   /transl_table=11
FT                   /locus_tag="ECA0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   hypothetical protein YqiA SWALL:YQIA_ECOLI (SWALL:P36653)
FT                   (193 aa) fasta scores: E(): 5.8e-60, 75.78% id in 190 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73253"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC1"
FT                   /protein_id="CAG73253.1"
FT                   /translation="MPTLLYLHGFNSTPQSSKATALKTWLAEQHPEIDMVIPQLPPYPT
FT                   EAAEMMESLIMERAGRPVGIVGSSLGGYYATWLSQCFMLPAVVVNPAVKPFELLLDHLG
FT                   EYQNPYTGEQYVLESRHVYDLKVMQVDRLESPDLLWLLLQTGDEVLDYRQAVAYYTACR
FT                   QTVESGGNHAFVGFEHFFTPIVNFLGLTTD"
FT   CDS_pept        382412..384307
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /gene_synonym="nfxD"
FT                   /locus_tag="ECA0335"
FT                   /product="topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /note="Similar to Escherichia coli topoisomerase IV subunit
FT                   B ParE or NfxD or b3030 SWALL:PARE_ECOLI (SWALL:P20083)
FT                   (630 aa) fasta scores: E(): 0, 90.65% id in 631 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73254"
FT                   /db_xref="GOA:Q6DAC0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAC0"
FT                   /protein_id="CAG73254.1"
FT                   /translation="MAQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSGK
FT                   NYQFSGGLHGVGISVVNALSTRVEVTVKRDGQVYDIAFENGDKVQELTVTGTCGRRNTG
FT                   TRVHFWPDEKFFDSARFSVSRLTHLLKAKAVLCPGVEIIFKDKVNNTEQRWCYLDGLND
FT                   YLCEAINGLITLPEKPFLGSISGDTEAVDWALLWLPEGGELLTESYVNLIPTPMGGTHV
FT                   NGLRQGLLDAMREFCEFRNILPRGVKLSADDIWERCAYVLSVKMQEPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCTSQDLNRTELFLVEGDSAGGSAKQAREREFQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSTDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRALVLG
FT                   GHVYVAMPPLYRIDLGKEVYYALDEEEKAGVLEQLKRKRGKPNVQRFKGLGEMNPPQLR
FT                   ETTLDPNTRRLVQLTINDEEMDQTMAMMDMLLAKKRSEDRRNWLQEKGDRAEIEV"
FT   misc_feature    382493..382930
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 2e-24"
FT   misc_feature    383066..383572
FT                   /note="HMMPfam hit to PF00204, DE DNA gyrase B, score
FT                   1.6e-55"
FT   misc_feature    383660..383686
FT                   /note="PS00177 DNA topoisomerase II signature."
FT   misc_feature    384065..384274
FT                   /note="HMMPfam hit to PF00986, DE DNA gyrase B subunit,
FT                   carboxyl terminus, score 2.5e-28"
FT   CDS_pept        384350..385246
FT                   /transl_table=11
FT                   /locus_tag="ECA0336"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Neisseria meningitidis CrgA SWALL:Q9JPU9
FT                   (EMBL:AF190471) (299 aa) fasta scores: E(): 4.9e-49, 45.27%
FT                   id in 296 aa, and to Yersinia pestis LysR-family regulatory
FT                   protein ypo0669 or y3510 SWALL:Q8ZI45 (EMBL:AJ414144) (303
FT                   aa) fasta scores: E(): 1.4e-70, 65.18% id in 293 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73255"
FT                   /db_xref="GOA:Q6DAB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB9"
FT                   /protein_id="CAG73255.1"
FT                   /translation="MKVTLEELQAFVVVIDTGSITAAAEQLGQTTSGISRALRRLEDKL
FT                   GTTLLHRTTRRLSLSEEGTMFLEHARGVIHAVEHAEEQVLLRHEQPSGRLRINSASAFI
FT                   QHVIVPLVPEFRRRYPKIILELNTDDFIIDLLEQHIDIAIRIGTLKDSTIHARPLGASK
FT                   LRIVASPDYLQQHGTPETVESLADHICLGFTQVESLNHWPLRHGLQDFYPITPALLASN
FT                   GEILRQLALRGEGIVRMSNFLIREDLAAGRLVPILTEVTVEASLPVYAVYYRNSQLAAR
FT                   ITCFLDFMSEKLTENPL"
FT   misc_feature    384362..384541
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 4.9e-21"
FT   misc_feature    384401..384466
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1816.000, SD 5.37 at aa 18-39, sequence
FT                   GSITAAAEQLGQTTSGISRALR"
FT   misc_feature    384404..384496
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    384611..385231
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.6e-44"
FT   CDS_pept        complement(385287..385868)
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="ECA0337"
FT                   /product="putative modulator of drug activity B"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 modulator of drug activity B
FT                   MdaB or mda66 or b3028 or c3768 or z4379 or ecs3910
FT                   SWALL:MDAB_ECOLI (SWALL:P40717) (193 aa) fasta scores: E():
FT                   8.6e-61, 70.83% id in 192 aa, and to Yersinia pestis
FT                   putative modulator of drug activity MdaB or ypo0670 or
FT                   y3509 SWALL:Q8ZI44 (EMBL:AJ414144) (194 aa) fasta scores:
FT                   E(): 2.1e-61, 74.46% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73256"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB8"
FT                   /protein_id="CAG73256.1"
FT                   /translation="MQKILLINAGKSFAHSKGELNDTLTDVAASFLRDKGHDIRVTVVD
FT                   NGYDIEKEIQNYLWADTIIYQMPGWWMDTPWILKKYIDDVFTAGHGSLYASDGRSRSDA
FT                   SKKYGSGGLLQGRKYMLSLTWNAPLEAFDDPDQFFHGVGVDGVYLPFHKANQFIGLSPL
FT                   PTFICNDVIKAPDVPAYLANYRQHLDQLFA"
FT   misc_feature    complement(385293..385865)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02525, DE Flavodoxin-like fold,
FT                   score 7.8e-68"
FT   CDS_pept        complement(386071..386934)
FT                   /transl_table=11
FT                   /locus_tag="ECA0338"
FT                   /product="probable sugar-bisphosphate aldolase"
FT                   /note="Similar to Lactobacillus casei
FT                   D-fructose-1,6-biphosphate aldolase sorG SWALL:Q9RGG1
FT                   (EMBL:AF129168) (276 aa) fasta scores: E(): 1.9e-37, 41.97%
FT                   id in 274 aa, and to Escherichia coli O6 putative aldolase
FT                   c4483 SWALL:AAN82919 (EMBL:AE016769) (286 aa) fasta scores:
FT                   E(): 8.4e-89, 80.06% id in 286 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73257"
FT                   /db_xref="GOA:Q6DAB7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB7"
FT                   /protein_id="CAG73257.1"
FT                   /translation="MLISMTDMLKPTREHRFAIGAFNVADSCFIRAVVEEAEATNTPAI
FT                   ISIHPSELAFVTDEFFAYVRERTLRSPVPFVIHLDHGASIAHVLRAIQCGFTSVMIDGS
FT                   LLPYEENVALTTEVVKLAHAVGVSVEGELGTIGDTGTTIEGGVSKVIYTDPEQAEDFVN
FT                   RTGVDTLAVAIGTAHGIYPKDLKPELQMHILRDISQRVSIPLVLHGGSANPDAEIAEAV
FT                   TLGVGKINISSDMKFAYFQKAREILSRETWWDPNAIYPEPINAAKEVIRYKMALFGSIG
FT                   KAALYR"
FT   misc_feature    complement(386086..386934)
FT                   /note="HMMPfam hit to PF01116, DE Fructose-bisphosphate
FT                   aldolase class-II, score 1.3e-69"
FT   CDS_pept        complement(387024..387875)
FT                   /transl_table=11
FT                   /locus_tag="ECA0339"
FT                   /product="probable sugar-bisphosphate aldolase"
FT                   /note="Similar to Escherichia coli
FT                   tagatose-1,6-bisphosphate aldolase GatY or b2096
FT                   SWALL:GATY_ECOLI (SWALL:P37192) (284 aa) fasta scores: E():
FT                   1.8e-26, 36.36% id in 286 aa, and to Escherichia coli O6
FT                   putative aldolase c4484 SWALL:AAN82920 (EMBL:AE016769) (283
FT                   aa) fasta scores: E(): 7.5e-58, 59.01% id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73258"
FT                   /db_xref="GOA:Q6DAB6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB6"
FT                   /protein_id="CAG73258.1"
FT                   /translation="MYAAMKALIDDAYQQQYAVLAINCFNLETARAAIAAAEQQRAPLI
FT                   LNVYQGHSAHFPPHLAVPLVKALAERATVPVALSLDHGTAFNLIGQAFRAGFTGLMIDA
FT                   SSYPLAENIQRTQQVVTIAATAGVCVEGELGHIADAPVYDLEDATVKMTQVEDVIPFIR
FT                   QTGIDLLAVSVGTAHGIYPAGVTPRIDFERLEALHQASTVPLALHGGSGTKADDIRRVS
FT                   RHGVAKINVGAAVFEAGKTALQQALHQYPTMELSDLLATMESACRDVVADYLSWSGSTN
FT                   KA"
FT   misc_feature    complement(387030..387875)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01116, DE Fructose-bisphosphate
FT                   aldolase class-II, score 3e-45"
FT   misc_feature    complement(387153..387176)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(387887..388978)
FT                   /transl_table=11
FT                   /locus_tag="ECA0340"
FT                   /product="PTS system, IIbc component"
FT                   /note="Similar to Escherichia coli O6 putative PTS
FT                   enzyme-II fructose c4485 SWALL:AAN82921 (EMBL:AE016769)
FT                   (363 aa) fasta scores: E(): 4.2e-116, 84.29% id in 363 aa,
FT                   and to Listeria innocua hypothetical protein Lin2240
FT                   SWALL:Q929N4 (EMBL:AL596171) (363 aa) fasta scores: E():
FT                   5.9e-68, 51.82% id in 357 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73259"
FT                   /db_xref="GOA:Q6DAB5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB5"
FT                   /protein_id="CAG73259.1"
FT                   /translation="MNTRKITVGQEIKQHLLTGISWMIPLIVAAGICIALGQVIGGPDV
FT                   GKQTGSIAWMLNQIGGWGMGLIVPLISAAIAYSIADRPGFAPGLIVGFICGQIQTGFIG
FT                   GILGGFLVGYTVLLLRRYIKLPTSMQGLMPVMILPLLSTIIAGLLMMTFIGQPIIWLQK
FT                   SLIHLLESMQGGSKFLMGAILGAMATFDFGGPVNKTMSLFADGMLVDGIYGPEAVKFVG
FT                   SMIPPFGITLSFFLTRYKYTRAEKEALKAAFPMGICMITEGVIPIAARDLFRVVASCVV
FT                   ASAIAGGLIMVWGVEAPVPHGGMFVVPLFTKPLMFCLALGIGTVICGVMLSLIKKRVTQ
FT                   ADEEFDDVDDSRVRDEDIKFTLE"
FT   misc_feature    complement(order(387986..388054,388097..388165,
FT                   388271..388330,388388..388456,388514..388582,
FT                   388610..388678,388739..388807,388850..388918))
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0340 by TMHMM2.0 at aa 21-43, 58-80, 101-123, 133-155,
FT                   175-197, 217-236, 272-294 and 309-331"
FT   misc_feature    complement(388133..388924)
FT                   /note="HMMPfam hit to PF02378, DE Phosphotransferase
FT                   system, EIIC, score 1.3e-13"
FT   CDS_pept        complement(389004..389318)
FT                   /transl_table=11
FT                   /locus_tag="ECA0341"
FT                   /product="PTS system, IIb component"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri PTS system,
FT                   fructose-like-2 IIb component 1 frwb or b3950 or c4908 or
FT                   z5506 or ecs4879 or sf4027 SWALL:PTWB_ECOLI (SWALL:P32673)
FT                   (106 aa) fasta scores: E(): 8.5e-14, 50% id in 100 aa, and
FT                   to Escherichia coli O6 pts system, fructose-like-2 IIb
FT                   component 1 c4486 SWALL:AAN82922 (EMBL:AE016769) (104 aa)
FT                   fasta scores: E(): 2.1e-27, 80.19% id in 101 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73260"
FT                   /db_xref="GOA:Q6DAB4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB4"
FT                   /protein_id="CAG73260.1"
FT                   /translation="MNIVCVAACTAGIAHTYIAREKLIKGANALNYAIKVETQGTIGTE
FT                   NELTDDEIAAADVVILAIDIKITGEERFKGKPIVRVKTEVVIKSPIKFLEKVASSLAGA
FT                   "
FT   misc_feature    complement(389013..389315)
FT                   /note="HMMPfam hit to PF02379, DE PTS system, Fructose
FT                   specific IIB subunit, score 6.8e-35"
FT   misc_feature    complement(389262..389318)
FT                   /note="Signal peptide predicted for ECA0341 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.736) with cleavage site
FT                   probability 0.445 between residues 19 and 20"
FT   CDS_pept        complement(389332..389811)
FT                   /transl_table=11
FT                   /locus_tag="ECA0342"
FT                   /product="PTS system, EIIa component"
FT                   /note="Similar to Escherichia coli O6 putative
FT                   phosphotransferase system c4487 SWALL:AAN82923
FT                   (EMBL:AE016769) (156 aa) fasta scores: E(): 1.7e-44, 79.73%
FT                   id in 153 aa, and to Listeria monocytogenes hypothetical
FT                   protein Lmo2137 lmo2137 SWALL:Q8Y5C8 (EMBL:AL591982) (157
FT                   aa) fasta scores: E(): 2.2e-23, 48.99% id in 149 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73261"
FT                   /db_xref="GOA:Q6DAB3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB3"
FT                   /protein_id="CAG73261.1"
FT                   /translation="MDINKILNANRVKLDMSATNKDEVINELTELLYADGAITNKQDFI
FT                   HDVWLREAEGSTGFENHIAIPHGKSSAVKQTTLAIGRTRQDIPWETLDGSQVRCIILFA
FT                   VRLEDQNTTHIRLLSQVASALADDEVIAQLLEESDPHKIIRLFSQYAETAPVTPT"
FT   misc_feature    complement(389362..389799)
FT                   /note="HMMPfam hit to PF00359, DE
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 1.1e-11"
FT   CDS_pept        complement(389860..391410)
FT                   /transl_table=11
FT                   /locus_tag="ECA0343"
FT                   /product="probable PTS system regulatory protein"
FT                   /note="Similar to Escherichia coli O6 putative
FT                   transcriptional antiterminator c4488 SWALL:AAN82924
FT                   (EMBL:AE016769) (532 aa) fasta scores: E(): 1.5e-115,
FT                   59.37% id in 512 aa, and to Bacillus stearothermophilus
FT                   MtlR protein SWALL:Q45419 (EMBL:U18943) (697 aa) fasta
FT                   scores: E(): 3.1e-30, 25% id in 508 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73262"
FT                   /db_xref="GOA:Q6DAB2"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB2"
FT                   /protein_id="CAG73262.1"
FT                   /translation="MMQPLTSRQNRLLKYLLQHQGYVTVKDIAHYLDVSEKTVYRDMQF
FT                   VEAFLFVWNIYPDKKVGAGIMLTTDDDRHLTLLEQQLVVDDGDTDALINNARRVKIASQ
FT                   LLSDTPHETSISKLSERYFISSASIVNDLKIIESWLHPLGLSLVRSQSGTHIEGSENQV
FT                   RQAMASLINDVMHHKEPGPLSHSRLDPGSYKALINYFGEKDVSFVEALLQDMEKALSYP
FT                   LGEPYYINIFTHTLIMMHRIAQGKALIMAEDSVHQQVDNRIFSIAQNMVTQIEQRVEST
FT                   LPSDEVWFIYQYIISSGIVMEERADNQLLRYQFSNGESRRITRALTQIFSDLINIDLRT
FT                   DKLLHEGLLIHIKPLLNRLKYQIHIRNPLLDDIKSEFIDIYEMTQQAMNEVCLRFQLKP
FT                   VAEDEVGYLTIHFQAALERQIAHKRILVVCSSGVGTSHLLKNRILRAFPDWIIVGVISA
FT                   SNMQTFCQQEDIELIISTIHLEEQLIPVVYVSAFFNDDDIKRVTEKVITNQLHQAVPH"
FT   misc_feature    complement(390166..390456)
FT                   /note="HMMPfam hit to PF00874, DE PRD domain, score
FT                   1.3e-08"
FT   misc_feature    complement(391279..391344)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1495.000, SD 4.28 at aa 23-44, sequence
FT                   VTVKDIAHYLDVSEKTVYRDMQ"
FT   CDS_pept        391922..392257
FT                   /transl_table=11
FT                   /locus_tag="ECA0344"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73263"
FT                   /db_xref="InterPro:IPR018756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB1"
FT                   /protein_id="CAG73263.1"
FT                   /translation="MKLPTYEIDHYELDDGEAINREYPDSFWIPAKAVRESLASGDFVK
FT                   LIFRMEETAGSDDLSVERMWVNVTKKHDAFYEGVLDNEPTGSDCVQCGQVVTFHSCHVI
FT                   GIYGKNE"
FT   CDS_pept        392535..394805
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="ECA0345"
FT                   /product="topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri topoisomerase IV subunit A
FT                   ParC or b3019 or z4373 or ecs3903 or sf3063
FT                   SWALL:PARC_ECOLI (SWALL:P20082) (752 aa) fasta scores: E():
FT                   0, 82.26% id in 750 aa, and to Yersinia pestis DNA
FT                   topoisomerase IV subunit A ParC SWALL:AAM87055
FT                   (EMBL:AJ414144) (757 aa) fasta scores: E(): 0, 84.94% id in
FT                   757 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73264"
FT                   /db_xref="GOA:Q6DAB0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAB0"
FT                   /protein_id="CAG73264.1"
FT                   /translation="MSEMTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLSELGQGTVDYTPNFDGTMQEPKMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPDFPTE
FT                   AEIITPRDEVRKLYQNGRGSVRMRAVWKKEDGDVVITALPHQVSGAKVLEQIASQMRAK
FT                   KLPMVEDLRDESDHENPTRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDG
FT                   RPSVKGLVEILSEWLVFRRDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRT
FT                   EDEPKPVLMRQFSLSETQAEAILELKLRHLAKLEEMKIRGEQGDLAKERDQLQALLASE
FT                   RKLSNLIKKEIQSDAQAYGDDRRSPLHERGEAKAMSEHDFVPSEPVTIVLSEMGWVRSA
FT                   KGHDIDPTGLSYKAGDSFRAAAKGKSNQPVVFIDSTGRSYALDPISMPSARGQGEPLTG
FT                   KLTPPPGATIEQVLMAADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKAL
FT                   APIEIKGEDNLLMAITAAGRMLLFPVSDLPQLSKGKGNKIVSISSADFSEGKDRLTWLY
FT                   LLPPQASVTLYFGKRKLVLRPNELQKYQGERGRKGTLLRGLQRIDRIEVDAPQQVDTGN
FT                   SEE"
FT   misc_feature    392631..393965
FT                   /note="HMMPfam hit to PF00521, DE DNA gyrase/topoisomerase
FT                   IV, subunit A, score 1.3e-255"
FT   misc_feature    393216..393245
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   CDS_pept        394956..395693
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /gene_synonym="parF"
FT                   /locus_tag="ECA0346"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="Similar to Escherichia coli
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC or ParF
FT                   or b3018 SWALL:PLSC_ECOLI (SWALL:P26647) (245 aa) fasta
FT                   scores: E(): 2e-77, 75.41% id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73265"
FT                   /db_xref="GOA:Q6DAA9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA9"
FT                   /protein_id="CAG73265.1"
FT                   /translation="MLSILRFFVVVIFSILICIFGLFYCLFSPRNPRHVATFGRLFGRL
FT                   SVVFGLKVEMRIPEEAAHYGNCIYIANHQNNYDMVTVSSAVQPRTVTVGKKSLLWIPFF
FT                   GPLYWLTGNLLIDRENRAKAHGTIAQVVKHIKERNTSIWMFPEGTRSRGRGLMPFKTGA
FT                   FHAAISAEVPIVPICVSTTSNKVKLNRWNNGIVIVEMLPPIDTRVYTKDQVRELATHCH
FT                   DVMAAKIAELDAEVAAREAANKK"
FT   misc_feature    394956..395060
FT                   /note="Signal peptide predicted for ECA0346 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.787) with cleavage site
FT                   probability 0.777 between residues 35 and 36"
FT   misc_feature    395127..395651
FT                   /note="HMMPfam hit to PF01553, DE Acyltransferase, score
FT                   9.9e-56"
FT   CDS_pept        395766..397181
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="ECA0347"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Escherichia coli protein sufi precursor
FT                   SufI or b3017 SWALL:SUFI_ECOLI (SWALL:P26648) (470 aa)
FT                   fasta scores: E(): 2.8e-137, 70.87% id in 467 aa, and to
FT                   Yersinia pestis putative cell division protein SufI or
FT                   ypo0673 or y3504 SWALL:Q8ZI41 (EMBL:AJ414144) (474 aa)
FT                   fasta scores: E(): 1.9e-150, 77.91% id in 471 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73266"
FT                   /db_xref="GOA:Q6DAA8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DAA8"
FT                   /protein_id="CAG73266.1"
FT                   /translation="MSLNRRQFIQASGLALCAGMTPLAAKASGNPAALPIPPLLESRRG
FT                   QPLFLTMQRAHWAFSGDRKTSIWGINGRYLGPTVRVYDGDDVKLIYSNRLNEPVAMTIG
FT                   GLQVPGPLMGGAARIISPGGDWSPVLPIRQSSATCWYHANTPNRMAPHIYNGLVGLWLV
FT                   EDSTSKSLPLPNHYGVDDFPLIIQDKRLDNFGVPLYNPPSSGGFVGDSLLVNGVQSPFV
FT                   EVSRGWVRLRLLNASNSRRYVMRLSDGRAMNVIASDQGLLPAPMAVNQLSLAPGERREI
FT                   LIDMSQGEEVTLTAGESAGIMDRLRGLFEPSSILISTQILTLKPTGLLPLVTDNLPMRL
FT                   LADNIIEGSISRTREFRLGDSLPGINGAMWDMTRADVQTQLGRCERWIIHADTPQAFHI
FT                   QGVKFLVRSANGRPPAVEDSGWKDTVWIDNDVELLVYFMQPSSMAFPFLYYSQTLELAD
FT                   RGSTGQLIVQSAM"
FT   misc_feature    395766..395846
FT                   /note="Signal peptide predicted for ECA0347 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.551 between residues 27 and 28"
FT   misc_feature    396285..396731
FT                   /note="HMMPfam hit to PF00394, DE Multicopper oxidase,
FT                   score 0.17"
FT   CDS_pept        397546..398283
FT                   /transl_table=11
FT                   /locus_tag="ECA0348"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hypothetical transcriptional
FT                   regulator YegW SWALL:YEGW_ECOLI (SWALL:P76420) (248 aa)
FT                   fasta scores: E(): 3.2e-22, 30.8% id in 237 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73267"
FT                   /db_xref="GOA:Q6DAA7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA7"
FT                   /protein_id="CAG73267.1"
FT                   /translation="MRELLLWLRDQLAGASSAPRYIQLASLLESEIGRRKTLSGQFLPA
FT                   ERLIAQQLGLSRVTVSRSLSLLEEKGLVTRQQGVGTRVTQRLNYALSAEDEGFTALVLK
