(data stored in ACNUC1104 zone)

EMBL: CP000002

ID   CP000002; SV 3; circular; genomic DNA; STD; PRO; 4222597 BP.
XX
AC   CP000002;
XX
PR   Project:PRJNA12388;
XX
DT   15-SEP-2004 (Rel. 81, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Bacillus licheniformis ATCC 14580, complete genome.
XX
KW   .
XX
OS   Bacillus licheniformis DSM 13 = ATCC 14580
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4222597
RX   DOI; 10.1186/gb-2004-5-10-r77.
RX   PUBMED; 15461803.
RA   Rey M.W., Ramaiya P., Nelson B.A., Brody-Karpin S.D., Zaretsky E.J.,
RA   Tang M., Lopez de Leon A., Xiang H., Gusti V., Clausen I.G., Olsen P.B.,
RA   Rasmussen M.D., Andersen J.T., Jorgensen P.L., Larsen T.S., Sorokin A.,
RA   Bolotin A., Lapidus A., Galleron N., Ehrlich S.D., Berka R.M.;
RT   "Complete genome sequence of the industrial bacterium Bacillus
RT   licheniformis and comparisons with closely related Bacillus species";
RL   Genome Biol. 5(10):R77-R77(2004).
XX
RN   [2]
RP   1-4222597
RA   Berka R.M., Rey M.W., Ramaiya P.;
RT   ;
RL   Submitted (14-JUL-2004) to the INSDC.
RL   Novozymes Biotech Inc, 1445 Drew Ave, Davis, CA 95616, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4222597
RA   Berka R.M., Rey M.W., Ramaiya P.;
RT   ;
RL   Submitted (29-SEP-2004) to the INSDC.
RL   Novozymes Biotech Inc, 1445 Drew Ave, Davis, CA 95616, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-4222597
RA   Berka R.M., Rey M.W., Ramaiya P.;
RT   ;
RL   Submitted (26-APR-2007) to the INSDC.
RL   Novozymes Biotech Inc, 1445 Drew Ave, Davis, CA 95616, USA
XX
DR   MD5; c757549b5571335a55a771d84cfb2307.
DR   BioSample; SAMN02603685.
DR   CABRI; DSM 13.
DR   EnsemblGenomes-Gn; BL_rrna_0001.
DR   EnsemblGenomes-Gn; BL_rrna_0002.
DR   EnsemblGenomes-Gn; BL_rrna_0003.
DR   EnsemblGenomes-Gn; BL_rrna_0004.
DR   EnsemblGenomes-Gn; BL_rrna_0005.
DR   EnsemblGenomes-Gn; BL_rrna_0006.
DR   EnsemblGenomes-Gn; BL_rrna_0007.
DR   EnsemblGenomes-Gn; BL_rrna_0008.
DR   EnsemblGenomes-Gn; BL_rrna_0009.
DR   EnsemblGenomes-Gn; BL_rrna_0010.
DR   EnsemblGenomes-Gn; BL_rrna_0011.
DR   EnsemblGenomes-Gn; BL_rrna_0012.
DR   EnsemblGenomes-Gn; BL_rrna_0013.
DR   EnsemblGenomes-Gn; BL_rrna_0014.
DR   EnsemblGenomes-Gn; BL_rrna_0015.
DR   EnsemblGenomes-Gn; BL_rrna_0016.
DR   EnsemblGenomes-Gn; BL_rrna_0017.
DR   EnsemblGenomes-Gn; BL_rrna_0018.
DR   EnsemblGenomes-Gn; BL_rrna_0019.
DR   EnsemblGenomes-Gn; BL_rrna_0020.
DR   EnsemblGenomes-Gn; BL_rrna_0021.
DR   EnsemblGenomes-Gn; BL_trna_0001.
DR   EnsemblGenomes-Gn; BL_trna_0002.
DR   EnsemblGenomes-Gn; BL_trna_0003.
DR   EnsemblGenomes-Gn; BL_trna_0004.
DR   EnsemblGenomes-Gn; BL_trna_0005.
DR   EnsemblGenomes-Gn; BL_trna_0006.
DR   EnsemblGenomes-Gn; BL_trna_0007.
DR   EnsemblGenomes-Gn; BL_trna_0008.
DR   EnsemblGenomes-Gn; BL_trna_0009.
DR   EnsemblGenomes-Gn; BL_trna_0010.
DR   EnsemblGenomes-Gn; BL_trna_0011.
DR   EnsemblGenomes-Gn; BL_trna_0012.
DR   EnsemblGenomes-Gn; BL_trna_0013.
DR   EnsemblGenomes-Gn; BL_trna_0014.
DR   EnsemblGenomes-Gn; BL_trna_0015.
DR   EnsemblGenomes-Gn; BL_trna_0016.
DR   EnsemblGenomes-Gn; BL_trna_0017.
DR   EnsemblGenomes-Gn; BL_trna_0018.
DR   EnsemblGenomes-Gn; BL_trna_0019.
DR   EnsemblGenomes-Gn; BL_trna_0020.
DR   EnsemblGenomes-Gn; BL_trna_0021.
DR   EnsemblGenomes-Gn; BL_trna_0022.
DR   EnsemblGenomes-Gn; BL_trna_0023.
DR   EnsemblGenomes-Gn; BL_trna_0024.
DR   EnsemblGenomes-Gn; BL_trna_0025.
DR   EnsemblGenomes-Gn; BL_trna_0026.
DR   EnsemblGenomes-Gn; BL_trna_0027.
DR   EnsemblGenomes-Gn; BL_trna_0028.
DR   EnsemblGenomes-Gn; BL_trna_0029.
DR   EnsemblGenomes-Gn; BL_trna_0030.
DR   EnsemblGenomes-Gn; BL_trna_0031.
DR   EnsemblGenomes-Gn; BL_trna_0032.
DR   EnsemblGenomes-Gn; BL_trna_0033.
DR   EnsemblGenomes-Gn; BL_trna_0034.
DR   EnsemblGenomes-Gn; BL_trna_0035.
DR   EnsemblGenomes-Gn; BL_trna_0036.
DR   EnsemblGenomes-Gn; BL_trna_0037.
DR   EnsemblGenomes-Gn; BL_trna_0038.
DR   EnsemblGenomes-Gn; BL_trna_0039.
DR   EnsemblGenomes-Gn; BL_trna_0040.
DR   EnsemblGenomes-Gn; BL_trna_0041.
DR   EnsemblGenomes-Gn; BL_trna_0042.
DR   EnsemblGenomes-Gn; BL_trna_0043.
DR   EnsemblGenomes-Gn; BL_trna_0044.
DR   EnsemblGenomes-Gn; BL_trna_0045.
DR   EnsemblGenomes-Gn; BL_trna_0046.
DR   EnsemblGenomes-Gn; BL_trna_0047.
DR   EnsemblGenomes-Gn; BL_trna_0048.
DR   EnsemblGenomes-Gn; BL_trna_0049.
DR   EnsemblGenomes-Gn; BL_trna_0050.
DR   EnsemblGenomes-Gn; BL_trna_0051.
DR   EnsemblGenomes-Gn; BL_trna_0052.
DR   EnsemblGenomes-Gn; BL_trna_0053.
DR   EnsemblGenomes-Gn; BL_trna_0054.
DR   EnsemblGenomes-Gn; BL_trna_0055.
DR   EnsemblGenomes-Gn; BL_trna_0056.
DR   EnsemblGenomes-Gn; BL_trna_0057.
DR   EnsemblGenomes-Gn; BL_trna_0058.
DR   EnsemblGenomes-Gn; BL_trna_0059.
DR   EnsemblGenomes-Gn; BL_trna_0060.
DR   EnsemblGenomes-Gn; BL_trna_0061.
DR   EnsemblGenomes-Gn; BL_trna_0062.
DR   EnsemblGenomes-Gn; BL_trna_0063.
DR   EnsemblGenomes-Gn; BL_trna_0064.
DR   EnsemblGenomes-Gn; BL_trna_0065.
DR   EnsemblGenomes-Gn; BL_trna_0066.
DR   EnsemblGenomes-Gn; BL_trna_0067.
DR   EnsemblGenomes-Gn; BL_trna_0068.
DR   EnsemblGenomes-Gn; BL_trna_0069.
DR   EnsemblGenomes-Gn; BL_trna_0070.
DR   EnsemblGenomes-Gn; BL_trna_0071.
DR   EnsemblGenomes-Gn; BL_trna_0072.
DR   EnsemblGenomes-Gn; EBG00001139521.
DR   EnsemblGenomes-Gn; EBG00001139522.
DR   EnsemblGenomes-Gn; EBG00001139523.
DR   EnsemblGenomes-Gn; EBG00001139524.
DR   EnsemblGenomes-Gn; EBG00001139525.
DR   EnsemblGenomes-Gn; EBG00001139526.
DR   EnsemblGenomes-Gn; EBG00001139527.
DR   EnsemblGenomes-Gn; EBG00001139528.
DR   EnsemblGenomes-Gn; EBG00001139529.
DR   EnsemblGenomes-Gn; EBG00001139530.
DR   EnsemblGenomes-Gn; EBG00001139531.
DR   EnsemblGenomes-Gn; EBG00001139532.
DR   EnsemblGenomes-Gn; EBG00001139533.
DR   EnsemblGenomes-Gn; EBG00001139534.
DR   EnsemblGenomes-Gn; EBG00001139535.
DR   EnsemblGenomes-Gn; EBG00001139536.
DR   EnsemblGenomes-Gn; EBG00001139537.
DR   EnsemblGenomes-Gn; EBG00001139538.
DR   EnsemblGenomes-Gn; EBG00001139539.
DR   EnsemblGenomes-Gn; EBG00001139540.
DR   EnsemblGenomes-Gn; EBG00001139541.
DR   EnsemblGenomes-Gn; EBG00001139542.
DR   EnsemblGenomes-Gn; EBG00001139543.
DR   EnsemblGenomes-Gn; EBG00001139544.
DR   EnsemblGenomes-Gn; EBG00001139545.
DR   EnsemblGenomes-Gn; EBG00001139546.
DR   EnsemblGenomes-Gn; EBG00001139547.
DR   EnsemblGenomes-Gn; EBG00001139548.
DR   EnsemblGenomes-Gn; EBG00001139549.
DR   EnsemblGenomes-Gn; EBG00001139550.
DR   EnsemblGenomes-Gn; EBG00001139551.
DR   EnsemblGenomes-Gn; EBG00001139552.
DR   EnsemblGenomes-Gn; EBG00001139553.
DR   EnsemblGenomes-Gn; EBG00001139554.
DR   EnsemblGenomes-Gn; EBG00001139555.
DR   EnsemblGenomes-Gn; EBG00001139556.
DR   EnsemblGenomes-Gn; EBG00001139557.
DR   EnsemblGenomes-Gn; EBG00001139558.
DR   EnsemblGenomes-Gn; EBG00001139559.
DR   EnsemblGenomes-Gn; EBG00001139560.
DR   EnsemblGenomes-Gn; EBG00001139561.
DR   EnsemblGenomes-Gn; EBG00001139562.
DR   EnsemblGenomes-Gn; EBG00001139563.
DR   EnsemblGenomes-Gn; EBG00001139564.
DR   EnsemblGenomes-Gn; EBG00001139565.
DR   EnsemblGenomes-Gn; EBG00001139566.
DR   EnsemblGenomes-Gn; EBG00001139567.
DR   EnsemblGenomes-Gn; EBG00001139568.
DR   EnsemblGenomes-Gn; EBG00001139569.
DR   EnsemblGenomes-Gn; EBG00001139570.
DR   EnsemblGenomes-Gn; EBG00001139571.
DR   EnsemblGenomes-Gn; EBG00001139572.
DR   EnsemblGenomes-Gn; EBG00001139573.
DR   EnsemblGenomes-Gn; EBG00001139574.
DR   EnsemblGenomes-Gn; EBG00001139575.
DR   EnsemblGenomes-Gn; EBG00001139576.
DR   EnsemblGenomes-Gn; EBG00001139577.
DR   EnsemblGenomes-Gn; EBG00001139578.
DR   EnsemblGenomes-Gn; EBG00001139579.
DR   EnsemblGenomes-Gn; EBG00001139580.
DR   EnsemblGenomes-Gn; EBG00001139581.
DR   EnsemblGenomes-Gn; EBG00001139582.
DR   EnsemblGenomes-Gn; EBG00001139583.
DR   EnsemblGenomes-Gn; EBG00001139584.
DR   EnsemblGenomes-Gn; EBG00001139585.
DR   EnsemblGenomes-Gn; EBG00001139586.
DR   EnsemblGenomes-Gn; EBG00001139587.
DR   EnsemblGenomes-Gn; EBG00001139588.
DR   EnsemblGenomes-Gn; EBG00001139589.
DR   EnsemblGenomes-Gn; EBG00001139590.
DR   EnsemblGenomes-Gn; EBG00001139591.
DR   EnsemblGenomes-Gn; EBG00001139592.
DR   EnsemblGenomes-Gn; EBG00001139593.
DR   EnsemblGenomes-Gn; EBG00001139594.
DR   EnsemblGenomes-Gn; EBG00001139595.
DR   EnsemblGenomes-Gn; EBG00001139596.
DR   EnsemblGenomes-Gn; EBG00001139597.
DR   EnsemblGenomes-Gn; EBG00001139598.
DR   EnsemblGenomes-Gn; EBG00001139599.
DR   EnsemblGenomes-Gn; EBG00001139600.
DR   EnsemblGenomes-Gn; EBG00001139601.
DR   EnsemblGenomes-Gn; EBG00001139602.
DR   EnsemblGenomes-Gn; EBG00001139603.
DR   EnsemblGenomes-Gn; EBG00001139604.
DR   EnsemblGenomes-Gn; EBG00001139605.
DR   EnsemblGenomes-Gn; EBG00001139606.
DR   EnsemblGenomes-Gn; EBG00001139607.
DR   EnsemblGenomes-Gn; EBG00001139608.
DR   EnsemblGenomes-Gn; EBG00001139609.
DR   EnsemblGenomes-Gn; EBG00001139610.
DR   EnsemblGenomes-Gn; EBG00001139611.
DR   EnsemblGenomes-Gn; EBG00001139612.
DR   EnsemblGenomes-Gn; EBG00001139613.
DR   EnsemblGenomes-Gn; EBG00001139614.
DR   EnsemblGenomes-Gn; EBG00001139615.
DR   EnsemblGenomes-Gn; EBG00001139616.
DR   EnsemblGenomes-Gn; EBG00001139617.
DR   EnsemblGenomes-Gn; EBG00001139618.
DR   EnsemblGenomes-Gn; EBG00001139619.
DR   EnsemblGenomes-Gn; EBG00001139620.
DR   EnsemblGenomes-Gn; EBG00001139621.
DR   EnsemblGenomes-Gn; EBG00001139622.
DR   EnsemblGenomes-Gn; EBG00001139623.
DR   EnsemblGenomes-Gn; EBG00001139624.
DR   EnsemblGenomes-Gn; EBG00001139625.
DR   EnsemblGenomes-Gn; EBG00001139626.
DR   EnsemblGenomes-Gn; EBG00001139627.
DR   EnsemblGenomes-Gn; EBG00001139628.
DR   EnsemblGenomes-Gn; EBG00001139629.
DR   EnsemblGenomes-Gn; EBG00001139630.
DR   EnsemblGenomes-Gn; EBG00001139631.
DR   EnsemblGenomes-Gn; EBG00001139632.
DR   EnsemblGenomes-Gn; EBG00001139633.
DR   EnsemblGenomes-Gn; EBG00001139634.
DR   EnsemblGenomes-Gn; EBG00001139635.
DR   EnsemblGenomes-Gn; EBG00001139636.
DR   EnsemblGenomes-Gn; EBG00001139637.
DR   EnsemblGenomes-Gn; EBG00001139638.
DR   EnsemblGenomes-Gn; EBG00001139639.
DR   EnsemblGenomes-Gn; EBG00001139640.
DR   EnsemblGenomes-Gn; EBG00001139641.
DR   EnsemblGenomes-Gn; EBG00001139642.
DR   EnsemblGenomes-Gn; EBG00001139643.
DR   EnsemblGenomes-Gn; EBG00001139644.
DR   EnsemblGenomes-Gn; EBG00001139645.
DR   EnsemblGenomes-Gn; EBG00001139646.
DR   EnsemblGenomes-Gn; EBG00001139647.
DR   EnsemblGenomes-Gn; EBG00001139648.
DR   EnsemblGenomes-Gn; EBG00001139649.
DR   EnsemblGenomes-Gn; EBG00001139650.
DR   EnsemblGenomes-Gn; EBG00001139651.
DR   EnsemblGenomes-Gn; EBG00001139652.
DR   EnsemblGenomes-Gn; EBG00001139653.
DR   EnsemblGenomes-Gn; EBG00001139654.
DR   EnsemblGenomes-Gn; EBG00001139655.
DR   EnsemblGenomes-Gn; EBG00001139656.
DR   EnsemblGenomes-Gn; EBG00001139657.
DR   EnsemblGenomes-Gn; EBG00001139658.
DR   EnsemblGenomes-Gn; EBG00001139659.
DR   EnsemblGenomes-Gn; EBG00001139660.
DR   EnsemblGenomes-Gn; EBG00001139661.
DR   EnsemblGenomes-Gn; EBG00001139662.