FT                   QGGIAGSLWLERSIQVPPASIAEKMSLPEGEAVTYLRRVRLSNGEPVSLETTWIPQKFL
FT                   PDPETLEQSLYQYWITGGVIPDKKRYRFKAIACAAEIATLLGIAAEAPALYCQLHVYNE
FT                   QGELLEYSEAHCRSDVYEIQFAD"
FT   misc_feature    397615..397794
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 8.9e-13"
FT   misc_feature    397672..397746
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    397675..397740
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1042.000, SD 2.74 at aa 44-65, sequence
FT                   PAERLIAQQLGLSRVTVSRSLS"
FT   CDS_pept        complement(398326..399153)
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="ECA0349"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /EC_number="1.1.1.274"
FT                   /note="Similar to Escherichia coli 2,5-diketo-D-gluconic
FT                   acid reductase A DkgA or b3012 SWALL:DKGA_ECOLI
FT                   (SWALL:Q46857) (275 aa) fasta scores: E(): 1e-80, 72.42% id
FT                   in 272 aa. In Salmonella typhi this is a putative
FT                   pseudogene but it is apparently intact here."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73268"
FT                   /db_xref="GOA:Q6DAA6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA6"
FT                   /protein_id="CAG73268.1"
FT                   /translation="MTQPKVKLADGNIMPQLGLGVWRASSEDTVIAVNEALSIGYRAID
FT                   TAAIYKNEEAVGQALSSANLPREEVFITTKLWNGDHTDPQKALEESLRKLRLDYIDLYL
FT                   IHWPLPQQNTFVDAWRGLIKLQEQGLAKSIGVSNFHIHHLQRLKEETGVLPVIDQVELH
FT                   PLLQQKQLHAWNATHHIQTESWSPLAQGGEGVFDHPIIRKLAMKYGKTPAQIVIRWHLD
FT                   SGLVVIPKSVTPARIKENFEVFDFRLDKDELSEITKLDCGKRLGSDPDEPRND"
FT   misc_feature    complement(398365..399132)
FT                   /note="HMMPfam hit to PF00248, DE Aldo/keto reductase
FT                   family, score 1.3e-117"
FT   misc_feature    complement(398425..398472)
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   misc_feature    complement(398737..398790)
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT   misc_feature    complement(398983..399036)
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT   CDS_pept        complement(399423..400586)
FT                   /transl_table=11
FT                   /locus_tag="ECA0350"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /note="Similar to Yersinia pestis putative iron-containing
FT                   alcohol dehydrogenase ypo0678 SWALL:Q8ZI38 (EMBL:AJ414144)
FT                   (385 aa) fasta scores: E(): 3.8e-112, 76.94% id in 386 aa,
FT                   and to Escherichia coli hypothetical oxidoreductase YqhD
FT                   SWALL:YQHD_ECOLI (SWALL:Q46856) (387 aa) fasta scores: E():
FT                   3e-108, 73.64% id in 387 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73269"
FT                   /db_xref="GOA:Q6DAA5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA5"
FT                   /protein_id="CAG73269.1"
FT                   /translation="MLNFTLHTPTKILFGEGQIAELGKEIPADARILITYGGGSVKHNG
FT                   VLDQVYRALEGRNVREFSGIEPNPTYETLMKAVEVVRAEKIDFLLAVGGGSVVDGTKFI
FT                   AAAADYQAAQDPWHILQTGGAEIDRGVALAAVLTLPATGSESNNGAVITRKSTNDKLAF
FT                   RSRYTQPLFAVLDPVVTYTLPARQIANGVVDAFVHTVEQYLTYSVDAKVQDRFAEGLLL
FT                   TLVEEGPRALAEPENYKVRANVMWSATMALNGLIGAGVPQDWSTHMLGHELTALHGLDH
FT                   AQTLAIVLPAMLTARKAQKRDKLLQYAERVWNLRDGSEDQRIDGAIAATRDFFEKMGVP
FT                   TLLSDYQLDGSSIPTLVAKLSEHGLTALGEHRDITLEESQKIYEAAR"
FT   misc_feature    complement(399450..400562)
FT                   /note="HMMPfam hit to PF00465, DE Iron-containing alcohol
FT                   dehydrogenase, score 8e-39"
FT   misc_feature    complement(399735..399797)
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   misc_feature    complement(399984..400070)
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   CDS_pept        complement(400590..401330)
FT                   /transl_table=11
FT                   /locus_tag="ECA0351"
FT                   /product="probable nitroreductase"
FT                   /note="Similar to Bacillus subtilis nitro/flavin reductase
FT                   NfrA or NfrA1 or Ipa-43D SWALL:NFRA_BACSU (SWALL:P39605)
FT                   (249 aa) fasta scores: E(): 5.2e-19, 29.83% id in 248 aa,
FT                   and to Clostridium acetobutylicum ortholog ycnd b.subtilis,
FT                   nitroreductase cac0718 SWALL:Q97L47 (EMBL:AE007587) (246
FT                   aa) fasta scores: E(): 1.2e-42, 45.49% id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73270"
FT                   /db_xref="GOA:Q6DAA4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA4"
FT                   /protein_id="CAG73270.1"
FT                   /translation="MNKTTELFTSHRSERSYLDKPIPDDVLDAIIQSAHLAPTSVNSQQ
FT                   VSLIVTRDPERKARIAELAGGQPWIAKAPVFITVVLDMHKTQLGIAMSGKQQHAHESLE
FT                   SLIAGTTDVGIALGTLMAAARSFGLGIVPIGGIRREPQELIDFLQLPELTFPVAGVAIG
FT                   YVDTPAHQKPRLPLNSFRHDETYHQDVLPAAIEQYNHTLVTHWQQTGRADGDNWGDNTA
FT                   SYYQHIYFPKVLPAILQQGFKLDK"
FT   misc_feature    complement(400815..401324)
FT                   /note="HMMPfam hit to PF00881, DE Nitroreductase family,
FT                   score 9.6e-26"
FT   CDS_pept        401582..402547
FT                   /transl_table=11
FT                   /locus_tag="ECA0352"
FT                   /product="AraC-family trancriptional regulator"
FT                   /note="Similar to Yersinia pestis AraC-family regulatory
FT                   protein ypo0679 SWALL:AAM87046 (EMBL:AJ414144) (297 aa)
FT                   fasta scores: E(): 3.2e-77, 66.21% id in 296 aa, and to
FT                   Escherichia coli hypothetical transcriptional regulator
FT                   YqhC SWALL:YQHC_ECOLI (SWALL:Q46855) (318 aa) fasta scores:
FT                   E(): 1.2e-66, 57.77% id in 296 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73271"
FT                   /db_xref="GOA:Q6DAA3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA3"
FT                   /protein_id="CAG73271.1"
FT                   /translation="MLTENQGISTESQREQLVQQQTVRQRIVQQAIRCSTKSWVTPSLV
FT                   PQVKILYTEQHHPRVPVMYEPTIVIIFQGQKIGYLGGKTFQYDPENYLLMTVPLPFECE
FT                   TIASVENPLVGMSISIDIQMLQDLLIDIGDDDSAIRPCSCTCGVNSAPLSDEILCAVER
FT                   LLDAMNSPRDARVLGPTIVREIIYHMLCGESGAALQALVNRHTHFSQIAKALRRIENHY
FT                   ADNLNVEQLAAEVNMSVSAFHHNFKAVTNTSPLQYLKSYRLHKARVMMINDGLRAGVAA
FT                   ARVGYESASQFSREFKRYFGATPGDEVTRLKATNMAVEEG"
FT   misc_feature    402209..402343
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    402221..402358
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 3.3e-11"
FT   misc_feature    402257..402322
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1308.000, SD 3.64 at aa 226-247, sequence
FT                   LNVEQLAAEVNMSVSAFHHNFK"
FT   misc_feature    402377..402508
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 6.6e-05"
FT   CDS_pept        complement(402577..403236)
FT                   /transl_table=11
FT                   /locus_tag="ECA0353"
FT                   /product="putative DedA-family membrane protein"
FT                   /note="Similar to Yersinia pestis putative DedA-family
FT                   membrane protein ypo0680 SWALL:Q8ZI36 (EMBL:AJ414144) (220
FT                   aa) fasta scores: E(): 1.6e-66, 75.11% id in 217 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 hypothetical protein YghB SWALL:YGHB_ECOLI
FT                   (SWALL:P33196) (219 aa) fasta scores: E(): 1e-60, 69.3% id
FT                   in 215 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73272"
FT                   /db_xref="GOA:Q6DAA2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA2"
FT                   /protein_id="CAG73272.1"
FT                   /translation="MSMVHDIIQALWQQDFSALADPHVIWVIYGILFTTLFLENGLLPA
FT                   SFLPGDSLLLLTGAMIAKGVMSFFPTMILLTIAASLGCWLSYLQGRWLSDTRLVKGWLL
FT                   QLPAHYHQRAYHLFHRHGMTALLVGRFLAFIRTLLPTMAGISGLNNTRFQIFNWLSGLL
FT                   WVGGIVTLGYALSHIPLVKRYEDQVMTALILLPVILLVSGLIGMAVIVWRKKRTVA"
FT   misc_feature    complement(order(402601..402669,402697..402765,
FT                   402973..403041,403099..403167))
FT                   /note="4 probable transmembrane helices predicted for
FT                   ECA0353 by TMHMM2.0 at aa 24-46, 66-88, 158-180 and
FT                   190-212"
FT   misc_feature    complement(402667..403149)
FT                   /note="HMMPfam hit to PF00597, DE DedA family, score
FT                   4.3e-53"
FT   CDS_pept        complement(403671..404861)
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="ECA0354"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="Similar to Escherichia coli cystathionine beta-lyase
FT                   MetC or b3008 SWALL:METC_ECOLI (SWALL:P06721) (395 aa)
FT                   fasta scores: E(): 8.3e-124, 73.85% id in 394 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73273"
FT                   /db_xref="GOA:Q6DAA1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA1"
FT                   /protein_id="CAG73273.1"
FT                   /translation="MTSKKTATALVAAGRSKKFTHGSVNPVIQRASSLVFDTVQDKKHA
FT                   TINRAKGALFYGRRGTLTHFSFQEAMVELEGGVGCALYPCGAAAISNAILSFVAAGDHI
FT                   LVTESAYEPTQDFCTKVLNKLNVSTTYFDPLIGADIAELIQPNTKVVFLESPGSITMEV
FT                   HDVPAIVQAVRLINPEIVIMIDNTWAAGILFKAFDFDIDISIQAGTKYIVGHSDAMIGT
FT                   AVANERCWVQLREHSYLMGQMVDADTAYVASRGLRTLGVRLKQHQESSIRIAKWLAERP
FT                   EVAVVNHPALPGCKGHEFYERDFNGCNGLFSFVLKEKLSKETLAHYLDHFEHFSMAYSW
FT                   GGFESLILANQPEELAALRPVSGVDFTGTLIRLHIGLEDSDDLIDDLVAGFGRLGA"
FT   misc_feature    complement(403686..404843)
FT                   /note="HMMPfam hit to PF01053, DE Cys/Met metabolism
FT                   PLP-dependent enzyme, score 4.6e-153"
FT   misc_feature    complement(404214..404258)
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(405197..406489)
FT                   /transl_table=11
FT                   /locus_tag="ECA0355"
FT                   /product="putative DedA-family membrane protein"
FT                   /note="Similar to Yersinia pestis putative c4-dicarboxylate
FT                   transporter, large subunit ypo1577 SWALL:AAM86142
FT                   (EMBL:AJ414149) (430 aa) fasta scores: E(): 2.6e-146,
FT                   92.09% id in 430 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73274"
FT                   /db_xref="GOA:Q6DAA0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DAA0"
FT                   /protein_id="CAG73274.1"
FT                   /translation="MDAFILVATLAVLLAVGVPVAYAVGLSAIVGAFWIDLPLEAVMIQ
FT                   ITNGVNKFSLLAIPFFILAGAIMAEGGIARRLVSFAYIFVGFIRGGLSLVNIVASTFFG
FT                   AISGSSVADTASIGSVMIPEMEKKGYPRDFSAAVTASGSVQAILTPPSHNSVIYSLATG
FT                   GTVSIASLFIAGILPGLLLSLTLMVMCVGFAHRRGYPKGERVPFRQALKIFVDTLWGLM
FT                   TVVIIMGGILSGIFTATESAAIACLWSFFVTMFIYKDYKWSELPKLMYRTVKTVTIVMI
FT                   LIGFAAAFGAIMTYMQLPSRITEFFTSISDNKYVILMWINIMLLLVGTLMDMAPLILIL
FT                   TPVLLPVALSLGIDPVHFGMIMLVNLGIGLITPPVGSVLFVASAVSKQKIEQVVKAMLP
FT                   FYCGLFFVLMLVTYIPAISLWLPKFFGVHTG"
FT   misc_feature    complement(order(405230..405298,405335..405403,
FT                   405431..405484,405497..405550,405593..405661,
FT                   405719..405772,405782..405850,405911..405979,
FT                   406181..406249,406268..406327,406385..406453))
FT                   /note="11 probable transmembrane helices predicted for
FT                   ECA0355 by TMHMM2.0 at aa 13-35, 55-74, 81-103, 171-193,
FT                   214-236, 240-257, 277-299, 314-331, 336-353, 363-385 and
FT                   398-420"
FT   misc_feature    complement(405617..406099)
FT                   /note="HMMPfam hit to PF00597, DE DedA family, score
FT                   0.0021"
FT   misc_feature    complement(406421..406489)
FT                   /note="Signal peptide predicted for ECA0355 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.987 between residues 23 and 24"
FT   CDS_pept        complement(406505..407011)
FT                   /transl_table=11
FT                   /locus_tag="ECA0356"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative C4-dicarboxylate
FT                   transporter, small subunit ypo1578 SWALL:Q8ZFV0
FT                   (EMBL:AJ414149) (168 aa) fasta scores: E(): 5.2e-51, 70.83%
FT                   id in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73275"
FT                   /db_xref="GOA:Q6DA99"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA99"
FT                   /protein_id="CAG73275.1"
FT                   /translation="MAQSYHLSMDVLYRIAMWVSGLALLIMTLIIPIGIFARYALNSAL
FT                   SWPEPISIICMVTFTFVGAAVSYRANSHIAVSMLTDRLPESGKKICVHLSNLLMLLISL
FT                   FILYYSTVLCMELWEQPVAEFPLLTAGESYLPLPIGSLITVLFIIEKMFFGPQDQRPVV
FT                   MLGSS"
FT   misc_feature    complement(order(406565..406633,406676..406744,
FT                   406805..406864,406907..406975))
FT                   /note="4 probable transmembrane helices predicted for
FT                   ECA0356 by TMHMM2.0 at aa 13-35, 50-69, 90-112 and 127-149"
FT   CDS_pept        complement(407348..408325)
FT                   /transl_table=11
FT                   /locus_tag="ECA0357"
FT                   /product="substrate-binding periplasmic protein"
FT                   /note="Similar to Rhodobacter capsulatus
FT                   C4-dicarboxylate-binding periplasmic protein precursor DctP
FT                   SWALL:DCTP_RHOCA (SWALL:P37735) (333 aa) fasta scores: E():
FT                   2.3e-25, 31.3% id in 329 aa, and to Yersinia pestis
FT                   putative C4-dicarboxylate transporter, periplasmic protein
FT                   ypo1579 SWALL:Q8ZFU9 (EMBL:AJ414149) (330 aa) fasta scores:
FT                   E(): 5.7e-94, 75.45% id in 330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73276"
FT                   /db_xref="GOA:Q6DA98"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA98"
FT                   /protein_id="CAG73276.1"
FT                   /translation="MKLSKTLIGVCLGSTALLMSQAIQAQQIKASDVHPEGYPNVVAVQ
FT                   KMGEKLQAATNGRLEINTFPGGVLGDEKQMIEQAQLGAIDIIRVSMTPVAAILPEIEVF
FT                   TLPYIFRDEDHLHKVLDGKIGQEIGDKITHSSKSKLVFLGWMDAGTRNLITKQPVAKPE
FT                   DLKGMKIRVQTSQVALATLKAMGANAIAMGTSEVFSGMQTGVIDGTENNPPTYVAHNYM
FT                   PVAKNFTWSRHFIIPELFLYSKAKWDKLSKEDQDLILKLAKEAQQEQRVLWNEYNQQSL
FT                   DKMKAGGVQFHEIDTEYYFKATQPVRDQFGAKYQELIKAVADVQ"
FT   misc_feature    complement(407384..408238)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 1.1e-82"
FT   misc_feature    complement(408251..408325)
FT                   /note="Signal peptide predicted for ECA0357 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.921 between residues 25 and 26"
FT   CDS_pept        409087..410001
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="ECA0358"
FT                   /product="biopolymer transport protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 biopolymer transport ExbB protein ExbB or b3006 or
FT                   z4359 or ecs3890 SWALL:EXBB_ECOLI (SWALL:P18783) (244 aa)
FT                   fasta scores: E(): 9.3e-57, 75.2% id in 242 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73277"
FT                   /db_xref="GOA:Q6DA97"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA97"
FT                   /protein_id="CAG73277.1"
FT                   /translation="MLVILLCTAGLSGNAFAAPATTPLSTQNAAQPAAASPSAPVTTDA
FT                   QAPTSALTLPASAAPGTNNLMKTDLSVWGMYQHADAVVKTVMIGLLLASVITWAIFFSK
FT                   SVEMSGAKRRLRREYLALEQAKTLDDALETADAFKTGSVAQQLLADAQNELDLSARSDD
FT                   NNGIKERTAFRLERRVAATGRHMGRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQT
FT                   QTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSIAGYKATVGDVAAQVLLLQS
FT                   RDLDVAASNDNRASSAAHKLRVG"
FT   misc_feature    order(409087..409140,409327..409395,409657..409725,
FT                   409795..409863)
FT                   /note="4 probable transmembrane helices predicted for
FT                   ECA0358 by TMHMM2.0 at aa 25-47, 110-132, 220-242 and
FT                   266-288"
FT   misc_feature    409492..409908
FT                   /note="HMMPfam hit to PF01618, DE MotA/TolQ/ExbB proton
FT                   channel family, score 1.2e-50"
FT   CDS_pept        410005..410430
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="ECA0359"
FT                   /product="biopolymer transport protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri biopolymer
FT                   transport ExbD protein SWALL:EXBD_ECOLI (SWALL:P18784) (141
FT                   aa) fasta scores: E(): 2.1e-36, 68.79% id in 141 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73278"
FT                   /db_xref="GOA:Q6DA96"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA96"
FT                   /protein_id="CAG73278.1"
FT                   /translation="MAMHLKEDVGDDGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   RVDLPASSAVPQPRPEKPLYLTVKADKQMFLGEEAINDQSLAQVLDAKTSANKETTIFF
FT                   QADKSVDYETIMSVMDSLRKAGYLKVGLVGAESAAAK"
FT   misc_feature    410035..410415
FT                   /note="HMMPfam hit to PF02472, DE Biopolymer transport
FT                   protein ExbD/TolR, score 1.8e-20"
FT   misc_feature    410062..410130
FT                   /note="1 probable transmembrane helix predicted for ECA0359
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        complement(410542..411561)
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="ECA0360"
FT                   /product="sucrose operon repressor"
FT                   /note="Similar to Erwinia amylovora repressor scrR
FT                   SWALL:Q9F497 (EMBL:AJ250722) (342 aa) fasta scores: E():
FT                   4.7e-86, 65.46% id in 333 aa, and to Klebsiella pneumoniae
FT                   sucrose operon repressor scrR SWALL:SCRR_KLEPN
FT                   (SWALL:P37076) (334 aa) fasta scores: E(): 5.5e-88, 65.07%
FT                   id in 335 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73279"
FT                   /db_xref="GOA:Q6DA95"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA95"
FT                   /protein_id="CAG73279.1"
FT                   /translation="MKPTKRITISDIAALAGVSKSTASLVLNGRSKEFRVSDETRDRIL
FT                   AVAHEQRYQPSIHARSLRSSRSNTLGLVVPEMTNYGFAVISRELEMRCREAGLQLLIAC
FT                   TDENASQEMMAVNSLVQRQVDGLIVASSLLSDIEYQKINQQLPVVQFDRIIGDSTLPMV
FT                   ISEAVESTAEMVERIARQHRDEFYFLGGQPRISPTRHRLEGFQLGLTRAGIECQPEWIL
FT                   HGNYHPSAGYEMFAQLCATLGRPPKALFVAACGLMEGVLRYMNQHNLMESGIRLCCFDD
FT                   HYLFDCLPLKIDTVAQDCENLARNSFEMITSLIAQQPLEEDRRYIPTRIHWRHPDSRA"
FT   misc_feature    complement(410560..411363)
FT                   /note="HMMPfam hit to PF00532, DE Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family, score
FT                   4.4e-05"
FT   misc_feature    complement(411466..411549)
FT                   /note="HMMPfam hit to PF00356, DE Bacterial regulatory
FT                   proteins, lacI family, score 2.3e-10"
FT   misc_feature    complement(411478..411543)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1816.000, SD 5.37 at aa 7-28, sequence
FT                   ITISDIAALAGVSKSTASLVLN"
FT   misc_feature    complement(411481..411537)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT   CDS_pept        complement(411592..413001)
FT                   /transl_table=11
FT                   /gene="scrB"
FT                   /locus_tag="ECA0361"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /note="Similar to Erwinia amylovora sucrose hydrolase,
FT                   invertase ScrB SWALL:Q9F498 (EMBL:AJ250722) (469 aa) fasta
FT                   scores: E(): 5.2e-132, 62.47% id in 469 aa, and to
FT                   Klebsiella pneumoniae sucrose-6-phosphate hydrolase ScrB
FT                   SWALL:SCRB_KLEPN (SWALL:P27217) (465 aa) fasta scores: E():
FT                   1.3e-110, 55.19% id in 462 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73280"
FT                   /db_xref="GOA:Q6DA94"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA94"
FT                   /protein_id="CAG73280.1"
FT                   /translation="MKEVHLVKRMAHALMSGHSRKQEDPYRPEWHLSPCVGLLNDPNGF
FT                   IHHNGRYHLFYQWNPLACAHGAKFWGHWSSADLVNWKHEPVALVPSESYESHGCYSGSA
FT                   VVDHGAITLIYTGNVKYDDGSRTAFQCLARENPNGEYDKLGAVLTLPDGYTGHVRDPKV
FT                   WRHGDHWYMVLGAQDLDLQGKVVLYRSADLLAWEKIAEIAGSRLGGLGDFGYMWECPDL
FT                   FPLDGEDILICCPQGVPAEDERYLNTFQAGYFIGSLDYENGDYSHQGFHELDLGFEFYA
FT                   PQTTLSEDGRRLLFGWMSIPDDNEFFEPTIEHGWIHTMTCARELTLHDDRVYQRPAREL
FT                   QQLRRQHYTWRGAADYASPLPISSAEVLITVQGEFQLNLASQLVLCWDGERVTISRRNR
FT                   RTGEPEHRYWRGDLRQLQILCDRSSVEIFINDGEAVMSARTFPESEATMTFSGSGQLTL
FT                   QHWLLAPCVIE"
FT   misc_feature    complement(411706..412911)
FT                   /note="HMMPfam hit to PF00251, DE Glycosyl hydrolases
FT                   family 32, score 3.2e-162"
FT   misc_feature    complement(412870..412911)
FT                   /note="PS00609 Glycosyl hydrolases family 32 active site."