DR   EnsemblGenomes-Gn; EBG00001139663.
DR   EnsemblGenomes-Gn; EBG00001139664.
DR   EnsemblGenomes-Gn; EBG00001139665.
DR   EnsemblGenomes-Gn; EBG00001139666.
DR   EnsemblGenomes-Gn; EBG00001139667.
DR   EnsemblGenomes-Tr; BL_rrna_0001-1.
DR   EnsemblGenomes-Tr; BL_rrna_0002-1.
DR   EnsemblGenomes-Tr; BL_rrna_0003-1.
DR   EnsemblGenomes-Tr; BL_rrna_0004-1.
DR   EnsemblGenomes-Tr; BL_rrna_0005-1.
DR   EnsemblGenomes-Tr; BL_rrna_0006-1.
DR   EnsemblGenomes-Tr; BL_rrna_0007-1.
DR   EnsemblGenomes-Tr; BL_rrna_0008-1.
DR   EnsemblGenomes-Tr; BL_rrna_0009-1.
DR   EnsemblGenomes-Tr; BL_rrna_0010-1.
DR   EnsemblGenomes-Tr; BL_rrna_0011-1.
DR   EnsemblGenomes-Tr; BL_rrna_0012-1.
DR   EnsemblGenomes-Tr; BL_rrna_0013-1.
DR   EnsemblGenomes-Tr; BL_rrna_0014-1.
DR   EnsemblGenomes-Tr; BL_rrna_0015-1.
DR   EnsemblGenomes-Tr; BL_rrna_0016-1.
DR   EnsemblGenomes-Tr; BL_rrna_0017-1.
DR   EnsemblGenomes-Tr; BL_rrna_0018-1.
DR   EnsemblGenomes-Tr; BL_rrna_0019-1.
DR   EnsemblGenomes-Tr; BL_rrna_0020-1.
DR   EnsemblGenomes-Tr; BL_rrna_0021-1.
DR   EnsemblGenomes-Tr; BL_trna_0001-1.
DR   EnsemblGenomes-Tr; BL_trna_0002-1.
DR   EnsemblGenomes-Tr; BL_trna_0003-1.
DR   EnsemblGenomes-Tr; BL_trna_0004-1.
DR   EnsemblGenomes-Tr; BL_trna_0005-1.
DR   EnsemblGenomes-Tr; BL_trna_0006-1.
DR   EnsemblGenomes-Tr; BL_trna_0007-1.
DR   EnsemblGenomes-Tr; BL_trna_0008-1.
DR   EnsemblGenomes-Tr; BL_trna_0009-1.
DR   EnsemblGenomes-Tr; BL_trna_0010-1.
DR   EnsemblGenomes-Tr; BL_trna_0011-1.
DR   EnsemblGenomes-Tr; BL_trna_0012-1.
DR   EnsemblGenomes-Tr; BL_trna_0013-1.
DR   EnsemblGenomes-Tr; BL_trna_0014-1.
DR   EnsemblGenomes-Tr; BL_trna_0015-1.
DR   EnsemblGenomes-Tr; BL_trna_0016-1.
DR   EnsemblGenomes-Tr; BL_trna_0017-1.
DR   EnsemblGenomes-Tr; BL_trna_0018-1.
DR   EnsemblGenomes-Tr; BL_trna_0019-1.
DR   EnsemblGenomes-Tr; BL_trna_0020-1.
DR   EnsemblGenomes-Tr; BL_trna_0021-1.
DR   EnsemblGenomes-Tr; BL_trna_0022-1.
DR   EnsemblGenomes-Tr; BL_trna_0023-1.
DR   EnsemblGenomes-Tr; BL_trna_0024-1.
DR   EnsemblGenomes-Tr; BL_trna_0025-1.
DR   EnsemblGenomes-Tr; BL_trna_0026-1.
DR   EnsemblGenomes-Tr; BL_trna_0027-1.
DR   EnsemblGenomes-Tr; BL_trna_0028-1.
DR   EnsemblGenomes-Tr; BL_trna_0029-1.
DR   EnsemblGenomes-Tr; BL_trna_0030-1.
DR   EnsemblGenomes-Tr; BL_trna_0031-1.
DR   EnsemblGenomes-Tr; BL_trna_0032-1.
DR   EnsemblGenomes-Tr; BL_trna_0033-1.
DR   EnsemblGenomes-Tr; BL_trna_0034-1.
DR   EnsemblGenomes-Tr; BL_trna_0035-1.
DR   EnsemblGenomes-Tr; BL_trna_0036-1.
DR   EnsemblGenomes-Tr; BL_trna_0037-1.
DR   EnsemblGenomes-Tr; BL_trna_0038-1.
DR   EnsemblGenomes-Tr; BL_trna_0039-1.
DR   EnsemblGenomes-Tr; BL_trna_0040-1.
DR   EnsemblGenomes-Tr; BL_trna_0041-1.
DR   EnsemblGenomes-Tr; BL_trna_0042-1.
DR   EnsemblGenomes-Tr; BL_trna_0043-1.
DR   EnsemblGenomes-Tr; BL_trna_0044-1.
DR   EnsemblGenomes-Tr; BL_trna_0045-1.
DR   EnsemblGenomes-Tr; BL_trna_0046-1.
DR   EnsemblGenomes-Tr; BL_trna_0047-1.
DR   EnsemblGenomes-Tr; BL_trna_0048-1.
DR   EnsemblGenomes-Tr; BL_trna_0049-1.
DR   EnsemblGenomes-Tr; BL_trna_0050-1.
DR   EnsemblGenomes-Tr; BL_trna_0051-1.
DR   EnsemblGenomes-Tr; BL_trna_0052-1.
DR   EnsemblGenomes-Tr; BL_trna_0053-1.
DR   EnsemblGenomes-Tr; BL_trna_0054-1.
DR   EnsemblGenomes-Tr; BL_trna_0055-1.
DR   EnsemblGenomes-Tr; BL_trna_0056-1.
DR   EnsemblGenomes-Tr; BL_trna_0057-1.
DR   EnsemblGenomes-Tr; BL_trna_0058-1.
DR   EnsemblGenomes-Tr; BL_trna_0059-1.
DR   EnsemblGenomes-Tr; BL_trna_0060-1.
DR   EnsemblGenomes-Tr; BL_trna_0061-1.
DR   EnsemblGenomes-Tr; BL_trna_0062-1.
DR   EnsemblGenomes-Tr; BL_trna_0063-1.
DR   EnsemblGenomes-Tr; BL_trna_0064-1.
DR   EnsemblGenomes-Tr; BL_trna_0065-1.
DR   EnsemblGenomes-Tr; BL_trna_0066-1.
DR   EnsemblGenomes-Tr; BL_trna_0067-1.
DR   EnsemblGenomes-Tr; BL_trna_0068-1.
DR   EnsemblGenomes-Tr; BL_trna_0069-1.
DR   EnsemblGenomes-Tr; BL_trna_0070-1.
DR   EnsemblGenomes-Tr; BL_trna_0071-1.
DR   EnsemblGenomes-Tr; BL_trna_0072-1.
DR   EnsemblGenomes-Tr; EBT00001555737.
DR   EnsemblGenomes-Tr; EBT00001555738.
DR   EnsemblGenomes-Tr; EBT00001555740.
DR   EnsemblGenomes-Tr; EBT00001555742.
DR   EnsemblGenomes-Tr; EBT00001555747.
DR   EnsemblGenomes-Tr; EBT00001555749.
DR   EnsemblGenomes-Tr; EBT00001555751.
DR   EnsemblGenomes-Tr; EBT00001555753.
DR   EnsemblGenomes-Tr; EBT00001555756.
DR   EnsemblGenomes-Tr; EBT00001555757.
DR   EnsemblGenomes-Tr; EBT00001555760.
DR   EnsemblGenomes-Tr; EBT00001555764.
DR   EnsemblGenomes-Tr; EBT00001555767.
DR   EnsemblGenomes-Tr; EBT00001555770.
DR   EnsemblGenomes-Tr; EBT00001555773.
DR   EnsemblGenomes-Tr; EBT00001555775.
DR   EnsemblGenomes-Tr; EBT00001555778.
DR   EnsemblGenomes-Tr; EBT00001555781.
DR   EnsemblGenomes-Tr; EBT00001555786.
DR   EnsemblGenomes-Tr; EBT00001555789.
DR   EnsemblGenomes-Tr; EBT00001555791.
DR   EnsemblGenomes-Tr; EBT00001555794.
DR   EnsemblGenomes-Tr; EBT00001555798.
DR   EnsemblGenomes-Tr; EBT00001555800.
DR   EnsemblGenomes-Tr; EBT00001555801.
DR   EnsemblGenomes-Tr; EBT00001555803.
DR   EnsemblGenomes-Tr; EBT00001555804.
DR   EnsemblGenomes-Tr; EBT00001555805.
DR   EnsemblGenomes-Tr; EBT00001555807.
DR   EnsemblGenomes-Tr; EBT00001555808.
DR   EnsemblGenomes-Tr; EBT00001555809.
DR   EnsemblGenomes-Tr; EBT00001555811.
DR   EnsemblGenomes-Tr; EBT00001555813.
DR   EnsemblGenomes-Tr; EBT00001555814.
DR   EnsemblGenomes-Tr; EBT00001555816.
DR   EnsemblGenomes-Tr; EBT00001555818.
DR   EnsemblGenomes-Tr; EBT00001555820.
DR   EnsemblGenomes-Tr; EBT00001555822.
DR   EnsemblGenomes-Tr; EBT00001555823.
DR   EnsemblGenomes-Tr; EBT00001555824.
DR   EnsemblGenomes-Tr; EBT00001555826.
DR   EnsemblGenomes-Tr; EBT00001555829.
DR   EnsemblGenomes-Tr; EBT00001555831.
DR   EnsemblGenomes-Tr; EBT00001555833.
DR   EnsemblGenomes-Tr; EBT00001555835.
DR   EnsemblGenomes-Tr; EBT00001555837.
DR   EnsemblGenomes-Tr; EBT00001555839.
DR   EnsemblGenomes-Tr; EBT00001555841.
DR   EnsemblGenomes-Tr; EBT00001555843.
DR   EnsemblGenomes-Tr; EBT00001555845.
DR   EnsemblGenomes-Tr; EBT00001555846.
DR   EnsemblGenomes-Tr; EBT00001555848.
DR   EnsemblGenomes-Tr; EBT00001555851.
DR   EnsemblGenomes-Tr; EBT00001555853.
DR   EnsemblGenomes-Tr; EBT00001555854.
DR   EnsemblGenomes-Tr; EBT00001555856.
DR   EnsemblGenomes-Tr; EBT00001555858.
DR   EnsemblGenomes-Tr; EBT00001555859.
DR   EnsemblGenomes-Tr; EBT00001555862.
DR   EnsemblGenomes-Tr; EBT00001555864.
DR   EnsemblGenomes-Tr; EBT00001555865.
DR   EnsemblGenomes-Tr; EBT00001555867.
DR   EnsemblGenomes-Tr; EBT00001555869.
DR   EnsemblGenomes-Tr; EBT00001555870.
DR   EnsemblGenomes-Tr; EBT00001555872.
DR   EnsemblGenomes-Tr; EBT00001555874.
DR   EnsemblGenomes-Tr; EBT00001555876.
DR   EnsemblGenomes-Tr; EBT00001555877.
DR   EnsemblGenomes-Tr; EBT00001555879.
DR   EnsemblGenomes-Tr; EBT00001555881.
DR   EnsemblGenomes-Tr; EBT00001555883.
DR   EnsemblGenomes-Tr; EBT00001555885.
DR   EnsemblGenomes-Tr; EBT00001555886.
DR   EnsemblGenomes-Tr; EBT00001555888.
DR   EnsemblGenomes-Tr; EBT00001555891.
DR   EnsemblGenomes-Tr; EBT00001555892.
DR   EnsemblGenomes-Tr; EBT00001555894.
DR   EnsemblGenomes-Tr; EBT00001555896.
DR   EnsemblGenomes-Tr; EBT00001555898.
DR   EnsemblGenomes-Tr; EBT00001555901.
DR   EnsemblGenomes-Tr; EBT00001555903.
DR   EnsemblGenomes-Tr; EBT00001555904.
DR   EnsemblGenomes-Tr; EBT00001555910.
DR   EnsemblGenomes-Tr; EBT00001555911.
DR   EnsemblGenomes-Tr; EBT00001555913.
DR   EnsemblGenomes-Tr; EBT00001555915.
DR   EnsemblGenomes-Tr; EBT00001555917.
DR   EnsemblGenomes-Tr; EBT00001555920.
DR   EnsemblGenomes-Tr; EBT00001555923.
DR   EnsemblGenomes-Tr; EBT00001555925.
DR   EnsemblGenomes-Tr; EBT00001555927.
DR   EnsemblGenomes-Tr; EBT00001555929.
DR   EnsemblGenomes-Tr; EBT00001555931.
DR   EnsemblGenomes-Tr; EBT00001555932.
DR   EnsemblGenomes-Tr; EBT00001555934.
DR   EnsemblGenomes-Tr; EBT00001555937.
DR   EnsemblGenomes-Tr; EBT00001555938.
DR   EnsemblGenomes-Tr; EBT00001555940.
DR   EnsemblGenomes-Tr; EBT00001555942.
DR   EnsemblGenomes-Tr; EBT00001555943.
DR   EnsemblGenomes-Tr; EBT00001555944.
DR   EnsemblGenomes-Tr; EBT00001555947.
DR   EnsemblGenomes-Tr; EBT00001555949.
DR   EnsemblGenomes-Tr; EBT00001555952.
DR   EnsemblGenomes-Tr; EBT00001555953.
DR   EnsemblGenomes-Tr; EBT00001555955.
DR   EnsemblGenomes-Tr; EBT00001555959.
DR   EnsemblGenomes-Tr; EBT00001555962.
DR   EnsemblGenomes-Tr; EBT00001555965.
DR   EnsemblGenomes-Tr; EBT00001555967.
DR   EnsemblGenomes-Tr; EBT00001555969.
DR   EnsemblGenomes-Tr; EBT00001555970.
DR   EnsemblGenomes-Tr; EBT00001555972.
DR   EnsemblGenomes-Tr; EBT00001555975.
DR   EnsemblGenomes-Tr; EBT00001555976.
DR   EnsemblGenomes-Tr; EBT00001555979.
DR   EnsemblGenomes-Tr; EBT00001555982.
DR   EnsemblGenomes-Tr; EBT00001555984.
DR   EnsemblGenomes-Tr; EBT00001555987.
DR   EnsemblGenomes-Tr; EBT00001555988.
DR   EnsemblGenomes-Tr; EBT00001555991.
DR   EnsemblGenomes-Tr; EBT00001555992.
DR   EnsemblGenomes-Tr; EBT00001555995.
DR   EnsemblGenomes-Tr; EBT00001555998.
DR   EnsemblGenomes-Tr; EBT00001555999.
DR   EnsemblGenomes-Tr; EBT00001556003.
DR   EnsemblGenomes-Tr; EBT00001556006.
DR   EnsemblGenomes-Tr; EBT00001556009.
DR   EnsemblGenomes-Tr; EBT00001556010.
DR   EnsemblGenomes-Tr; EBT00001556014.
DR   EnsemblGenomes-Tr; EBT00001556018.
DR   EnsemblGenomes-Tr; EBT00001556020.
DR   EnsemblGenomes-Tr; EBT00001556021.
DR   EnsemblGenomes-Tr; EBT00001556024.
DR   EnsemblGenomes-Tr; EBT00001556028.
DR   EnsemblGenomes-Tr; EBT00001556031.
DR   EnsemblGenomes-Tr; EBT00001556033.
DR   EnsemblGenomes-Tr; EBT00001556035.
DR   EnsemblGenomes-Tr; EBT00001556037.
DR   EnsemblGenomes-Tr; EBT00001556039.
DR   EnsemblGenomes-Tr; EBT00001556043.
DR   EnsemblGenomes-Tr; EBT00001556044.
DR   EnsemblGenomes-Tr; EBT00001556045.
DR   EnsemblGenomes-Tr; EBT00001556046.
DR   EnsemblGenomes-Tr; EBT00001556047.
DR   EnsemblGenomes-Tr; EBT00001556048.
DR   EnsemblGenomes-Tr; EBT00001556049.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC2727956; 19707558.
DR   EuropePMC; PMC2863459; 20208025.
DR   EuropePMC; PMC3568030; 23409173.
DR   EuropePMC; PMC4231854; 25372819.
DR   EuropePMC; PMC4746201; 28330118.
DR   EuropePMC; PMC4919412; 27340073.
DR   EuropePMC; PMC4921080; 27407196.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5078553; 27582514.
DR   EuropePMC; PMC5131670; 27965753.
DR   EuropePMC; PMC5356052; 28302775.
DR   EuropePMC; PMC545597; 15461803.
DR   EuropePMC; PMC5496451; 28706723.
DR   EuropePMC; PMC5863238; 16611136.
DR   GOA; P86720.
DR   GOA; Q65MB1.
DR   InterPro; IPR023774; Put_metal_dep_hydrolase_YfiT.
DR   InterPro; IPR027632; Lant_SP_1948.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; CP000002.
DR   SILVA-SSU; CP000002.
DR   StrainInfo; 29491; 1.