FT   CDS_pept        complement(413001..414371)
FT                   /transl_table=11
FT                   /gene="scrA"
FT                   /locus_tag="ECA0362"
FT                   /product="PTS system, sucrose-specific IIbc component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to Klebsiella pneumoniae PTS system,
FT                   sucrose-specific IIbc component ScrA SWALL:PTSB_KLEPN
FT                   (SWALL:P27219) (456 aa) fasta scores: E(): 2.1e-142, 80.92%
FT                   id in 456 aa, and to Erwinia amylovora enzyme II ScrA
FT                   SWALL:Q9F499 (EMBL:AJ250722) (457 aa) fasta scores: E():
FT                   9e-140, 80.97% id in 452 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73281"
FT                   /db_xref="GOA:Q6DA93"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA93"
FT                   /protein_id="CAG73281.1"
FT                   /translation="MDINATAAALIPLLGGKENIASAAHCATRLRLVLNDDSLADKKAI
FT                   ENVDGVKGCFQNAGQMQIIFGTGLVNKVYAEFIKAAGISESSKSEAASIAARKLNPLQR
FT                   LARLLSNIFVPIMPAIIASGLLMGLLGMIKTYGWVDANSAIFVMLDMFSSAAFIILPVL
FT                   IGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAGGFQTMHFFGMDIAMIGYQGTVFP
FT                   VLLAVWFMSLVEKRLRKVVPDALDIIVTPFLTVIISGFVAMLLIGPAGRALGDGISLVL
FT                   STLIAHAGWFAGLLFGGLYSVIVITGVHHSFHAIEAGLLGNPNIGVNFLLPIWAMANVA
FT                   QGGACLAVYFKTRDAKTRAIAVPAGLSCLLGITEAAIFGINLRFIKPFLAALAGGALGG
FT                   AWVVFNHVNMTAVGLTGFPGLAIVQGGSMLNYLIGMLIAFGAAFVISLLLKYKTDSE"
FT   misc_feature    complement(order(413025..413093,413151..413210,
FT                   413229..413297,413355..413423,413460..413528,
FT                   413571..413639,413673..413741,413784..413852,
FT                   413871..413939,413982..414050))
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0362 by TMHMM2.0 at aa 108-130, 145-167, 174-196,
FT                   211-233, 245-267, 282-304, 317-339, 359-381, 388-407 and
FT                   427-449"
FT   misc_feature    complement(413184..414047)
FT                   /note="HMMPfam hit to PF02378, DE Phosphotransferase
FT                   system, EIIC, score 2.6e-86"
FT   misc_feature    complement(413733..413780)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT   misc_feature    complement(414249..414353)
FT                   /note="HMMPfam hit to PF00367, DE phosphotransferase
FT                   system, EIIB, score 2.1e-17"
FT   misc_feature    complement(414264..414317)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   CDS_pept        complement(414451..415986)
FT                   /transl_table=11
FT                   /gene="scrY"
FT                   /locus_tag="ECA0363"
FT                   /product="putative sucrose porin"
FT                   /note="Similar to Klebsiella pneumoniae sucrose porin
FT                   precursor ScrY SWALL:SCRY_KLEPN (SWALL:P27218) (505 aa)
FT                   fasta scores: E(): 1.3e-125, 63.33% id in 510 aa, and to
FT                   Erwinia amylovora porin ScrY SWALL:Q9F4A0 (EMBL:AJ250722)
FT                   (514 aa) fasta scores: E(): 8.5e-118, 62.57% id in 521 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73282"
FT                   /db_xref="GOA:Q6DA92"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA92"
FT                   /protein_id="CAG73282.1"
FT                   /translation="MKPSHLAVTIGLLLSAPFYVSAANTDSIEDRLNAMEQRLQQAEAR
FT                   AQAAEARANAAEKQTQQLATRTTQTEQKTQQVEQRTTALAKQKSFSDGFEFHGYARSGL
FT                   SINDSATSAKTDIGPGMSPAGQTGGHIGRLGNEDDTYVELKLEHKQKLDNGATTRFKVM
FT                   MADGQRSYNDWTATTSDLNIREAFVELGSLPTFTDVFKDTTLWAGKRFDRDNFDIHWLD
FT                   SDVVFLAGTGGGIYDVKWADSAKSNFSLYGRSLGEITSLDNDIKNYVFTANNYVGPFQF
FT                   MLSGLTAKNNDVKENTGTSRDNITVTNTNAGGKGYHAMVAYHGDSFYGLRDGTSKTAIL
FT                   YGHGLGGEVKSIGSDGNLTNDANTWRFATYGTTALNKTWSFAPSILAQTSKDRYVSGDS
FT                   YEWVTFNARLIQEITENFALAYEGSYQYMGLDPRGYRSLNQVSGGFYKLTFAPTFKVGD
FT                   IGNFFSRPELRVFASYMDWDKRLDNYSNDDTFGSTGFKAGGEWNFGIQMETWF"
FT   misc_feature    complement(414457..415701)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02264, DE LamB porin, score
FT                   1.4e-146"
FT   misc_feature    complement(415921..415986)
FT                   /note="Signal peptide predicted for ECA0363 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.992 between residues 22 and 23"
FT   CDS_pept        complement(416177..417112)
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /gene_synonym="cscK"
FT                   /locus_tag="ECA0364"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="Similar to Escherichia coli fructokinase CscK
FT                   SWALL:SCRK_ECOLI (SWALL:P40713) (307 aa) fasta scores: E():
FT                   4.5e-67, 60.39% id in 303 aa, and to Erwinia amylovora
FT                   fructokinase ScrK SWALL:Q9F4A1 (EMBL:AJ250722) (308 aa)
FT                   fasta scores: E(): 1.6e-65, 60.06% id in 303 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73283"
FT                   /db_xref="GOA:Q6DA91"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA91"
FT                   /protein_id="CAG73283.1"
FT                   /translation="MANKIWVMGDAVVDLIPEDTERYLKCPGGAPANVAVGIARLGGNS
FT                   AFVGRVGDDVFGHFLKTVLEEENVDTHYMAYDRHHRTSTVVVSLDDAGERTFTFMVRPS
FT                   ADLFLQPEDLPVFNRREWLHLCSIALSQEPSRSTAFEAMRQIKAALGRVCFDPNIRDDL
FT                   WQSEQELRDCLTQALMLADVVKLSCEELTFLCPTSDVEEGIQQFMLRYPTRLLLVTLGS
FT                   EGVWLHDRHQLQHFAAPSVTPVDTTGAGDAFVAGLLHGLAEYDDLSQPLSWDPIIEQAQ
FT                   RCGALATTAKGAMTALPYAQQLYTLPLAKV"
FT   misc_feature    complement(416213..417109)
FT                   /note="HMMPfam hit to PF00294, DE pfkB family carbohydrate
FT                   kinase, score 9.5e-98"
FT   misc_feature    complement(416339..416380)
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   misc_feature    complement(416957..417031)
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT   CDS_pept        417455..418135
FT                   /transl_table=11
FT                   /locus_tag="ECA0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo4112 SWALL:AAM87668 (EMBL:AJ414160) (223 aa) fasta
FT                   scores: E(): 2e-10, 30% id in 190 aa, and to Proteus
FT                   mirabilis CcM1 protein SWALL:O86433 (EMBL:AJ000084) (228
FT                   aa) fasta scores: E(): 1.1e-08, 32.06% id in 131 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73284"
FT                   /db_xref="GOA:Q6DA90"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA90"
FT                   /protein_id="CAG73284.1"
FT                   /translation="MVVVWLVDIYSEFSLHYYGQGVAAMLATSAVIAFFYTVKRNNTMF
FT                   SFDKNKKDLKEPQGRSEINSSPAISPSNELINSVNPVRVKKDTFISQGARMTGSLSVDG
FT                   NITVEGQVEGDVQCDNTIKVEHTGQVNGEMKSQQIVINGRVEGRVVASVVAILAQGKVF
FT                   GDIFTDELSIEKGGIFTGQSHPLTSPTQSQEKLTYVEKKKEKTGKMPAGQENVVVLAES
FT                   APTA"
FT   CDS_pept        418295..418606
FT                   /transl_table=11
FT                   /locus_tag="ECA0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c3274 SWALL:AAN81723 (EMBL:AE016765) (103 aa) fasta scores:
FT                   E(): 2.1e-22, 55.34% id in 103 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73285"
FT                   /db_xref="GOA:Q6DA89"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA89"
FT                   /protein_id="CAG73285.1"
FT                   /translation="MHVISRAPFDAATNQFPNQAVALADLYRVIKREMYATPEDMKKRF
FT                   PSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKIFIKHITSHAEYDRLTEYYRRNKE"
FT   CDS_pept        418603..419019
FT                   /transl_table=11
FT                   /locus_tag="ECA0367"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   YgjM c3273 SWALL:AAN81722 (EMBL:AE016765) (139 aa) fasta
FT                   scores: E(): 1.1e-21, 50% id in 134 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73286"
FT                   /db_xref="GOA:Q6DA88"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA88"
FT                   /protein_id="CAG73286.1"
FT                   /translation="MMYADAIKAANDLTSIVPFLGGSTSRKDYEDALKLTEYLIESEPD
FT                   SSLIDMLTAKIDKYENEAPEFAAFNERIKALPAGIALLRVLMDQHQLMQSDFEAEIGKK
FT                   SLVSRILNGERTLTLAHMRALAKRFNIPVSAFVD"
FT   misc_feature    418849..419010
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   1.9e-05"
FT   CDS_pept        419222..419680
FT                   /transl_table=11
FT                   /locus_tag="ECA0368"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA87"
FT                   /protein_id="CAG73287.1"
FT                   /translation="MKVEAAESSVFASQQVMAKRSTEHAEKVALSEQLQSYQASSGAVP
FT                   AGQTTRYDFTRISPAELYETVGSLVSSGQLGREEGSALLGFISSPRANVGSVPPSNVFQ
FT                   PINVFDTIQQGAAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV"
FT   misc_feature    419429..419515
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(419778..421130)
FT                   /transl_table=11
FT                   /locus_tag="ECA0369"
FT                   /product="putative pyridoxal-dependent decarboxylase"
FT                   /note="Similar to Rhizobium meliloti putative amino acid
FT                   decarboxylase, pyridoxal-dependent protein rb1241
FT                   SWALL:Q92U95 (EMBL:AL603646) (473 aa) fasta scores: E():
FT                   3.5e-54, 42.5% id in 440 aa, and to Polyangium cellulosum
FT                   aromatic amino acid decarboxylase Ddc SWALL:Q9L402
FT                   (EMBL:AJ270937) (512 aa) fasta scores: E(): 1.4e-17, 22.95%
FT                   id in 453 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73288"
FT                   /db_xref="GOA:Q6DA86"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA86"
FT                   /protein_id="CAG73288.1"
FT                   /translation="MSELTLLADADERGRRYLAGNAQRRVFPDADALSALARFNEALPQ
FT                   QGFSPEDTLTLLDEVGSPATTASNGPNYFGFVIGAALPIAAASERLMIAWDQCASTFDN
FT                   SPVSATLERLASRWVLDILKLPKESAVGFGTSATACTLSCLVAARRAMLAKQGWDFDND
FT                   GLIGAPEIKVVISALTHITVKKALRVLGFGLRHIIVAPVNAFGQIDVTQLPPLDDRTIL
FT                   CLQAGEVNTGEFDDFAQIIPIAKAAGAWVHVDGAFGLWARASSHAALTESIELADSWTT
FT                   DAHKWLNTPYDCAMAICRNADALAEAMNADAVYSSAARDAQKNLTLEFSRRPRGIPVWA
FT                   VLRTLGRDGVAEMIERHCRQATLIADGLRHAGFEVLNRVVLNQVLLRGETDSQTTAIRE
FT                   ALQASGKAWFGGTVWQGRPALRISVSSWRTQDDNVQALIALLTEIKAKTPR"
FT   misc_feature    complement(419964..420920)
FT                   /note="HMMPfam hit to PF00282, DE Pyridoxal-dependent
FT                   decarboxylase conserved domain, score 5.5e-14"
FT   CDS_pept        complement(421164..422444)
FT                   /transl_table=11
FT                   /locus_tag="ECA0370"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1352 pa1352 SWALL:Q9I3Z2 (EMBL:AE004564) (403 aa)
FT                   fasta scores: E(): 8.6e-83, 60.45% id in 397 aa, and to
FT                   Escherichia coli hypothetical protein YgaY SWALL:YGAY_ECOLI
FT                   (SWALL:P76628) (394 aa) fasta scores: E(): 1.5e-55, 41.17%
FT                   id in 391 aa. Note that redicted start site of this feature
FT                   is around 23 AA upstream of that predicted for its
FT                   ortholgues."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73289"
FT                   /db_xref="GOA:Q6DA85"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA85"
FT                   /protein_id="CAG73289.1"
FT                   /translation="MKNSPIHTTSSVTEYDLYSTLYSTTPPAQTTLPRALVLLFACASA
FT                   LSVANVYYAQPLLDALSIDFHISIAAVGGVMTATQLGCALALILLVPLGDILNRRYLML
FT                   AQLSALIVALIAVGLATTSLYLLISMLAVGMFGTAMTQGLIAYAATAAAPQERGRVVGA
FT                   AQGGVVIGLLLARVLSGFIADMAGWRSVYFFSALLMLLLAVLLWRLLPHQPPSRQRPHY
FT                   SALLLSMLTLLRKERVLQIRGVIALLMFAALSIFWSALVLPLSREPYFFSHTVIGAFGL
FT                   VGILGALAAVKAGSLADKGREQWVSGIALLLLLASWLPLWLAPYSLFALVVGIIVLDLG
FT                   GQAIHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTVAYDASGWSGVCLLGA
FT                   VVSLLALLFWKMTLHVSAPSPTAFTPS"
FT   misc_feature    complement(order(421218..421277,421290..421358,
FT                   421407..421466,421476..421535,421572..421640,
FT                   421650..421718,421812..421871,421899..421967,
FT                   421986..422054,422067..422135,422172..422240,
FT                   422283..422351))
FT                   /note="12 probable transmembrane helices predicted for
FT                   ECA0370 by TMHMM2.0 at aa 32-54, 69-91, 104-126, 131-153,
FT                   160-182, 192-211, 243-265, 269-291, 304-323, 327-346,
FT                   363-385 and 390-409"
FT   CDS_pept        422598..423044
FT                   /transl_table=11
FT                   /locus_tag="ECA0371"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Pseudomonas putida conserved hypothetical
FT                   protein pp0502 SWALL:AAN66130 (EMBL:AE016775) (147 aa)
FT                   fasta scores: E(): 8e-26, 55.14% id in 136 aa. Note that
FT                   there are no significant database matches to
FT                   enterobacterial species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73290"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA84"
FT                   /protein_id="CAG73290.1"
FT                   /translation="MVKRKSLKEDVCPVARALDVVGDRWTLLIIRDAFDNRRRFSDFQR
FT                   SLGVAKNILTDRLRTLVDEGIFSVQPVSESSAYQEYVLTPKGEQLFPLVVALRQWGEQQ
FT                   LFAKGEPHSLLLDKHTGQPLQAMLPHSAERQRLTGKDTFVQKVD"
FT   misc_feature    422655..422924
FT                   /note="HMMPfam hit to PF01638, DE Transcriptional
FT                   regulator, score 4.2e-20"
FT   CDS_pept        423054..423548
FT                   /transl_table=11
FT                   /locus_tag="ECA0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   hypothetical protein YhbP SWALL:AAN44662 (EMBL:U18997) (147
FT                   aa) fasta scores: E(): 2.2e-29, 54.54% id in 143 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73291"
FT                   /db_xref="GOA:Q6DA83"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA83"
FT                   /protein_id="CAG73291.1"
FT                   /translation="MQKESRETGRDLEAISRYLKKLHVLTLCVGENSELWCASCFYTYD
FT                   DKQIAFYLMTELQTRHGEIMARLPQVAGTVSGQPKSVMLIKGVQFRAQAVQLEGEDAQQ
FT                   ARAQYNTRFPIARASQAPIWRLDLTEVKMTDNTLGFGKKRYWQRDEQTDQKEQYQHENM
FT                   G"
FT   CDS_pept        423578..424231
FT                   /transl_table=11
FT                   /locus_tag="ECA0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhi hypothetical protein
FT                   sty3451 SWALL:Q8Z3I6 (EMBL:AL627278) (211 aa) fasta scores:
FT                   E(): 2.2e-41, 55.76% id in 208 aa, and to Escherichia coli
FT                   O157:H7 hypothetical protein YraR SWALL:Q8XAA0
FT                   (EMBL:AE005544) (226 aa) fasta scores: E(): 2.7e-41, 54.8%
FT                   id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73292"
FT                   /db_xref="GOA:Q6DA82"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA82"
FT                   /protein_id="CAG73292.1"
FT                   /translation="MSRVLLLGATGLVGHELLELLKANNRVETIYAPTRKPLVHSEKVV
FT                   NPHDPDLSAELAQLTDPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGAKMALALGAT
FT                   HLLVVSSLSANATSPFFYSRVKGETEKSLRQQGWQHLTLAQPSMLLGEREDSRTLESLA
FT                   APLFRMFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGQWQPLQ"
FT   CDS_pept        complement(424243..424707)
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="ECA0374"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein NrdG or b4237 or z5847 or ecs5214
FT                   SWALL:NRDG_ECOLI (SWALL:P39329) (154 aa) fasta scores: E():
FT                   1.1e-51, 82.46% id in 154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73293"
FT                   /db_xref="GOA:Q6DA81"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA81"
FT                   /protein_id="CAG73293.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCSLFVAGCVHECVGCYNKSTWRLNSGQ
FT                   PFTQEQEDRIIADLQDKLIPRQGISLSGGDPLHPQNVPDILRLVERIRAECPGKDIWVW
FT                   TGYVLADITREQQRVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHRLR"
FT   misc_feature    complement(424603..424668)
FT                   /note="PS01087 Radical activating enzymes signature."
FT   misc_feature    complement(424606..424701)
FT                   /note="HMMPfam hit to PF02143, , score 2e-10"
FT   CDS_pept        complement(424789..426927)
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="ECA0375"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="Similar to Escherichia coli anaerobic
FT                   ribonucleoside-triphosphate reductase NrdD or b4238
FT                   SWALL:NRDD_ECOLI (SWALL:P28903) (712 aa) fasta scores: E():
FT                   0, 85.97% id in 713 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73294"
FT                   /db_xref="GOA:Q6DA80"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA80"
FT                   /protein_id="CAG73294.1"
FT                   /translation="MKPVVIKRDGCQVPFDEVRIKEAVERAAHAAGVNDADYCATVACA
FT                   VAQQMQDKSRVDIRDIQDAVENLLMSGNYKKLARTYIEYRHDRDIARERHGRLNQEIRG
FT                   LVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQYILPRDVVLAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLNGMLTNGFKMGNAEIEQPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEILAPFVTASHAKHKAVAEEWQIPDAENYALTRTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTCWESRLIQESILRNRIAGLGKNHKTAVFPKLVFAIRDGLNH
FT                   KAGDANYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEENGQQIH
FT                   DGRNNLGVISLNLPRIALEAEGNEDRFWTLLDQRLTLSKKALMTRIARLENVKARVAPI
FT                   LYMEGACGVRLNADDNIADIFKNGRASISLGYIGLHETINALFGSQTHVFDDETLRAKA
FT                   VAIIARLKAATEQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVQGVTDKGYYTNS
FT                   FHLDVEKKVNPYQKIDFELPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYTRVPYY
FT                   GTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDSARVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLGNGQLG"
FT   misc_feature    complement(424858..425187)
FT                   /note="HMMPfam hit to PF01228, DE Glycine radical, score
FT                   5.5e-53"
FT   misc_feature    complement(424876..424902)
FT                   /note="PS00850 Glycine radical signature."
FT   misc_feature    complement(426652..426921)
FT                   /note="HMMPfam hit to PF03477, DE ATP cone domain, score
FT                   2.9e-25"
FT   CDS_pept        complement(427331..428068)
FT                   /transl_table=11
FT                   /locus_tag="ECA0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa1733 SWALL:Q9I304 (EMBL:AE004599) (243 aa) fasta
FT                   scores: E(): 5.7e-55, 59.25% id in 243 aa. Note that there
FT                   are no significant database matches to enterobacterial
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73295"
FT                   /db_xref="GOA:Q6DA79"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA79"
FT                   /protein_id="CAG73295.1"
FT                   /translation="MTYCVAMCLSDGLVFASDSRTNAGVDHIATFKKLYVFQHGDERVL
FT                   VIQCAGNLATTQSIISLLSARIDAQHTPNLMQVSSMYDAAMLLGETVREVIHRDSSAQQ
FT                   SGSNTNFGCNLLIGGQISGETHRLFHIYPEGNFIEATPDTPYFQIGESKYGKPIIDRVL
FT                   TMDTPLEQAICCALISIDSTLRSNLSVGLPLDVMIYRTGSFDSGEQQRVTENNAYFTTI
FT                   RKAWSEGLLNTFRQLPPFPDSQQ"
FT   CDS_pept        complement(428092..428913)
FT                   /transl_table=11
FT                   /locus_tag="ECA0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa1732 SWALL:Q9I305 (EMBL:AE004599) (266 aa) fasta
FT                   scores: E(): 9.2e-52, 51.1% id in 272 aa. Note that there
FT                   are no significant database matches to enterobacterial
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73296"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA78"
FT                   /protein_id="CAG73296.1"
FT                   /translation="MKLTINHLTHYRYDEEVKFSTQYLRLTPQNSAHQKIHEWKLTLPA
FT                   SAVQTTDAYGNVLHVLTLDHPHHDITIHAEGVVDIIDSDEGDNPGVQDGLSPLVFLRMT
FT                   PLTEADNDIRAFAQRYYRPDAVEESLNTLMAELQLKMPYTPGATQVQDTAAAAFAMQKG
FT                   VCQDHTHVFLACCRSLSIPARYVSGYVYSQDTQHVAMHAWAEVWLNGYWRGFDITNSTR
FT                   QLHQHLWLAVGMDYMDACPVRGTRLGGGCEEMFSEAEVRLFERQQQVQQQQ"
FT   misc_feature    complement(428260..428436)
FT                   /note="HMMPfam hit to PF01841, DE Transglutaminase-like
FT                   superfamily, score 1.1e-16"
FT   CDS_pept        complement(428910..429839)
FT                   /transl_table=11
FT                   /locus_tag="ECA0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa1731 SWALL:Q9I306 (EMBL:AE004599) (317 aa) fasta
FT                   scores: E(): 1.3e-51, 45.57% id in 316 aa. Note that there
FT                   are no significant database matches to enterobacterial
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73297"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA77"
FT                   /protein_id="CAG73297.1"
FT                   /translation="MLSRTASELYWMARYLERAESLARVLDVTYKLSMMPRHSQQQHDL
FT                   ALPLNLTMTHELFQQRYAHFSMNNLLNFFALDSENPSSIYNCIEMAWNNAHAVRGSLSS
FT                   EVWECINTTRIDIRNLRHQGVDNIGINEFFDWVKERSHLFRGAMFGTLLRNDAQCFIRI
FT                   GTLIERACATAQLLNVKHQQLHNDPDPVREYYRLDTLLRAVSAREAYHSIYRQPISPET
FT                   VTELLVLREDVPRSLHACVGDLVLQLEAIGSQRAKVPHRLAHLLHVELRFSTLDDVLAQ
FT                   DLPTYLNNFIIKINELADSIRHTYLEAL"
FT   CDS_pept        complement(429833..431263)
FT                   /transl_table=11
FT                   /locus_tag="ECA0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa1730 SWALL:Q9I307 (EMBL:AE004599) (470 aa) fasta
FT                   scores: E(): 9.3e-133, 68.88% id in 466 aa. Note that there
FT                   are no significant database matches to enterobacterial
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73298"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA76"
FT                   /protein_id="CAG73298.1"
FT                   /translation="MKLPSAPYYDEMLSSQGKQRQHYNSYWQWLQQTDQQAIKQKKEQA
FT                   ELLFHRVGITFNVYGEEGGTERLIPFDSVPRIIPAHEWQLLDRGIRQRVQALNAFLYDI
FT                   YHQQHILKAGIIPSEQVLANEQYQPCMQGVNLHNNIYAHITGIDMVRNSDGHYYVLEDN
FT                   LRTPSGVSYMLENRKMMMRLYPDLFASQHIAPVERYPSYLLQTLRESTQVDDPTVVVMT
FT                   PGRFNSAYFEHSFLAQQMGVELVESADLFVKEGAVYMRTTEGPCQVDVIYRRVDDAFLD
FT                   PLAFRADSMLGVPGLLSVYRAGGVVLANAVGTGVADDKSIYPYVPEMIRFYLSEEPILH
FT                   NIPTWQCRNPKDLRYVLDHLDSMVVKEVHGAGGYGMLVGPRATRQEIEMFRQRLLAHPH
FT                   NYIGQETLALSTCPTFIDDGLAPRHIDLRPFALSGEEIRLVPGGLTRVALTEGSLVVNS
FT                   SQGGGTKDTWVMEEDESC"
FT   CDS_pept        complement(431494..431880)
FT                   /transl_table=11
FT                   /locus_tag="ECA0380"
FT                   /product="putative endoribonuclease"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi YjgF SWALL:Q9X445 (EMBL:AF095578) (128 aa) fasta
FT                   scores: E(): 1.5e-36, 82.81% id in 128 aa, and to Yersinia
FT                   pestis hypothetical protein Ypo3590 SWALL:Q8ZB37
FT                   (EMBL:AJ414157) (128 aa) fasta scores: E(): 5.4e-37, 83.59%
FT                   id in 128 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73299"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA75"
FT                   /protein_id="CAG73299.1"
FT                   /translation="MSRTISTEHAPAAIGPYVQGVDLGSMIITSGQIPVNPKSGLVADN
FT                   ITAQTRQSLENVQAIVEAAGLKVSDIVKTTVFVKDLHDFTLVNTAYEAFFNEHGAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   misc_feature    complement(431500..431862)
FT                   /note="HMMPfam hit to PF01042, DE Endoribonuclease L-PSP,
FT                   score 1.2e-58"
FT   misc_feature    complement(431518..431574)
FT                   /note="PS01094 Uncharacterized protein family UPF0076
FT                   signature."
FT   CDS_pept        complement(431979..432443)
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="ECA0381"
FT                   /product="aspartate carbamoyltransferase regulatory
FT                   subunit"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 aspartate carbamoyltransferase
FT                   regulatory chain pyri or b4244 or c5344 or z5855 or ecs5221
FT                   SWALL:PYRI_ECOLI (SWALL:P00478) (152 aa) fasta scores: E():
FT                   5.2e-43, 74.34% id in 152 aa, and to Serratia marcescens
FT                   aspartate carbamoyltransferase regulatory chain pyrI
FT                   SWALL:PYRI_SERMA (SWALL:P19936) (153 aa) fasta scores: E():
FT                   1.3e-48, 85.43% id in 151 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73300"
FT                   /db_xref="GOA:Q6DA74"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA74"
FT                   /protein_id="CAG73300.1"
FT                   /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITIG
FT                   LNLPSNHLGRKDLIKIENIFLTEQQANQLAIYAPQATVNQIDGYDVVRKLVPTLPDHIT
FT                   GVLICPNSNCISRSEPVSSSFSVKQRDGDVHLKCKYCEKEFERQAVLQDS"
FT   misc_feature    complement(431988..432143)
FT                   /note="HMMPfam hit to PF02748, DE Aspartate
FT                   carbamoyltransferase regulatory chain, metal binding
FT                   domain, score 2.1e-26"
FT   misc_feature    complement(432147..432440)
FT                   /note="HMMPfam hit to PF01948, DE Aspartate
FT                   carbamoyltransferase regulatory chain, allosteric domain,
FT                   score 1e-55"
FT   CDS_pept        complement(432459..433394)
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="ECA0382"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /EC_number="2.1.3.2"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri aspartate
FT                   carbamoyltransferase catalytic chain PyrB or b4245 or c5345
FT                   or z5856 or ecs5222 or sf4245 SWALL:PYRB_ECOLI
FT                   (SWALL:P00479) (310 aa) fasta scores: E(): 7.7e-100, 85.43%
FT                   id in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73301"
FT                   /db_xref="GOA:Q6DA73"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA73"
FT                   /protein_id="CAG73301.1"
FT                   /translation="MVNPLYQKHIISINDLSREDLELALNVAASLKAKPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETAMHRLGASVVGFADSNNTSLGKKGETLADTISVISQYVDAIV
FT                   MRHPQEGASRLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAMVGD
FT                   LKYGRTVHSLTQALAKFEGNRFYFIAPDALAMPDYILSMLKEKNIAYSLHNSIDEVVGE
FT                   LDILYMTRVQKERLDPSEYINIKSQFVLRAADLDNARPNLKVLHPLPRVDEITIDVDTT
FT                   PYAYYFQQAGNGIYARQALLALVLNRELVL"
FT   misc_feature    complement(432480..432938)
FT                   /note="HMMPfam hit to PF00185, DE Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn binding domain, score
FT                   3.1e-56"
FT   misc_feature    complement(432945..433373)
FT                   /note="HMMPfam hit to PF02729, DE Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain, score
FT                   1.7e-71"
FT   misc_feature    complement(433227..433250)
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT   CDS_pept        433843..434310
FT                   /transl_table=11
FT                   /locus_tag="ECA0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3447 SWALL:AAM84326 (EMBL:AJ414157) (152 aa) fasta
FT                   scores: E(): 6.9e-49, 83.89% id in 149 aa, and to
FT                   Escherichia coli, and Shigella flexneri protein Yjgk
FT                   SWALL:YJGK_ECOLI (SWALL:P39335) (150 aa) fasta scores: E():
FT                   1.1e-39, 70.47% id in 149 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73302"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA72"
FT                   /protein_id="CAG73302.1"
FT                   /translation="MITGNVHHLDLVPYLPAKLREAIEYVKQNITADTPLGKHDIEGNS
FT                   VFVLISNDSTDLLEKRRAEYHAKYLDIQIVLSGVEGMTFSNLPAGKPDTDWLADKDIAF
FT                   LPAGEQEKLFVMQEGDFVVFFPGEVHKPLCAVGEPAHVRKAVVKIDASLVV"
FT   CDS_pept        complement(434357..435364)
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="ECA0384"
FT                   /product="ornithine carbamoyltransferase chain I"
FT                   /EC_number="2.1.3.3"
FT                   /note="Similar to Escherichia coli ornithine
FT                   carbamoyltransferase chain I ArgI or b4254 SWALL:OTC1_ECOLI
FT                   (SWALL:P04391) (333 aa) fasta scores: E(): 1.8e-109, 82.77%
FT                   id in 331 aa, and to Shigella flexneri ornithine
FT                   carbamoyltransferase 1 ArgI SWALL:AAN45654 (EMBL:AE015431)
FT                   (337 aa) fasta scores: E(): 2.8e-110, 82.63% id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73303"
FT                   /db_xref="GOA:Q6DA71"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA71"
FT                   /protein_id="CAG73303.1"
FT                   /translation="MQPFYKRHFLRLMDFTPAEIAHLLALSTKLKADKKNGIETRRLQG
FT                   KNIALIFEKDSTRTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESIKDTARVLGRMYDGI
FT                   QYRGYGQQIVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEYLPGKALSDMTLVYVG
FT                   DARNNMGNTMLEAAALTGLDLRLVAPKACWPDAGLVAECQAAAKQTGGSITLTEDIAAG
FT                   VAGADFIYTDVWVSMGEPKETWKERIALLKPYQVNMAMIAATGNPQVKFLHCLPAFHDD
FT                   QTTMGQQMAEQYGLHGGMEVTDEVFESAHSIVFDQAENRMHTIKAVMVATLAQD"
FT   misc_feature    complement(434369..434905)
FT                   /note="HMMPfam hit to PF00185, DE Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn binding domain, score
FT                   9.2e-99"
FT   misc_feature    complement(434918..435346)
FT                   /note="HMMPfam hit to PF02729, DE Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain, score
FT                   2.7e-80"
FT   misc_feature    complement(435188..435211)
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT   CDS_pept        435526..435951
FT                   /transl_table=11
FT                   /locus_tag="ECA0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo3445 SWALL:AAM84328 (EMBL:AJ414157) (143 aa) fasta
FT                   scores: E(): 1e-40, 80.42% id in 143 aa, and to Escherichia
FT                   coli, Escherichia coli O157:H7, and Shigella flexneri
FT                   hypothetical protein YjgD SWALL:YJGD_ECOLI (SWALL:P37163)
FT                   (138 aa) fasta scores: E(): 2.9e-37, 75.88% id in 141 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73304"
FT                   /db_xref="GOA:Q6DA70"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA70"
FT                   /protein_id="CAG73304.1"
FT                   /translation="MANRELLEEQREETRLIIEELLDDGSDPDALYTIEHHFSAEKFEV
FT                   LEKVAVEAFKLGYEMTDAEELEVEEGVLLMCCDAISEVALKAELIDAQVEQLLALAERH
FT                   GVHYDGWGTYFEDPDGEGEEEGDDEDFYDEDDDGKRH"
FT   CDS_pept        complement(436144..436647)
FT                   /transl_table=11
FT                   /locus_tag="ECA0386"
FT                   /product="putative acetyltransferase"
FT                   /note="Similar to Yersinia pestis putative
FT                   acetyltransferase ypo3444 SWALL:Q8ZBH0 (EMBL:AJ414157) (167
FT                   aa) fasta scores: E(): 2.7e-48, 74.84% id in 167 aa, and to
FT                   Escherichia coli hypothetical acetyltransferase YjgM
FT                   SWALL:YJGM_ECOLI (SWALL:P39337) (167 aa) fasta scores: E():
FT                   3.4e-41, 67.94% id in 156 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73305"
FT                   /db_xref="GOA:Q6DA69"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA69"
FT                   /protein_id="CAG73305.1"
FT                   /translation="MTTATSANLQVRPITAQDDAAIAQVIRQVSAEFGLTADKGYTVSD
FT                   PNLDALFALYSQPKSAYWVVEYEGHIVGGGGIAPLVAGEEDVCELQKMYFLPVVRGKGL
FT                   ARQLAIQALDFARQHGFRRCYLETTGHLTSAIRLYESLGFDPIPHSMGNTGHTDCEVTM
FT                   LKVL"
FT   misc_feature    complement(436213..436461)
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 3.1e-18"
FT   CDS_pept        437057..438238
FT                   /transl_table=11
FT                   /locus_tag="ECA0387"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo0399 SWALL:Q8ZIT9 (EMBL:AJ414142) (398 aa) fasta scores:
FT                   E(): 2.2e-94, 59.04% id in 398 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73306"
FT                   /db_xref="GOA:Q6DA68"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA68"
FT                   /protein_id="CAG73306.1"
FT                   /translation="MTINTSENSTQHRVQFHGKAGEYFAIWLVNALLTVITLGIYSAWA
FT                   TVRRRRYFYGNTEINGDRFDYHAQPIQILKGRLLVIGSLILFYIVMMVSPTLGTILALA
FT                   FAALIPVLVIRNWRYDAIMSSYRGIRFNYHCQTGRAYWVLLLCPILLLLAFYIALVVVV
FT                   MIGMQSNSPILIGFIALAIAIPGFAAVNGIMKMMQLDFYVNNLFFGKTAFKAELTKAVF
FT                   IKFSLISLLIFVPFLIAALSFMSSFFFTLFQTMMMGGGNEELVLMMLLSNVFNFIMMII
FT                   VTLLGVLVSSSYLVVAQRNYLFNQTSLNGGVKLHSSMQTMSYMGLLITNSLITIFSLGW
FT                   AAPVAEIRHARYLANATAVEGDLALLHVQAHQDTANSALAEEAVQALDLGVGL"
FT   misc_feature    order(437123..437191,437273..437332,437345..437413,
FT                   437474..437542,437570..437638,437735..437803,
FT                   437876..437944,438020..438088)
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0387 by TMHMM2.0 at aa 23-45, 73-92, 97-119, 140-162,
FT                   172-194, 227-249, 274-296 and 322-344"
FT   CDS_pept        438255..439292
FT                   /transl_table=11
FT                   /locus_tag="ECA0388"
FT                   /product="putative peptidase"
FT                   /note="Similar to Yersinia pestis m48 peptidase family
FT                   protein ypo0398 SWALL:AAM87329 (EMBL:AJ414142) (348 aa)
FT                   fasta scores: E(): 4.5e-79, 59.88% id in 344 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73307"
FT                   /db_xref="GOA:Q6DA67"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA67"
FT                   /protein_id="CAG73307.1"
FT                   /translation="MNIEGHYQYPGLAARVAASLHLTDNGSTMVLNTGSSNTTFALEQV
FT                   TVSDALGSIPLTLTFPDGGRFVPADDPTFRAWYSARRRPGLVHRLERHKRGVILTLFAT
FT                   ILIVINYVYVVLPWASSTLALRIPTAIEQQLGQNTLKLLRHSDFKPSKLPIERQQEMQT
FT                   LFQQVMPADMREDKTPLRLEIMSAPIGPNAFMLADGTLIISDDLVTLAKSDNELAAVML
FT                   HEMGHHAYRHPMRMVVRSSLVSLTFMWMTGDVSGIGDTVLQSAAFINEMQFSRDMEREA
FT                   DTWAIAEMQQQGRSLQSMQAMYQALIAKDRSQDEIDSLDLPDWLSTHPDMDERLETIER
FT                   EMNKH"
FT   misc_feature    438543..438611
FT                   /note="1 probable transmembrane helix predicted for ECA0388
FT                   by TMHMM2.0 at aa 97-119"
FT   misc_feature    438741..439268
FT                   /note="HMMPfam hit to PF01435, DE Peptidase family M48,
FT                   score 9e-06"
FT   CDS_pept        439647..440726
FT                   /transl_table=11
FT                   /locus_tag="ECA0389"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Bradyrhizobium japonicum protein blr6677
FT                   SWALL:BAC51942 (EMBL:AP005959) (353 aa) fasta scores: E():
FT                   9.7e-77, 55.45% id in 339 aa, and to Caulobacter crescentus
FT                   hydrolase, alpha/beta hydrolase fold family cc3204
FT                   SWALL:Q9A3K0 (EMBL:AE005984) (358 aa) fasta scores: E():
FT                   1.5e-48, 44.41% id in 331 aa. Note that there are no
FT                   significant database matches to enterobacterial species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73308"
FT                   /db_xref="GOA:Q6DA66"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA66"
FT                   /protein_id="CAG73308.1"
FT                   /translation="MINRILSGVVGAFLLMLSLLTHAQSNFPEPKEGDWIAPEFIFNSG
FT                   EKLKDLRIHYYTIGDKTKPAVLLLHGTNQPIKALLANGFGGELFGPGQALDSSKYFIIM
FT                   PESIGSGKSSKPSDGLRMKFPQYDYNDMVQAQYRLIKEGLGINHLSLVMGYSMGGMQTW
FT                   LWGEKYPDMMDALVPMASLPNELSGRNWMMRRILIESIKNDPVWNHGDYTQQPPTLKTA
FT                   NIMFSIATTGGTLAYQSKAPTRAQADKLVEDRLAVPSTSDANDFIYLWGSSANYNAALE
FT                   LNKIKAPVLVINSADDERNPVETGILENELKKIKQATLFLIPASKDTSGHGTMMSAKFY
FT                   KDELQRFLDKNQAQKKNKK"
FT   misc_feature    439647..439715
FT                   /note="Signal peptide predicted for ECA0389 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 23 and 24"
FT   misc_feature    439944..440678
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 4.8e-11"
FT   CDS_pept        440934..442553
FT                   /transl_table=11
FT                   /locus_tag="ECA0390"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein rsc1460 SWALL:Q8XZE1 (EMBL:AL646064) (513 aa) fasta
FT                   scores: E(): 3.5e-62, 42.3% id in 520 aa, and to
FT                   Escherichia coli methyl-accepting chemotaxis protein I Tsr
FT                   or CheD SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa) fasta
FT                   scores: E(): 5.4e-57, 39.42% id in 553 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73309"
FT                   /db_xref="GOA:Q6DA65"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA65"
FT                   /protein_id="CAG73309.1"
FT                   /translation="MFRKIKIRTALSMMVFSLAALLLFVGVLGLIAVQSGNKSFARVDM
FT                   EVLPGLVALNDSSELLLRGRLDLRLYESLMGKGDLEAAKVALGRARGKVDGASEKWQEY
FT                   LKYPQYEEEKAISSDMAEKRNALMQDFIDPAFAALNAGNLDEYRQRAGKSTVLYAAFDK
FT                   SSKALVAFKLKSIDEAYADSNGRVELMETILYVAIACALLLAALAWSVMTNMIVKPLNQ
FT                   AISVFDRIAEGDLRAQIDSSGKNEIAHLFAAVQRMRDGLENMVRVVRNGTDAISVGVEE
FT                   IASGNIDLSSRTEQQAASLDETASSMEQIMSTVKNNEDNTRKANQLAQKASDSASRGGN
FT                   VVSEVVDTMRSIKMSSAKISDIVGVIDGIAFQTNLLALNAAVESARAGQYGKGFAVVAS
FT                   EVRMLAARSATAAKEIGTMIDASLSRIEKGAGLVEVAGNTMDEVLMDVKKVVDIMDEIT
FT                   LASSEQSRGISQINIAINQMDGVTQQNASLVAEVATSANALQEQVINLQQSVSRFQIAR
FT                   ENREMDNVLPGLRQNITLADAR"
FT   misc_feature    440934..441029
FT                   /note="Signal peptide predicted for ECA0390 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.480 between residues 32 and 33"
FT   misc_feature    order(440961..441029,441510..441569)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0390 by TMHMM2.0 at aa 10-32 and 193-212"
FT   misc_feature    441513..441722
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   8.9e-14"
FT   misc_feature    441783..442481
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 9.6e-85"
FT   CDS_pept        442927..444705
FT                   /transl_table=11
FT                   /locus_tag="ECA0391"
FT                   /product="putative activator or transporter protein of
FT                   haemolysin-like protein"
FT                   /note="Similar to Erwinia chrysanthemi HecB precursor HecB
FT                   SWALL:P94771 (EMBL:AF501263) (558 aa) fasta scores: E():
FT                   9.6e-40, 29.33% id in 559 aa, and to Yersinia pestis
FT                   putative hemolysin activator protein ypo2491 or y1696
FT                   SWALL:Q8ZDR5 (EMBL:AJ414152) (562 aa) fasta scores: E():
FT                   8.5e-141, 63.86% id in 559 aa, and to Proteus mirabilis
FT                   hemolysin activator protein precursor HpmB SWALL:HLYB_PROMI
FT                   (SWALL:P16465) (561 aa) fasta scores: E(): 2.8e-26, 26.52%
FT                   id in 524 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73310"
FT                   /db_xref="GOA:Q6DA64"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA64"
FT                   /protein_id="CAG73310.1"
FT                   /translation="MTRIVLFYFLSLKINKIKSIALVITLLIRSLIFALPLPFFAVIAN
FT                   AATSAELQQLDQRQINQQQINQQERQRAQERQLSPQAPDVRLQEPGAFLTRLHFPVEMT
FT                   PCFPIKKVELQGTEDFPGWLPLQRLADQAVNQCLGGKGINLLMSALQNRLVNHGYVTAR
FT                   VLAPAQDLKSGTLKLVVMAGKVGKITLSPDSDRYVQLYSAMPARESELLDLRDIEQGLE
FT                   NLQRVPTAQADMQLVPGEKPGESDIVVGYKQAKHWRLGATLDDSGNKSTGRYQGGLTLF
FT                   LDNPFSLSDTFYLYGGHDLQGRGSKGSKSYVAHYSVPFGYWQAGMTASGYDYHQTIAGL
FT                   NENYTYSGENESLNFQLSRVLHRSGSQKTSVSYEVMTRESRNFVNDTEVEVQRRKTAGW
FT                   RLGLQHRHYISQATLDAAVSYQRGTRWFGAQPVPEETNDEGTGLSKIIQFSSELDVPFA
FT                   VFDEAFRYNVQYRRQLANTRLTAQDQFSIGNRWTVRGFDGELTLSADDGWLVRNELAWR
FT                   TPLQNQELYLGVDYGEISNNSKEMLVGNHLAGGVIGVRGNVLNTGYDLFAGIPLSKPDG
FT                   FETSPAVFGFSLNWQY"
FT   misc_feature    order(442927..442962,442981..443049)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0391 by TMHMM2.0 at aa 4-21 and 28-50"
FT   misc_feature    442927..443064
FT                   /note="Signal peptide predicted for ECA0391 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.897 between residues 55 and 56"
FT   misc_feature    442975..444624
FT                   /note="HMMPfam hit to PF03865, DE Hemolysin activator HlyB,
FT                   score 2.3e-09"
FT   CDS_pept        join(444777..449840,449842..451995)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECA0392"
FT                   /product="putative haemolysin/hemagglutinin-like protein
FT                   (pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation around codon 1688. Similar to Yersinia pestis
FT                   putative hemolysin ypo2490 SWALL:Q8ZDR6 (EMBL:AJ414152)
FT                   (2535 aa) fasta scores: E(): 7.4e-93, 41.25% id in 2390 aa,
FT                   and to Ralstonia solanacearum probable
FT                   hemagglutinin-related protein rsp1073 or rs02477
FT                   SWALL:Q8XQZ5 (EMBL:AL646082) (3322 aa) fasta scores: E():
FT                   1.5e-92, 30.39% id in 3145 aa, and to Erwinia chrysanthemi
FT                   hemolysin/hemagglutinin-like protein HecA precursor hecA
FT                   SWALL:AAN38708 (EMBL:AF501263) (3848 aa) fasta scores: E():
FT                   2.6e-91, 31.08% id in 2474 aa"
FT                   /db_xref="PSEUDO:CAG73311.1"
FT   CDS_pept        451996..452394
FT                   /transl_table=11
FT                   /locus_tag="ECA0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to uncultured bacterium orf118
FT                   SWALL:AAN16074 (EMBL:AY129391) (117 aa) fasta scores: E():
FT                   1.8e-07, 32.2% id in 118 aa. No other significant database
FT                   matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73312"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA63"
FT                   /protein_id="CAG73312.1"
FT                   /translation="MTDRAMMYQKYLYSGFSFPDSFINYVSQSELEDIEPWWLFCSSSN
FT                   YVDFWCEKVRELYPERKLIPFANWRYSDDIVCFDGEDTSGNPKVYYVHAFASSGWEDRG
FT                   YTDDFTEWLKIASLESARNKEERAEDDV"
FT   CDS_pept        complement(452395..452937)
FT                   /transl_table=11
FT                   /gene="kptA"
FT                   /locus_tag="ECA0395"
FT                   /product="RNA 2'-phosphotransferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="Similar to Escherichia coli RNA
FT                   2'-phosphotransferase KptA or b4331 SWALL:KPTA_ECOLI
FT                   (SWALL:P39380) (184 aa) fasta scores: E(): 2.6e-38, 54.8%
FT                   id in 177 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73313"
FT                   /db_xref="GOA:Q6DA62"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA62"
FT                   /protein_id="CAG73313.1"
FT                   /translation="MSKKNTDISKFLSYILRHQPEAIGLSLDKEGWVVISDLILCAAEE
FT                   GYIFDNNLIHSIVNNSDKKRFTISDDGLRIRAAQGHSTQQVDIRYEAKIPPEFLYHGTA
FT                   TRFIISIRVQGLNAKDRQYVHLSADEETAIQVGSRHGKPIVLRIKALTMYEQGFYFYQA
FT                   ANGVWLSNSIPYQFIQE"
FT   misc_feature    complement(452404..452937)
FT                   /note="HMMPfam hit to PF01885, DE RNA
FT                   2'-phosphotransferase, Tpt1 / KptA family, score 2.7e-65"
FT   misc_feature    complement(452662..452709)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   CDS_pept        453261..454961
FT                   /transl_table=11
FT                   /locus_tag="ECA0396"
FT                   /product="putative haemolysin-like protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   Ypo2486 SWALL:Q8ZDS0 (EMBL:AJ414152) (677 aa) fasta scores:
FT                   E(): 5.9e-27, 40.91% id in 479 aa, and to Escherichia coli
FT                   O6 hypothetical protein c1207 SWALL:Q8FIZ4 (EMBL:AE016758)
FT                   (537 aa) fasta scores: E(): 2.9e-22, 43.51% id in 347 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73314"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA61"
FT                   /protein_id="CAG73314.1"
FT                   /translation="MQMLSNLASNSLISGNNDGNAASTTRAAVSNGQLVIRDEASQRQD
FT                   VAQLSNDVEHANQTLSPIFDKEKEQKRLQQMQVIAEISSQVIDIAGTHGAIIATKAAKA
FT                   EADAKATGLSDADRKMARDAFAKGDKPNLNPTDAEIQKYVYQTTYDKAYTQALNSSGFG
FT                   TGGAIRQGIMAVSAAVQGLAGGNVAQAIAGAAAPYLATEIKKATTDANDNVNIVANAVA
FT                   HAVLGGIVAEASGNSALAGAAGAATGELAARVIADRLYPGKAISEMTESEKQTVTTLSL
FT                   LAGGLAAGTVGDSTTNAVAGAQASQNAVENNFLSTDENRQRLSEMSSCGSDSACKDGVT
FT                   EKFKKISDEQIKSVENCSSVDVCVVKAKEMAELQADYGQRIEELGEKLRANGHLSGADL
FT                   EEWTYLHIVTPALEAGRIKAIHNAQAVGGSDEASQLAINTIAQAGATSAAGIIGGTSKA
FT                   GHNTGNGTSQVTTKNVDPSILISRQNKNEMSGSQVKRLVKDMKANGFDINEPVDVAIVN
FT                   GKAIIIDGHHRAEAAAKAGIKDIPVRIHEVTKEQGDQLLREAAEARVRY"
FT   misc_feature    454674..454943
FT                   /note="HMMPfam hit to PF02195, DE ParB-like nuclease
FT                   domain, score 6.2e-09"
FT   CDS_pept        454963..455337
FT                   /transl_table=11
FT                   /locus_tag="ECA0397"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA60"
FT                   /protein_id="CAG73315.1"
FT                   /translation="MMNEREIISFISLQEMLMKAFFIAYPSLKDFDFLLDFPKKGTVFV
FT                   NNDEWGFVKHGKGIRFLINSDQKEAVVDVNNVKNPKLIDIWRLSQYFSSYDDHEIKGVL
FT                   DGMVESGILQKISEKQYELI"
FT   CDS_pept        455619..456002
FT                   /transl_table=11
FT                   /locus_tag="ECA0398"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA59"
FT                   /protein_id="CAG73316.1"
FT                   /translation="MVLKLSWTLAGKGGNKKISSWDDINRCLYLLKDVEGTLTLDVINS
FT                   DENEAEMLQLRTEKGFYFMTLSGIRDDEYVVRTFNDLSQPNIEIMILGDNWPAQQVTRD
FT                   FNLAVRIFKEFFDTGNVSTNLLN"
FT   CDS_pept        complement(456048..456269)
FT                   /transl_table=11
FT                   /locus_tag="ECA0399"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Shigella flexneri orf, partial conserved
FT                   hypothetical protein sf0591 SWALL:AAN42233 (EMBL:AE015090)
FT                   (95 aa) fasta scores: E(): 6.2e-05, 44.44% id in 54 aa. No
FT                   other significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73317"
FT                   /db_xref="GOA:Q6DA58"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA58"
FT                   /protein_id="CAG73317.1"
FT                   /translation="MDKSEPATSQALLHLISYVSRRHADRSDMTRYYSRSPSLHLQDHW
FT                   LEAAGFEIDIPVVITVEQGQLVIRPAPE"
FT   CDS_pept        <456305..>456442
FT                   /transl_table=11
FT                   /locus_tag="ECA0399A"
FT                   /product="putative hemagglutinin-like protein (partial)"
FT                   /note="Similar to Yersinia pestis putative
FT                   hemagglutinin-like secreted protein y1701 SWALL:AAM85269
FT                   (EMBL:AE013774) (681 aa) fasta scores: E(): 1.7e-06, 68.29%
FT                   id in 41 aa, and to Escherichia coli O6 hypothetical
FT                   protein c1207 SWALL:AAN79669 (EMBL:AE016758) (537 aa) fasta
FT                   scores: E(): 2.3e-06, 64.28% id in 42 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0399A"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA57"
FT                   /protein_id="CAG73318.1"
FT                   /translation="LSNDVEHANQTLSPIFDKEKEQKRLQQMQVIAEISSQVIDIAGNA
FT                   R"
FT   CDS_pept        456426..456719
FT                   /transl_table=11
FT                   /locus_tag="ECA0400"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Human herpesvirus 4 capsid protein vp26
FT                   bfrf3 SWALL:CAD53401 (EMBL:AJ507799) (176 aa) fasta scores:
FT                   E(): 5.7, 33.73% id in 83 aa, and to Epstein-barr virus
FT                   capsid protein vp26 bfrf3 SWALL:VP26_EBV (SWALL:P14348)
FT                   (176 aa) fasta scores: E(): 5.7, 33.73% id in 83 aa"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73319"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA56"
FT                   /protein_id="CAG73319.1"
FT                   /translation="MLVTQGRGFWFTEVVSVAGAYAGAKLQNKDPLTASIAAGVGTAVG
FT                   AGGGKVLEVGNKYFPVVSDKTASMTGAIGGALASEVAGSKVQDKAGNTGESK"
FT   CDS_pept        complement(457211..457861)
FT                   /transl_table=11
FT                   /locus_tag="ECA0401"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptococcus mutans conserved
FT                   hypothetical protein smu.1642C SWALL:AAN59281
FT                   (EMBL:AE014994) (210 aa) fasta scores: E(): 3.5e-19, 35.92%
FT                   id in 206 aa. Note that there are no significant database
FT                   matches to enterobacterial species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73320"
FT                   /db_xref="GOA:Q6DA55"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA55"
FT                   /protein_id="CAG73320.1"
FT                   /translation="MEYYGYVLLKFIIGFTIVITHLNFSGKTQLSQMTPVDFIGNFILG
FT                   GIIGGVIYSDSIPLYQYVIVLLIGVSLISILNSISKNIYFFRSVSIGDPIPIIKKGQFL
FT                   MENILQKKNKIDIINVASQLHAQGINSFQKINYAQIEPNGQLSVICEGMEMPSVIVIKD
FT                   GKPRKYDLCEIEKDEEWLSAEIARHGIELDNIYLAEFWKGNLMFILKDGTVVK"
FT   misc_feature    complement(order(457625..457693,457703..457750,
FT                   457784..457852))
FT                   /note="3 probable transmembrane helices predicted for
FT                   ECA0401 by TMHMM2.0 at aa 4-26, 38-53 and 57-79"
FT   CDS_pept        complement(458055..460910)
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="ECA0402"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Similar to Escherichia coli valyl-tRNA synthetase
FT                   ValS or b4258 SWALL:SYV_ECOLI (SWALL:P07118) (951 aa) fasta
FT                   scores: E(): 0, 87.27% id in 951 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73321"
FT                   /db_xref="GOA:Q6DA54"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA54"
FT                   /protein_id="CAG73321.1"
FT                   /translation="METKYNPQDIEQPLYEHWEKQGYFKPHGNTSKESFSIMIPPPNVT
FT                   GSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHD
FT                   YGRDAFIDKIWQWKGESGGNITNQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKE
FT                   DLIYRGKRLVNWDPKLRTAISDLEVENRDVKGSMWHLRYPLADGVKTAEGKDYLVVATT
FT                   RPETMLGDTGVAVNPEDPRYKDLIGKEVILPLIGRRIPIVGDEHADMEKGTGCVKITPA
FT                   HDFNDYEVGKRHQLPMVNILTFDGDIRQSAEIFDTNGEASTACSSEIPEAFQGLERFAA
FT                   RKALVAAFDELGLLEEIKAHDLTVPYGDRGGVVIEPMLTDQWYVRAAVLAKPAVEAVED
FT                   GRIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGNVYVGRTEAEVRSEN
FT                   NLADDVVLNQDEDVLDTWFSSGLWTFSTLGWPEQTPDLKSFHPSSVMVSGFDIIFFWIA
FT                   RMIMLTMHFIKDEDGKPQVPFNTVYMTGLIRDEEGQKMSKSKGNVIDPLDMVDGISLEA
FT                   LLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRFVLMNTEDQDCGFNGGEMELSLADRWILAEFNRTVKAYRDALDG
FT                   YRFDIAANILYEFTWNQFCDWYLELTKPVMNGGSEAELRGTRHTLVTVLEALLRLAHPI
FT                   IPFITETIWLRVKALKGINDDTIMLQPFPEFNAAQEDTLALNDLEWIKQAIIAVRNIRA
FT                   EMNIAPGKPLEVLLRDATAEAQRRVEENLSFIQTLARLESITLLPAGDKGPVSVTKLIE
FT                   GAELLIPMAGLIDKAAELDRLAKEVAKLEAEIGRIESKLSNEGFVARAPEAVVAKEREK
FT                   MDGYAVAKTKLLEQQAVIAAL"
FT   misc_feature    complement(459018..460799)
FT                   /note="HMMPfam hit to PF00133, DE tRNA synthetases class I
FT                   (I, L, M and V), score 0"
FT   misc_feature    complement(460752..460787)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        complement(460923..461372)
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="ECA0403"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase III, chi
FT                   subunit HolC or b4259 SWALL:HOLC_ECOLI (SWALL:P28905) (147
FT                   aa) fasta scores: E(): 1.8e-40, 72.41% id in 145 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73322"
FT                   /db_xref="GOA:Q6DA53"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA53"
FT                   /protein_id="CAG73322.1"
FT                   /translation="MKNATFYLLEHDSKSGELSAHEALACDLAAERWRAGKRVLIVCED
FT                   EQQAIRLDEALWQRDPNAFVPHNLAGEGPRHGAPVELAWPQRRGNAPRDLLISLLPQFA
FT                   DFATAFHEVIDFVPYEDSLKQLARDRYKTYRSVGFRLTTATPPTH"
FT   CDS_pept        complement(461737..463248)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /gene_synonym="xerB"
FT                   /gene_synonym="carP"
FT                   /locus_tag="ECA0404"
FT                   /product="cytosolic aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 cytosol aminopeptidase PepA or
FT                   XerB or CarP or b4260 or c5360 or z5872 or ecs5237
FT                   SWALL:AMPA_ECOLI (SWALL:P11648) (503 aa) fasta scores: E():
FT                   2.7e-179, 91.05% id in 503 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73323"
FT                   /db_xref="GOA:Q6DA52"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA52"
FT                   /protein_id="CAG73323.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISA
FT                   LLRRGELEGKVGQSLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINALNETG
FT                   SMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKSNKVELRRPLRKMVFNVPT
FT                   RRELTSGERAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADTYSQNTITRV
FT                   IGEEQMKELGMNAYLAVGQGSQNESLMSVIEYKGDPNPENRPIVLVGKGLTFDSGGISI
FT                   KPADSMDEMKYDMCGAATVYGVMRMAAELALPLNIIGVLAGCENMVDGRAYRPGDVLTT
FT                   MSGQTVEVLNTDAEGRLVLCDTLTYVERYEPDVVIDVATLTGACVIALGHHITGLMANH
FT                   NPLAHELLSASEQSGDRAWRLPLTDEFQEQLESNFADMANIGGRPGGAITAGCFLSRFT
FT                   RKYSWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGQNDVE"
FT   misc_feature    complement(461776..462699)
FT                   /note="HMMPfam hit to PF00883, DE Cytosol aminopeptidase
FT                   family, catalytic domain, score 6e-203"
FT   misc_feature    complement(462178..462201)
FT                   /note="PS00631 Cytosol aminopeptidase signature."