DR   UniProtKB/Swiss-Prot; P86720; LANLB_BACLD.
DR   UniProtKB/Swiss-Prot; Q65MB1; Y869_BACLD.
XX
CC   On Apr 26, 2007 this sequence version replaced gi:56160984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4222597
FT                   /organism="Bacillus licheniformis DSM 13 = ATCC 14580"
FT                   /strain="ATCC 14580; DSM 13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:279010"
FT   gene            507..1847
FT                   /gene="dnaA"
FT                   /locus_tag="BL00076"
FT   CDS_pept        507..1847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BL00076"
FT                   /product="DnaA"
FT                   /function="initiation of chromosome replication, Molecular
FT                   Function: DNA binding, Molecular Function: DNA replication
FT                   origin binding, Molecular Function: ATP binding, Biological
FT                   Process: DNA replication initiation, Biological Process:
FT                   regulation of DNA"
FT                   /db_xref="EnsemblGenomes-Gn:BL00076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21645"
FT                   /db_xref="GOA:Q65PM2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PM2"
FT                   /protein_id="AAU21645.1"
FT                   /translation="MKNISDLWNQALGQIEKKLSKPSFETWMKSTKAHSLQGDTLIITA
FT                   PNEFARDWLESRYLHLIADTIYDLTGEELSIKFVIPQNQNEEDFMPKSPIKKMSKEEPA
FT                   DFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNTLHEETKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPSSKPKVITIKDIQRIVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLSDDEQLQQQIKEIKEQLR"
FT   gene            2024..3160
FT                   /gene="dnaN"
FT                   /locus_tag="BL00077"
FT   CDS_pept        2024..3160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BL00077"
FT                   /product="DNA polymerase III (beta subunit)"
FT                   /function="Molecular Function: DNA binding, Molecular
FT                   Function: DNA-directed DNA polymerase activity, Biological
FT                   Process: DNA replication, Molecular Function:
FT                   3'-5'-exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00077"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21646"
FT                   /db_xref="GOA:Q65PM1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PM1"
FT                   /protein_id="AAU21646.1"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDEGVSLT
FT                   GSDSDISIESFIPKEDGDLEIVTIEQPGSIVLQARFFSEIVKKLPMSTVEIEVQNQYLT
FT                   IIRSGKAEFNLNGLDASEYPLLPQIEEHHAFQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWNVTGGELICTATDSHRLALRKAKLDINEDSSYNVVIPGKSLTELSKILDDHQELV
FT                   DIVITETQVLFKTKNVLFFSRLLDGNYPDTNRLIPQESKTNLIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSAAANESIEISSNSPEIGKVVETVNAEQIEGEDLKISFSPKYMLDALK
FT                   VLEGEDIHVSFTGAMRPFLIRTPNDDSIVQLILPVRTY"
FT   gene            3328..3543
FT                   /gene="yaaA"
FT                   /locus_tag="BL00078"
FT   CDS_pept        3328..3543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="BL00078"
FT                   /product="conserved protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:BL00078"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21647"
FT                   /db_xref="GOA:Q65PM0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PM0"
FT                   /protein_id="AAU21647.2"
FT                   /translation="MTKTVAIDTEMITLGQFLKLADVIQSGGMAKWFLSEYEVLVNDEP
FT                   DNRRGRKLYVGDVVTIEGFGSFQVVG"
FT   gene            3560..4672
FT                   /gene="recF"
FT                   /locus_tag="BL00079"
FT   CDS_pept        3560..4672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BL00079"
FT                   /product="DNA repair RecF"
FT                   /function="DNA repair and genetic recombination, Molecular
FT                   Function: single-stranded DNA binding, Molecular Function:
FT                   ATP binding, Biological Process: DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BL00079"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21648"
FT                   /db_xref="GOA:Q65PL9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL9"
FT                   /protein_id="AAU21648.1"
FT                   /translation="MYIQNLTLSSYRNYERLDLQFENKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDKELIRWDEDYAKIEGRVIKKNGSVPIQLVISKKGKKGKVNHIEQQKL
FT                   SQYVGAVNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHF
FT                   LKQLQTRKQTDQTMLDVLTEQLTEFAAKVVMKRLQFVDQLEKWAQPIHSGISRGLEELT
FT                   LKYHTSLHVSDSPDLSKMINSYQETFSKLRDKEIERGVSLSGPHRDDVLFYVNGRDVQT
FT                   YGSQGQQRTTALSLKLAEIDLIQEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQT
FT                   FVTTTSVDGIDHKTLNEAEIFRVENGTLSD"
FT   gene            4690..4932
FT                   /gene="yaaB"
FT                   /locus_tag="BL00080"
FT   CDS_pept        4690..4932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaB"
FT                   /locus_tag="BL00080"
FT                   /product="YaaB"
FT                   /db_xref="EnsemblGenomes-Gn:BL00080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21649"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PL8"
FT                   /protein_id="AAU21649.1"
FT                   /translation="MYIHLGDDFVVSTREIVAIFDYKAKTSPIVEEFLSKQKQRIVSSN
FT                   STPKSIVVTLQSIYFSPLASGTLKKRAQSKPEIDS"
FT   gene            4986..6905
FT                   /gene="gyrB"
FT                   /locus_tag="BL00081"
FT   CDS_pept        4986..6905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BL00081"
FT                   /product="DNA gyrase (subunit B)"
FT                   /function="initation of replication cycle and DNA
FT                   elongation, Molecular Function: DNA binding, Molecular
FT                   Function: DNA topoisomerase (ATP-hydrolyzing) activity,
FT                   Molecular Function: ATP binding, Biological Process: DNA
FT                   metabolism, Biological Process: DNA topological"
FT                   /db_xref="EnsemblGenomes-Gn:BL00081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21650"
FT                   /db_xref="GOA:Q630A8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q630A8"
FT                   /protein_id="AAU21650.1"
FT                   /translation="MAMEQQNNYDENQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWE
FT                   IVDNSIDEALAGYCTEINVAIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAG
FT                   GKFDGSGYKVSGGLHGVGASVVNALSTELDVTVYRDGKIHYQEFERGVPKADLKVIGDT
FT                   EVTGTTTHFKPDPEIFTETTEYDYDTLATRVRELAFLTKGVKITIEDKREGKERKNEYC
FT                   YEGGIKSYVEHLNRSREVIHEEPVYIEGSKDGITVEVALQYNDSYTSNIYSFANNIHTY
FT                   EGGTHEAGFKTGLTRVINDYARRNGVFKESDPNLSGEDVREGLTAIISIKHPDPQFEGQ
FT                   TKTKLGNSEARTITDALFSEALEKFLLENPDSAKKIVEKGVMAARARMAAKKARELTRR
FT                   KSALEVSNLPGKLADCSSKDPTISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNV
FT                   EKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTF
FT                   FYRYMRQIIEQGYVYIAQPPLYKVQQGKRVEYAYNDQQLEEILKELPQNPKPGLQRYKG
FT                   LGEMNATQLWETTMDPETRTLLQVTLKDAIDADETFEMLMGDKVEPRRNFIEENARYVK
FT                   NLDI"
FT   gene            7096..9564
FT                   /gene="gyrA"
FT                   /locus_tag="BL00082"
FT   CDS_pept        7096..9564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BL00082"
FT                   /product="DNA gyrase (subunit A)"
FT                   /function="initation of replication cycle and DNA
FT                   elongation, Molecular Function: DNA binding, Molecular
FT                   Function: DNA topoisomerase (ATP-hydrolyzing) activity,
FT                   Cellular Component: chromosome, Biological Process: DNA
FT                   topological change, Biological Process: DNA unwinding"
FT                   /db_xref="EnsemblGenomes-Gn:BL00082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21651"
FT                   /db_xref="GOA:Q65PL6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PL6"
FT                   /protein_id="AAU21651.1"
FT                   /translation="MSEQHKPQVQEVNISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKPYKKSARIVGEVIGKYHPHGDSAVYEAMVRMAQDFNYRYMLV
FT                   QGHGNFGSVDGDSAAAMRYTEARMSKISMEILRDINKDTIDYQDNYDGSEKEPVVMPAR
FT                   FPNLLVNGAAGIAVGMATNIPPHQLGEVIDGVLAVSKNPDITLPELMEIIPGPDFPTAG
FT                   LILGRSGIRKAYETGRGSITLRAKAQIEETSSGKPVIIITEIPYQVNKARLIEKIADLV
FT                   RDKKIDGITDLRDESDRNGMRIVIELRRDANANVLLNNLYKQTALQTSFGINLLALVDG
FT                   QPKVLSLKQCLEHYLDHQKVVIRRRTAFELRKAEARAHILEGLRVALDHLDEVISLIRN
FT                   SQTAEIAKNGLIEKFSLTEKQAQAILDMRLQRLTGLEREKIEEEYQSLVELIAELKAIL
FT                   ADEEKVLEIIREELTEVKERFNDERRTEIVTSGLETIEDEDLITRENIVVTLTHNGYIK
FT                   RLPSSTYRSQKRGGKGIQGMGTNEDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   FGRTAKGIPIINLLEVEKGEWINAIIPVGEFDDESYLFFTTKHGISKRTPLSQFANIRN
FT                   NGLIALSLRDEDELIAVRLTDGNKQIIIGTKNGLLIRFPETDVRQMGRTAAGVKGINLT
FT                   DDDVVVGMEILEEDSHVLIVTEKGYGKLTPASEYRVQSRGGKGLKTCKITENNGSLVTV
FT                   KATTGEEDLMIITASGVIIRMDIKDISTTGRVTQGVRLIRLGEQEHVATVALVEKDEEN
FT                   DSEEQEADES"
FT   gene            9909..11453
FT                   /locus_tag="BL_rrna_0001"
FT   rRNA            9909..11453
FT                   /locus_tag="BL_rrna_0001"
FT                   /product="16S ribosomal RNA"
FT   gene            11554..11630
FT                   /locus_tag="BL_trna_0001"
FT   tRNA            11554..11630
FT                   /locus_tag="BL_trna_0001"
FT                   /product="tRNA-Ile"
FT   gene            11642..11717
FT                   /locus_tag="BL_trna_0002"
FT   tRNA            11642..11717
FT                   /locus_tag="BL_trna_0002"
FT                   /product="tRNA-Ala"
FT   gene            11788..14718
FT                   /locus_tag="BL_rrna_0002"
FT   rRNA            11788..14718
FT                   /locus_tag="BL_rrna_0002"
FT                   /product="23S ribosomal RNA"
FT   gene            14850..14965
FT                   /locus_tag="BL_rrna_0003"
FT   rRNA            14850..14965
FT                   /locus_tag="BL_rrna_0003"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14981..15958)
FT                   /gene="yaaC"
FT                   /locus_tag="BL02362"
FT   CDS_pept        complement(14981..15958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BL02362"
FT                   /product="conserved protein YaaC"
FT                   /db_xref="EnsemblGenomes-Gn:BL02362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21652"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PL5"
FT                   /protein_id="AAU21652.2"
FT                   /translation="MQDKGWKDLKLFYSVETAQHFLEMVYKNQGMEDAKKNSYKNGERF
FT                   IFFLKHAEAFYKQAKIATLEIKPILLFYGMAQLLKACLLMTDPSYPSHTSVLAHGVTTR
FT                   KRKKQNYRFYEDEVKIQRNGLCMHVIRSLFQLSGLEDERFNMKQLLARIPEINKVLAFQ
FT                   RKPNPIVKAAVEDRLIWLPSETPDAYNMSSKRFIEHVEYHLNWSFCREEKEGIIFSAAQ
FT                   KECRPSTSTTLLYDLEHGAYYFPAERDRFLKLPEILVHYLVAYNLSMIARYETEWWYDL
FT                   LLQSASDDYVIIQQFLHIVESKFPYYIAELLIRKKENNKKDQLI"
FT   gene            16080..17546
FT                   /gene="guaB"
FT                   /locus_tag="BL02350"
FT   CDS_pept        16080..17546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BL02350"
FT                   /product="inosine-monophosphate dehydrogenase"
FT                   /function="Molecular Function: IMP dehydrogenase activity,
FT                   Biological Process: GMP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21653"
FT                   /db_xref="GOA:Q65PL4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PL4"
FT                   /protein_id="AAU21653.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTPSLKLNVP
FT                   IISAGMDTVTEAQMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   EHQVFDAEHLMGKYRISGVPIVDNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TAPVGTTLDEAEKILQKYKIEKLPLLDDQGVLKGLITIKDIEKVIEFPNSAKDVHGRLL
FT                   VGAAVGVTGDTMTRVRKLVEANVDVIVVDTAHGHSQGVLDTVKKIRDTYPELNIIAGNV
FT                   ATAEGTKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQVTAIYDCATEARKHGAAIIA
FT                   DGGIKYSGDIVKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVADTVYQLVGGLKSGMGYCGTKDLHALREDA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
FT   gene            17701..19026
FT                   /gene="dacA"
FT                   /locus_tag="BL02352"
FT   CDS_pept        17701..19026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BL02352"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /function="Molecular Function: serine carboxypeptidase
FT                   activity, Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21654"
FT                   /db_xref="GOA:Q65PL3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PL3"
FT                   /protein_id="AAU21654.1"
FT                   /translation="MKSKRLKQLIMLIVAFAVTVGAFSPMSTAKAANDPINVDAKAAIL
FT                   VEASSGKILYSKNADQRLPVASMAKMMTEYLLLEAIHEGKVKWDQKYTPDDYVYEISQD
FT                   RSLSNVPLRKDGSYTVKELYQATAIYSANAAAIALSEIVAGSESKFVELMNKKAKELGM
FT                   KDFKFVNATGLENKDLHGKHPSGTNANEENEVSARDMALLADHLVSDYPEILDTASIAK
FT                   TKFRKGTDDEMDMPNWNFMLKGLVQQYEGVDGLKTGSTDSAGSCFTATAERNGMRVISV
FT                   VLNAKGDLHTARFKETKKMLDYAFENFTMKEFYAKGAQVKGNETVTVDKGKETEVGIVT
FT                   EKAFSMPVKNGEEKNYKAKVTLNKDELTAPVKKGEKVGTLTASYKGEEKDYGFLGSDVS
FT                   GVNLVTKEDDEKANWFILTMRSIGGFFAGIWNSIVEMVTGWF"
FT   gene            19213..20097
FT                   /gene="pdxS"
FT                   /locus_tag="BL02353"
FT   CDS_pept        19213..20097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BL02353"
FT                   /product="Vitamin B6 biosynthesis protein"
FT                   /function="vitaming B6 biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21655"
FT                   /db_xref="GOA:Q65PL2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL2"
FT                   /protein_id="AAU21655.1"
FT                   /translation="MAQTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEALGVDYIDES
FT                   EVLTPADEEFHLNKNEFTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVGMSDDELMTEAKNLGAPYELLKEIKAEGRLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
FT   gene            20119..20709
FT                   /gene="pdxT"
FT                   /locus_tag="BL02354"
FT   CDS_pept        20119..20709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BL02354"
FT                   /product="SNO glutamine amidotransferase"
FT                   /function="vitamin B6 biosythesis"
FT                   /note="vitamin B6 biosynthesis PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:BL02354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21656"
FT                   /db_xref="GOA:Q65PL1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL1"
FT                   /protein_id="AAU21656.1"
FT                   /translation="MLTIGVLGLQGAVREHIRSIEACGAAGKVIKWPEELKEIDGLILP
FT                   GGESTTMRRLIDTYQFMKPLQEFAASGKPVFGTCAGLIILAKNIAGTNDAHLGVLDVTV
FT                   ERNSFGRQVDSFEADLTVKGLEGPFTGVFIRAPHILEAGADVEVLSEHNGRIVAAKQGN
FT                   LLGCSFHPELTDDHRMTKLFVEMVEKHKREAVV"
FT   gene            21037..22314
FT                   /gene="serS"
FT                   /locus_tag="BL02355"
FT   CDS_pept        21037..22314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BL02355"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="Molecular Function: serine-tRNA ligase activity,
FT                   Molecular Function: ATP binding, Biological Process:
FT                   seryl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL02355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21657"
FT                   /db_xref="GOA:Q65PL0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL0"
FT                   /protein_id="AAU21657.1"
FT                   /translation="MLDVKLLRANFEEIKQKLAHRGEDLSDFDQFEELDTKRRELIVKV
FT                   EELKGKRNEVSQQVAALKREKKDADHLIKEMREVGEDIKKLDEELRTVESSLDKIMLSI
FT                   PNIPHESVPVGETEDDNVEVRKWGELPEFSFEPKPHWDIADQLDILDFERAGKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEYGYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNLHRDEILSADELPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNQAEKVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQNTYREISSCSNFEAFQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAALLEN
FT                   YQQEDGSVIIPKALRPYMGNRDVIQP"
FT   gene            complement(22344..23474)
FT                   /gene="glxK"
FT                   /locus_tag="BL02363"
FT   CDS_pept        complement(22344..23474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="BL02363"
FT                   /product="Glycerate kinase GlxK"
FT                   /function="Biological Process: protein amino acid
FT                   phosphorylation, Molecular Function: glycerate kinase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21658"
FT                   /db_xref="GOA:Q630A0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q630A0"
FT                   /protein_id="AAU21658.1"
FT                   /translation="MKIVIAPDSFKESMTSLEAARSIEKGFKEILPDAEYVNIPVADGG
FT                   EGTVQALVDATGGDIVYQTVTGPLGKPVKAAYGLLGDGKTAVIEMAEASGLHLVPPEQR
FT                   NPLLTTTRGTGELILDAAEKGVSQIIIGLGGSATNDGGAGMASALGVKFLNRAGEEIEN
FT                   GGGALAEIAKIDVSGLDPKLKHIQFEAACDVDNPLTGPRGASAVFGPQKGANSEMTAHL
FT                   DQNLKHYAAAVKAELGCEIDSLPGAGAAGGLGAGLCAFLKAELKSGVDIVLDTLSFSER
FT                   IKGADLVITGEGKIDGQTVSGKTPAGVAKRACSENIPVIAFAGSLGEGCELVYDIGISA
FT                   LFSIVPGISSLENALADGSSNLTRCARNVAAVWSLE"
FT   gene            complement(23490..24758)
FT                   /gene="gntT"
FT                   /locus_tag="BL02364"
FT   CDS_pept        complement(23490..24758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntT"
FT                   /locus_tag="BL02364"
FT                   /product="Putative gluconate transporter"
FT                   /function="Molecular Function: gluconate transporter
FT                   activity, Biological Process: gluconate transport, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21659"
FT                   /db_xref="GOA:Q65PK9"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK9"
FT                   /protein_id="AAU21659.1"
FT                   /translation="MDIQINAIGALCALVISIFLILKKVPPAYGMMIGALAGGLIGGAD
FT                   LIETTDLMIAGAKNMIPAVLRILAAGVLAGVLIQSGSAAVIAETIVNQIGEKRALLALT
FT                   LATAILTTVGVFVDVAVITVAPIALAIARRTFISKAAILLAMIGGGKAGNIMSPNPNAI
FT                   AASDAFHVPLTSVMAAGIIPAIFGLGATYLLAKRLSNKGTKVAANEIETQTAQQLPAFW
FT                   AAVSGPVVSILLLALRPAAGITIDPIIALPAGGLVTAIASGQAGKLRDFAASGLSKMSG
FT                   VAVMLLGTGTLAGIIANSKLNSLITDTLVGLGLPSFLLAPISGMLMSMATASTTAGTAV
FT                   ASSVFGPTLLDLGVAGLAGAAMIHAGATVLDHLPHGSFFHTTGGSVFMAMKERLKLIPY
FT                   ESVIGLILTIISTLIFGIFQFFI"
FT   gene            complement(24848..25966)
FT                   /locus_tag="BL02365"
FT   CDS_pept        complement(24848..25966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02365"
FT                   /product="Putative sugar diacid recognition protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21660"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK8"
FT                   /protein_id="AAU21660.1"
FT                   /translation="MNYLSKELAEEIVERTMSIIRHNINMMDENGVIIASGDRSRIGDE
FT                   HAGAKDALAAEKVISITPEECSALTGTKPGVNLPIVFHDEIIGVIGITGPPSEVSRYGE
FT                   LVKMAAELTVEQAFLTKQLTWDQRLREETVIQMIQGTDLASLDFFERAERLNIPLDGQR
FT                   TCLVFELPSADMKPAFIKKLEKHLTAKDLYANISLKEVAVILAGAPTKSRSDLFSAWNG
FT                   WLSQWKTVRGALGEQADQLQQLPFSYQSAKQTLKIAENNCSLYDYREFAIPVLLSKIEH
FT                   PDQEIHFQNIWDRLSQADQKGELTHTLLCYIEENGEIGETSSRLFIHRNTLNYRLRKIE
FT                   LATGCNPKRFDDLFKLYTAITLFSPFCANEQF"
FT   gene            complement(25996..26418)
FT                   /locus_tag="BL05000"
FT   CDS_pept        complement(25996..26418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05000"
FT                   /product="conserved Hypothetical Heavy metal
FT                   transport/detoxification protein"
FT                   /function="Biological Process: metal ion transport,
FT                   Molecular Function: metal ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL05000"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21661"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK7"
FT                   /protein_id="AAU21661.1"
FT                   /translation="MWKHFISRLPQDYTLNRPIETGKLQKAEELLGVSFPDELVSLLKM
FT                   TNGINDTFGDHLIWPADRIIEENLDMRCTDCFKPFDCLLFIAGAGNGDLFAYSILNGSI
FT                   RKNDIYVWNHIDDSRIWVAPSLKSFIKGWIDGTITI"
FT   gene            26548..26640
FT                   /locus_tag="BL_trna_0003"
FT   tRNA            26548..26640
FT                   /locus_tag="BL_trna_0003"
FT                   /product="tRNA-Ser"
FT   gene            complement(26773..27414)
FT                   /gene="dck"
FT                   /locus_tag="BL02366"
FT   CDS_pept        complement(26773..27414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BL02366"
FT                   /product="deoxyadenosine/deoxycytidine kinase"
FT                   /function="Molecular Function: ATP binding, Biological
FT                   Process: nucleobase, nucleoside, nucleotide and nucleic
FT                   acid metabolism, Molecular Function: phosphotransferase
FT                   activity, alcohol group as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:BL02366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21662"
FT                   /db_xref="GOA:Q65PK6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK6"
FT                   /protein_id="AAU21662.1"
FT                   /translation="MSVYDIPKDAIITVAGTVGVGKSTLTKELAKRLGFKTSLEEVVNN
FT                   PYLEAFYQDFERWSFHLQIFFLAERFKEQKYIYESGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKVDYKTYTSLFEAMVMTPYFPRPDVLVYLEGDLETILDRIQKRGREMELLTDRSY
FT                   WEEMYTRYENWISGFNACPVVRVNIDEYDLFNNSASLDPIIEKISEAIQR"
FT   gene            complement(27411..28034)
FT                   /gene="dgk"
FT                   /locus_tag="BL02367"
FT   CDS_pept        complement(27411..28034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BL02367"
FT                   /product="deoxyguanosine kinase"
FT                   /function="Molecular Function: ATP binding, Biological
FT                   Process: nucleobase, nucleoside, nucleotide and nucleic
FT                   acid metabolism, Molecular Function: phosphotransferase
FT                   activity, alcohol group as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:BL02367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21663"
FT                   /db_xref="GOA:Q65PK5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK5"
FT                   /protein_id="AAU21663.1"
FT                   /translation="MNTAPFIAVEGPIGAGKTTLASMLSEKLSLSLVKEIVEENPFLDK
FT                   FYDEKDEWSFQLEMFFLCNRYKQLEDTEKKYLHHHMPVVSDYHIYKNLIFAERTLEGKK
FT                   LEKYRKIYQLLTEDLPKPNVIIYIRASLPTLLERIKKRGRPFEQEMDKQYLEQLINDYE
FT                   AAIKQFKESDPPIPVIEINGDQEDFVISEAVFNRIADQVKEYIE"
FT   gene            complement(28121..29440)
FT                   /gene="yaaH"
FT                   /locus_tag="BL02368"
FT   CDS_pept        complement(28121..29440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="BL02368"
FT                   /product="Glycoside hydrolase, family 18, YaaH"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: hydrolase activity, Biological Process: cell wall
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21664"
FT                   /db_xref="GOA:Q65PK4"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK4"
FT                   /protein_id="AAU21664.1"
FT                   /translation="MRKEAFPIQIYVVKRGDTLYQIANRYRTTVNEIVATNEIPNPNRL
FT                   VVGQTIVIPIAGEFYEVRQGDTLASIGARFNISPAELARINRIQVSAVLPVGLLLYIPP
FT                   RPRRNIETNAYIEPRGESVSPALQQAAREASPYLTYLGAFSFQAKRDGTLEEPPLNNLK
FT                   EIADRHRTTMMMIVTNLENEAFSDELGRIILTDQNVKNRLLDNIVAAARRYGFKDIHFD
FT                   FEYLRPEDREAYNQFLRDARARFRQEGWLISTALAPKTRADQPGQWYEAHDYRAHGEIV
FT                   DFVVLMTYEWGYSGGPPMAVSPIGPVRDVIEYALTEMPASKIVMGQNLYGYDWTLPYTP
FT                   GGPLARAISPQRAIEIASENNAAIQYDETAQAPNFRYTDNAGKQHEVWFEDARSIQAKF
FT                   DLIRELNLRGISYWKLGLSFPQNWLLIADQFNVVKETFPS"
FT   gene            complement(29478..30020)
FT                   /gene="yaaI"
FT                   /locus_tag="BL02370"
FT   CDS_pept        complement(29478..30020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BL02370"
FT                   /product="putative Isochorismatase hydrolase YaaI"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02370"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21665"
FT                   /db_xref="GOA:Q65PK3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK3"
FT                   /protein_id="AAU21665.1"
FT                   /translation="MSNSALIIVDIINDFQFDMGNVLSKKTRNITEHLLALKEHAAKMK
FT                   WPIIYINDHFGIWQADIAAIIKKCKNGRSEYIIDRLAPNDSDYFLIKPKHSAFYGTALE
FT                   TLLHELHVDHLIITGIAGNICVLFTANDAYMREYEITIPRDCIASNNEKDNKYALTMME
FT                   NVLFANITTAKAITSET"
FT   gene            30001..30591
FT                   /gene="yaaJ"
FT                   /locus_tag="BL02356"
FT   CDS_pept        30001..30591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="BL02356"
FT                   /product="putative Cytidine/deoxycytidylate deaminase,
FT                   zinc-binding region YaaJ"
FT                   /function="Molecular Function: zinc ion binding, Molecular
FT                   Function: hydrolase activity"
FT                   /note="putative tRNA specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21666"
FT                   /db_xref="GOA:Q62ZZ2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZZ2"
FT                   /protein_id="AAU21666.2"
FT                   /translation="MRAELDNAIVSFQILYSFNYKLAYSVWRKTLKECMRMTQDEFYMK
FT                   EAVNEARKAEEKGEVPIGAVLVLDGEIIARAHNLRETEQRSVAHAEMLVIEEACRKLGT
FT                   WRLERAVLYVTLEPCPMCAGAAVLSRIDKVVFGASDPKGGCAGTLMNLLQEERFNHQAE
FT                   VVSGVMEEECGRMLSDFFRKLRAKKKAEKQSEL"
FT   gene            31077..32777
FT                   /gene="dnaX"
FT                   /locus_tag="BL02357"
FT   CDS_pept        31077..32777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BL02357"
FT                   /product="DNA polymerase III (gamma and tau subunits)"
FT                   /function="DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BL02357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21667"
FT                   /db_xref="GOA:Q65PK1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PK1"
FT                   /protein_id="AAU21667.2"
FT                   /translation="MSYQALYRVFRPQLFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKLFAKAVNCERAPVSEPCNECSACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMKKIVEAEQLKVQDGALDIIASAADGGMRDALSLLD
FT                   QAVSFSGEELTVDDALLITGAVSQHYIGKLASTLHEKNVSGALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYQTAPDLEGVLEKVKVDEEFQTLSRQIPASDLYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKLCQGPKAGASAAAQPEVDNLVNKVRQLEQEIERLKTQGVQVSS
FT                   APAQAKEASRPQKSIKSAYKAPVGRIHEILKDATRPDLEKLKGCWGQLLAQLKQQNKVS
FT                   HAALLNDSEPVAASSKAFVLAFKYEIHCKMVAEDNNGVRTNLEQILDGMLGGRIDIVGV
FT                   PEAQWGKIREEFLQDHQPEDSEANEPKEEDPLVAEAKKLFGAELIEIKE"
FT   gene            32804..33127
FT                   /gene="yaaK"
FT                   /locus_tag="BL02358"
FT   CDS_pept        32804..33127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BL02358"
FT                   /product="conserved hypothetical YaaK"
FT                   /db_xref="EnsemblGenomes-Gn:BL02358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21668"
FT                   /db_xref="GOA:Q65PK0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PK0"
FT                   /protein_id="AAU21668.2"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMQKAQEELAEKVLEGTAGGGMVTV
FT                   KVNGQKEVIDVIIKEEVVDPEDVEMLQDLVLAATNDALKKVDEVTNETMGKFTKGMNMP
FT                   GLF"
FT   gene            33141..33737
FT                   /gene="recR"
FT                   /locus_tag="BL02359"
FT   CDS_pept        33141..33737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BL02359"
FT                   /product="DNA repair protein RecR"
FT                   /function="DNA repair and genetic recombination, Biological
FT                   Process: DNA repair, Biological Process: DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:BL02359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21669"
FT                   /db_xref="GOA:Q65PJ9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PJ9"
FT                   /protein_id="AAU21669.1"
FT                   /translation="MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLSMKEDVVLDFAK
FT                   ALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPS
FT                   GIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREM"
FT   gene            33758..33982
FT                   /gene="yaaL"
FT                   /locus_tag="BL02360"
FT   CDS_pept        33758..33982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BL02360"
FT                   /product="conserved hypothetical protein YaaL"
FT                   /db_xref="EnsemblGenomes-Gn:BL02360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21670"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ8"
FT                   /protein_id="AAU21670.1"
FT                   /translation="MGFLRKKKLRKEFDNKLVEQLIHQKEEWNRQKRLIENSLEPSPEV
FT                   LYELKVAEAKYFFYLREAKKRNLRIGSWK"
FT   gene            34047..34313
FT                   /gene="bofA"
FT                   /locus_tag="BL02361"
FT   CDS_pept        34047..34313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BL02361"
FT                   /product="BofA"
FT                   /function="inhibition of the pro-sigma-K processing
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:BL02361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21671"
FT                   /db_xref="GOA:Q65PJ7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ7"
FT                   /protein_id="AAU21671.1"
FT                   /translation="MGSVIFIGAIVALVALLFFSKASFKPLRLIGRIAVRFVVGALFLF
FT                   CVNLFGESVGIHVPINIVTTGVSGLLGVPGVAALIVIKQFIAI"
FT   gene            34607..36151
FT                   /locus_tag="BL_rrna_0004"
FT   rRNA            34607..36151
FT                   /locus_tag="BL_rrna_0004"
FT                   /product="ribosomal protein"
FT   gene            36252..36328
FT                   /locus_tag="BL_trna_0004"
FT   tRNA            36252..36328
FT                   /locus_tag="BL_trna_0004"
FT                   /product="tRNA-Ile"
FT   gene            36340..36415
FT                   /locus_tag="BL_trna_0005"
FT   tRNA            36340..36415
FT                   /locus_tag="BL_trna_0005"
FT                   /product="tRNA-Ala"
FT   gene            36486..39416
FT                   /locus_tag="BL_rrna_0005"
FT   rRNA            36486..39416
FT                   /locus_tag="BL_rrna_0005"
FT                   /product="ribosomal protein"
FT   gene            39549..39664
FT                   /locus_tag="BL_rrna_0006"
FT   rRNA            39549..39664
FT                   /locus_tag="BL_rrna_0006"
FT                   /product="ribosomal protein"
FT   gene            39833..40024
FT                   /gene="csfB"
FT                   /locus_tag="BL05001"
FT   CDS_pept        39833..40024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="BL05001"
FT                   /product="CsfB"
FT                   /note="sigma-F-transcribed gene"
FT                   /db_xref="EnsemblGenomes-Gn:BL05001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21672"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZY6"
FT                   /protein_id="AAU21672.2"
FT                   /translation="MSKSNHGETCIICEENKTEGIHLYTKFLCSDCEKKIVSTSTSDPE
FT                   YSDYVKKLKSLRTPPLYS"
FT   gene            40217..40834
FT                   /gene="xpaC"
FT                   /locus_tag="BL02506"
FT   CDS_pept        40217..40834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BL02506"
FT                   /product="XpaC"
FT                   /function="hydrolysis of 5-bromo 4-chloroindolyl phosphate
FT                   (X-phos)"
FT                   /db_xref="EnsemblGenomes-Gn:BL02506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21673"
FT                   /db_xref="GOA:Q65PJ6"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ6"
FT                   /protein_id="AAU21673.1"
FT                   /translation="MKPILHFMIRATAASALSVLLWFTSFFAFNQTFLLSSAYAAGAWI
FT                   AVYLGGKWYGTYLFLKENQLTRREYAYIKQNLREAKLKIARLRKALFAVKNIQTIKQNL
FT                   EILRIVRKIYSITKNEPKRFYQVERFYYQSLDSIVELTEKHAFLASQPKRNANLEVSLS
FT                   ETRMMIDKLAKQLEDDLYDLLKTDIDHLEFELDVAKHSMKKS"
FT   gene            40850..42043
FT                   /gene="yaaN"
FT                   /locus_tag="BL02507"
FT   CDS_pept        40850..42043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaN"
FT                   /locus_tag="BL02507"
FT                   /product="putative Toxic anion resistance protein YaaN"
FT                   /db_xref="EnsemblGenomes-Gn:BL02507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21674"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ5"
FT                   /protein_id="AAU21674.1"
FT                   /translation="MSEYKPSLHKTGAQLEFDDLLSDPFGQGEAPVSGVEEKLRGQQVN
FT                   LVDTLSEEKRRQAFQLAEQIDPKNHNSITLYGTQAQSKLLNFSHEMLEHVQKKDVGEIG