FT   misc_feature    complement(462808..463206)
FT                   /note="HMMPfam hit to PF02789, DE Cytosol aminopeptidase
FT                   family, N-terminal domain, score 5.3e-49"
FT   CDS_pept        463531..464646
FT                   /transl_table=11
FT                   /locus_tag="ECA0405"
FT                   /product="putative permease"
FT                   /note="Similar to Salmonella typhimurium putative permease
FT                   YjgP SWALL:Q8ZK27 (EMBL:AE008910) (366 aa) fasta scores:
FT                   E(): 1.1e-107, 73.33% id in 360 aa, and to Escherichia
FT                   coli, Escherichia coli O6, Escherichia coli O157:H7, and
FT                   Shigella flexneri hypothetical protein YjgP
FT                   SWALL:YJGP_ECOLI (SWALL:P39340) (366 aa) fasta scores: E():
FT                   1.3e-106, 73.46% id in 358 aa. YjgP belongs to a family of
FT                   predicted permeases but there is no experimental evidence
FT                   of this."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73324"
FT                   /db_xref="GOA:Q6DA51"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA51"
FT                   /protein_id="CAG73324.1"
FT                   /translation="MIIIRYLVRETFKSQLAILFILLLIFFCQKLVRILGAAVDGEIPT
FT                   NLVISLLGLGVPEMVQLILPLSLFLGVLMTFGRLYAESEITVMHACGLGKRVLLKAALI
FT                   LAMFTAVIATINVMWLSPWSSMHQEEVLAEAKANPSMAALVEGQFQSAQGGNAVLFVGN
FT                   VKGSEFQHVFLAQLRPSGNARPSVVVADRGHITQNEDGAQVVTLDNGSRYEGTALLRDF
FT                   RITDFTNYQAVIGHQTVTLNNSDVQQMGMQALWSSDAHDARAEFHWRLTLIVSVLIMAL
FT                   MVVPLSVVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNASKGKIDPMVWIWLTNLMYFG
FT                   IAVMLNLWDTVPMRKMRARLKPRTLKTQGAA"
FT   misc_feature    463531..463641
FT                   /note="Signal peptide predicted for ECA0405 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.658) with cleavage site
FT                   probability 0.354 between residues 37 and 38"
FT   misc_feature    463543..464592
FT                   /note="HMMPfam hit to PF03739, DE Predicted permease
FT                   YjgP/YjgQ family, score 7.6e-75"
FT   misc_feature    order(463579..463647,463705..463773,463831..463899,
FT                   464329..464397,464416..464469,464512..464571)
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0405 by TMHMM2.0 at aa 17-39, 59-81, 101-123, 267-289,
FT                   296-313 and 328-347"
FT   CDS_pept        464646..465722
FT                   /transl_table=11
FT                   /locus_tag="ECA0406"
FT                   /product="putative permease"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   hypothetical protein YjgQ SWALL:YJGQ_ECOLI (SWALL:P39341)
FT                   (360 aa) fasta scores: E(): 2.6e-108, 77.24% id in 356 aa,
FT                   and to Salmonella typhimurium putative permease YjgQ
FT                   SWALL:Q8ZK26 (EMBL:AE008910) (360 aa) fasta scores: E():
FT                   2.6e-109, 78.37% id in 356 aa.YjgQ belongs to a family of
FT                   predicted permeases but there is no experimental evidence
FT                   of this."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73325"
FT                   /db_xref="GOA:Q6DA50"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA50"
FT                   /protein_id="CAG73325.1"
FT                   /translation="MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQGEY
FT                   SALGAGLYTLLSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIATAV
FT                   MKTAIPLVLLTMAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGNNFIFIER
FT                   VTGDKELSGVSIYRFDDQNKLLSVRYAASAEFEDDRNVWKLSQVDESDLSDGKQIGGSQ
FT                   TLSGEWKTNLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQESNRYQLNMWSKIFAPV
FT                   SVAVMMLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIPPILGAI
FT                   LPSSVFLFISVALLLKRR"
FT   misc_feature    464664..465713
FT                   /note="HMMPfam hit to PF03739, DE Predicted permease
FT                   YjgP/YjgQ family, score 4e-92"
FT   misc_feature    order(464679..464738,464829..464882,464943..465011,
FT                   465474..465533,465552..465605,465642..465710)
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0406 by TMHMM2.0 at aa 12-31, 62-79, 100-122, 277-296,
FT                   303-320 and 333-355"
FT   tRNA            465940..466024
FT                   /note="tRNA Leu anticodon CAA, Cove score 79.54"
FT   CDS_pept        <466210..466377
FT                   /transl_table=11
FT                   /locus_tag="ECA0407"
FT                   /product="putative integrase (partial)"
FT                   /note="Similar to Shigella flexneri integrase intB or
FT                   sf4224 SWALL:AAN45643 (EMBL:AE015430) (415 aa) fasta
FT                   scores: E(): 5.6e-17, 81.48% id in 54 aa, and to
FT                   Escherichia coli integrase inT SWALL:Q93SE7 (EMBL:AJ278144)
FT                   (394 aa) fasta scores: E(): 1.7e-15, 70.9% id in 55 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73326"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA49"
FT                   /protein_id="CAG73326.1"
FT                   /translation="MALTDVKVRTAKPADKQYKLTDGNGMHLLIHPNGSKYWRLQYRFG
FT                   GKQKMLALGI"
FT   CDS_pept        466558..466815
FT                   /transl_table=11
FT                   /locus_tag="ECA0408"
FT                   /product="putative plasmid-related protein"
FT                   /note="Similar to Pseudomonas resinovorans hypothetical
FT                   protein SWALL:BAC41561 (EMBL:AB088420) (133 aa) fasta
FT                   scores: E(): 5.7e-08, 41.97% id in 81 aa, and to
FT                   Escherichia coli O157:H7 plasmid po157 DNA, complete
FT                   sequence l7010 SWALL:O82927 (EMBL:AB011549) (94 aa) fasta
FT                   scores: E(): 1.7e-06, 38.66% id in 75 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73327"
FT                   /db_xref="GOA:Q6DA48"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA48"
FT                   /protein_id="CAG73327.1"
FT                   /translation="MMLMGQPAKQTISAQIPAELAAAVESLAIELDRSKSWVIKEALTA
FT                   MIEERERRHQQVLKGLADVDAGRVVSHADVIDFANKLKKS"
FT   CDS_pept        466819..467094
FT                   /transl_table=11
FT                   /locus_tag="ECA0409"
FT                   /product="putative plasmid-related protein"
FT                   /note="Similar to Escherichia coli O157:H7 plasmid po157
FT                   DNA, complete sequence l7011 SWALL:O82928 (EMBL:AB011549)
FT                   (91 aa) fasta scores: E(): 9.3e-12, 42.85% id in 91 aa, and
FT                   to Shigella sonnei YacB protein yacB SWALL:Q9Z4G4
FT                   (EMBL:AB021078) (93 aa) fasta scores: E(): 0.63, 30% id in
FT                   90 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73328"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA47"
FT                   /protein_id="CAG73328.1"
FT                   /translation="MEIRWTQKAQDDLERIYGFASQYSRQHADEVLDRLIIGTTGLADH
FT                   PRIGVSQARYEPREVRKILLDDYEFHYEIQHDTIYIVDLWHTREDR"
FT   CDS_pept        467142..467654
FT                   /transl_table=11
FT                   /locus_tag="ECA0410"
FT                   /product="putative kinase"
FT                   /note="Similar to Corynebacterium glutamicum shikimate
FT                   kinase Arok or cgl1622 SWALL:AROK_CORGL (SWALL:Q9X5D1) (169
FT                   aa) fasta scores: E(): 0.12, 26.62% id in 169 aa, and to
FT                   Xanthomonas campestris hypothetical protein Xcc0737
FT                   SWALL:Q8PCI9 (EMBL:AE012173) (148 aa) fasta scores: E():
FT                   2e-19, 52.38% id in 126 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73329"
FT                   /db_xref="GOA:Q6DA46"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA46"
FT                   /protein_id="CAG73329.1"
FT                   /translation="MLIIFGGLAGTGKSTTARLLASRLNAVWLRIDSIEQSLIRSEKIT
FT                   MSDMGPAGYLVAYAIAADNLKLGNNVIADSVNPLAITRQAWRDVASESAAPALEIEITC
FT                   SDKAQHKERVEHRSADIAGHVLPDWQKVVTRQYEAWLSTDITLDTSVLTPEQAVEAILQ
FT                   HIESCKL"
FT   misc_feature    467160..467183
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        join(468116..468325,468324..469061,469063..469137,
FT                   469137..469355)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECA0411"
FT                   /product="putative intergrase (pseudogene)"
FT                   /note="Similar to Bacteriophage P4 integrase inT
FT                   SWALL:VINT_BPP4 (SWALL:P08320) (439 aa) fasta scores: E():
FT                   5.8e-149, 90.04% id in 412 aa, and to Salmonella typhi
FT                   integrase sty4821 SWALL:Q8Z112 (EMBL:AL627283) (421 aa)
FT                   fasta scores: E(): 2.9e-152, 90.9% id in 418 aa. Probable
FT                   pseudogene arising from frame shift mutations at amino acid
FT                   resisdues 70, 316 and 341."
FT   misc_feature    468720..469064
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00589, DE Phage integrase family,
FT                   score 0.0058"
FT   CDS_pept        complement(469396..472884)
FT                   /transl_table=11
FT                   /locus_tag="ECA0413"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Bacillus subtilis DNA-binding
FT                   protein YobI SWALL:O34784 (EMBL:AF027868) (1201 aa) fasta
FT                   scores: E(): 2.7, 21.21% id in 773 aa. Note that there are
FT                   no significant database matches to enterobacterial
FT                   species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73331"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA45"
FT                   /protein_id="CAG73331.1"
FT                   /translation="MWNDLGDIFYESVYCEKNDNRYSNVLKLGDEVQAAFGRATLDKLI
FT                   MDHVPDKEYEPSKLHVSLLSLPWIDVFTTNYDTLLERACVNVDSRKYDIVLNKNDLMNA
FT                   ERPRIIKLHGSFPSERPFIVTEEDYRKYPLENSPFVNTVQQSLIENTLCLIGFSGDDPN
FT                   FLNWIGWIRDNLGAENSPKIYLIGLFSFNEAQRKLLEKRNISIVDLSFLGDFDKDHYLA
FT                   HQHFIQFLYESKNKDNLIEWPIEVNHERVTFNDSIDLKIEKIKKCLSEWTQSRKSYPNW
FT                   LILPESNRSNLSHNTRDWLFIVNYEIAWDGSDDLDFGYEVTWRLNKALLPISNDTSEFL
FT                   FKLVEKYESIYAEGMKNKNIVDFDEKYSHIIISLMKFCRQESFVDKWKKLNNVLIQNLD
FT                   RLTPEVKSEYYYENILFSYFNLNFDEARNRLSNWETNKLLPQHEIKKAGLLAEFGMLDE
FT                   AINLLEETLSTIRRNSLLSSRNIDYSSESQEAYGIYILRMFKHSWRIDSKDDDYSSEYN
FT                   SRLAALSQYRSDPEKEIKYLEIKLESLPGTSRNTNDTDFDLNRRTVTTYFGGSPTEVRS
FT                   LDAFSFFLLAEELGLPFHIPGMNIFSGIVENAARHIYQYSPEWAIFSIFRTFDKDKAKS
FT                   LFNRNRISSLERKKVEDLFDGYYKKYEQIITKKIDDRLNDKLEIEISTLSVIPEILSRL
FT                   VTKVSFEKKKDIICLLLKLFNSENFHWYMETKDLLKRTISNLSDSQKISLIDIFIDFPS
FT                   TPHNSQLHMGQRYNFITPFECLLGITINPQKESSKKIASSKLKKDIIDLKSESSELRKA
FT                   SSQKLITLYNLEMLNKSDTTKLIKNLWSKRDNFGFPIDSGYYKFFFINNLYPDNENIAD
FT                   KFTPIIKTYKFPVQDGKSVGITGGLDVYCTELNGALHHIPLPEKTLSEIVSKMNDWYVK
FT                   DRIWLVKMDDLAKEFTLRFRNITNIITTILEHHNDKLSTESINEISSLLEKMKEDKIPV
FT                   NSAVTMLYLKNNSTHLVRMKDIVNGLYSFNKNDVIEAINSIYVFIRNNEYPLTIIQAIS
FT                   DKIAWDRDPRLPECYDLIAYIINSCEFTLSDEFIEKILRGLAYQVNIDDRDFVDNNEYL
FT                   NHLEKKLSATKLAASIFRKNEMLGIDQPPIIQEWKNMCNSRNEFDEIRNEWNNHV"
FT   CDS_pept        complement(473425..473673)
FT                   /transl_table=11
FT                   /locus_tag="ECA0414"
FT                   /product="putative bacteriophage regulatory protein"
FT                   /note="Similar to Bacteriophage 186 late control protein B
FT                   SWALL:VPB_BP186 (SWALL:P08711) (72 aa) fasta scores: E():
FT                   1.1e-08, 52.38% id in 63 aa, and to Salmonella typhi
FT                   bacteriophage gene regulatory protein sty4826 SWALL:Q8Z107
FT                   (EMBL:AL627283) (79 aa) fasta scores: E(): 3.2e-12, 57.57%
FT                   id in 66 aa. Also similar to ECA0833 (41.818% id. in 55 aa
FT                   overlap), and to ECA3454 (84.146% id. in 50 aa overlap),
FT                   and to ECA2599 (39.726% id. in 51 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73332"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA44"
FT                   /protein_id="CAG73332.1"
FT                   /translation="MMSCPFCGNAAHTRTSKIFSNNVKQRYHQCRNIECSATFRTMESI
FT                   EEIIQPSHRKDLPVPDIPLSPVMQKKYKDYPASTQRN"
FT   CDS_pept        complement(join(473670..474029,474033..474347))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECA0415"
FT                   /product="putative bacteriophage capsid protein
FT                   (pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TGA stop
FT                   codon. Similar to bacteriophage P4 glycoprotein 3 siD
FT                   SWALL:VSID_BPP4 (SWALL:P05461) (244 aa) fasta scores: E():
FT                   2.8e-19, 35.74% id in 221 aa, and to Salmonella typhi
FT                   putative phage capsid protein sty4827 SWALL:Q8Z106
FT                   (EMBL:AL627283) (286 aa) fasta scores: E(): 1.4e-15, 33.33%
FT                   id in 219 aa. Probable pseudogene arising from nonsense
FT                   mutation after amino acid resisdue 105."
FT                   /db_xref="PSEUDO:CAG73333.1"
FT   CDS_pept        join(474532..474795,474792..475391,475391..475612)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECA0417"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="Similar to Xanthomonas axonopodis pv. dieffenbachiae
FT                   transposase SWALL:Q9F822 (EMBL:AF263433) (363 aa) fasta
FT                   scores: E(): 1.1e-104, 66.57% id in 359 aa. Probable
FT                   pseudogene arising from frame shift mutations at amino acid
FT                   resisdues 88 and 288."
FT                   /db_xref="PSEUDO:CAG73334.1"
FT   misc_feature    474541..474792
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01527, DE Transposase, score
FT                   7.4e-25"
FT   CDS_pept        476014..477135
FT                   /transl_table=11
FT                   /locus_tag="ECA0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   ycfd ycfd or c1480 SWALL:AAN79949 (EMBL:AE016759) (376 aa)
FT                   fasta scores: E(): 1.3e-105, 66.12% id in 372 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73335"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA43"
FT                   /protein_id="CAG73335.1"
FT                   /translation="MAYQLNLNWPEFLEKYWQKKPVVLKNAFPNFVDPITPDELAGLAM
FT                   EAEVDSRLVSYKNGQWQASNGPFEHFDNLGETGWSLLAQAVNHWHAPSAELVSPFRVLP
FT                   DWRLDDLMISFSVPGGGVGPHIDQYDVFIIQGMGSRRWRVGDKLPMRQFCPHPALLHVD
FT                   PFPPIIDEDLEPGDILYIPPGFPHDGFTHETALNYSVGFRGPNGRDLISSFADYVLEND
FT                   LGGEHYSDPDLTCREHSGRVEDYEFDRLRAMMIDVINQPEALKAWFGRFVTTPRHELDI
FT                   APAEPPYEQDEIVGALMDGDVLTRLSGLRVLEVGGSYFINSEWLDTVDPKAADALCRYT
FT                   VFGKKELGEALENPAFVAELTGLVNQGYWFFDE"
FT   CDS_pept        477432..478562
FT                   /transl_table=11
FT                   /locus_tag="ECA0421"
FT                   /product="putative exported lipase"
FT                   /note="Similar to Zymomonas mobilis hypothetical protein
FT                   SWALL:AAL36135 (EMBL:AY057845) (394 aa) fasta scores: E():
FT                   2.9e-49, 41.3% id in 368 aa. Note that there are no
FT                   significant database matches to enterobacterial species."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73336"
FT                   /db_xref="GOA:Q6DA42"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA42"
FT                   /protein_id="CAG73336.1"
FT                   /translation="MFHLPKLKQKPLALLLTISVGMMAPFTFAEAKTPGTLVEKAPLDS
FT                   KNGLMEAGEQYRIQYYSKSGVDGESLREDTGVVFIPKGEAPKEGWPVVVWTHGTIGVGK
FT                   SCAPSLNPRSARDSQYLNTWLSLGFAIVAPDYAGLGSAGLHHYLNSRGEAWSVLDSVKA
FT                   SLTAFPLHNQLTIVGQSQGAHAAFASTGYQPSYAPNLNIASAVLTGTPYFDGKTSAKEI
FT                   FAEGSGKDGDPKIPYVMYIYLSAADTNKGLNADDYFTPKAAELVKKADTMCIGELTQKV
FT                   MEEGLNAENSLKPEIYKLLDDQMVHFRYNTLNVTPPVFIGIGTEDINVPTKMQRHFAKD
FT                   VVGAGTSADVHEYKGMDHSETVNVSLRNSVPFVLEK"
FT   misc_feature    477432..477518
FT                   /note="Signal peptide predicted for ECA0421 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.913 between residues 29 and 30"
FT   misc_feature    477723..477746
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    477759..478556
FT                   /note="HMMPfam hit to PF03583, DE Secretory lipase, score
FT                   4.7e-07"
FT   CDS_pept        complement(478617..479807)
FT                   /transl_table=11
FT                   /locus_tag="ECA0422"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio vulnificus ABC-type multidrug
FT                   transport system, permease component vv12691 SWALL:AAO11038
FT                   (EMBL:AE016806) (381 aa) fasta scores: E(): 1.2e-62, 45.26%
FT                   id in 391 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73337"
FT                   /db_xref="GOA:Q6DA41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA41"
FT                   /protein_id="CAG73337.1"
FT                   /translation="MLTFADIIRFELRSLLRDPTILLTLFGGILLYSFLYPRPYLAQTP
FT                   RDLPVVLVDEDKTQLSRRLAFMADATPEVHLVAQRNTLDEAKTLLLHGEAKGIFYIPRH
FT                   FYRDIMQGKSVTVSYSADASYFLIYGAIAQSLATVGGTAGAQVKISRLLAQGEGIPAAS
FT                   SQWQATPLNAVPVFNSTMGYVDYVVPGVFMLILHQILLMGCGLLGAGQNQRTQSGEVRY
FT                   WQYATPWRLLLARTLIVGGAYLLSLLYMLGFCLDAYGIAREASMSQLLLFTLPFLLSTL
FT                   WLGVVLGAAFTRKDLPSQAVLLSSIPIIFLSGFIWPVEMIPAPLNWLAQWVPAVFAIQG
FT                   ILRLNQMGADFTQIAAFWWHLWMLAALYGLLAWGMLGYRQRQYRRENKAARRWLEN"
FT   misc_feature    complement(order(478674..478742,478839..478907,
FT                   478944..479012,479049..479117,479178..479246,
FT                   479373..479441,479697..479765))
FT                   /note="7 probable transmembrane helices predicted for
FT                   ECA0422 by TMHMM2.0 at aa 15-37, 123-145, 188-210, 231-253,
FT                   266-288, 301-323 and 356-378"
FT   CDS_pept        complement(479801..480919)
FT                   /transl_table=11
FT                   /locus_tag="ECA0423"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vc1608 vc1608 SWALL:Q9KRM8 (EMBL:AE004238) (387 aa) fasta
FT                   scores: E(): 3.2e-46, 38.08% id in 365 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73338"
FT                   /db_xref="GOA:Q6DA40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA40"
FT                   /protein_id="CAG73338.1"
FT                   /translation="MMREWKALWRDRWGMALALWLPLFTMLIAWWTLSGAIVRELPIGL
FT                   IDLDNSTMSRQFARELDASSSFNLNHQFSTVVEGATSLRGGEIYALVVIPRHFERDIRL
FT                   GTSPTITAWNNGQFVLIAKVINSALSLVAGTFNGQIAVVQALSQGAAVPEAKGLAVPIG
FT                   GQITALFNQNANYAQFLLNAIIPSIWSVLLALYGLNTLAREDRHGSRWIPENHTTAISF
FT                   KFLTHWLIGWAWGGIWSYGLYSLLNYPLNGSPLLLFISIGVTAGACVALGMAFYALIRD
FT                   PARAVSIVGALMAPGLAFMGITFPAAAMETFATFWRQLLPVAHYGDISIAITSYGAGIV
FT                   QIAPALMALALFWLLLPLTLWRYRPCNKEATC"
FT   misc_feature    complement(order(479837..479905,479999..480067,
FT                   480086..480154,480197..480265,480326..480394,
FT                   480815..480883))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0423 by TMHMM2.0 at aa 13-35, 176-198, 219-241, 256-278,
FT                   285-307 and 339-361"
FT   CDS_pept        complement(480919..481917)
FT                   /transl_table=11
FT                   /locus_tag="ECA0424"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   vc1607 SWALL:Q9KRM9 (EMBL:AE004238) (324 aa) fasta scores:
FT                   E(): 1.5e-72, 62.03% id in 324 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73339"
FT                   /db_xref="GOA:Q6DA39"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA39"
FT                   /protein_id="CAG73339.1"
FT                   /translation="MTQSPSSSRSTRKWILQAILVIVVVWIAYRFWLAYQPEPIRLQGQ
FT                   IEAQQYSVSSKVPGRIADVRIEKGQQLDVGDLVFTLLTPELDAKLEQAKAGEAAAGAVA
FT                   LEAKTGAREQQIAAAKDQWQKAKAGSELSNKTYLRVQNLYQEGVLPLQKRDEAKASWDA
FT                   ARYTEGMAWQEYQMALEGTRKETLVAAEEKARMAAGSVAEVEAYLAEARVVSPHSGEVS
FT                   NVLLRNGEIAPQGFPVVTLLDMSDIWIQLAVREDLLERFAMGTEFEARIPALNNQTFRF
FT                   KVSYVSVMGDFATWRATDTRQGFDMRTFEVEARPVQPISGLRVGMSALVEM"
FT   misc_feature    complement(481813..481881)
FT                   /note="1 probable transmembrane helix predicted for ECA0424
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(481914..483335)
FT                   /transl_table=11
FT                   /locus_tag="ECA0425"
FT                   /product="putative outer membrane efflux protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vc1606 SWALL:Q9KRN0 (EMBL:AE004238) (476 aa) fasta scores:
FT                   E(): 6e-69, 44.34% id in 451 aa, and to Shewanella
FT                   oneidensis outer membrane efflux protein so4090
FT                   SWALL:AAN57064 (EMBL:AE015839) (473 aa) fasta scores: E():
FT                   1.2e-68, 45.11% id in 450 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73340"
FT                   /db_xref="GOA:Q6DA38"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA38"
FT                   /protein_id="CAG73340.1"
FT                   /translation="MPQLTYGKNRFLAYFPAALLLLQCWSSTAFGQPITFNQAWVRLLQ
FT                   SDDSIAAEHAGVDRAQSLRESAKGLYWPQINVGASYTRLDKPVELDARDLNPLANHRDI
FT                   FAALNQLVNISGNPFVTRFTEQNVVTSSVQVVWPLFTGGRIDAAQSIRAAQVNEAEQML
FT                   IIRTLAQFEALAQAYYGVVIAHQVIKTRQDIEKGMAQHYDHASKLEAQGQIARVEVLSA
FT                   QSAYDMARIETQKARRSLETTEIVFAKLIKTEGATPSSSLFINKVLPELPALVKQTLNT
FT                   HPGLKVLSAKRDQAKDLIRIERAKYAPDVFLFGNYQLYEQDTLAARTTPDWMVGVGVSV
FT                   PLISREGRSDNIAAAKSAEMQVNYLEADMRQNLEVLVETTWRDARQALEEFNSLSSTQK
FT                   LAEENVQLRNKAFMQGMSTSLDVVDALNQLAGAKTQRASAAYRYVVSIARLMAISSQLN
FT                   RFSDYQTQYAIQVTP"
FT   misc_feature    complement(481938..482525)
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 5.9e-18"
FT   misc_feature    complement(482547..483230)
FT                   /note="HMMPfam hit to PF02321, DE Outer membrane efflux
FT                   protein, score 7.8e-15"
FT   misc_feature    complement(483243..483335)
FT                   /note="Signal peptide predicted for ECA0425 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.947 between residues 31 and 32"
FT   CDS_pept        complement(483705..485144)
FT                   /transl_table=11
FT                   /gene="aspA1"
FT                   /locus_tag="ECA0426"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Shigella flexneri aspartate ammonia-lyase AspA or b4139
FT                   or c5222 or sf4293 SWALL:ASPA_ECOLI (SWALL:P04422) (478 aa)
FT                   fasta scores: E(): 7.8e-167, 88.05% id in 477 aa. Also
FT                   similar to ECA0621 (91.195% id. in 477 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73341"
FT                   /db_xref="GOA:Q6DA37"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA37"
FT                   /protein_id="CAG73341.1"
FT                   /translation="MSTNIRIEEDLLGTREVPADAYYGIHTLRAIENFYISNSTISDIP
FT                   EFVRAMVMVKKAAALANKELQTIPRKIADTILQACDEVLNNGKCLDQFPVDVYQGGAGT
FT                   SVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYTSILKL
FT                   VEAITQLSDGFERKAKEFENILKMGRTQLQDAVPMTLGQEFHAFNVLLKEENRNLLRTA
FT                   ELLLEVNLGATAIGTRLNTPDEYQKLAVQHLAKISGLPCVPAEDLIEATSDCGAYVMMH
FT                   SALKRVAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESIQILSNACYNLLEKCVNGITANKE
FT                   VCEAYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEEQLDDIFS
FT                   IQNLMHPAYKAKRYTDENEAV"
FT   misc_feature    complement(483765..485108)
FT                   /note="HMMPfam hit to PF00206, DE Lyase, score 4.2e-208"
FT   misc_feature    complement(484158..484187)
FT                   /note="PS00163 Fumarate lyases signature."