FT                   QVLSDLMKKLEQVSPDELKTEKRNFFSRLFGRVSHSVQEVLSRYQKTGAQIDRISVKLE
FT                   HSKSALINDNKMLERLYEKNKEYYEALNVYIAAGQLKLEELNHKTIPELKEKSKTEHHH
FT                   MAVQEVNDMIQFADRLEKRVYDLTLSRQITLQSAPQIRLIQHTNQVLAEKIQSSIMTAI
FT                   PLWKNQVAIALTLLRQRRAVEAQKQVSATTNELLLKNAEMLKANTIETAKENERGFIDI
FT                   ETLKQVQDNLIGTLEETLKIQEEGRSKRLQAEEEIRAMEDGLKAKLLDMKENQNRRS"
FT   gene            42184..43626
FT                   /gene="yaaO"
FT                   /locus_tag="BL02508"
FT   CDS_pept        42184..43626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BL02508"
FT                   /product="putative Orn/Lys/Arg decarboxylase, C-terminal
FT                   YaaO"
FT                   /function="Molecular Function: catalytic activity"
FT                   /note="probable lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21675"
FT                   /db_xref="GOA:Q62ZY3"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZY3"
FT                   /protein_id="AAU21675.1"
FT                   /translation="MKTPLYTALVNHAEGHHYSFHVPGHHNGDVFFDEAKTFFETILKV
FT                   DLTELTGLDDLHEPSGVIKEAQDLVSRLYGAEESFFLVNGSTVGNLAMILAVCQPGDTI
FT                   LVQRNCHKSVFHAIELSGAHPVFLTPEIDEAMAVPTHILYETVEDAISQYPHAKGIVLT
FT                   YPNYYGHAVDLKPIIEKAHQHDISVLVDEAHGAHFVLGHPFPQSSLKAGADAVVQSAHK
FT                   TLPAMTMGSYLHLNSGRINRDRLAYYLSVLQSSSPSYPIMASLDIARAYAEDILKTNRT
FT                   ADIEKELINMREVFSQINGADIVEPADARIRQDPLKLCIRSAYGHSGFELKSIFEANGI
FT                   HPELADERQVLLILPLEGKNMPAPELISTISKDMKDTAVRNDLPAGIGIPSEKVTALPY
FT                   RKSKLSAFKKESVPFTEAAGRISAESVTPYPPGIPLIMAGERITKETISRLTRLVDLNV
FT                   HIQGSNQLKQKQLTVYIEEEKS"
FT   gene            43623..44261
FT                   /gene="tmk"
FT                   /locus_tag="BL02509"
FT   CDS_pept        43623..44261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BL02509"
FT                   /product="thymidylate kinase"
FT                   /function="Molecular Function: thymidylate kinase activity,
FT                   Molecular Function: ATP binding, Biological Process: dTDP
FT                   biosynthesis, Biological Process: dTTP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21676"
FT                   /db_xref="GOA:Q65PJ3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PJ3"
FT                   /protein_id="AAU21676.1"
FT                   /translation="MNGLFITFEGPEGAGKTTILQAAADQLTKNGHSVLATREPGGIEI
FT                   SERIREVILNPSHTAMDPKTEALLYAAARRQHLVEKVKPALEEGKIVLCDRFIDSSLAY
FT                   QGYARGLGIDEVFSVNQFAIGSLMPNVTIYFDIDPEEGIKRIDLNDAREKNRLDLEKLH
FT                   FHQLVQKGYEEVMNRFPGRFRIVDASQSVELVLKRVNNIIEEALKENQL"
FT   gene            44337..44666
FT                   /gene="yaaQ"
FT                   /locus_tag="BL02510"
FT   CDS_pept        44337..44666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="BL02510"
FT                   /product="YaaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BL02510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21677"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ2"
FT                   /protein_id="AAU21677.1"
FT                   /translation="MKLIIAVVQDQDSNRLLKALTDHNFRVTKLASTGGFLKSGNTTFM
FT                   LGVDDIRVDKALSLIKENGSKRDQLIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPIE
FT                   QFHQF"
FT   gene            44678..45118
FT                   /gene="yaaR"
FT                   /locus_tag="BL05002"
FT   CDS_pept        44678..45118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BL05002"
FT                   /product="conserved hypothetical protein YaaR"
FT                   /db_xref="EnsemblGenomes-Gn:BL05002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21678"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ1"
FT                   /protein_id="AAU21678.2"
FT                   /translation="MKISQELRTMIEKQQTPPARGENVSASFKEKMNIQSGKLRVEQLT
FT                   MLLTDIEAFGKRLSKSRNFKDLARFKGLIKRFVKETVENGLTVENSRSFDLYGNSRTLS
FT                   IVKELDEKLVQLTEDLMDQEKSSIELLERIGEIKGLLINLYT"
FT   gene            45130..46119
FT                   /gene="holB"
FT                   /locus_tag="BL00541"
FT   CDS_pept        45130..46119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BL00541"
FT                   /product="DNA polymerase III (delta' subunit)"
FT                   /function="Molecular Function: DNA-directed DNA polymerase
FT                   activity, Biological Process: DNA replication, Molecular
FT                   Function: 3'-5'-exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21679"
FT                   /db_xref="GOA:Q65PJ0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PJ0"
FT                   /protein_id="AAU21679.1"
FT                   /translation="MATTWTEMQKLQPRVMKLLQNSIERNRLAHAYLFEGRKGTGKLDA
FT                   ATLLAKSFFCLEDGAEPCESCRNCQRIESGNHPDVHVVHPDGLSIKKGQIQALQEEFSK
FT                   TGLESHKKLYIISHADQMTVNAANSLLKFLEEPSSDTIAVLLTEQPQKLLDTIISRCQV
FT                   LSFQSLQPESIEKELVKQEVSPNIAALLSNMTNNLSEALELSRNDQFAESRAKVIKLYE
FT                   VLHQRKGHAFFYIQDQWMPFFKEKDHQEMGLDMLLFIYRDVLSIQLGHEDKILFQDLFQ
FT                   SLKQHALQTTQQRVTNQILAVLEAKKRLYSNVNAQGLMEHLVLMLQEG"
FT   gene            46122..46949
FT                   /gene="yaaT"
FT                   /locus_tag="BL00539"
FT   CDS_pept        46122..46949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="BL00539"
FT                   /product="putative signal peptidase II YaaT"
FT                   /note="involved in the transduction of signals to the
FT                   phosphorelay for initiation of sporulation, similar to
FT                   signal peptidase II, contains PSP1_C terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BL00539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21680"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI9"
FT                   /protein_id="AAU21680.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFQIDKDSCVIVETVRGVEYGQVV
FT                   IANKKVDENDVVLPLRKVIRVADERDRLIVEENQEAALSAFDVCQKKVNEHGLEMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEVIATSSGPAKVVGLNILERILQVELTDCDKVVEYTWDELLQEGVVSAQTTD"
FT   gene            46964..47326
FT                   /gene="yabA"
FT                   /locus_tag="BL00538"
FT   CDS_pept        46964..47326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BL00538"
FT                   /product="DnaA and DnaN interacting protein containing
FT                   domain DUF972-YabA"
FT                   /function="negatively regulates timing of replication
FT                   initiation"
FT                   /note="when level of YabA is reduced, replication begins at
FT                   a decreased cell mass and when level is increased,
FT                   initiation is delayed. YabA regulates initiation through
FT                   coupling with the elongation of replication."
FT                   /db_xref="EnsemblGenomes-Gn:BL00538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21681"
FT                   /db_xref="GOA:Q65PI8"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PI8"
FT                   /protein_id="AAU21681.1"
FT                   /translation="MDKKELFDTVISLEEQIGSLYRQLGDLKQHIGEMIEENNHLQLEN
FT                   EHLRKRLEETDQRLKSVKSDEKEIKAEKTGHADIGEGHDNLARLYQEGFHICNIHYGSV
FT                   RKEGDCLFCLSFLNKK"
FT   gene            47391..48134
FT                   /gene="yabB"
FT                   /locus_tag="BL00537"
FT   CDS_pept        47391..48134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="BL00537"
FT                   /product="conserved hypothetical protein containing SAM
FT                   (and some other nucleotide) binding motif YabB"
FT                   /function="Molecular Function:
FT                   S-adenosylmethionine-dependent methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21682"
FT                   /db_xref="GOA:Q65PI7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI7"
FT                   /protein_id="AAU21682.1"
FT                   /translation="MIQLKDDERLDYLLAEDMKIVQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGNIIDLCTGNGIVPLLLSTRTKAAITGVEIQERLYDMALRSVEYNNLQKQIHLIRDDL
FT                   KNMPQVLGYNKADVVTCNPPYFKTPQKTEQNLNEHLAIARHEIYCTLEDVIRVSSKLLK
FT                   QGGKLALVHRPGRLLEIFELMKAFQIEPKRVQFVYPKKSKEANTILVEGIKDGRPDLKI
FT                   LPPLFVYDEQDQYTHEIRKILYGDE"
FT   gene            48121..48414
FT                   /gene="yazA"
FT                   /locus_tag="BL00536"
FT   CDS_pept        48121..48414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BL00536"
FT                   /product="putative Excinuclease ABC, C subunit, N-terminal
FT                   YazA"
FT                   /function="Molecular Function: nuclease activity, Cellular
FT                   Component: intracellular, Biological Process: DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BL00536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21683"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PI6"
FT                   /protein_id="AAU21683.1"
FT                   /translation="METNSHYFYVLSCRDGSLYAGYTNNIEKRLKTHNDGKGAKYTRAR
FT                   LPVKLHYAECFSTKREAMQAEYYFKKLSRKNKERYIEEKRREGVDYQPAKEF"
FT   gene            48386..49264
FT                   /gene="yabC"
FT                   /locus_tag="BL00535"
FT   CDS_pept        48386..49264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="BL00535"
FT                   /product="putative methyltransferase YabC containing domain
FT                   UPF0011"
FT                   /function="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21684"
FT                   /db_xref="GOA:Q62ZX4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZX4"
FT                   /protein_id="AAU21684.2"
FT                   /translation="MIINRQKSFDQKSDMGMLYLVPTPIGNLEDMTFRAVSVLKEADII
FT                   AAEDTRQTKKLCHVYEIETQLVSYHEHNKESSGHKILEWLKEGKNVALVSDAGMPTISD
FT                   PGAEIVRDFIEMGGYVVPLPGANAALTALIASGIAPQPFFFFGFLDRSKRERKKQLEAL
FT                   KNRQETMIFYESPHRLKETLAAIREVFGNRQIALTRELTKKFEEFIRGSIEEALTWSEQ
FT                   EQVRGEFCLVIEGSREETIEEAVWWEHLSEKEHVEHYISEGYPSKEAIKKTAVDRGVPK
FT                   RKIYDAYHIQN"
FT   gene            complement(49313..49597)
FT                   /gene="abrB"
FT                   /locus_tag="BL00502"
FT   CDS_pept        complement(49313..49597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BL00502"
FT                   /product="transcriptional regulator AbrB"
FT                   /function="regulation of transition state genes (negative
FT                   regulation of abrB, aprE, ftsAZ, kinC, motAB, nprE, pbpE,
FT                   rbs, spo0H, spoVG, spo0E, tycA, sbo-alb, yqxM-sipW-tasA
FT                   positive regulation of comK, hpr)"
FT                   /db_xref="EnsemblGenomes-Gn:BL00502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21685"
FT                   /db_xref="GOA:Q65PI4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI4"
FT                   /protein_id="AAU21685.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDDNLKLAGGKLVLSPEGAEQIINEIQAQLQSQK"
FT   gene            50111..52099
FT                   /gene="metS"
FT                   /locus_tag="BL00533"
FT   CDS_pept        50111..52099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BL00533"
FT                   /product="methionyl-tRNA synthetase MetS"
FT                   /function="Molecular Function: methionine-tRNA ligase
FT                   activity, Biological Process: methionyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21686"
FT                   /db_xref="GOA:Q65PI3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI3"
FT                   /protein_id="AAU21686.1"
FT                   /translation="MPQEKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFD
FT                   VRYLTGTDEHGQKIQQTAEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHK
FT                   KVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLAFYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPGNPKHVIYVWIDALFNYITALGFNTENDENYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMVNKYFDGRIQSYEGPVTAFDEP
FT                   LSSFSQKTIEAYEQAIENMEFSVALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKELQS
FT                   VMYHLAESLRITAVLLQPFLTQTPEKIFAQLGVTDASLKTWDSIQSFGQLKSVTVQKGE
FT                   PLFPRLEAEDEVAYIKSKMQGTAPKEEPKQEEKAHERLPEITIDDFMSTELRVAEVIHA
FT                   EPVKKADRLLKLQLDLGFEKRQVVSGIAKHYKPEELVGRKVICVTNLKPVKLRGELSQG
FT                   MILAGEDNGVLSLAAVDSSLANGTRIK"
FT   gene            52184..52951
FT                   /gene="yabD"
FT                   /locus_tag="BL00532"
FT   CDS_pept        52184..52951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="BL00532"
FT                   /product="putative TatD-related deoxyribonuclease YabD"
FT                   /db_xref="EnsemblGenomes-Gn:BL00532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21687"
FT                   /db_xref="GOA:Q65PI2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI2"
FT                   /protein_id="AAU21687.1"
FT                   /translation="MLFDTHAHLNAEQFNEDLEEVIARAKEEKVEHIVVVGFDRPTIKR
FT                   AMELIEEYDFIYAAIGWHPVDAIDMTDEDLAWIKDLSAHEKVVAIGEMGLDYHWDKSPK
FT                   DVQKEVFRKQIALAKEVGLPIVIHNRDATEDVVSILREEGAEEVGGIMHCYTGSAEIAQ
FT                   ECIDMNFYLSFGGPVTFKNAKKPKEVVKQIPNDRLLIETDCPYLTPHPYRGKRNEPSYV
FT                   KLVAEQIAELKGMTYEEIAAVTTENAKKLFGIS"
FT   gene            53068..54393
FT                   /gene="yabE"
FT                   /locus_tag="BL00531"
FT   CDS_pept        53068..54393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BL00531"
FT                   /product="conserved hypothetical containing domain DUF348
FT                   YabE"
FT                   /note="MineBlast: resuscitation promoting factor"
FT                   /db_xref="EnsemblGenomes-Gn:BL00531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21688"
FT                   /db_xref="GOA:Q65PI1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI1"
FT                   /protein_id="AAU21688.2"
FT                   /translation="MRWFSHNKRDGGLAEKIERRVDRLVDTLYNLPEEKEAFFIIQKMK
FT                   KLFSVKLSKSRWILIAAGLLVAGSGTAYGAHELAKQQVTISINGKKQDVRTNAKTVGEL
FT                   LKSLDIETRKEDHISPAEDTKLTANMNVEYVAAKPVHFTVDGQEKEIWTTAGTVGKLLK
FT                   DLNLELAEHDQIDPSVDKEITKDMKLTLQRAFKVTVKDAGKDKDLWTTSTTVADFLKHH
FT                   KISIKGDDEVKPALDKKLTKDQAIHITRIKKVTDVVEENIPFEVRKKEDDSLEKGKEKV
FT                   VQDGKHGKLKKHYAVVMKNGKEVSRELIKEETAAESKAKIIAVGTKQAAVAKVSANVSR
FT                   GNQSSGKEFYVSSTAYTASCNGCSGHTATGVNLKNNPGAKVIAVDPSVIPLGSKVHVEG
FT                   YGYAVAADTGSAIKGRKIDVFFPNKSTAYRWGNKRVKIKVLN"
FT   gene            54561..55121
FT                   /gene="rnmV"
FT                   /locus_tag="BL00530"
FT   CDS_pept        54561..55121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BL00530"
FT                   /product="ribonuclease M5"
FT                   /function="5S ribosomal RNA maturation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21689"
FT                   /db_xref="GOA:Q65PI0"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PI0"
FT                   /protein_id="AAU21689.1"
FT                   /translation="MKIKEIIVVEGRDDTAKIKSAVDADTIETNGSAIGEDVIKRIRLA
FT                   QETRGVIILTDPDFPGEKIRKTIAEKVPGCKHAFLPKHLAKPKNKRGIGVEHASLEAIR
FT                   ECLMTVQEEMEATEPEIEARDLIEAGLIGGPLAKQRRERLGEILNIGYTNGKQLQKRLQ
FT                   MFQIKKSDYLSALDAVLREEEHE"
FT   gene            55114..55992
FT                   /gene="ksgA"
FT                   /locus_tag="BL00529"
FT   CDS_pept        55114..55992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BL00529"
FT                   /product="dimethyladenosine transferase"
FT                   /function="high level kasugamycin resistance, Molecular
FT                   Function: rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21690"
FT                   /db_xref="GOA:Q65PH9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH9"
FT                   /protein_id="AAU21690.1"
FT                   /translation="MNKDIATPIRTKEILNKYGFSFKKSLGQNFLIDTNILDRIVDHAG
FT                   VTERTGVIEIGPGIGALTEQLAKRAKKVTAFEIDQRLLPILEDTLSPYDNVTVIHQDVL
FT                   KADVRAVMDEQFQDCDEVMVVANLPYYVTTPIIMKLLEENLPLKGIVVMLQKEVADRMA
FT                   AKPSSKEYGSLSIAVQFYTEAKTVMNVPKTVFVPQPNVDSAVIRLTLRKEPAVAVQDAA
FT                   FFFQVVKASFAQRRKTLFNNLVNNLPNGKENKSKIERALQDSHIDGKRRGESLSIEEFA
FT                   VLSDRLREVLL"
FT   gene            56152..57033
FT                   /gene="yabG"
FT                   /locus_tag="BL00528"
FT   CDS_pept        56152..57033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="BL00528"
FT                   /product="spore coat assembly Peptidase U57, YabG"
FT                   /function="sporulation-specific protease involved in the
FT                   proteolysis and maturation of spore coat proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BL00528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21691"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A5"
FT                   /protein_id="AAU21691.2"
FT                   /translation="MQFKIGDMVVRKSYRRDILFRIIRIDQSANGEPVAVLHGDEVRLI
FT                   ADAHLGDLEIVREAEWQMRKREEETRMKESLDLLRQDYKLLHDKHEYRATNQYNNQQQY
FT                   FHMPGRVLHLDGDSAYLKKCLALYEKIGVPVYGIHCYEKKMSSVIEELIDEYRPDLLVI
FT                   TGHDAYSKQKGDINNLDAYRHSKDFIETVQKARRKIPHLDQLVIFAGACQSHFESLIRA
FT                   GANFASSPSRVNIHALDPVYIVAKISFTPFMDRINVWEVLRNTLTREKGLGGIETRGVL
FT                   RIGMPYKTKAND"
FT   gene            57258..57518
FT                   /gene="veg"
FT                   /locus_tag="BL00527"
FT   CDS_pept        57258..57518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BL00527"
FT                   /product="Veg"
FT                   /db_xref="EnsemblGenomes-Gn:BL00527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21692"
FT                   /db_xref="GOA:Q65PH7"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PH7"
FT                   /protein_id="AAU21692.1"
FT                   /translation="MAKTLSDIKRSLDGHLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELRFSDDKTSSVAL"
FT   gene            57675..57860
FT                   /gene="sspF"
FT                   /locus_tag="BL00526"
FT   CDS_pept        57675..57860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BL00526"
FT                   /product="small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /function="Molecular Function: double-stranded DNA binding,
FT                   Biological Process: DNA topological change"
FT                   /db_xref="EnsemblGenomes-Gn:BL00526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21693"
FT                   /db_xref="GOA:Q65PH6"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PH6"
FT                   /protein_id="AAU21693.1"
FT                   /translation="MGRRRSIMSEEFKNELAKDLGFYDTVKTEGWGGIRARDAGNMVKR
FT                   AIELAEQHMAQNQQNH"
FT   gene            58158..59027
FT                   /gene="ispE"
FT                   /locus_tag="BL00525"
FT   CDS_pept        58158..59027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BL00525"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /function="Molecular Function:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase activity,
FT                   Biological Process: terpenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21694"
FT                   /db_xref="GOA:Q65PH5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH5"
FT                   /protein_id="AAU21694.2"
FT                   /translation="MRILEKAPAKINLSLDVRHKRPDGYHEVEMVMTTIDLADRVELTE
FT                   LAEDKVTVSSHNRFVPDDQRNLAYQAAMLMKERYGIKKGVSIFITKVIPVAAGLAGGSS
FT                   DAAAVFRGLNRLWDLKLSMNELAELGAEIGSDVSFCVHGGTALATGRGEKIRHIETPPH
FT                   CWVVLAKPTIGVSTAEVYKQLKVDEIEHPDVQGMIAAIEEKNFQKMCDKLGNVLESVTL
FT                   NMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNELD"
FT   gene            59084..59917
FT                   /gene="purR"
FT                   /locus_tag="BL00523"
FT   CDS_pept        59084..59917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BL00523"
FT                   /product="transcriptional regulator"
FT                   /function="negative regulation of the purine operons
FT                   (purEKBCLQFMNHD, purA)"
FT                   /db_xref="EnsemblGenomes-Gn:BL00523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21695"
FT                   /db_xref="GOA:Q65PH4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PH4"
FT                   /protein_id="AAU21695.1"
FT                   /translation="MKFRRSGRLVDLTNYLLTHPHVLVPLTFFSERYQSAKSSISEDLT
FT                   IIKQTFEQQGIGTLQTVPGAAGGVKYIPKVKRDEAEEFVKSLGESLIDSERILPGGYLY
FT                   LTDILGKPSVLTKAGKIFASAFSDREIDVVMTVATKGIPLAYAVASYLDVPTVVVRKDN
FT                   KVTEGSTVSINYVSGSSNRIQTMSLAKRSLQTGSHVLIIDDFMKAGGTINGMINLLDEF
FT                   NAHVAGIGVLVEAQGVKERLVDEYMSLLTLSEIDMKEKKVEIQNGNFQRFFAENE"
FT   gene            59935..60312
FT                   /gene="yabJ"
FT                   /locus_tag="BL00522"
FT   CDS_pept        59935..60312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="BL00522"
FT                   /product="putative regulator of purine operon, putative
FT                   translation initiation inhibitor"
FT                   /function="regulation of purine operon"
FT                   /note="YjgF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21696"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PH3"
FT                   /protein_id="AAU21696.1"
FT                   /translation="MTKVVQTKEAPAAIGPYSQGIVVNNMFYSSGQIPLTPSGEMVTGD
FT                   ITEQTHQVFRNLKAVLKEAGASLETVVKATVFLADMNQFTEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
FT   gene            60492..60785
FT                   /gene="spoVG"
FT                   /locus_tag="BL00521"
FT   CDS_pept        60492..60785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BL00521"
FT                   /product="Stage V sporulation protein G"
FT                   /function="required for spore cortex synthesis, Biological
FT                   Process: sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21697"
FT                   /db_xref="GOA:Q65PH2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH2"
FT                   /protein_id="AAU21697.1"
FT                   /translation="MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSSTRGKIQDAVLNEYHRLGDVEEIEYEEIGAS"
FT   gene            61090..62460
FT                   /gene="gcaD"
FT                   /locus_tag="BL00520"
FT   CDS_pept        61090..62460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BL00520"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /function="Molecular Function: UDP-N-acetylglucosamine
FT                   diphosphorylase activity, Biological Process:
FT                   lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21698"
FT                   /db_xref="GOA:Q65PH1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH1"
FT                   /protein_id="AAU21698.1"
FT                   /translation="MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLS
FT                   LEKLVTIVGHGAEDVKKQLGEKSEYALQAEQLGTAHAVKQAKSILGSEKGTTIVICGDT
FT                   PLLTAETMEAMLTEHQKKAAKVTILTAVAEDPTGYGRIIRNENGDVAKIVEHKDATEEE
FT                   RLVKEINTGTYCFDNEALFQTIEQVSNDNVQGEYYLPDVIEILKNQGETVAAYQTVNFQ
FT                   ETLGVNDRVALSQAEIYMKQRINKRHMQNGVSLIDPDNTYISPEAVIGRDTVIYPGTVI
FT                   KGRVVIGEDAVIGQNSELENSTVGSRTVIKQSVIVDSEVGDDVTIGPFAHIRPDSKIGN
FT                   EVRIGNFVEVKKSEFGDRSKASHLSYIGDAEIGTDVNLGCGSITVNYDGKHKFKTKIEN
FT                   GAFIGCNSNLVAPVTIGEGAYVAAGSTITDDVPGRALSIARARQVNKEDYAENIHKK"
FT   gene            62481..63431
FT                   /gene="prs"
FT                   /locus_tag="BL00519"
FT   CDS_pept        62481..63431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BL00519"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /function="Molecular Function: ribose-phosphate
FT                   diphosphokinase activity, Biological Process: nucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21699"
FT                   /db_xref="GOA:Q65PH0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PH0"
FT                   /protein_id="AAU21699.1"
FT                   /translation="MSKYEDDNLKIFSLNSNPGLAKEIADIVGVELGKSSVKRFSDGEV
FT                   QINIEESIRGCDCYVIQSTSAPVNEHIMELLIMVDALKRASAKTINIVMPYYGYARQDR
FT                   KARSREPITAKLVANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGNYFEEK
FT                   NFKDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPKPNVAEVMNIIGHIEGKTAILI
FT                   DDIIDTAGTITLAANALVESGAEEVYACCTHPVLSGPAIERIDNSKIKELVVTNSIELP
FT                   EEKKIAKFKQLSVAPLLAEAIIRVHEKQSVSFLFD"
FT   gene            63512..64138
FT                   /gene="ctc"
FT                   /locus_tag="BL00518"
FT   CDS_pept        63512..64138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BL00518"
FT                   /product="general stress protein"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis, Molecular Function: 5S rRNA binding (GO:"
FT                   /db_xref="EnsemblGenomes-Gn:BL00518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21700"
FT                   /db_xref="GOA:Q65PG9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PG9"
FT                   /protein_id="AAU21700.1"
FT                   /translation="MAILKAEERTDSRRSSLRRIRQSGYVPGVIYGRNLENKSVALDSI
FT                   ELLKILRAEGKNTIINLDINGDQHSVMVTELQTDPLKDSIVHADFKVVDMEAEMEATVP
FT                   VNLTGEAEGIKQGGVLQQPLYELSVTAKPKNIPQTIEVDISSLEVNDVLTVGDIPTKGD
FT                   YSYNHEPDEVVASILPPQKQEETEAESAAQDVEEPEKGTEEEKEE"
FT   gene            64255..64821
FT                   /gene="spoVC"
FT                   /locus_tag="BL00517"
FT   CDS_pept        64255..64821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BL00517"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="Molecular Function: aminoacyl-tRNA hydrolase
FT                   activity, Biological Process: protein biosynthesis"
FT                   /note="stage V sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21701"
FT                   /db_xref="GOA:Q65PG8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PG8"
FT                   /protein_id="AAU21701.1"
FT                   /translation="MLVFAGLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQ
FT                   YGIGFVSGKKVLLVKPLTYMNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRT
FT                   KGSAGGHNGIKSTIQHLGTSEFNRIRIGIGRPVNGMKVVDYVLGAFTDEEEPAIKEAVR
FT                   QSAKACEASLEKPFLEVMNEFNAKV"
FT   gene            64878..65108
FT                   /gene="yabK"
FT                   /locus_tag="BL00516"
FT   CDS_pept        64878..65108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="BL00516"
FT                   /product="conserved hypothetical YabK"
FT                   /db_xref="EnsemblGenomes-Gn:BL00516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21702"
FT                   /db_xref="GOA:Q65PG7"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG7"
FT                   /protein_id="AAU21702.1"
FT                   /translation="MALHYYCRHCGVKVGSLDHSYVNSEQLGFNHLTNDERNDMISYMD
FT                   NGDLHVKTICEDCQEALERNPDYHQYHSFIQ"
FT   gene            65173..68706
FT                   /gene="mfd"
FT                   /locus_tag="BL00515"
FT   CDS_pept        65173..68706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BL00515"
FT                   /product="transcription-repair coupling factor"
FT                   /function="promotes strand-specific DNA repair by
FT                   displacing RNA polymerase stalled at a nucleotide lesion
FT                   and directing the (A)BC excinuclease to the RNA damage
FT                   site, Molecular Function: damaged DNA binding, Biological
FT                   Process: DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BL00515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21703"
FT                   /db_xref="GOA:Q65PG6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG6"
FT                   /protein_id="AAU21703.1"
FT                   /translation="MNNIQSYITKSDDFKSIVNGLNEGLKEQLLAGLSGSARSLFTAAL
FT                   TKETRRPVFLITHNLYQAQKITDDLTGLIKDQPVLLYPVNELISSEIAVASPELRSQRL
FT                   DVLNRLASGETPIVVAPAAAVRRMLPPVEVWQNSQIHIETGRDIDTEQLLQKLVQMGYE
FT                   RTDMVAAPGEFSIRGGIIDVYSLTEENPVRIELFDTEVDSIRIFNTDDQRSLETRDEVT
FT                   IGPAKELIVRDEDRQRALEQIDQGLANSLKKLKLDKQKEILDQNIAEDKERLKEGHIGQ
FT                   EMVKYLSYFYEKPASLLDYFPKNTLLILDEISRIHEMEDQLQKEEAEWITSLLEEGKIL
FT                   HDTSMSFPFHSLISKQSRPILYYSLFLRHVQHTSPQNIVNVSSKQMQSFHGQMNVLKNE
FT                   IERFKKSKYTTVFLGDSKERVEKLASVLSDYDIEAAQADQDAALAQGQIYIMEGGLQSG
FT                   FELPMIKLAVITEEELFKKRVKKQARKQKLTNAERIKSYSELQIGDYVVHVNHGIGKYL
FT                   GIETLEINGIHKDYLNIHYQGSDKLYVPVDQIDQVQKYVGSEGKEPKLYKLGGSEWKRV
FT                   KKKVESSVQDIADDLIKLYAEREASKGYAFSPDHEMQREFEAAFPYQETEDQLRSIHEI
FT                   KRDMEKERPMDRLLCGDVGYGKTEVAIRAAFKAIADGKQVAILVPTTILAQQHYETILE
FT                   RFQDYPINIGLLSRFRTRKEANETIKGLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDE
FT                   EQRFGVTHKEKIKRIKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNGALVREAIERELARGGQVYFLYNRVEDIERKAEEISMLVPDAKVTYAHGKMTEN
FT                   ELESVMLNFLEGESDVLVSTTIIETGVDIPNVNTLIVFDADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGF
FT                   IDSVGFDLYSQMLKEAIEARKGDAPQAEKFEPEIDLELDAYIPQTYVTDGKQKIDMYKR
FT                   FRAISTIEEKSELQDEMIDRFGEYPKEVEYLFAIAEAKVYAIKERVELIKQDKDAVRLT
FT                   IDEKASAEIDGQKLFELGSKYGRQIGLGMEGKKLKISIQVKNRKPEEWLETLLDILKGL
FT                   QNVKKQTIASS"
FT   gene            68844..69380
FT                   /gene="spoVT"
FT                   /locus_tag="BL00514"
FT   CDS_pept        68844..69380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BL00514"
FT                   /product="transcriptional regulator"
FT                   /function="positive and negative regulation of
FT                   sigma-G-dependent genes"
FT                   /db_xref="EnsemblGenomes-Gn:BL00514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21704"
FT                   /db_xref="GOA:Q65PG5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG5"
FT                   /protein_id="AAU21704.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSMGHSVLICDRDVYIAVSGGSKKDYLNKSISDMVEK
FT                   AMDQRTSVLDGDAKTIQLIDGIDEEVASYTVGPIVANGDPIGAVVIFSKDQSIGEVEHK
FT                   AVETAAGFLARQMEQ"
FT   gene            69594..71186
FT                   /gene="yabM"
FT                   /locus_tag="BL00513"
FT   CDS_pept        69594..71186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="BL00513"
FT                   /product="putative Polysaccharide biosynthesis protein
FT                   YabM"
FT                   /function="Biological Process: polysaccharide biosynthesis,
FT                   Cellular Component: membrane"
FT                   /note="possible polysaccharide transporter, similar to
FT                   spoVB"
FT                   /db_xref="EnsemblGenomes-Gn:BL00513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21705"
FT                   /db_xref="GOA:Q65PG4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG4"
FT                   /protein_id="AAU21705.1"
FT                   /translation="MGFLKGQRQLLWQGAFVLSLAGILSKILSAVYRVPFQNIVGDVGF
FT                   YIFQQVYPMIGISVMLATSGFPVIISKLLNDYGSANRAKILRVSMLFLSAVGLGFFLLL
FT                   FAGAGAIAGFMGDPDLAGVIRAVSFSYLLLPFVSLLRGYFQGSERMLPTALSQIGEQTL
FT                   RVGAILVLTWWLVKSGFSLYDAGAGAAFGSLVGGLAAFFILAVFWAKREKKATAARMEA
FT                   GTGDILKQLCLYSVTICTAGLMLILIQLVDALHLYSLLAGQGMGELQAKHTKGVYDRGQ
FT                   PLLQLGTVFAASIATALVPSLTKAKKKGETAVLEEKIRYSLKMSFVIGTGAAAGLICIL
FT                   EPVNVMLFKNSDGTAALQIFSASILFASLAMTMTAVLQGLGNTCLPAVSVCCGFLVKAV
FT                   LNELLIPGFGISGAAFATMMSFAAVAGLNFFQLKRKGWIKLSEYRIAGVLLSAVIMSAA
FT                   LAVWLFAFEAAIPHKSRWISAAESLSAVFVGGVVFLSGIFTLRVFSEKELELVPFGSKL
FT                   LTLKRERGGRHGR"
FT   gene            71176..72645
FT                   /gene="yabN"
FT                   /locus_tag="BL00512"
FT   CDS_pept        71176..72645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BL00512"
FT                   /product="putative phosphatase and methylase"
FT                   /note="putative phosphatase and methylase similar to MazG"
FT                   /db_xref="EnsemblGenomes-Gn:BL00512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21706"
FT                   /db_xref="GOA:Q65PG3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG3"
FT                   /protein_id="AAU21706.1"
FT                   /translation="MAGKITVVGLGAGDMNQLTLGVYKRLTQAEVLYVRTKDHPLIEDL
FT                   KKEIAEIHFFDEVYEKHDQFEDVYEEIVERLFEEAKQGDVLYAVPGHPFVAEKTVQLLL
FT                   ERRGAHQADVVVEGGHSFIDATLNALQIDPIDGFQFVDAVRFSADEVELRHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSSMQDIRTVPLYELDRSVGINNLTSVYVPP
FT                   VKDEEILHQEFSMFRSVIRKLRGPDGCPWDRKQTHESLKKYLIEECYEVLEAIDEEDPD
FT                   HLVEELGDVMLQVLLHAQIGEDDGLFTIDDVIRGITAKMIRRHPHVFGEVSVRDEADVM
FT                   VNWEEIKKQEKQADDKSLLDDIPKPLPALSKANKLQKKAAKTGFDWSNVQDIWDKVQEE
FT                   MKEFSSEISEAEQHSKKMKEEFGDLLFALVNIGRFYKIEPEEALAMTNAKFYRRFTYIE
FT                   QSAKRMGKDLESMTLEEMDELWNEAKGIERS"
FT   gene            72652..72915
FT                   /gene="yabO"
FT                   /locus_tag="BL00511"
FT   CDS_pept        72652..72915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="BL00511"
FT                   /product="putative RNA-binding S4 protein YabO"
FT                   /function="Molecular Function: RNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL00511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21707"
FT                   /db_xref="GOA:Q65PG2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG2"