FT   CDS_pept        complement(485398..486354)
FT                   /transl_table=11
FT                   /locus_tag="ECA0427"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Brucella melitensis transcriptional
FT                   regulatory protein, LysR family bmei0116 SWALL:Q8YJG7
FT                   (EMBL:AE009454) (308 aa) fasta scores: E(): 1.7e-24, 29.18%
FT                   id in 305 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73342"
FT                   /db_xref="GOA:Q6DA36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA36"
FT                   /protein_id="CAG73342.1"
FT                   /translation="MYAVYVFVTMAEAGSMTAAATRLGLTPSAISQTIRLLEEDFGVKL
FT                   VNRARRPFVLTPYGIALKNRGEILTEEIANLKAQVLEAGKGIKPDLRIGLVDSFAITCG
FT                   SVFTKSLMKSSSQLLIRTGLSPQQGEALMRRELDLIVTSDPLIDSDSVVRHQLFSEGYF
FT                   IITPPDYRKRIKTVEDIRELSAALPLVRFNRNSQIGMQIERYLRRIDIRVPNMLEFDNA
FT                   DTLTSMVAAGIGWAVTTPLSFLQSVAHSREVLTHMPEQLNIKRSLYIIGHRDEYSAFFE
FT                   EACDVTHDIIKTVFVPKLKTLNRGIEKLVEINPDNTE"
FT   misc_feature    complement(485500..486105)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.2e-15"
FT   misc_feature    complement(486175..486354)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 4e-20"
FT   misc_feature    complement(486220..486312)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(486250..486315)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1862.000, SD 5.53 at aa 34-55, sequence
FT                   GSMTAAATRLGLTPSAISQTIR"
FT   CDS_pept        487122..488642
FT                   /transl_table=11
FT                   /locus_tag="ECA0428"
FT                   /product="putative porin"
FT                   /note="Similar to Porphyromonas gingivalis immunogenic 23
FT                   kDa lipoprotein pg3 SWALL:Q9XCA4 (EMBL:AF145799) (223 aa)
FT                   fasta scores: E(): 2.3e-10, 32.2% id in 236 aa, and to
FT                   Escherichia coli hypothetical lipoprotein YiaD precursor
FT                   SWALL:YIAD_ECOLI (SWALL:P37665) (219 aa) fasta scores: E():
FT                   1.5e-09, 35.13% id in 222 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73343"
FT                   /db_xref="GOA:Q6DA35"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA35"
FT                   /protein_id="CAG73343.1"
FT                   /translation="MKHYQVRRISLLAAIVTLTTSCATLHDAGRSYGTAIGCIGGAALG
FT                   GGITYLVTGDAKKAVAGGLLGGAAGCALGNVWQNREEALAKIAQEENIAITTRSLQSQE
FT                   KSGTETVGLVAQVQDSGMFDTNSAQLSTDGLRQVKKIATAMKEGDQSGVILVVGHTDAT
FT                   GSAEWNQRLSEQRAQNVGRVLEQAGLSAQKLYFQGAGSARPVADNVTITGRTSNRRVEI
FT                   VGLANETLLKQRLEQEGSNLAYLRYGTAEQATSTASSSSTSSRKAKPSTSSSNRKVEPT
FT                   RKAEMETAAVTPSAPPQPSGAPTTKKASEPANSKSFVDFGGQPVSSSTPVLAANLKPRS
FT                   SGFSLIPEANASSMLKSCVADNVRVSGQAKNLASGKAVETHETREYLPGMNGRAWAGLV
FT                   NNHLVTLSPVKVLSDNATVVENPKVYVTRDYQSKGNRKADAPLNAVANAWEGEDSILYR
FT                   VYLQNETQQALSCVDLLVPKKASKAQQGQLFYSNHSKEYIASYTPTRS"
FT   misc_feature    487485..487775
FT                   /note="HMMPfam hit to PF00691, DE OmpA family, score
FT                   2.6e-26"
FT   CDS_pept        488659..490308
FT                   /transl_table=11
FT                   /locus_tag="ECA0429"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73344"
FT                   /db_xref="GOA:Q6DA34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA34"
FT                   /protein_id="CAG73344.1"
FT                   /translation="MELFQSIAEAISLYRYIFWPLLVLMTLVLIFIRWWDQVSYFFLNL
FT                   MSSLPLIGHVSRLSRANEPRRQGTGKLAWYPAEEAICAKYWQYYKTSNLDADFYLRCVN
FT                   YLNKVDERGRKQTGVILWGCSVVLVLLEAFIFALVLSPFIASNISANQAEFSAIVISVL
FT                   IGVVLVPATHLMGSELHKNTLLKKIRYWYSEARHSGSAKGLSKNHEISLENTRLDDNDP
FT                   NYIQMLNRITHNVHVKPQYWATAVALALIIFFSVGAYLVRAATINAMDTQAVNGSPFSQ
FT                   VVQTSEISPFDLPSGAAADNAKADTQASQEITDNRVFASKLTFIILSVIFVGVQLIGIL
FT                   IGIYRSFAGIESKAAAKYIGNFSGSEEFASWHAMRRERVERDGQEKLTALQNRLMMKRT
FT                   NSQSEPLTTLPTFDDYISGKLRDKARSTAELNAHLQATNEPVQPKAPIVQSVSAQSIEP
FT                   APVEAVSQPVALVSTPPVVDTVSVAQPVAASASTAEADDEKQRIHELGDLTSFSEEELQ
FT                   LIADDLDLSLASLQKRQRVQALLNKARPKENV"
FT   misc_feature    order(488695..488763,489010..489078,489115..489183,
FT                   489379..489447,489622..489690)
FT                   /note="5 probable transmembrane helices predicted for
FT                   ECA0429 by TMHMM2.0 at aa 13-35, 118-140, 153-175, 241-263
FT                   and 322-344"
FT   CDS_pept        490305..491135
FT                   /transl_table=11
FT                   /locus_tag="ECA0430"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73345"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA33"
FT                   /protein_id="CAG73345.1"
FT                   /translation="MRSLLALLLLGVTCMSQAAERNDIPSCYSFAKLDQHRPADSGREL
FT                   VVIVDQTVKVPVDLKKSIWNQVVRYVQPGDHVVMYQFSALLQDNYMKRVFDGKLEMPFT
FT                   DHKVRNSLGMDSLKSLDGCLVQQRQFFAQNIGKKMAESFADRGDNIAKSEIMDSLKHIG
FT                   DDLKETPASSKTILLVSDMLENSEFGSFYSNNSIRLLEPEKEMARAGKQNLVADFTGAN
FT                   VYIAGAGLIDTDSKNNYRSGKIMQQLEIFWRQYFAASKATVVSFGAPELTVDLK"
FT   misc_feature    490305..490358
FT                   /note="Signal peptide predicted for ECA0430 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.879 between residues 18 and 19"
FT   CDS_pept        491595..492941
FT                   /transl_table=11
FT                   /locus_tag="ECA0431"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73346"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA32"
FT                   /protein_id="CAG73346.1"
FT                   /translation="MASYDLLLLQLEKLVALPDNYYRPSQSGLIDSAPRLIALTRHYNG
FT                   HIRQRAVLCLGFMDEVSALPALVVRVNDWAEPVRRAAKQSVRLLLTPDNTANFVANLPE
FT                   IFWLLQCQRENHQPLVDEIVSFLTEEVHAPSLLAGLSSDDKTVARLSLDILAERDLFPL
FT                   KQIFDQAMLHRDPLVRANAVRYLLSADRDVDHEVMAILLKDTFAPIKQVALQYVMDNAF
FT                   PVPESLLIALLFDKNALVRQRASALLRETNNDPVAHYLTALDRATTVTERKITLWGLDE
FT                   HRYDGIVALAERNLDERYPSLYHSALRILILRTGDDSRERLLAALRHPSIAIAKVAQKL
FT                   FYQQKIYLLLPELQRCLEEASSREHVEVYYFLAHKLNKWDWLIFLLDNAQAENAVLTQT
FT                   GVTYWTQRFNRSGILPNTRQQARLWELLDKCPHVISRKSPYIALFLFGG"
FT   CDS_pept        complement(492953..493744)
FT                   /transl_table=11
FT                   /locus_tag="ECA0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria polysaccharea hypothetical
FT                   protein SWALL:AAO17344 (EMBL:AF542178) (249 aa) fasta
FT                   scores: E(): 4e-35, 38.97% id in 254 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73347"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA31"
FT                   /protein_id="CAG73347.1"
FT                   /translation="MAATNHWTRDQLLIAFTLYSQLPFGRLHSRNPDIIRYAALINRTP
FT                   SALAMKLVNLASLDPFIIDSGRTGLRGASNADRALWQEMDGNPELFEQQCQQAMISLEA
FT                   GAATATVAPSPFQANESDIRDYHGGERFAQVKTRIGQQLFRKRVLSNYGERCCVTGLEE
FT                   PTLLVASHIRPWKTAAEHRLNPSNGLCLSNLHDKAFDMGLISFNDSLEMLLSTRIKKLK
FT                   SAISDVNFAQYEGKQIHLPDAYPPDLSQMEYHREHIFLGQG"
FT   CDS_pept        493897..494994
FT                   /transl_table=11
FT                   /locus_tag="ECA0433"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa2695 SWALL:Q9I0E7 (EMBL:AE004697) (367 aa) fasta
FT                   scores: E(): 4.9e-93, 67.61% id in 352 aa, and to
FT                   Escherichia coli hypothetical protein YaiW SWALL:YAIW_ECOLI
FT                   (SWALL:P77562) (364 aa) fasta scores: E(): 4.5e-89, 66.02%
FT                   id in 365 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73348"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA30"
FT                   /protein_id="CAG73348.1"
FT                   /translation="MSRSYSPLFRPLCALALLVLAGCASKTATTPESRPADVRAQLLKL
FT                   LPDNVKDRQGWATDIATAFIAQGLDPSNENLCSVLAVTEQESTFNADPQVPNLSKIAWQ
FT                   EIDRRAEKVHVPAFLVRTALLIKSPNGKSYSERLDKVRTEKELSAIFDDFIEMVPMGQQ
FT                   LFGRLNPVHTGGPMQVSIAFADANAKGYPYTVDGSLRREVFSRRGGMYFGIKHLLGYSA
FT                   NYPQSIYRFADFNAGWYASRNAAFQRAVSRLTGVKLALDGDLINYSSDKASATELAVRA
FT                   LGKRLDMSDNAIRRGLEKGNSLDFEDTSLYDRVFALADKSGSKAPRAILPGIMLESPKI
FT                   TRKLTTAWFAQRVDERRQRCLVRAK"
FT   misc_feature    493897..493980
FT                   /note="Signal peptide predicted for ECA0433 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.573 between residues 28 and 29"
FT   misc_feature    493933..493965
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(495149..497098)
FT                   /transl_table=11
FT                   /locus_tag="ECA0434"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Rahnella aquatilis putative
FT                   methyl-accepting chemotaxis protein I SWALL:Q93ET6
FT                   (EMBL:AF338038) (554 aa) fasta scores: E(): 2.3e-40, 34.6%
FT                   id in 500 aa, and to Salmonella typhimurium
FT                   methyl-accepting chemotaxis protein II Tar or CheM
FT                   SWALL:MCP2_SALTY (SWALL:P02941) (553 aa) fasta scores: E():
FT                   8.8e-39, 36.2% id in 464 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73349"
FT                   /db_xref="GOA:Q6DA29"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA29"
FT                   /protein_id="CAG73349.1"
FT                   /translation="MKSLHHISIRSKFILALLPPILALLWFSFSGVMERRSTEHEMIRM
FT                   EKLITLARDAGELAHQLQRERGMSAGYFGSQGKKFGAELTTQRQASDRAQQQFQQTAAN
FT                   LSDSELGNDVSGEIGKITQKMQQLDEYRRNIDSMSISVTQALGYYSDSVSYLLSIVGDM
FT                   THLVSDGGIAQRLAAYYNLLNVKEQAGLERAVLSNTFSANSFATGMFERLNQMVGKGEA
FT                   YITAYNMFANAELRKAFEQALNNPAAQNALQMRNKAIASPGGNFSIDANQWFNQQTVKI
FT                   DELKNVEQLATNDLTAQVNALAADARQSWISYLAGALISLLMALGLASMIMRSINEQLQ
FT                   QTLTTIREMGGDLTRRLRVPGTDELSQLNQAYNASLENIADMVVNIKRSSQTIGRASSE
FT                   ISNGNQDLAQRTEEQSASLVQTASSMEEITVTVKQTADFAGQARQLTTEVDDQAHRVGT
FT                   ITESASDAMERIQDTSQRVNAVVAAIDAIAFQTNLLALNAAVEAARAGQHGRGFSVVAA
FT                   EVRQLSQRSADEAGKIRALISDSIASVNEGTKLVNQSNQGINDIVTGTRKVRDLVNEIA
FT                   VAADEQSLGIAQINEALSQLEMVTQQNATLVSQASVASQLLDEQAIEMESLVSHFKVDD
FT                   SAPQQPLQHALLSR"
FT   misc_feature    complement(495197..495895)
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 1.5e-64"
FT   misc_feature    complement(495956..496162)
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score
FT                   2.7e-08"
FT   misc_feature    complement(order(496103..496171,497003..497062))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0434 by TMHMM2.0 at aa 13-32 and 310-332"
FT   misc_feature    complement(497009..497098)
FT                   /note="Signal peptide predicted for ECA0434 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.984) with cleavage site
FT                   probability 0.261 between residues 30 and 31"
FT   CDS_pept        complement(497561..500272)
FT                   /transl_table=11
FT                   /gene="mgtB"
FT                   /locus_tag="ECA0435"
FT                   /product="Magnesium transport ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="Similar to Salmonella typhimurium Mg(2+) transport
FT                   ATPase MgtB or stm3763 SWALL:ATMB_SALTY (SWALL:P22036) (908
FT                   aa) fasta scores: E(): 0, 70.62% id in 909 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73350"
FT                   /db_xref="GOA:Q6DA28"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA28"
FT                   /protein_id="CAG73350.1"
FT                   /translation="MTDMITQTGHRRARKTPTATFAIAREAQNSLDQTLANLNTHLHGL
FT                   SHDDVIERQQTYGENRVAHEKAPHALVQLAAAFNNPFIYVLMALAAISFFTDYWLPQRN
FT                   NEETSLTGVIIILVMVSLSGLLRFWQEFRTNKAAEALKSMVRTTATVLRRPHASATAVM
FT                   QEIPLQQLVPGDILILSAGDMVPADVRLVESRDLFVSQAVLTGESLPIEKYDVFSNISA
FT                   KGCQPTDCGSESDLLALSNICLMGTNISSGTATAIVVATGSHTYFGSLAKSIVGTRSQT
FT                   AFDRGVNSVSWLLIRFMIVMVPVVLLINGFTKGDWMEASLFALAVAVGLTPEMLPMIVS
FT                   SNLAKGAIAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDRIILEHHLNTQGQIDE
FT                   SVLQLAWLNSAHQSGMKNLMDQAIMHFGRHNPAISALGRYRKIDELPFDFIRRRLSIIV
FT                   ADEHNQQRLICKGAVEEMLAVATHVSENGQRHELDDERRNTLKKLAESYNQQGFRVLMI
FT                   GTRELSPVGSTMPLSAVDERDLTLCGLLTFLDPPKESASAAIRALHENGVTVKVLTGDN
FT                   AIITSKICRDVGLEPGEVLEGNEIDALSDEQLGVLVEQRTIFARLTPLQKSRVLKALQG
FT                   NDHTVGFLGDGINDAPALRDADIGISVDTGTDIAKESADIILLEKNLMVLEEGIIKGRE
FT                   TFGNIIKYLNMTASSNFGNVFSVLVASAFIPFLPMLAIHLLIQNLMYDISQLSLPWDKM
FT                   DKEFLRKPRKWDAKNIGRFMLFIGPTSSIFDITTYALMWFVFAANSVEHQALFQSGWFV
FT                   EGLLSQTLVVHMLRTQKIPFIQSTAALPVMLMTGLVMALGIYLPFSPMGPLVGLQPLPW
FT                   EYFPWLAATLIGYCTVAQLVKRAYIRRFGQWF"
FT   misc_feature    complement(order(497600..497668,497711..497779,
FT                   497885..497953,498065..498133,499241..499309,
FT                   499337..499405,499886..499954,499997..500065))
FT                   /note="8 probable transmembrane helices predicted for
FT                   ECA0435 by TMHMM2.0 at aa 70-92, 107-129, 290-312, 322-344,
FT                   714-736, 774-796, 832-854 and 869-891"
FT   misc_feature    complement(498275..499168)
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 8.1e-17"
FT   misc_feature    complement(499130..499150)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   misc_feature    complement(499178..499930)
FT                   /note="HMMPfam hit to PF00122, DE E1-E2 ATPase, score
FT                   3.1e-75"
FT   misc_feature    complement(499979..500230)
FT                   /note="HMMPfam hit to PF00690, DE Cation
FT                   transporter/ATPase, N-terminus, score 3.5e-16"
FT   CDS_pept        complement(500719..502296)
FT                   /transl_table=11
FT                   /locus_tag="ECA0436"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Rahnella aquatilis putative
FT                   methyl-accepting chemotaxis protein I SWALL:Q93ET6
FT                   (EMBL:AF338038) (554 aa) fasta scores: E(): 6.9e-55, 40.22%
FT                   id in 527 aa, and to Salmonella typhimurium
FT                   methyl-accepting chemotaxis protein II Tar or Chem
FT                   SWALL:MCP2_SALTY (SWALL:P02941) (553 aa) fasta scores: E():
FT                   4.7e-51, 40.61% id in 517 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73351"
FT                   /db_xref="GOA:Q6DA27"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA27"
FT                   /protein_id="CAG73351.1"
FT                   /translation="MKFSQLTVLSKLLLGFSVLIAMMLLLGVVSLLQLSVNNSRIDELS
FT                   SSSLPGVRYSLEMRGSLSETRLQQIQYIDSKTPEEREGHRKELLQNADTFLAALKNYQT
FT                   VVNSEDKKALIKVIGENFSGFNSVNATLIDTVNRGDLAEASKISGASSSKYRSQLMKDL
FT                   AKLVEMELATAKNIVASADSTYRTSQYYVWGLLLLALLATIMIATVISRNISRQLGGDP
FT                   HYAQEIMTEIASGNLTTEIKLRQGDSSSLLASINHMNRQLVNTVHTIMSGSESISLASN
FT                   EIAQGNSDLSQRTEEQAASLIQASANMQQLTHTVRQNADNAKEASQLAQQTSETASQGG
FT                   LIVDDMLKRMHEISDSSQKIVDIIAVIEGIAFQTNILALNAAVEAARAGSEGKGFAVVA
FT                   GEVRTLAQKSANAAKEIKTLIEGTVEKITDGSARADKASQAMSEIVQSVKKVTDIVAEI
FT                   SQASNEQHIGIKEISVAVEQMDRVTQQNAALVEESATAAHAMTEQGEQLRDAVRFFKVN
FT                   QDHLLRIH"
FT   misc_feature    complement(500737..501819)
FT                   /note="HMMPfam hit to PF03915, DE Actin interacting protein
FT                   3, score 18"
FT   misc_feature    complement(500746..501444)
FT                   /note="HMMPfam hit to PF00015, DE Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 5.4e-95"
FT   misc_feature    complement(order(501667..501726,502201..502269))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0436 by TMHMM2.0 at aa 10-32 and 191-210"
FT   misc_feature    complement(502192..502296)
FT                   /note="Signal peptide predicted for ECA0436 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.468 between residues 35 and 36"
FT   CDS_pept        complement(502735..503049)
FT                   /transl_table=11
FT                   /locus_tag="ECA0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0326 SWALL:Q8ZJ05 (EMBL:AJ414142) (104 aa) fasta scores:
FT                   E(): 1.3e-33, 75% id in 104 aa, and to Escherichia coli
FT                   hypothetical protein yiil SWALL:YIIL_ECOLI (SWALL:P32156)
FT                   (104 aa) fasta scores: E(): 3.4e-33, 73.78% id in 103 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73352"
FT                   /db_xref="GOA:Q6DA26"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA26"
FT                   /protein_id="CAG73352.1"
FT                   /translation="MLRKAFVMSVFPDSHDEYQRRHNPIWPELAEVLKNHGAHHYSIFL
FT                   DKQRNLLFGYVEVESEARWEAIAQTDVCQRWWKHMGDVMPSNPDNSPISDALDPVFYLD
FT                   "
FT   CDS_pept        complement(503193..504017)
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="ECA0438"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="Similar to Escherichia coli rhamnulose-1-phosphate
FT                   aldolase RhaD or b3902 SWALL:RHAD_ECOLI (SWALL:P32169) (274
FT                   aa) fasta scores: E(): 7.4e-86, 74.63% id in 272 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73353"
FT                   /db_xref="GOA:Q6DA25"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA25"
FT                   /protein_id="CAG73353.1"
FT                   /translation="MQAILSSWFVQGMIKATSDMWLKGWDERNGGNVSLRLTAEDVTPY
FT                   ESDFSPQPRHEALSQPMPELADCWFIVTGSGKFFRNVQLDPADSLVVLQVDSDGKGYRI
FT                   FWGLTNGGLPTSELASHFQSHIVRMGVTHGRDRVIMHCHATNLIALSYVLELNTATFTR
FT                   ELWEGSTECLVVFPDGVGIVPWMVPGTDSIGDATSEQMKRHSLVLWPFHGIFGTGPTLD
FT                   EAFGLIDTAEKSAEVMVKVRSMGGKKQTISTEELIALGKRFGVTPLEAALRV"
FT   misc_feature    complement(503253..503987)
FT                   /note="HMMPfam hit to PF00596, DE Class II Aldolase and
FT                   Adducin N-terminal domain, score 1.6e-18"
FT   CDS_pept        complement(504022..505284)
FT                   /transl_table=11
FT                   /gene="rhaA"
FT                   /locus_tag="ECA0439"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="Similar to Escherichia coli L-rhamnose isomerase
FT                   RhaA or b3903 SWALL:RHAA_ECOLI (SWALL:P32170) (419 aa)
FT                   fasta scores: E(): 5.5e-137, 79.66% id in 418 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73354"
FT                   /db_xref="GOA:Q6DA24"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA24"
FT                   /protein_id="CAG73354.1"
FT                   /translation="MSTPIEAAWQLAKTRYAGLNIDVEAALKQLDQIPVSMHCWQGDDV
FT                   AGFENTGGPLTGGIQATGNYPGKASTPDELRADLEQAFALIPGPKRLNLHAIYLESAQP
FT                   VARNEIAPEHFSNWVAWAKRHQLGLDFNPTCFSHPLSADGFTLSHPDEKVRRFWIEHCQ
FT                   ASRRISAYFGRELGTPSVMNIWVPDGMKDLTIDRLAFRQRLLSALDEVIAEPLDQTHHI
FT                   DAVESKLFGIGAESFTVGSSEFCLGYAASRGTALCLDAGHFHPTEVISDKISSAILYVP
FT                   RLLLHVSRPVRWDSDHVVLLDDETQAIAHEIIRHQLLNRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTETLRKLEQNGDYTARLALLEEQKSLPWQAVWEHYCQRHDVIP
FT                   GSEWLQQVRQYEETILTQRQG"
FT   CDS_pept        complement(505281..506771)
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="ECA0440"
FT                   /product="rhamnulokinase"
FT                   /EC_number="2.7.1.5"
FT                   /note="Similar to Escherichia coli rhamnulokinase rhaB or
FT                   b3904 SWALL:RHAB_ECOLI (SWALL:P32171) (489 aa) fasta
FT                   scores: E(): 2.7e-109, 56.93% id in 483 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73355"
FT                   /db_xref="GOA:Q6DA23"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA23"
FT                   /protein_id="CAG73355.1"
FT                   /translation="MAVKNIVAVDLGASSGRVMLATFHTATQHLTLKEIHRFSNTLVFQ
FT                   DNHHQWDLVALERDILTGLQQIDAMGIAPDSIGVDSWGVDYVLLDKNGQRVGLPYSYRD
FT                   HRTDGVMAAVTAELGREAIYQHTGIQFLPFNTLYQLKALCDAPPDDLDKVEHLLMIPDY
FT                   FHYRLTGNLVCEYTNASTTQLLNLEKKTWDGELLDYLGVPRRWLSDPVQPGHAVGNWTA
FT                   PSGRQIPVTAVATHDTASAVVGAPLQSRDSAYLSSGTWSLMGIESDTPFNSPQALAANI
FT                   TNEGGVDDTYRVLKNIMGLWLLQRVCQERDIKDLGTLIQSATTLPAFVSLINPNDDRFI
FT                   NPPSMHQAIRDYCREHGQPVPQSDAELARCIFDSLALLYRQVVLELGELRHAPIRQLHI
FT                   VGGGSQNAFLNQLCADVCQIPVLAGPVEASTLGNIGCQLMALGAVTDLAAFRHMLTHNF
FT                   PLHRYTPRAESDFAGHWRRFQALSQPETAPQGKKETTQ"
FT   misc_feature    complement(506040..506759)
FT                   /note="HMMPfam hit to PF00370, DE FGGY family of
FT                   carbohydrate kinases, N-terminal domain, score 2e-18"
FT   CDS_pept        507088..507927
FT                   /transl_table=11
FT                   /gene="rhaS"
FT                   /locus_tag="ECA0441"
FT                   /product="L-rhamnose operon regulatory protein"
FT                   /note="Similar to Escherichia coli L-rhamnose operon
FT                   regulatory protein RhaS or rhac2 or b3905 SWALL:RHAS_ECOLI
FT                   (SWALL:P09377) (278 aa) fasta scores: E(): 8.9e-57, 51.64%
FT                   id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73356"
FT                   /db_xref="GOA:Q6DA22"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA22"
FT                   /protein_id="CAG73356.1"
FT                   /translation="MTLLRGDDFFTSRAVTVAVEPRTPQTAFPEHYHDFWEIVLVEQGA
FT                   GVHVFNDQPYALCSGSVFFVRDNDRHLFEDVEGLCLTNMLYRSPRGFRFLSDIAAFLPY
FT                   GPNGEWQGQWQVNAAGMQQLKQSLNSLAGLAQSDAPEAIAASESLFLQILVQLRQHCFQ
FT                   TEGNGSERQGVQALLGWLQNNYSEEVNWGGLADQFSLPLRTLHRQLKQHTGMTPQRYLN
FT                   RLRLLEARRRLQQSDDSITTIAHACGFSDSNHFSTQFRKAFSQAPKSLRHQAFSREE"
FT   misc_feature    507616..507753
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 2.5e-05"
FT   misc_feature    507652..507717
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1068.000, SD 2.82 at aa 189-210, sequence
FT                   VNWGGLADQFSLPLRTLHRQLK"
FT   misc_feature    507760..507888
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    507772..507903
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 7e-11"
FT   CDS_pept        507952..508806
FT                   /transl_table=11
FT                   /gene="rhaR"
FT                   /locus_tag="ECA0442"
FT                   /product="L-rhamnose operon transcriptional activator"
FT                   /note="Similar to Escherichia coli L-rhamnose operon
FT                   transcriptional activator RhaR or RhaC1 or b3906
FT                   SWALL:RHAR_ECOLI (SWALL:P09378) (312 aa) fasta scores: E():
FT                   1.4e-50, 46.95% id in 279 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73357"
FT                   /db_xref="GOA:Q6DA21"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA21"
FT                   /protein_id="CAG73357.1"
FT                   /translation="MATAIRGLKLQTEDYFLTDKNAVMVAERHPQPVFPLHHHDFDELV
FT                   IVWRGNGLHLWNDVPYRITRGDMFYVSAHDRHSYESVHELELDNILYIRNRLTLSADWQ
FT                   TLLPSGELPQSQRHWCLGSEGMDTIREKVDALTQECMKSDALSLQLSEALLLQIALLAA
FT                   RYRHSPDSPQLADAHQLDMLMNALRASIAAPFRFEAFCEQHHFSARSLRSRFKEQTGMS