FT                   /protein_id="AAU21707.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQQAKASSVVKAGD
FT                   ELAVRFGQKLVTVKVNELKDTTKKEEAADMYTVLKEEKLGGE"
FT   gene            72992..73300
FT                   /gene="yabP"
FT                   /locus_tag="BL00510"
FT   CDS_pept        72992..73300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BL00510"
FT                   /product="conserved hypothetical protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:BL00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21708"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG1"
FT                   /protein_id="AAU21708.1"
FT                   /translation="MNVYYDQHNPSGGASGPEHNVTMKGRKLLDISGVKQVESFDNEEF
FT                   LLETVMGMLAVRGENLQMKNLDVEKGVVSIKGRVLDLVYLDEQQGEKAKGFFSKLFK"
FT   gene            73297..73923
FT                   /gene="yabQ"
FT                   /locus_tag="BL00509"
FT   CDS_pept        73297..73923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BL00509"
FT                   /product="essential protein for formation of the spore
FT                   cortex YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:BL00509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21709"
FT                   /db_xref="GOA:Q65PG0"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PG0"
FT                   /protein_id="AAU21709.1"
FT                   /translation="MTLTTQFYTMLAMAGMGAWLGASLDTYTRFVVRSKTARWLLFLHD
FT                   FLFWVVQGLLFFYVLLSVNEGEFRIYIFLAVMLGFAAYQSLFKQVYIKLLEWMISFFIF
FT                   ISRLVSKMMRMMVFRPVVWTFQAILAIILFTMRNIYVLFRFFAVCLYKILKFAGYPIYF
FT                   ILYQCCRLLPAPVRGLLRRFLQKGAGFFEKGKKLFITIKAKLLKK"
FT   gene            73940..74317
FT                   /gene="divIC"
FT                   /locus_tag="BL00508"
FT   CDS_pept        73940..74317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BL00508"
FT                   /product="cell-division initiation protein"
FT                   /function="required for both vegetative and sporulation
FT                   septum formation, Biological Process: cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:BL00508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21710"
FT                   /db_xref="GOA:Q65PF9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF9"
FT                   /protein_id="AAU21710.1"
FT                   /translation="MNDPTRRNISQIQNEYKEQMERKQQQLKRKRRGLYRRLMVFGAVV
FT                   LLSAIVIVSSLWSQTSDISAKQEKKAELLKQLEQLEAKKSDLKDEIVKLKDEDYVAELA
FT                   RKDYYLSKDGEIIFKFEDKSK"
FT   gene            74397..74795
FT                   /gene="yabR"
FT                   /locus_tag="BL00507"
FT   CDS_pept        74397..74795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BL00507"
FT                   /product="putative Nucleic acid-binding OB-fold
FT                   protein,contains S1 domain"
FT                   /function="Molecular Function: nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL00507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21711"
FT                   /db_xref="GOA:Q65PF8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF8"
FT                   /protein_id="AAU21711.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAVDRPQSSRPARPKNDFRSKETFEQKMNK
FT                   FLKDSEDRLSSLKRNTESKRGGRGARRG"
FT   gene            74946..75019
FT                   /locus_tag="BL_trna_0006"
FT   tRNA            74946..75019
FT                   /locus_tag="BL_trna_0006"
FT                   /product="tRNA-Met"
FT   gene            75030..75101
FT                   /locus_tag="BL_trna_0007"
FT   tRNA            75030..75101
FT                   /locus_tag="BL_trna_0007"
FT                   /product="tRNA-Glu"
FT   gene            75311..77800
FT                   /gene="spoIIE"
FT                   /locus_tag="BL00506"
FT   CDS_pept        75311..77800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BL00506"
FT                   /product="serine phosphatase"
FT                   /function="dephosphorylates SpoIIAA-P and overcomes
FT                   SpoIIAB-mediated inhibition of sigma-F required for normal
FT                   formation of the asymmetric septum, Molecular Function:
FT                   catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21712"
FT                   /db_xref="GOA:Q65PF7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF7"
FT                   /protein_id="AAU21712.1"
FT                   /translation="MEKAERRVNSPIAGPAVQKLYSWFGSMTKLMMQHLYSLFFYKGLI
FT                   YMVIGFLLGRAFILSEVIPFALPFFGAMLLIKKDKAFLACLALLAGALSISPQHSLFVL
FT                   AALFAFAICSKMTSLIIKDRVRTLPVVVFLAMAVTRCGFVYAEYGTVSGYHYIMAFVEA
FT                   GLSFILTLIFLQSLPIVTSKRAKQSLKIEEIICFMILIASVLTGLTGVSFQGMQAELIL
FT                   ARYVVLAFAFIGGASIGCTVGVVTGLILSLSNIGNLYQMSLLAFSGLLGGLLKEGKKFG
FT                   AAVGLLIGSLLISLYGEGSAELVPTLYESLIAIGLFLLTPQSITKKVAKYIPGTTEHAQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYHSAPDDEGKEKEIDLFLSTVTEHS
FT                   CQSCYKKNKCWVQNFDKTYDLMKRVMQETEEKQYFKNRKLKKEFHQHCSKSKQVEALIE
FT                   DELTHFRANQTLKQKVHDSRRLVAEQLLGVSQVMADFSREIKREREQHFIQEEQIRDAL
FT                   QHFGIEIQQVEIYSLEQGNIDIEMSIPYCNGHGECEKIIAPMLSDILEEQIIVKAEQCA
FT                   GHPNGYCHVAFGSAKSYRVVTGAAHAAKGGGLVSGDSYNMMELGTGKYAAAISDGMGNG
FT                   ARAHFESNETIKLLEKILQSGIDEKVAIKTINSILSLRTTDEIYSTLDLSVIDLQDASC
FT                   KFLKIGSTPSFIKRGDQIIKVQASNLPIGIITEFDVDVVSEQLKAGDLLIMMSDGIFEG
FT                   PRHVENHDLWMKRKLKSLKTEEPQEIADLIMEEVIRTRSGLIEDDMTVIVIKLDHNTPK
FT                   WASIPAPAFFQKNQEIS"
FT   gene            77877..78614
FT                   /gene="yabS"
FT                   /locus_tag="BL00505"
FT   CDS_pept        77877..78614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BL00505"
FT                   /product="YabS"
FT                   /note="conserved hypothetical containing domain similar to
FT                   von Willebrand factor,type A"
FT                   /db_xref="EnsemblGenomes-Gn:BL00505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21713"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF6"
FT                   /protein_id="AAU21713.1"
FT                   /translation="MKKGHLNQILLLTDGCSNRGEDPQAMAAFAKEQGITVNVIGIMDE
FT                   HEMDQEAMKEVEGIALAGGGVHQVVYTSQLSQTVQMVTKKAMTQTLQGVVNSELKQILG
FT                   KHTEMDELPPDKRGEVMEVVDELGETVHLHVLVLVDTSASMNPKLPTVKEALIDLSISL
FT                   NSRIGENEFAMLIFPGKKQEVELVLDWTPKFESLSSIFSKLSAGGITPTGPAIREAIQH
FT                   FNKIGSRRRMLEDDEKRFDEFGG"
FT   gene            78583..79617
FT                   /gene="yabT"
FT                   /locus_tag="BL00504"
FT   CDS_pept        78583..79617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="BL00504"
FT                   /product="putative serine/threonine-protein kinase"
FT                   /function="Molecular Function: protein kinase activity,
FT                   Biological Process: protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00504"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21714"
FT                   /db_xref="GOA:Q65PF5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF5"
FT                   /protein_id="AAU21714.1"
FT                   /translation="MKNASTSLAASLKPGAAVVGKWNNHSYKIIRQLGKGANGVVYLAD
FT                   SRKGRVALKVSDDSLSITSEVNVLKSFSKAQAKAMGPSFFDVDDMMVTGTGKKLSFYVM
FT                   EYIEGPLLLRYVNEKGEEWTPVLISQLLSSLSAIHREGWVFGDLKPENLIVTGPPPQIR
FT                   CIDVGGTTKEGRAIKEYTEFFDRGYWEFGTRKAEPSYDLFSVAMIMVNCAVKKEFKKTA
FT                   RPQEQLMSVIDGHPFLKRYKPVLASALKGSYRTADEMKGDLLEIGRPPRMQSSRQSRTA
FT                   RSSSASAPSQGLRHKRGTPQQQRLRSGRRKQRNPSKSGGVFETLLIVVSVLALYFAYIV
FT                   LFFI"
FT   gene            79720..81150
FT                   /gene="tilS"
FT                   /locus_tag="BL00503"
FT   CDS_pept        79720..81150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BL00503"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /function="RNA-modifying enzyme that governs both the codon
FT                   and amino acid specificities of isoleucine tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:BL00503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21715"
FT                   /db_xref="GOA:Q65PF4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF4"
FT                   /protein_id="AAU21715.1"
FT                   /translation="MKSIEDFMKKYELSFDGVTLIAGVSGGPDSMALLHALHHTVPASA
FT                   TLIAAHVDHMFRGEESERDMRFVQDYCEAEGIQCEAVQIDVLAFAAENNLNKQAAAREC
FT                   RYAFFQELMKRHRAEYLVLGHHGDDQVETMLMKMAKGTVGIGLAGIQPKRRFDSGWLLR
FT                   PFLKLSKDDLLAYCKENRIPFRTDPSNSEDDYTRNRFRHHVLPFLKKESEDVHKRFQSV
FT                   SEFLTEDELYLQALTKDKMNTVITSKSSSGVEISIERLLALPMPLQRRGVHLILNYLYE
FT                   NVPSAFSAHHIQVFLDWISQDGPSGSLDFPNGLKVAKSYHTCLFTFQRLQCENVSYHYE
FT                   ISGAGEEELILPGGSSLHVSGPGSTRKLQGNDVFATSPKQVQFPLYVRTRQNGDRVKLK
FT                   GMNGSKKVKDIFIDEKVPLSKRDSWPIVTDAVGNIIWIPGLKKTIFEELDVTNNDRIVL
FT                   QYRQHEKCRGLAKNETGY"
FT   gene            81134..81673
FT                   /gene="hprT"
FT                   /locus_tag="BL05003"
FT   CDS_pept        81134..81673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BL05003"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /function="Molecular Function: hypoxanthine
FT                   phosphoribosyltransferase activity, Cellular Component:
FT                   cytoplasm, Biological Process: purine ribonucleoside
FT                   salvage"
FT                   /db_xref="EnsemblGenomes-Gn:BL05003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21716"
FT                   /db_xref="GOA:Q65PF3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF3"
FT                   /protein_id="AAU21716.1"
FT                   /translation="MKQDIENILISEEEIQKKVKELGATLTEEYSGKFPLAIGVLKGAM
FT                   PFMADLLKHIDTYLEMDFMDVSSYGSSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDSG
FT                   LTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADYVGFEVPDAFVVGYGLDYAERY
FT                   RNLPYIGVLKPAVYES"
FT   gene            81770..83689
FT                   /gene="ftsH"
FT                   /locus_tag="BL00852"
FT   CDS_pept        81770..83689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BL00852"
FT                   /product="cell-division protein and general stress protein
FT                   (class III heat-shock)"
FT                   /function="involved in major cellular processes such as
FT                   sporulation, stress adaptation and secretion, Molecular
FT                   Function: metalloendopeptidase activity, Cellular
FT                   Component: membrane, Biological Process: protein
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL00852"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21717"
FT                   /db_xref="GOA:Q65PF2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PF2"
FT                   /protein_id="AAU21717.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTANPKTENMTYSDFVSNLE
FT                   NGKVENVSIQPVRGVYEVRGQLTTYEKDQYFLTHVPEGKGADQIIDQVKKTKIQIEPAQ
FT                   EANGWMTFFTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVDFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVKGREAVL
FT                   QVHARNKPLDESVNLKAIAMRTPGFSGADLENLLNEAALVAARQDKKKIDMRDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEAGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PKEDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATGIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNDQNYSDAIAYEIDKEIQRFIKECYERAKTILTENR
FT                   DKLELIAQTLLEVETLDAEQIKHLSEHGRLPDRTYSDDQEKTDDVKVNINKRDDEEKNE
FT                   DEKE"
FT   gene            83892..84668
FT                   /gene="yacB"
FT                   /locus_tag="BL00853"
FT   CDS_pept        83892..84668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacB"
FT                   /locus_tag="BL00853"
FT                   /product="conserved hypothetical protein YacB"
FT                   /note="similar to Bordetella pertussis Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BL00853"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21718"
FT                   /db_xref="GOA:Q65PF1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF1"
FT                   /protein_id="AAU21718.2"
FT                   /translation="MLLVIDVGNTNTVLGIYHEGELEYHWRIETSRHKTEDEFGMLLRS
FT                   LFDYVGLMFDQIEGIIISSVVPPIMFSLERMCIKYFQIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGSPLIVVDFGTATTYCYINERKEYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEIARPDHIVGKSTVSAMQSGILYGYVGQVEGIVKRMKWQSKKNPKVIATGG
FT                   LASLIADESDCIDIVDPFLTLKGLELIYERNRVESV"
FT   gene            84680..85549
FT                   /gene="hslO"
FT                   /locus_tag="BL00854"
FT   CDS_pept        84680..85549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BL00854"
FT                   /product="putative chaperone protein HslO"
FT                   /function="Molecular Function: chaperone activity, Cellular
FT                   Component: cytoplasm, Biological Process: protein folding"
FT                   /note="similar to Hsp33 chaperon"
FT                   /db_xref="EnsemblGenomes-Gn:BL00854"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21719"
FT                   /db_xref="GOA:Q65PF0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF0"
FT                   /protein_id="AAU21719.1"
FT                   /translation="MDYLVKAIAYDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRT
FT                   MTAAVMLGAMLKGEDKLTVKIEGGGPIGAIVADGNAKGDVRGYVSNPHVHFDLNEHGKL
FT                   DVRRAVGTSGTLSVVKDLGLRDLFTGQVEIVSGEIGEDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNTILAAGGFILQLLPGTDDETITKLETNLSQVEPISKLIQKGLTPEEVLAAVLGEE
FT                   PEVLETVPVRFTCNCSKERFARGIIGLGKDEIQQMIDEDGQAEAQCHFCNETYLFTKEE
FT                   LEALRDEI"
FT   gene            85602..86492
FT                   /gene="yacD"
FT                   /locus_tag="BL00855"
FT   CDS_pept        85602..86492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BL00855"
FT                   /product="putative PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /function="Molecular Function: isomerase activity"
FT                   /note="pric/parvulin family of rotamase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00855"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21720"
FT                   /db_xref="GOA:Q65PE9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE9"
FT                   /protein_id="AAU21720.2"
FT                   /translation="MKSRTLWPIILGAIFVNCIVIAYVLTKAQTASSSSAQEVIAHIGK
FT                   NGITREEWLSEMEERYGKSTLEDMINDRVVTQMAEKNKIKVSDDDIEREFLLIKAVYNS
FT                   FYEDENTTEKEWKEQIKHNILLEELLTKDIVISDSELKSFYNKNKDLYKFDDSYRLKHI
FT                   VVKDKDEAEQVLKELKEGSSFEAAAAEHSTDRYTAPYGGDLGFVNDQHENVPAEYLEKA
FT                   EQLKENQWVDEPIKTSQGYAIIQLKEKLPGQAFTYSEVKNQIRRQIAMDQLGDKASVKT
FT                   LWKDAKLSWFYDDKK"
FT   gene            86568..87491
FT                   /gene="cysK"
FT                   /locus_tag="BL00857"
FT   CDS_pept        86568..87491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BL00857"
FT                   /product="cysteine synthetase A"
FT                   /function="Molecular Function: cysteine synthase activity,
FT                   Biological Process: cysteine biosynthesis from serine,
FT                   Molecular Function: cysteine synthase activity, Biological
FT                   Process: cysteine biosynthesis from serine"
FT                   /db_xref="EnsemblGenomes-Gn:BL00857"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21721"
FT                   /db_xref="GOA:Q65PE8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE8"
FT                   /protein_id="AAU21721.2"
FT                   /translation="MVRVANSVYDLIGNTPVVKLNRLVDEDSAEVYVKLEYMNPGSSVK
FT                   DRIALAMIEDAEEKGLLKEGDTLIEPTSGNTGIGLAMVAAAKGIKAILVMPDTMSSERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEEHGYFMPQQFNNPANAEVHRRTTGKEIA
FT                   EQFGDGLDAFIAGIGTGGTITGAGEVLKEKNPSIKIFAVEPTDSPVLSGGKPGPHKIQG
FT                   IGAGFVPKILNTEIYDEIITVKNEEAFEFARKAAREEGILGGISSGAAICAALQVAKKL
FT                   GKGKKVLAVLPSNGERYLSTPLYQFE"
FT   gene            87691..89121
FT                   /gene="pabB"
FT                   /locus_tag="BL00858"
FT   CDS_pept        87691..89121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BL00858"
FT                   /product="para-aminobenzoate synthase (subunit A)"
FT                   /function="Biological Process: biosynthesis, Molecular
FT                   Function: oxo-acid-lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00858"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21722"
FT                   /db_xref="GOA:Q62ZT6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZT6"
FT                   /protein_id="AAU21722.1"
FT                   /translation="MRQRRPVARAFPFSNQQFLQQYESLSKGKEYHVLLESARGGEYSI