FT                   VPHYLRQLRLCKAMELLRYDLQTIGDVAALCGFEDSNYFSVVFHQAFGVSPSAYRQRFL
FT                   NVE"
FT   misc_feature    508507..508635
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.34"
FT   misc_feature    508654..508785
FT                   /note="HMMPfam hit to PF00165, DE Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 1.5e-10"
FT   CDS_pept        complement(508848..509102)
FT                   /transl_table=11
FT                   /locus_tag="ECA0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   hypothetical protein YoeB SWALL:YOEB_ECOLI (SWALL:P56605)
FT                   (84 aa) fasta scores: E(): 8.2e-31, 85.71% id in 84 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73358"
FT                   /db_xref="GOA:Q6DA20"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA20"
FT                   /protein_id="CAG73358.1"
FT                   /translation="MKLIWSEEAWEDYLYWQDIDKRTVKKINELIKETRRTPFEGKGKP
FT                   EPLKHNLAGFWSRRITEAHRLVYAITDDAMMIAACRYHY"
FT   CDS_pept        complement(509099..509350)
FT                   /transl_table=11
FT                   /locus_tag="ECA0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   hypothetical protein YefM SWALL:YEFM_ECOLI (SWALL:P46147)
FT                   (83 aa) fasta scores: E(): 5.3e-25, 87.95% id in 83 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73359"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA19"
FT                   /protein_id="CAG73359.1"
FT                   /translation="MRTISYSEARQNLSATMMKTVEDRAPILITRQNGEACVLMSLEEY
FT                   NSLEETAYLLRSPANAKRLMNSIESLKAGNSEERDIIE"
FT   misc_feature    complement(509105..509347)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02604, DE Uncharacterized ACR,
FT                   COG2161, score 1.4e-41"
FT   CDS_pept        complement(509425..511134)
FT                   /transl_table=11
FT                   /locus_tag="ECA0445"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="Similar to Bradyrhizobium japonicum ABC transporter
FT                   ATP-binding protein blr1604 SWALL:BAC46869 (EMBL:AP005940)
FT                   (626 aa) fasta scores: E(): 4.6e-90, 49.21% id in 573 aa,
FT                   and to Agrobacterium tumefaciens MoaD SWALL:O50270
FT                   (EMBL:AF242881) (588 aa) fasta scores: E(): 2.2e-61, 39.78%
FT                   id in 553 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73360"
FT                   /db_xref="GOA:Q6DA18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA18"
FT                   /protein_id="CAG73360.1"
FT                   /translation="MSLNPLSHSSHSSSDASAKTPLLRVDGLSVTFPSPFGPIRSVKNL
FT                   SFQVNAGEILALVGESGSGKSVTARTLVGLSGENVDVQANAIELTRHDGSLCDLRYLTD
FT                   RDWRAIRGREIGFVLQDALVSLDPLRKIGQEVAEPILTHRLLPREQIPARVAELLTKAG
FT                   IPDPENRAAQYPHELSGGLRQRALIASALAAGPQLLIADEPTTALDATVQKQVLKVFAA
FT                   LAQAGHGVLLITHDLAVVADIADRVIVMQQGSLVEGGEARQLLSAPTHPYTRRLLAAIP
FT                   TASTRGKWLAGVDPLQNGITPSAASLAANHASTDDTIALTADRIAVSFKRPDGSRMQAV
FT                   NQVSLQIKRGETLGIVGESGSGKTTLGKVILALQKPDSGEVRLAGNAWSALTERERRPL
FT                   RARIQTITQDPLSSFDPQFTVAQILRQPLRLRRDLSDDEKQRRILTLLEYVGLTPDLLT
FT                   RRPTALSGGQRQRVSIAQALASDPEILICDEPVSALDVTTQAQVLDLLGALQRQLGLTM
FT                   LFISHDLGVVQHMSHRIAVMKDGDIVETGPVEQIFNQPQHPYTRLLLSTVAE"
FT   misc_feature    complement(509515..510087)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.2e-59"
FT   misc_feature    complement(509701..509745)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(510043..510066)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(510376..510981)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1e-42"
FT   misc_feature    complement(510937..510960)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(511131..511997)
FT                   /transl_table=11
FT                   /locus_tag="ECA0446"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Xanthomonas axonopodis ABC transporter
FT                   permease OppC SWALL:Q8PP30 (EMBL:AE011717) (294 aa) fasta
FT                   scores: E(): 8.7e-38, 43.26% id in 282 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73361"
FT                   /db_xref="GOA:Q6DA17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA17"
FT                   /protein_id="CAG73361.1"
FT                   /translation="MSSEPMPFTQIPSRKTYRSPWLSTATLLPAAIVSLLALAVFFPSL
FT                   FTSRTADEMDMGAVFQSPNATYWFGTDQLGRDIFSRIVHGTSLSLGIGVGAMLIACFGG
FT                   VLFGTLSVLAPLRIRQLLVRLLDIMLAFPDLLLALLVIAVLGRGPENTMLAVGLAGIAG
FT                   YARLIRSQVLQVRLSGYVEHAIALGEHPLYIVFRHIIPNTLRPLLIVATIGVGHAVLSA
FT                   SALSFLGLGVVPPTAEWGALLADGRNFLDIAPWVSLLPASVVALSVISITLLGRRLQTI
FT                   LAKGEAR"
FT   misc_feature    complement(order(511176..511244,511311..511379,
FT                   511488..511541,511569..511637,511656..511724,
FT                   511869..511937))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0446 by TMHMM2.0 at aa 21-43, 92-114, 121-143, 153-170,
FT                   207-229 and 252-274"
FT   misc_feature    complement(511254..511484)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport system inner membrane component, score 2.3e-05"
FT   misc_feature    complement(511845..511997)
FT                   /note="Signal peptide predicted for ECA0446 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.645 between residues 51 and 52"
FT   CDS_pept        complement(511990..512949)
FT                   /transl_table=11
FT                   /locus_tag="ECA0447"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Xanthomonas axonopodis ABC transporter
FT                   permease oppC SWALL:Q8PP31 (EMBL:AE011717) (325 aa) fasta
FT                   scores: E(): 2e-42, 43.27% id in 305 aa, and to Salmonella
FT                   typhi hypothetical ABC transporter permease protein yliC
FT                   SWALL:Q8Z862 (EMBL:AL627268) (306 aa) fasta scores: E():
FT                   1.1e-34, 36.36% id in 308 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73362"
FT                   /db_xref="GOA:Q6DA16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA16"
FT                   /protein_id="CAG73362.1"
FT                   /translation="MMSGLNVNLYALGKRLLTILAVLWGAATLTFIAVKLIPGDPVAIL
FT                   SGGDNVVDEAYRAVLIKQFGLDQPLWVQYLRYCWQALQGDFGVSYLYRLPVGGVISDAM
FT                   QETLPLAIGGLILALFLAITSALLTAGRYGPLRTAVSWLELTLLSTPVYWIGIVLLSLF
FT                   SFRLQWFPVTGNDGFMSLVLPVITLGLPIAAILSQVLRDGLEDALSQPFSLTVRTRGVS
FT                   EIRLRFRHGLRHAALAASTLTGTLLASVLGGSVLTETVFGRAGIGQVTLSAIENRDMPL
FT                   VLGVVMLSAFLFVVINLLVDALYLLIDPRLRKKASAHE"
FT   misc_feature    complement(order(512029..512097,512179..512247,
FT                   512350..512418,512461..512529,512563..512631,
FT                   512848..512916))
FT                   /note="6 probable transmembrane helices predicted for
FT                   ECA0447 by TMHMM2.0 at aa 12-34, 107-129, 141-163, 178-200,
FT                   235-257 and 285-307"
FT   CDS_pept        complement(512927..514540)
FT                   /transl_table=11
FT                   /locus_tag="ECA0448"
FT                   /product="putative ABC transporter extracellular solute
FT                   binding protein"
FT                   /note="Similar to Xanthomonas axonopodis ABC transporter
FT                   oligopeptide binding protein oppa or xac0856 SWALL:Q8PP32
FT                   (EMBL:AE011717) (538 aa) fasta scores: E(): 9.5e-59, 33.84%
FT                   id in 526 aa, and to Escherichia coli O157:H7 periplasmic
FT                   binding protein for nickel nika or z4868 or ecs4343
FT                   SWALL:Q8X5U3 (EMBL:AE005572) (524 aa) fasta scores: E():
FT                   9.3e-27, 26.4% id in 534 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73363"
FT                   /db_xref="GOA:Q6DA15"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA15"
FT                   /protein_id="CAG73363.1"
FT                   /translation="MEKNHPQVTTLAAGLLSLLFALNPGAYAAQSGEKPVSGGILNIGL
FT                   GSDTPIIDPHITAYGVTALISRNVVDSLVGQAEDNRFTPWLAESWKINDDNTEYTFHLR
FT                   KDVTFSDGTKLDAEAVKYNIERILDPKTTSSYAKSLLGPIDKISTPDAYTVVIHYSSAF
FT                   APLLQGLSLPYLGIQSPTYLKKTPNTSNTVVGSGPFILDSFVKGSGSKLTKRPDYNWGP
FT                   GYAKHTGPAYLDGLVFKYLPEASVRLGALSSGQIQAIDAVPPANFPTVKRNPKLEVITY
FT                   ENPGVNRVLYLNTTKGPFQDVAVRKAFQSAVDTNAAVKVAFFGTLKAADNVLGPATLYY
FT                   DPSVASRWGFDVKKANELLDNAGWKQKDSAGYRTKDGKRLSVSFVYATTNVEAADVALF
FT                   QAVQFQVKQAGFDVQLTPVDAGEFTTRTNANEYDIASNFFVRAEPDILRTVFDSAYAPP
FT                   NGNGFTRISVLDDKLRKAIGAGEAERKQLYTEIQNEVIDQAYVVPLYVPAYQLGLSKQV
FT                   QGISWATNAKPNFYDVWIKR"
FT   misc_feature    complement(512936..514522)
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 8.2e-48"
FT   misc_feature    complement(514457..514540)
FT                   /note="Signal peptide predicted for ECA0448 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 28 and 29"
FT   CDS_pept        515161..515775
FT                   /transl_table=11
FT                   /locus_tag="ECA0449"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein YagU SWALL:YAGU_ECOLI
FT                   (SWALL:P77262) (204 aa) fasta scores: E(): 1.6e-77, 88.23%
FT                   id in 204 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73364"
FT                   /db_xref="GOA:Q6DA14"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA14"
FT                   /protein_id="CAG73364.1"
FT                   /translation="MNFFEQTPPSRRRYGLAAFIGLIAGIVSSFVKWGAENPLPPRSPT
FT                   DMFSSACVPESLIRAAEQIDCSRNFLNPPYIFLRDWLGVVDPNAAVYTFAGHVFNWVGV
FT                   THIVFSIVFALGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPSLFVLPMY
FT                   EHVSEIVGHLIWFWSIEIIRRDLRNRMTHEPDPEIPLNASR"
FT   misc_feature    515161..515262
FT                   /note="Signal peptide predicted for ECA0449 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.848) with cleavage site
FT                   probability 0.730 between residues 34 and 35"
FT   misc_feature    order(515197..515265,515452..515520,515554..515622)
FT                   /note="3 probable transmembrane helices predicted for
FT                   ECA0449 by TMHMM2.0 at aa 13-35, 98-120 and 132-154"
FT   CDS_pept        complement(516073..517107)
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="ECA0450"
FT                   /product="L-rhamnose-proton symport"
FT                   /note="Similar to Escherichia coli L-rhamnose-proton
FT                   symport RhaT or b3907 SWALL:RHAT_ECOLI (SWALL:P27125) (344
FT                   aa) fasta scores: E(): 2.3e-103, 76.96% id in 343 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73365"
FT                   /db_xref="GOA:Q6DA13"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA13"
FT                   /protein_id="CAG73365.1"
FT                   /translation="MSNPILLGIFWHFIGAASAACFYAPFKQVKNWSWETMWSLGGFFS
FT                   WIILPWSISWWLLPDFWRYYGSFDMATLLPIFLFGAMWGIGNINYGLTMRYLGMSMGIG
FT                   IAIGVTLIIGTLMTPVLQGKFSVLFGSPGGQMTLLGVLVAVIGVAIVSYAGLLKERALG
FT                   IRAEEFSLKKGLILAVMCGIFSAGMSFAMDAAKPMHTAAQALGINSLYVALPSYVVIMG
FT                   GGAIVNLGFCFIRLATCKGISLKADLAQAKPLLIANALFAILGGVMWYLQFFFYAWGHA
FT                   NIPADYTYISWMLHMSFYVLCGGIVGLLFKEWKAVGQKPVRMLVLGCVVIILAANIVGL
FT                   GMAV"
FT   misc_feature    complement(order(516082..516141,516178..516246,
FT                   516289..516348,516409..516477,516535..516603,
FT                   516640..516708,516751..516819,516838..516906,
FT                   516934..516993,517030..517098))
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0450 by TMHMM2.0 at aa 4-26, 39-58, 68-90, 97-119,
FT                   134-156, 169-191, 211-233, 254-273, 288-310 and 323-342"
FT   CDS_pept        517457..517939
FT                   /transl_table=11
FT                   /locus_tag="ECA0451"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella typhi hypothetical protein
FT                   yqha sty3326 or t3074 SWALL:YQHA_SALTI (SWALL:Q8Z3Q8) (164
FT                   aa) fasta scores: E(): 5.4e-49, 84.41% id in 154 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa4574 pa4574
FT                   SWALL:Y9H4_PSEAE (SWALL:Q9HVL0) (162 aa) fasta scores: E():
FT                   7.2e-49, 83.11% id in 154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73366"
FT                   /db_xref="GOA:Q6DA12"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA12"
FT                   /protein_id="CAG73366.1"
FT                   /translation="MYSSRWLLAPVYLGLSLGLLALAIKFFQEVFHVLPNIFDMAEADL
FT                   VLVLLSLIDMTLVGGLLVMVMLSGYENFVSALDITDGREKLNWLGKMDSGSLKNKVAAS
FT                   IVAISSIHLLRVFMDARNIPDNKLMWYVIIHLTFVLSALVMGYLDRMSRYEKSKTA"
FT   misc_feature    517457..517519
FT                   /note="Signal peptide predicted for ECA0451 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.878) with cleavage site
FT                   probability 0.543 between residues 21 and 22"
FT   misc_feature    517457..517924
FT                   /note="HMMPfam hit to PF03350, DE Uncharacterized protein
FT                   family, UPF0114, score 1.4e-101"
FT   misc_feature    order(517469..517528,517589..517657,517838..517900)
FT                   /note="3 probable transmembrane helices predicted for
FT                   ECA0451 by TMHMM2.0 at aa 5-24, 45-67 and 128-148"
FT   CDS_pept        518034..519071
FT                   /transl_table=11
FT                   /locus_tag="ECA0452"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa2197 SWALL:Q9I1S0 (EMBL:AE004646) (345 aa) fasta
FT                   scores: E(): 1.9e-102, 75.94% id in 345 aa, and to
FT                   Salmonella typhi putative NADP-dependent oxidoreductase
FT                   sty1476 SWALL:Q8Z742 (EMBL:AL627270) (345 aa) fasta scores:
FT                   E(): 1.7e-100, 76.23% id in 345 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73367"
FT                   /db_xref="GOA:Q6DA11"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA11"
FT                   /protein_id="CAG73367.1"
FT                   /translation="MTQIDRINRRVVLAQRPHGAPTQDNFRLEQQAVPSVDSGQVLLRT
FT                   VFLSLDPYMRGRMSDAPSYAKPVELNDVMVGGTISRVVESKHPDYQTGDWVLSYSGWQD
FT                   YAISDGKGLTNLGQSPTNPSYALGILGMPGFTAYMGLTDIGQPKAGETLVVAAATGPVG
FT                   ATVGQIGKLKGCRVVGVAGGAEKCRYAVEVLGFDVCLDHRADDFAEQLKQACPQGIDIY
FT                   FENVGGKVFDAVLPLLNTSARIPVCGLVSGYNGTGLPDGPDRLPLLAGTLLKKRIRMQG
FT                   FIIFDDYGHRFDEFWKEVSPWVAQGKIKYREEIVDGLENASEAFIGLLHGRNFGKLVIR
FT                   IGPDA"
FT   misc_feature    518091..519056
FT                   /note="HMMPfam hit to PF00107, DE Zinc-binding
FT                   dehydrogenase, score 8.5e-28"
FT   CDS_pept        complement(519168..519398)
FT                   /transl_table=11
FT                   /locus_tag="ECA0453"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo0754 SWALL:Q8ZHX2 (EMBL:AJ414144) (100 aa) fasta scores:
FT                   E(): 3.1, 30% id in 60 aa, and to Salmonella typhimurium
FT                   putative inner membrane protein yjeo or stm4346
FT                   SWALL:Q8ZKB3 (EMBL:AE008904) (104 aa) fasta scores: E():
FT                   0.34, 34% id in 50 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73368"
FT                   /db_xref="GOA:Q6DA10"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA10"
FT                   /protein_id="CAG73368.1"
FT                   /translation="MLRKTGYIYNVYFYTYAALCFFLINAFSTIEYEWMIDGDSVADFC
FT                   EVPRADADAFLNFIIIPLSIPSFLSKRAQPE"
FT   misc_feature    complement(519312..519380)
FT                   /note="1 probable transmembrane helix predicted for ECA0453
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(519485..519781)
FT                   /transl_table=11
FT                   /locus_tag="ECA0454"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo0754 SWALL:Q8ZHX2 (EMBL:AJ414144) (100 aa) fasta scores:
FT                   E(): 1.5, 29.89% id in 97 aa, and to Salmonella typhimurium
FT                   putative inner membrane protein yjeo or stm4346
FT                   SWALL:Q8ZKB3 (EMBL:AE008904) (104 aa) fasta scores: E():
FT                   0.00095, 30.2% id in 96 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73369"
FT                   /db_xref="GOA:Q6DA09"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA09"
FT                   /protein_id="CAG73369.1"
FT                   /translation="MPNYSNITYNILFYFYSTLCALIILITSIRDYEGMVDGVEIINLC
FT                   EIPEGDSDGFFSFIIIPLSIPFFIVKKSLARAITYIILLFYYFWSFYIRFNFC"
FT   misc_feature    complement(order(519503..519562,519695..519763))
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0454 by TMHMM2.0 at aa 7-29 and 74-93"
FT   CDS_pept        complement(519800..520555)
FT                   /transl_table=11
FT                   /locus_tag="ECA0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c3766 SWALL:AAN82210 (EMBL:AE016766) (245 aa) fasta scores:
FT                   E(): 1.7e-14, 34.93% id in 229 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73370"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA08"
FT                   /protein_id="CAG73370.1"
FT                   /translation="MNKFNDIIDECDLSFSDWGKNYPRWSSLDAAWWKTFGGDNYLNKY
FT                   KDGYIVFHREKIKEIARQYKIPSILLASVAHAEAGGMVDYFKYPTLFGRQVVHSYSGWP
FT                   GKEKILPSPEKTSIGIIAMQIRVVAEIFGKNPSALRNAEATYISICLNKDNFNLTMVAR
FT                   HLYELINYDYPGTDTLNLTDEQFILAGARYNRGVQRSRSDLIRSINAEKDLIEVRDWTS
FT                   YGRSMLNHREKITKLLYEVTTPPKNSDSN"
FT   misc_feature    complement(520124..520189)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1473.000, SD 4.20 at aa 123-144, sequence
FT                   MQIRVVAEIFGKNPSALRNAEA"
FT   CDS_pept        complement(520562..521041)
FT                   /transl_table=11
FT                   /locus_tag="ECA0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2868 SWALL:AAM84938 (EMBL:AJ414154) (159 aa) fasta
FT                   scores: E(): 2.3e-30, 50.94% id in 159 aa, and to
FT                   Escherichia coli O6 conserved hypothetical protein c3767
FT                   SWALL:AAN82211 (EMBL:AE016766) (159 aa) fasta scores: E():
FT                   2.6e-22, 42.76% id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73371"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA07"
FT                   /protein_id="CAG73371.1"
FT                   /translation="MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATN
FT                   YDLSRDRHVNHHPFSVTKAVDKSTPLVLTSIANNELLEVELRYYRTSASGTQENYMTIT
FT                   LRDASIVNLSNQNPNSLTHNDMQPFETLSLRYESITCQHNIAGTSGYSILTENMY"
FT   CDS_pept        complement(521576..522787)
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="ECA0457"
FT                   /product="putative monooxygenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Escherichia coli protein VisC or b2906
FT                   SWALL:VISC_ECOLI (SWALL:P25535) (400 aa) fasta scores: E():
FT                   3.8e-114, 72.43% id in 399 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73372"
FT                   /db_xref="GOA:Q6DA06"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:4N9X"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA06"
FT                   /protein_id="CAG73372.1"
FT                   /translation="MQSFDVVIAGGGMVGLALACGLQGSGLRIAVLEKQAAEPQTLGKG
FT                   HALRVSAINAASECLLRHIGVWENLVAQRVSPYNDMQVWDKDSFGKISFSGEEFGFSHL
FT                   GHIIENPVIQQVLWQRASQLSDITLLSPTSLKQVAWGENEAFITLQDDSMLTARLVVGA
FT                   DGAHSWLRQHADIPLTFWDYGHHALVANIRTEHPHQSVARQAFHGDGILAFLPLDDPHL
FT                   CSIVWSLSPEQALVMQSLPVEEFNRQVAMAFDMRLGLCELESERQTFPLMGRYARSFAA
FT                   HRLVLVGDAAHTIHPLAGQGVNLGFMDVAELIAELKRLQTQGKDIGQHLYLRRYERRRK
FT                   HSAAVMLASMQGFRELFDGDNPAKKLLRDVGLVLADKLPGIKPTLVRQAMGLHDLPDWL
FT                   SAGK"
FT   misc_feature    complement(521735..522322)
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   5.1e-39"
FT   misc_feature    complement(521864..521905)
FT                   /note="PS01304 ubiH/COQ6 monooxygenase family signature."
FT   CDS_pept        complement(522816..523994)
FT                   /transl_table=11
FT                   /gene="visB"
FT                   /gene_synonym="ubiH"
FT                   /locus_tag="ECA0458"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="Similar to Escherichia coli
FT                   2-octaprenyl-6-methoxyphenol hydroxylase UbiH or VisB or
FT                   b2907 SWALL:UBIH_ECOLI (SWALL:P25534) (392 aa) fasta
FT                   scores: E(): 2.4e-96, 62.24% id in 392 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73373"
FT                   /db_xref="GOA:Q6DA05"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA05"
FT                   /protein_id="CAG73373.1"
FT                   /translation="MAVMIVGGGMAGATLALAISRLSQGTIPVDLIEAYSPLDKEHPGF
FT                   DARALALSDGTRQQLAALGIWQAMSGNATAITDIHVSERGHASVVNLHAADYHVQALGH
FT                   VVELHDVGQRLFSLLQQAPGVRLHCPAKVVAVTRTQENATLTLDNGTALTGQLLVAADG
FT                   SHSMLSQSCGIHWQQHEYDQVAVIANVTTGEPHRGRAFERFTPHGPLALLPMSNGRSSL
FT                   VWCHDKHRQHDVDGWSETEFRQQLQLAFGWRLGQFTHIGERHSYPLRLLTASQHTSHRL
FT                   ALVGNAAQTLHPIAGQGFNLGIRDVMSLAETLVEAVKNQQDIGQYSVLSRYQQRREPDQ
FT                   HTTVAITDGLVRLFANRYTALAVGRNLGLIAMNNLPLMRDAFARRTLGWVER"
FT   misc_feature    complement(522951..523535)
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   7.8e-29"
FT   misc_feature    complement(523080..523121)
FT                   /note="PS01304 ubiH/COQ6 monooxygenase family signature."
FT   misc_feature    complement(523920..523994)
FT                   /note="Signal peptide predicted for ECA0458 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.802) with cleavage site
FT                   probability 0.321 between residues 25 and 26"
FT   CDS_pept        complement(524040..525365)
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="ECA0459"
FT                   /product="proline aminopeptidase II"
FT                   /EC_number="3.4.11.9"
FT                   /note="Similar to Escherichia coli xaa-pro aminopeptidase
FT                   PepP or b2908 SWALL:AMPP_ECOLI (SWALL:P15034) (440 aa)
FT                   fasta scores: E(): 2.8e-138, 77.67% id in 430 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73374"
FT                   /db_xref="GOA:Q6DA04"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA04"
FT                   /protein_id="CAG73374.1"
FT                   /translation="MNPQEFLRRRQGLLEKMAPGSAAIIFSAPEAQRNADSDYPYRQNS
FT                   DFWYFTGFNEPEAVLLLVKSDVKHHHSVIFNRVRDLTAEIWFGRRLGQEAAPAKLGVDR
FT                   ALPFGEISTQLHLLLNGLDVVYHAQGQYDYADKLIFSALETLRNGTRQGLAAPTTLTDW
FT                   RPWVHEMRLFKSPAEISIMRRACEITALAHTRAMQKCRPGMYEYQLEGEIHHEFTRHGA
FT                   RYPSYNTIVGSGDNACILHYTENETQMRDGDLVLIDAGCEYKSYAGDITRTFPVNGKFT
FT                   APQRAIYDIVLRSQLRALELFGPGRSIREVNEDVVRIMVSGLIKLGVMKGEVEELIAEQ
FT                   AHRQFFMHGLSHWLGLDVHDVGNYGSTDRGRPLEPGMVLTIEPGLYIAPDAKVPQQYRG
FT                   IGVRIEDNIVITENGNENLTAGVIKDADAIEALMAQRYDTQH"
FT   misc_feature    complement(524088..524852)
FT                   /note="HMMPfam hit to PF00557, DE metallopeptidase family
FT                   M24, score 2.3e-101"
FT   misc_feature    complement(524286..524324)
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature."
FT   CDS_pept        complement(525471..526058)
FT                   /transl_table=11
FT                   /locus_tag="ECA0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0911 SWALL:Y911_YERPE (SWALL:Q8ZHI2) (192 aa) fasta
FT                   scores: E(): 1.2e-49, 70.76% id in 195 aa, and to
FT                   Escherichia coli, Escherichia coli O6, Escherichia coli
FT                   O157:H7, and Shigella flexneri hypothetical protein YgfB
FT                   SWALL:YGFB_ECOLI (SWALL:P25533) (192 aa) fasta scores: E():
FT                   4.4e-49, 70.25% id in 195 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73375"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA03"
FT                   /protein_id="CAG73375.1"
FT                   /translation="MSIENTFPAYEGLNQLLHQQQVALTAAEMHGLISGMLCGGNHDDS
FT                   WRTLVFELTNEGMAFTQTLSQPLQDLYQATRDALEDDGFMFQLFLPDDSLDEVSVFDRA
FT                   DALAGWVNHFLLGLGVIQPKLNKVKGELKEAIEDLRNIAQLGYDEDEDQEELEQSMEEV
FT                   IEYVRVSAILCHTEFTNQRVVTAPEQQKPTLH"
FT   misc_feature    complement(525477..526040)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03695, DE Uncharacterised protein
FT                   family (UPF0149), score 3.2e-91"
FT   CDS_pept        526251..526580
FT                   /transl_table=11
FT                   /locus_tag="ECA0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0912 SWALL:Q8ZHI1 (EMBL:AJ414145) (109 aa) fasta scores:
FT                   E(): 2.9e-35, 91.74% id in 109 aa, and to Escherichia coli,
FT                   Escherichia coli O6, Escherichia coli O157:H7, and Shigella
FT                   flexneri hypothetical protein YgfE SWALL:YGFE_ECOLI
FT                   (SWALL:P45580) (109 aa) fasta scores: E(): 3.1e-31, 82.56%
FT                   id in 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73376"
FT                   /db_xref="GOA:Q6DA02"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR023771"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DA02"
FT                   /protein_id="CAG73376.1"
FT                   /translation="MSAQPVDIQIFGRSLRVNCPPEQQEALNQAAEDLNQRLQDLKVRT
FT                   RVTNTEQLVFIAALNVCHELAQERGKTRDYASNMEQRIRMLQQTIEQALLEQGKITDRQ
FT                   GTQFE"
FT   misc_RNA        526656..526839
FT                   /gene="ssrS"
FT                   /note="Erwinia_carotovora 526656 526839 RF00013 1 59 81.84
FT                   6S"
FT   CDS_pept        526894..527520
FT                   /transl_table=11
FT                   /locus_tag="ECA0462"
FT                   /product="putative 5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="Similar to Oryctolagus cuniculus
FT                   5-formyltetrahydrofolate cyclo-ligase MthfS
FT                   SWALL:FTHC_RABIT (SWALL:P80405) (201 aa) fasta scores: E():
FT                   2.9e-11, 28.35% id in 201 aa, and to Yersinia pestis
FT                   putative 5-formyltetrahydrofolate cyclo-ligase-family
FT                   protein ypo0913 or y3300 SWALL:Q8ZHI0 (EMBL:AJ414145) (198
FT                   aa) fasta scores: E(): 1.2e-51, 67.87% id in 193 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73377"
FT                   /db_xref="GOA:Q6DA01"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA01"
FT                   /protein_id="CAG73377.1"
FT                   /translation="MSILPSASPSSTAVSRQQIRQAVRQQRRLLTPEQQRLFALQACER
FT                   VMAHPKIIRADNIAVFLSFDGELDTPPLIQQLWQQGKRVYLPVLHPFRAGYLLFLRYAP
FT                   DTELVRNRLKIMEPRLDVRQVLPLPQLDILLTPLVAFDHQGQRLGMGGGFYDRTLQYRN
FT                   QMSRGPYPIGLAHDCQQVDALPVESWDIPLPEIITPSHHWQWNTR"
FT   misc_feature    526933..527490
FT                   /note="HMMPfam hit to PF01812, DE 5-formyltetrahydrofolate
FT                   cyclo-ligase family, score 5.1e-62"
FT   CDS_pept        complement(527517..528770)
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /gene_synonym="nadI"
FT                   /locus_tag="ECA0463"
FT                   /product="transcriptional regulator of NAD metabolism"
FT                   /note="Similar to Salmonella typhimurium transcriptional
FT                   regulator NadR SWALL:NADR_SALTY (SWALL:P24518) (410 aa)
FT                   fasta scores: E(): 1.1e-140, 85.5% id in 407 aa, and to
FT                   Escherichia coli transcriptional regulator NadR or NadI or
FT                   b4390 SWALL:NADR_ECOLI (SWALL:P27278) (410 aa) fasta
FT                   scores: E(): 2.2e-139, 83.9% id in 410 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73378"
FT                   /db_xref="GOA:Q6DA00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DA00"
FT                   /protein_id="CAG73378.1"
FT                   /translation="MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPSA
FT                   QKLEALHRFLELEFPRYEKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDEPR
FT                   DRLLFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKGIQA
FT                   FMQEKSITPNFVYTSEEQDALQYREHLGIEAILIDPQRSFMNISGSQIRHDPFRYWDYI
FT                   PTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQY
FT                   SDYDKIALGQAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALVDEYRFD
FT                   LVILLENNTPWVADGLRSLGSTTARSEFQDLLKTMLAKNNIPYVYIKEPDYDSRFLHCV
FT                   ELVQQMLGHDRSPEQIKN"
FT   misc_feature    complement(528033..528056)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    complement(528036..528059)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(528585..528752)
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   8e-06"
FT   misc_feature    complement(528660..528725)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1756.000, SD 5.17 at aa 16-37, sequence
FT                   CTLQQVADATDMTKGYLSQLLN"
FT   CDS_pept        complement(528905..530287)
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="ECA0464"
FT                   /product="putative DNA repair protein"
FT                   /note="Similar to Escherichia coli DNA repair protein RadA
FT                   or Sms or b4389 SWALL:RADA_ECOLI (SWALL:P24554) (460 aa)
FT                   fasta scores: E(): 3.9e-155, 90.88% id in 461 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73379"
FT                   /db_xref="GOA:Q6D9Z9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z9"
FT                   /protein_id="CAG73379.1"
FT                   /translation="MAKAIKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLASASVS
FT                   RSDRLTGYAGESAGVSRVQKLSEISLEALPRFSTGFLEFDRVLGGGVVPGSAILIGGSP
FT                   GAGKSTLLLQTLCKLSEHMKTLYVTGEESLQQVAMRAHRLNLPTQNLNMLSETSIEQIC
FT                   LIAEQEQPKLMVIDSIQVMHLADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVT
FT                   KDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREIS
FT                   NPSAIFLSRGDEVTSGSSVMVVWEGTRPLLVEIQALVDQSMMANPRRVAVGLEQNRLAI
FT                   LLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLLSLVSSFRDRPLPQDLVIFGE
FT                   VGLAGEIRPVPSGQERITEAAKHGFKRAIIPHANMPKKAPASMQVFGVKKLADALAILD
FT                   DL"
FT   misc_feature    complement(529961..529984)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(530305..531282)
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="ECA0465"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri phosphoserine phosphatase
FT                   SerB or b4388 or z5989 or ecs5346 or sf4420
FT                   SWALL:SERB_ECOLI (SWALL:P06862) (322 aa) fasta scores: E():
FT                   5.7e-81, 71.87% id in 320 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73380"
FT                   /db_xref="GOA:Q6D9Z8"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z8"
FT                   /protein_id="CAG73380.1"
FT                   /translation="MSNSLTYRDLPNEINCWPGLPLSLSGDEVMPLDYRAGDTGWLIYS
FT                   DVLDKNLISRYQRKLGSAMVIVSAWNVGDYQVVRLAGTLTPRATKLAHELGIDVAAMSN
FT                   APTLRSPGLLVMDMDSTAIQIECIDEIAKLAGTGELVAEVTERAMRGELDFAASLRQRV
FT                   GTLKGADATILQTVRKTLPLMPGLNNMVSQLQEAGWHVAIASGGFTYFSDYLRDELGLV
FT                   AAVANELGMQDGKLTGEVIGTIVDAKYKATTLQQLAEKLEIPMHQTVAIGDGANDLPMI
FT                   KTASLGIAYHAKPKVNEQSAVTIRHADLTGVLCILSGSMRHEKR"
FT   misc_feature    complement(530401..530952)
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 2.6e-20"
FT   CDS_pept        531439..532134
FT                   /transl_table=11
FT                   /gene="smp"
FT                   /locus_tag="ECA0466"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   protein Smp precursor Smp or b4387 or sf4419
FT                   SWALL:SMP_ECOLI (SWALL:P18838) (214 aa) fasta scores: E():
FT                   3.9e-52, 65.72% id in 213 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73381"
FT                   /db_xref="GOA:Q6D9Z7"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z7"
FT                   /protein_id="CAG73381.1"
FT                   /translation="MVRARVKFRLHRTAIALICLALLVILMQGASYFSLSHQMARSEQV
FT                   EDLARTLSRQVAYSLSPLMGNVDDNGQKITTILKQLTDNSRILDAGVYQQDGSLVAHIG
FT                   EQVQLRDRLALDGNRVGSYFNHQLVQPIEGKEGPIGFLRITLDTHVLATEARQVDNTTN
FT                   ILRLMILLSLAIGIILTRTLLQNRRTRWQQSPYLLTASTPVKEEDETESETQPDGSVVV
FT                   KKDGEEKSL"
FT   misc_feature    531439..531558
FT                   /note="Signal peptide predicted for ECA0466 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.259 between residues 40 and 41"
FT   misc_feature    order(531475..531543,531922..531990)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0466 by TMHMM2.0 at aa 13-35 and 162-184"
FT   misc_feature    531691..531726
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   CDS_pept        complement(532188..533090)
FT                   /transl_table=11
FT                   /locus_tag="ECA0467"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z6"
FT                   /protein_id="CAG73382.1"
FT                   /translation="MSLSVSNTGHSNSQAQSTAIPSATTPLTTEPTTTDSVQTVSPITG
FT                   KTVTFSNNIKISAEAVARLKENRANTPPATLSQEEQDAMQGEVLKTRNLMIQRETHSTL
FT                   NLPIDYISTNEMALELWSNNLKADSSISKDEFVDLVHQALSKPSDVTTWSYTTDSIEIT
FT                   LKAAKLEELKNRYVDSGANQNADKDIQDFITYQSDALSNLEKNILQDEYQRSVDAGDTD
FT                   KTNSTFLELQRNAEGTSATQIQRRQIFSLAASTRADSLFDSFRSYVSATTADRYTKSDH
FT                   LSVVSKFQTHWLQFQQQLK"
FT   CDS_pept        533382..534971
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /gene_synonym="tos"
FT                   /gene_synonym="miaD"
FT                   /locus_tag="ECA0468"
FT                   /product="peptide chain release factor 3"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 peptide chain release factor 3
FT                   PrfC or Tos or MiaD or b4375 or c5456 or z5976 or ecs5333
FT                   SWALL:RF3_ECOLI (SWALL:P33998) (528 aa) fasta scores: E():
FT                   6e-177, 89.35% id in 526 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73383"
FT                   /db_xref="GOA:Q6D9Z5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6D9Z5"
FT                   /protein_id="CAG73383.1"
FT                   /translation="MSPSEYAREVSKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGT
FT                   VKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYRECLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDTAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMEVLDEVESELK
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQTGKGHTIQEVRIVKGLDNPDLDIAVGED
FT                   LAAQLREELELVQGASHEFELEAFLAGELTPVFFGTALGNFGVDHMLDGLIAWAPTPMS
FT                   RKTDTREVTAAEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKSMKLRQVRTGKDV
FT                   VISDALTFMAGDRSHIEEAYPGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLTNNDLIVGAVGVLQFEVVVARLKTEYN
FT                   VEAIYESVNVSTARWVECSDAKKLEEFTRKNELHLALDGGNNLAYVAPTMVNLNLTRER
FT                   YPEVTFHQTREH"
FT   misc_feature    533412..534221
FT                   /note="HMMPfam hit to PF00009, DE Elongation factor Tu GTP
FT                   binding domain, score 3.9e-57"
FT   misc_feature    533553..533600
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT   misc_feature    534273..534521
FT                   /note="HMMPfam hit to PF03144, DE Elongation factor Tu
FT                   domain 2, score 7e-16"
FT   CDS_pept        535473..536081
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="ECA0469"
FT                   /product="osmotically inducible protein Y"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   osmotically inducible protein Y precursor OsmY or b4376 or
FT                   c5457 SWALL:OSMY_ECOLI (SWALL:P27291) (201 aa) fasta
FT                   scores: E(): 6.7e-31, 56.93% id in 202 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73384"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z4"
FT                   /protein_id="CAG73384.1"
FT                   /translation="MKKTTLTQSLIVVALGSILAGGAMAEETLGQKVERIADTTGAKID
FT                   NSANKASGYMSDSAVTAKVKSALLEDKSITSSDISVETSKGVVTLSGFVGSQALSSRAV
FT                   EIATQVEGVQSVSDKLQVKDNQSQSVGAYADDAVITSTIKAKLLADDIVPSRKVKVETQ
FT                   EGVVLLSGEVDNKAQSDRAESIVKAIDGVKSVKNDLTVK"
FT   misc_feature    535473..535547
FT                   /note="Signal peptide predicted for ECA0469 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   CDS_pept        536233..536394
FT                   /transl_table=11
FT                   /locus_tag="ECA0470"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein Z5978 SWALL:Q8X479 (EMBL:AE005669) (59 aa) fasta
FT                   scores: E(): 3.4e-16, 98.11% id in 53 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi putative inner membrane
FT                   protein stm4562 or sty4912 SWALL:Q8XEW6 (EMBL:AE008914) (59
FT                   aa) fasta scores: E(): 4e-16, 96.22% id in 53 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73385"
FT                   /db_xref="GOA:Q6D9Z3"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6D9Z3"
FT                   /protein_id="CAG73385.1"
FT                   /translation="MFRWGIIFLVIALIAAALGFGGLAGTAAGAAKIVFVVGIILFLVS
FT                   LFTGRKRP"
FT   misc_feature    536233..536319
FT                   /note="Signal peptide predicted for ECA0470 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.379 between residues 29 and 30"
FT   misc_feature    order(536245..536301,536311..536379)
FT                   /note="2 probable transmembrane helices predicted for
FT                   ECA0470 by TMHMM2.0 at aa 5-23 and 27-49"
FT   CDS_pept        536538..536726
FT                   /transl_table=11
FT                   /locus_tag="ECA0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein xac4007 SWALL:Q8PFH4 (EMBL:AE012049) (69 aa) fasta
FT                   scores: E(): 6.4e-07, 47.36% id in 57 aa, and to
FT                   Escherichia coli, Escherichia coli O157:H7, and Shigella
FT                   flexneri protein YjbJ SWALL:AAN45582 (EMBL:U00006) (71 aa)
FT                   fasta scores: E(): 0.00014, 37.93% id in 58 aa."
FT                   /db_xref="EnsemblGenomes-Gn:ECA0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73386"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z2"
FT                   /protein_id="CAG73386.1"
FT                   /translation="MNSDIVVGKWKQWKGNFLALWADWFDSDCAWLEGSNDYLSGVLQE
FT                   GYGKAHEEVSSEKTTLH"
FT   CDS_pept        536846..537643
FT                   /transl_table=11
FT                   /locus_tag="ECA0472"
FT                   /product="putative TatD-family deoxyribonuclease"
FT                   /note="Similar to Yersinia pestis putative metalloenzyme
FT                   ypo0434 SWALL:Q8ZIQ6 (EMBL:AJ414142) (262 aa) fasta scores:
FT                   E(): 1.3e-62, 64.2% id in 257 aa, and to Escherichia coli
FT                   putative deoxyribonuclease YjjV SWALL:YJJV_ECOLI
FT                   (SWALL:P39408) (259 aa) fasta scores: E(): 1.8e-61, 62.45%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73387"
FT                   /db_xref="GOA:Q6D9Z1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z1"
FT                   /protein_id="CAG73387.1"
FT                   /translation="MPSEQHRFIDTHCHFDFPLFYDDAPESLRLAQDAGVERIIIPAVA
FT                   SQHFERVLMLSRTYSPLYAALGLHPLYIAEHQENDLLRLEEELRQLPARLVAVGEIGLD
FT                   LYMPEPQFERQLTFLEAQLRLAKKYDLPVILHSRRSHDRLAQLLRRIEVPRTGVVHGFA
FT                   GSLAQAQAFIRLGYYIGVGGTITYDRANKTRQAIAQLPLDRLLLETDAPDMPMSGYQGQ
FT                   PNRPERISCAFETLCALRTEPPEEIAEALLQNSLRLFGRLAPE"
FT   misc_feature    536867..536893
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT   misc_feature    536882..537625
FT                   /note="HMMPfam hit to PF01026, DE TatD related DNase, score
FT                   3.4e-93"
FT   misc_feature    537431..537481
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT   CDS_pept        537938..539215
FT                   /transl_table=11
FT                   /locus_tag="ECA0473"
FT                   /product="putative Na+ dependent nucleoside
FT                   transporter-family protein"
FT                   /note="Similar to Yersinia pestis putative Na+ dependent
FT                   nucleoside transporter-family protein ypo0435 SWALL:Q8ZIQ5
FT                   (EMBL:AJ414142) (423 aa) fasta scores: E(): 9.9e-133,
FT                   84.39% id in 423 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73388"
FT                   /db_xref="GOA:Q6D9Z0"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Z0"
FT                   /protein_id="CAG73388.1"
FT                   /translation="MQLVMSLIGMIVLILCAVMLSNNRKAIRLRTVAGAFILQIGIGAL
FT                   VLYVPVGRKILEGLTGGVANVISYGNQGVSFMFGGLVSDKMFEVFGGGGFVFALRVLPI
FT                   IVFFSSLIAVLYYIGVMQLVIKVLGGGLQKLLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIANMTQSELFAVMCGGLASIAGAVMAGYAQMGVPLEYLIAASFMAAPGGLLFAKLMVP
FT                   ETEKTHDHDEMVGFVDEDERPANVIDAAASGAASGMQLALNVGAMLLAFIALIAVLNGI
FT                   LGGIGGWFDYPQLSLEMILGWCFAPVAFLIGIPWSEATVAGSFIGQKLIVNEFVAYMNF
FT                   SEYLKADDVVRAAGLQVLSDHTKAVISFALCGFANLSSIAILIGGLGSMAPTRRQDIAR
FT                   FGLKAVAAGTLSNLMSACIAGFFLAL"
FT   misc_feature    537938..539206
FT                   /note="HMMPfam hit to PF01773, DE Na+ dependent nucleoside
FT                   transporter, score 1.1e-225"
FT   misc_feature    order(537947..538003,538022..538090,538118..538186,
FT                   538223..538291,538454..538513,538532..538600,
FT                   538736..538804,538817..538885,539030..539098,
FT                   539135..539203)
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0473 by TMHMM2.0 at aa 4-22, 29-51, 61-83, 96-118,
FT                   173-192, 199-221, 267-289, 294-316, 365-387 and 400-422"
FT   CDS_pept        539365..540081
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="ECA0474"
FT                   /product="enterobactin synthetase component D
FT                   (4'-phosphopantetheinyl transferase)"
FT                   /EC_number="2.7.8.-"
FT                   /note="Similar to Escherichia coli 4'-phosphopantetheinyl
FT                   transferase EntD or b0583 SWALL:ENTD_ECOLI (SWALL:P19925)
FT                   (209 aa) fasta scores: E(): 4.1e-09, 31.49% id in 181 aa,
FT                   and to Photorhabdus luminescens NgrA SWALL:Q9AI14
FT                   (EMBL:AF288077) (248 aa) fasta scores: E(): 2.9e-24, 34.32%
FT                   id in 236 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73389"
FT                   /db_xref="GOA:Q6D9Y9"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y9"
FT                   /protein_id="CAG73389.1"
FT                   /translation="MLSAFIDDVEWITFPRATDGAAYPGITARCHFHLSAYDDALFAEA
FT                   NIPFSDALERAVPKRRAEFLAGRCLAKRVLNKLDHPDFILHSGEDRSPQWPVNIAGSLS
FT                   HNKDSVLCAAHLRSDELSCVGVDIEGFISDERAQSLWPGIIGDEEFQWFQGRDESFCCL
FT                   LTVSFSAKESLFKALYPQVRHYFDFLDARLVALDITKREFELELLTDLTPTFYAGRRFK
FT                   GAYLLREYDVTTFICC"
FT   CDS_pept        complement(540116..542077)
FT                   /transl_table=11
FT                   /locus_tag="ECA0475"
FT                   /product="TonB-dependent siderophore receptor protein"
FT                   /note="Similar to Escherichia coli colicin I receptor
FT                   precursor CirA or Cir or FeuA or b2155 SWALL:CIRA_ECOLI
FT                   (SWALL:P17315) (663 aa) fasta scores: E(): 9.5e-57, 36.61%
FT                   id in 661 aa, and to Vibrio cholerae iron-regulated outer
FT                   membrane virulence protein precursor IrgA or vc0475
FT                   SWALL:IRGA_VIBCH (SWALL:P27772) (652 aa) fasta scores: E():
FT                   1.1e-48, 29.73% id in 676 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73390"
FT                   /db_xref="GOA:Q6D9Y8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y8"
FT                   /protein_id="CAG73390.1"
FT                   /translation="MQLKPESRFSHHHFPHSKVYRALLVTGLLTLPALAQAENAADEKI
FT                   VVTATQTKHTTLSAPASVSVITHAELEKMSVNNVSDAVKKLPGININPSTSYGRNEIKI
FT                   RGMKADYTLLLINGRRVNSRDALAGNMGNDFDLSAIPISAIERVEVIRGPMSSLYGADA
FT                   LGGVINVILNQPSNELKGEIGYNFEAPTEGSGGDHNRLNGYISGPLIENTLLGSLLADG
FT                   GKRDAWKTEQSVNQNTDALEKRDNYSVMGNLTWLIDAQQSLDFDATYTKDDRDVRWNNY
FT                   GTAVRNIQKMERLGLGLTHNGSWDNVDTRLRYFYENVELMDNSQLNNGKADITQDNHTV
FT                   DGQASGYLGDHLLTGGGEYRLTSLKHSMNLPNSTIDVSQGALFLQDEFKLSDLALTFGG
FT                   RVDKHETYGTEFSPRAYATYSLTDNWVVKGGVSKAFKAPSIAQSSESYAIAACRGRCQT
FT                   VGNPDLKPETSISYEIGTAYEAERFGAGVTLFNNDIKDMIQVQTWDRVATRLTYENVNK
FT                   ARIQGIETSFWVDVTDDLNWTTNWTIVDAEDRTTKMRLKQTPKNTVNTQLNWQTLDNLS
FT                   TYIAYQYTGNQYLFDKEVSKTRGFNTVDIGATYTPVKNVDLKLGLTNLTNEKRDYVATN
FT                   NDYFLSGRTVYGGVSYKF"
FT   misc_feature    complement(540122..540421)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00593, DE TonB dependent receptor,
FT                   score 6e-10"
FT   misc_feature    complement(541967..542077)
FT                   /note="Signal peptide predicted for ECA0475 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.604 between residues 37 and 38"
FT   CDS_pept        complement(542160..543410)
FT                   /transl_table=11
FT                   /locus_tag="ECA0476"
FT                   /product="putative iron transporter"
FT                   /note="Similar to Stigmatella aurantiaca MxcK SWALL:Q9F632
FT                   (EMBL:AF299336) (407 aa) fasta scores: E(): 2.9e-29, 32.74%
FT                   id in 394 aa, and to Azotobacter vinelandii AvxA
FT                   SWALL:Q8KY99 (EMBL:AF238500) (407 aa) fasta scores: E():
FT                   1.2e-25, 35.04% id in 371 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73391"
FT                   /db_xref="GOA:Q6D9Y7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y7"
FT                   /protein_id="CAG73391.1"
FT                   /translation="MYRPHTRSVVHLALLINMLSLGSLMMVMPLGPDFVSALSMDAKNI
FT                   GYISGGATFASAIVGFLAAPYLDRFNRKHALIVLLTLRFGLTAACMFSTSQTDLLLLFI
FT                   LAGCVAGPASGVLMAAVVDIVPANERGKQLAYVGMSFSLAAIVIMPLSLELAHRINWQA
FT                   PFYTFGLGGLLLVLLVLWRFPSMPPTHRAQQKLDPSKAPTSVLQDLLASPLFVLGLTVM
FT                   SLQMFGHFLLIPHFSNYFQFNLAFPRDDISLLYLCGGLASMVTMQLCGNLLDRGYASQT
FT                   VVVTTLLLAVVILCGFVLPFSLSLYLVFTLFMALSAARSSSTLAITAGIPLPHQRAAFM
FT                   SYQGTAANVASGLASVASAAYLSTSAEGKIDGFSQLAIASTVFALAAMLLTLRLIPQLA
FT                   ERGRKMAARQSAQVTEQ"
FT   misc_feature    complement(order(542226..542294,542487..542555,
FT                   542592..542660,542718..542786,542856..542924,
FT                   542952..543011,543045..543113,543123..543191,
FT                   543210..543278,543306..543374))
FT                   /note="10 probable transmembrane helices predicted for
FT                   ECA0476 by TMHMM2.0 at aa 13-35, 45-67, 74-96, 100-122,
FT                   134-153, 163-185, 209-231, 251-273, 286-308 and 373-395"
FT   misc_feature    complement(543294..543410)
FT                   /note="Signal peptide predicted for ECA0476 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.815) with cleavage site
FT                   probability 0.478 between residues 39 and 40"
FT   CDS_pept        543754..544950
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="ECA0477"
FT                   /product="enterobactin synthetase component C
FT                   (isochorismate synthase)"
FT                   /EC_number="5.4.4.2"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 isochorismate synthase EntC or b0593 or z0735 or
FT                   ecs0632 SWALL:ENTC_ECOLI (SWALL:P10377) (391 aa) fasta
FT                   scores: E(): 6.1e-66, 46.31% id in 393 aa, and to
FT                   Pseudomonas fluorescens isochorismate synthase PmsC
FT                   SWALL:P95475 (EMBL:Y09356) (391 aa) fasta scores: E():
FT                   8.2e-75, 51.2% id in 373 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73392"
FT                   /db_xref="GOA:Q6D9Y6"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y6"
FT                   /protein_id="CAG73392.1"
FT                   /translation="MDTLISETETFSGLTYSEQTAFLYASEHRSLSTSGLFERISSPVC
FT                   APGSHNDELSLAIAQAFQRARQAGQSLPIVVGAIPFDTTQPSCLYIPDSYTVTTKYELV
FT                   SRARKHTAVAPTALTLNSVPGECQFKSIVAEAVERFRRGELSKAVLSRILDIELASPVK
FT                   AQTILNNLMVQNAGGYHFSLPLPDGSVLLGASPELLLRKQGNVIVSNPLAGSARRMNDE
FT                   HLDYLNSQRLLNSGKDKHEHKLVVDDIRQRLMPLCASLTIPSAPSLMSTASMWHLSTAI
FT                   RGELANPDMTALQVACQLHPTPALCGFPTQEARQLIAELEPHDRGVFSGIVGWCDANGD
FT                   GEWVIVIRCGTIKHNKVRLFAGAGIVEASVPEDEWAETAAKLNTMLNAFGLNSGVDGL"
FT   misc_feature    544126..544920
FT                   /note="HMMPfam hit to PF00425, DE chorismate binding
FT                   enzyme, score 7.7e-102"
FT   CDS_pept        544947..546572
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="ECA0478"
FT                   /product="enterobactin synthetase component E [includes:
FT                   2,3-dihydroxybenzoate-AMP ligase;
FT                   S-dihydroxybenzoyltransferase]"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Escherichia coli enterobactin synthetase
FT                   component E [includes: 2,3-dihydroxybenzoate-AMP ligase;
FT                   S-dihydroxybenzoyltransferase] EntE SWALL:ENTE_ECOLI
FT                   (SWALL:P10378) (536 aa) fasta scores: E(): 1.1e-129, 64.63%
FT                   id in 540 aa"
FT                   /note="EC number 7.7.58"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73393"
FT                   /db_xref="GOA:Q6D9Y5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y5"
FT                   /protein_id="CAG73393.1"
FT                   /translation="MSIEFTPWPEELAQRYRDKGYWVGLPLTDAWERHLATQPDAVAVV
FT                   CGERQWSYRELDQQSSALASRLTQNGLRGGDTALVQLPNVAEFYLTFFALLKMGVAPVN
FT                   ALFSHNKLELLSYATQIEPRLLIASAEHPLFGNGEFLDRLQTQVPSLQTVVMLGDSPLG
FT                   HSLTDWLQPHASVSKYQPSASGQVAFFQLSGGSTGTPKLIPRTHDDYYYSVRRSVEICE
FT                   LTPQTRYLCALPAPHNFPLSSPGSLGVFYAGGRVVLASDPGAMTCFPLIERHQIDITSL
FT                   VPPAAALWIQAAEQFGEALRSLKILQVGGAKLSETVARRIPAVLGCQLQQVLGMAEGLV
FT                   NYTRLDDSDEHIFTTQGYPMSPDDEVKVLDRDGNPLPRGEAGLLATRGPYTFRGYYRSP
FT                   EHNARAFDRDGFYHSGDVVQMTEEGYLRVVGREKDQINRGGEKIAAEEIENLLLKHDGI
FT                   LHAALVSMPDPVMGEKSCAFLVVSDSSLKAITLRKYLRNQGIAEFKLPDRFEMIDTLPV
FT                   TPVGKIDKKSLRQRIQTQLSIQNK"
FT   misc_feature    545100..546335
FT                   /note="HMMPfam hit to PF00501, DE AMP-binding enzyme, score
FT                   5.3e-104"
FT   misc_feature    545514..545549
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        546583..547458
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /gene_synonym="entG"
FT                   /locus_tag="ECA0479"
FT                   /product="enterobactin synthetase component B
FT                   (isochorismatase)"
FT                   /EC_number="3.3.2.1"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri isochorismatase EntB or EntG
FT                   or b0595 or z0737 or ecs0634 or sf0509 SWALL:ENTB_ECOLI
FT                   (SWALL:P15048) (285 aa) fasta scores: E(): 1.1e-69, 63.63%
FT                   id in 286 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73394"
FT                   /db_xref="GOA:Q6D9Y4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D9Y4"
FT                   /protein_id="CAG73394.1"
FT                   /translation="MAIPSIASYPLPCAQDFPENNVSWAFEPERAVLLIHDMQDYFVNF
FT                   YGADSPLAQQLIENISALRTYCKAQGIPVVYTAQPNTQSAADRALLNDMWGAGLNNHPE
FT                   KQRVVSALAPDEHDTVLVKWRYSAFHRSPLEPMMKEMGKDQLIICGVYGHIGCMITATD
FT                   AFMRDIKPFMVGDAIADFSLQEHLMALKYVATRAGRVVSTAELTGAKMAQALTKQGLRA
FT                   HLLSLIDEEEDQFDEDENLIDYGLDSVRMMALLTEWRNQGVTLSFVDLARNPSLNAWWA
FT                   LIEKQQGAAL"
FT   misc_feature    546658..547206
FT                   /note="HMMPfam hit to PF00857, DE Isochorismatase family,
FT                   score 1.5e-86"
FT   misc_feature    547234..547431
FT                   /note="HMMPfam hit to PF00550, DE Phosphopantetheine
FT                   attachment site, score 1.3e-11"
FT   CDS_pept        547455..550598
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="ECA0480"
FT                   /product="enterobactin synthetase component F"
FT                   /EC_number="2.7.7.-"
FT                   /note="Similar to Escherichia coli enterobactin synthetase
FT                   component F EntF or b0586 SWALL:ENTF_ECOLI (SWALL:P11454)
FT                   (1293 aa) fasta scores: E(): 2.4e-63, 30.4% id in 1069 aa,
FT                   and to Stigmatella aurantiaca MxcG SWALL:Q9F636
FT                   (EMBL:AF299336) (1456 aa) fasta scores: E(): 6.8e-106,
FT                   41.03% id in 1065 aa"
FT                   /db_xref="EnsemblGenomes-Gn:ECA0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAG73395"
FT                   /db_xref="GOA:Q6D9Y3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6D