FT                   AGLDPVAIAKGKDGITTIQYKGDVIFKEGDPFLQFSQWFETLKTETVADFPDFQGGAVG
FT                   FLSYDYARYIEKFKILSIDDLQTPDLFFLVFDDIAVYDHEQQQLWVITHTDEETPAAAE
FT                   EKLDRLEQMWKTEHPKAAGGHQPNDNKGPAFAASFTEAGFSQAVEKVKQYIASGDVFQV
FT                   NLSVRQSERLSAPPYEVYKMLREINPSPYMAYLETPDFQIICGSPELLIKKKGTRLETR
FT                   PIAGTRSRGADEAEDEALANELIMNEKERAEHVMLVDLERNDLGRVSKYGSVRVDEFMV
FT                   IEKYSHVMHIVSNVCGELRDECDAVDVIHAVFPGGTITGAPKVRTMEIIEELEPTRRGL
FT                   YTGSIGWFGYNQDMHFNIVIRTIYVKAGQAFMQSGAGIVIDSNPRHEYKESIKKALAMK
FT                   KALQLSEEEKKEQRRAEI"
FT   gene            89118..89702
FT                   /gene="pabA"
FT                   /locus_tag="BL00859"
FT   CDS_pept        89118..89702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BL00859"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase (subunit B) and anthranilate synthase
FT                   (subunit II)"
FT                   /function="Molecular Function: anthranilate synthase
FT                   activity, Biological Process: metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL00859"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21723"
FT                   /db_xref="GOA:Q65PE6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE6"
FT                   /protein_id="AAU21723.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDEITLQEIEDMSPD
FT                   FLMISPGPCSPDEAGISLEAIRHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SEISHDGLTVFKGLEHPLTATRYHSLIVKPDTLPDCFETSAWTEEGEIMAIRHKELPVE
FT                   GVQFHPESIMTAYGKEMLKNFIETYRKKVNA"
FT   gene            89699..90559
FT                   /gene="pabC"
FT                   /locus_tag="BL00860"
FT   CDS_pept        89699..90559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BL00860"
FT                   /product="aminodeoxychorismate lyase"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL00860"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21724"
FT                   /db_xref="GOA:Q65PE5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE5"
FT                   /protein_id="AAU21724.1"
FT                   /translation="MIIYLNGQYVKEEEARLSPFDHGFLYGVGVFETFRLYEGKPFLLD
FT                   WHMDRLNNALEQLKIELELTKSEVLVILDRLLQLNQPQNLDARVRLNISAGPGGPGLFP
FT                   DSYKNPGVMVMMNPFQPASVPAEKEGVILQVRRNTPEGPFRLKSHHFLNNLYGKRELGH
FT                   DAAKEGIFLTEGGAVAEGIISNVFWRKGSCVYTPSLDTGILGGVTRRYVIERLADMGIE
FT                   VIEGVYPLEELLFADEAWMTNSVQEIVPFRRIGSTEFPGKDGNLSKRLQEAYTNDRKAA
FT                   KEYLS"
FT   gene            90572..91429
FT                   /gene="sul"
FT                   /locus_tag="BL00861"
FT   CDS_pept        90572..91429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="BL00861"
FT                   /product="dihydropteroate synthase"
FT                   /function="Molecular Function: dihydropteroate synthase
FT                   activity, Biological Process: folic acid and derivative
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00861"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21725"
FT                   /db_xref="GOA:Q65PE4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE4"
FT                   /protein_id="AAU21725.1"
FT                   /translation="MALQTAVRSKQLIAKQYTLSYEDKTLIMGILNVTPDSFSDGGKYN
FT                   SIDRAVIHAKQMIEDGAHILDIGGESTRPGAEKVSLDEELSRVIPVIEKLVQEIDVPIS
FT                   VDTYKAQVADEAIKAGAAIINDVWGAKADPDMARVAAAHNVPIILMHNREERNYKDLIP
FT                   DMLSDLMECVSIAKSAGVQDHHIVLDPGIGFAKTYHDNLAVMNQLEKFSEPGYPVLLGT
FT                   SRKKFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQISRMAKMMDAMIDKGG
FT                   VYHR"
FT   gene            91401..91784
FT                   /gene="folB"
FT                   /locus_tag="BL00862"
FT   CDS_pept        91401..91784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BL00862"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="Molecular Function: dihydroneopterin aldolase
FT                   activity, Biological Process: folic acid and derivative
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL00862"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21726"
FT                   /db_xref="GOA:Q65PE3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE3"
FT                   /protein_id="AAU21726.1"
FT                   /translation="MIKEAFIIDKVHVEGMEFYGYHGVFKEENKLGQRFRVDLTAFLDL
FT                   SEAGKTDNIEATINYAELYKLCKEVVEGEPVNLVETLAETIAAQVLENFEAVQECTVKV
FT                   VKPDPPIPGHYKSVAIEMTRKRK"
FT   gene            91781..92281
FT                   /gene="folK"
FT                   /locus_tag="BL05004"
FT   CDS_pept        91781..92281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BL05004"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /function="Molecular Function:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase activity, Biological Process: folic acid
FT                   and derivative biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL05004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21727"
FT                   /db_xref="GOA:Q65PE2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE2"
FT                   /protein_id="AAU21727.1"
FT                   /translation="MNNTAYIALGSNIGRREEYLKKAVSLLHQHPSVEVTDISSIYETD
FT                   PVGYTDQDLFLNMAAAVKTSLSPFELLDLTQRIEKELGRKRDIRWGPRTADLDILLYNR
FT                   ENIETEQLIVPHPRMHERLFVLIPLLEIYPDLEGAVNHAKNQEGVRVWKQKSGVDEFVH
FT                   IES"
FT   gene            92233..92442
FT                   /gene="yazB"
FT                   /locus_tag="BL05005"
FT   CDS_pept        92233..92442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazB"
FT                   /locus_tag="BL05005"
FT                   /product="putative transcriptional regulator"
FT                   /function="transcriptional regulation"
FT                   /note="Similar to lambda repressor, DNA binding, Xre
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BL05005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21728"
FT                   /db_xref="GOA:Q62ZT0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZT0"
FT                   /protein_id="AAU21728.1"
FT                   /translation="MEAEIWGRRIRAYRKLKGYTQEGFAKALGISVSVLGEVERGNRMP
FT                   TESMLRDVANTLNITVEELSPSEE"
FT   gene            92459..93460
FT                   /gene="dus1"
FT                   /locus_tag="BL03311"
FT   CDS_pept        92459..93460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dus1"
FT                   /locus_tag="BL03311"
FT                   /product="putative Dihydrouridine synthase TIM-barrel
FT                   protein"
FT                   /function="Biological Process: tRNA processing, Molecular
FT                   Function: oxidoreductase activity, Molecular Function: FAD
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL03311"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21729"
FT                   /db_xref="GOA:Q65PE1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE1"
FT                   /protein_id="AAU21729.1"
FT                   /translation="MFKIGDIELKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNAKTMGMLYIDEREKPLSLQIFGGEKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPNKIYEMVSAVVEAVDKPVTVKMRMGWDEDHIFAVENARAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVHYLETGELKDEPKVREKISVCKLHLDRLIGLKGENVAVREM
FT                   RKHAAWYLKGIRGNAKVRNEINHCETRDELVQLLDAFTIEAEAKELQDAKVG"
FT   gene            93545..95044
FT                   /gene="lysS"
FT                   /locus_tag="BL03312"
FT   CDS_pept        93545..95044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BL03312"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="Molecular Function: lysine-tRNA ligase activity,
FT                   Molecular Function: ATP binding, Biological Process:
FT                   lysyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL03312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21730"
FT                   /db_xref="GOA:Q65PE0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PE0"
FT                   /protein_id="AAU21730.1"
FT                   /translation="MSHEEHNHEELNDQLQVRRDKMNQLRESGKDPFGQRFDRTHQSTD
FT                   LIESYNEFSKEELEEKAIEVTIAGRMMTKRGKGKAGFAHIQDLKGQIQIYVRKDSVGEE
FT                   QYEWFKSSDLGDIVGVTGVMFKTNVGELSVKATSFDLLTKALRPLPDKYHGLKDIEQRY
FT                   RQRYLDLIVNPESKNTFITRSKIIQSMRRYLDDHGYLEVETPTMHAIPGGASARPFITH
FT                   HNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMRLTENLIAHIAQEVLGTTTVQYGDYEVDLKPEWKRLHMVDAVKEATGVDFWKE
FT                   VSVEEARAYAKEHGIEISEGMSVGHIINEFFEQKVEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQKERFEAQLKEREEGNDEAHMMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRHR"
FT   gene            95349..96894
FT                   /locus_tag="BL_rrna_0007"
FT   rRNA            95349..96894
FT                   /locus_tag="BL_rrna_0007"
FT                   /product="16S ribosomal RNA"
FT   gene            97067..99997
FT                   /locus_tag="BL_rrna_0008"
FT   rRNA            97067..99997
FT                   /locus_tag="BL_rrna_0008"
FT                   /product="23S ribosomal RNA"
FT   gene            100130..100245
FT                   /locus_tag="BL_rrna_0009"
FT   rRNA            100130..100245
FT                   /locus_tag="BL_rrna_0009"
FT                   /product="5S ribosomal RNA"
FT   gene            100422..100886
FT                   /gene="ctsR"
FT                   /locus_tag="BL03258"
FT   CDS_pept        100422..100886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BL03258"
FT                   /product="transcriptional regulator"
FT                   /function="negative regulation of stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:BL03258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21731"
FT                   /db_xref="GOA:Q65PD9"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PD9"
FT                   /protein_id="AAU21731.1"
FT                   /translation="MGKNISDIIEQYLKQILEQNGKEILEIKRSEIADKFQCVPSQINY
FT                   VINTRFTSERGYIVESKRGGGGYIRIIKIKMNDKIDLINNIMNQIYTRLSQAASDDIIL
FT                   RLLENGVITESEAKLMVSVMDRSVLYIDLPERDELRARMMKAMLTSLKFK"
FT   gene            100901..101455
FT                   /gene="mcsA"
FT                   /locus_tag="BL03259"
FT   CDS_pept        100901..101455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BL03259"
FT                   /product="McsA"
FT                   /function="modulation of CtsR repression"
FT                   /db_xref="EnsemblGenomes-Gn:BL03259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21732"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PD8"
FT                   /protein_id="AAU21732.1"
FT                   /translation="MICQECKERPATFHFTKVINGEKKEMHICEQCAKENSESYSMNES
FT                   GGFSIHNLLSGLLNFDSSFTNSSEAQLFQQPDQVLRCKKCNMTFPEFRKTGRFGCSECY
FT                   KTFHSYITPVLRKVHSGNTVHAGKIPKRIGGNLHVRRQIEALKKELKELIQQEEFEKAA
FT                   NIRDQIRSLEQNLNANKEEED"
FT   gene            101455..102546
FT                   /gene="mcsB"
FT                   /locus_tag="BL03260"
FT   CDS_pept        101455..102546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BL03260"
FT                   /product="McsB"
FT                   /function="modulation of CtsR repression, Molecular
FT                   Function: kinase activity,transferase activity,
FT                   transferring phosphorus-containing groups"
FT                   /db_xref="EnsemblGenomes-Gn:BL03260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21733"
FT                   /db_xref="GOA:Q65PD7"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD7"
FT                   /protein_id="AAU21733.1"
FT                   /translation="MSLQHFIQNALSNWMRQEGPESDIVLSSRIRLARNLDKVRFPTLF
FT                   SNEEASAIIALFEEQFTGYEVPGIGKFELVKMDQVQPLEKRVLVEKHLISPHLTEASFG
FT                   ACLLSENEEVSIMLNEEDHIRIQCLFPGFQLSEALKAANQVDDWIEDRIDYAFSEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEALGNIFQ
FT                   ISNQITLGKSEHDIVEDLNSVVAQLIEQERSARKALYQTSQIELEDRVYRSYGVLSNCR
FT                   MIESKETARCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLKLENNGNRQEDETI"
FT   gene            102543..104975
FT                   /gene="clpC"
FT                   /locus_tag="BL03261"
FT   CDS_pept        102543..104975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BL03261"
FT                   /product="class III stress response-related ATPase"
FT                   /function="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BL03261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21734"
FT                   /db_xref="GOA:Q65PD6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PD6"
FT                   /protein_id="AAU21734.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGI
FT                   AAKALQALGLSPDKIQKEVESLIGRGQEMSQSIHYTPRAKKVTELAMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESGGAASGANSSANTPTL
FT                   DSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIINNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVD
FT                   QPSPEESIQILKGLRDRYEAHHRVSITDEAIEAAVKLSDRYISDRFLPDKAIDLIDEAG
FT                   SKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEETKK
FT                   TWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQTETDKLLNMESILHSRVIGQDEAV
FT                   VAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEEAMIRIDMSE
FT                   YMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTILIMTSNVGASELRRNKYVGFNVQDETQNYKDMKDKVMGELK
FT                   RAFRPEFINRIDEIIVFHSLEKKHLKDIVSLMSDQLTKRLKEQDLSIELTEAAKEKIAD
FT                   EGVDLEYGARPLRRAIQKHVEDRLSEELLKGHIQKGQHIVLDVEDGEFVVKTEAKTN"
FT   gene            105055..106434
FT                   /gene="radA"
FT                   /locus_tag="BL03262"
FT   CDS_pept        105055..106434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BL03262"
FT                   /product="DNA repair protein RadA"
FT                   /function="Molecular Function: damaged DNA binding,
FT                   Molecular Function: ATP binding, Biological Process: DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:BL03262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21735"
FT                   /db_xref="GOA:Q65PD5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PD5"
FT                   /protein_id="AAU21735.2"
FT                   /translation="MAKTKTKFICHSCGYESAKWMGKCPGCGAWNTMVEETIKKPAANR
FT                   RTAFSHSVQTVQKPSPLTSIETTEEPRIKTKLGEFNRVLGNGIVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLADSKENVLYISGEESVKQTKLRADRLGINSPTLHVLSETDMEYITSSI
FT                   EEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMRIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGAAGSSVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAVAVSIASSFRDTPPHPTDCFIGEVGL
FT                   TGEVRRVSRIEQRVQEAAKLGFKRMIIPSANVEGWTKPKGIEVVGVENVAEALRASLGG
FT                   S"
FT   gene            106438..107514
FT                   /gene="disA"
FT                   /locus_tag="BL03263"
FT   CDS_pept        106438..107514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BL03263"
FT                   /product="DNA binding protein"
FT                   /note="with Helix-hairpin-helix motif,conserved
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:BL03263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21736"
FT                   /db_xref="GOA:Q65PD4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD4"
FT                   /protein_id="AAU21736.1"
FT                   /translation="MDKDKKGAKQDLSEILQFVAPGTPLREGIENVLRAKTGGLIVVGF
FT                   NDKVKEVVDGGFHINSSFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPEATIPSSE
FT                   TGMRHRTAERVAKQTGCLIIAISERRNVITLYQENMKYILKDIGFILTKANQAIQTLEK
FT                   YKLILDHAISNLNALEFEELVTFGDVISVLHRYEMVLRIKNEINMYIKELGTEGHLIRL
FT                   QVSELITDMEQEAALFVKDYVKEKIKDPFVLLKQLQDMSSFELLDDAILLKLLGYSATT
FT                   NMEEYVFPRGYRLLHKIPRLPMPIVENVVEAFGHLKLIIEADVKDLDEVEGIGAVRAQK
FT                   IKKGLKRLQEKHYTDRQL"
FT   gene            107646..108734
FT                   /gene="yacL"
FT                   /locus_tag="BL03264"
FT   CDS_pept        107646..108734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BL03264"
FT                   /product="conserved hypothetical protein YacL"
FT                   /note="putative Nucleotide binding protein, PINc"
FT                   /db_xref="EnsemblGenomes-Gn:BL03264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21737"
FT                   /db_xref="GOA:Q65PD3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PD3"
FT                   /protein_id="AAU21737.1"
FT                   /translation="MLKRIVQAFFAILGGVIGIFLIPELFVLLNVQDIPLVTNPYASAC
FT                   LGAIIFFLLGIWCADHVINWVKQIEDSLIKAPVSDLLFGSLGLIFGLMLAYLIVNVIPL
FT                   KDIPYQLISTVIPIVLAAFLGYLGFRVGFKKKDEMLTLFTSRKKKGSAEEERPEEDKKL
FT                   KILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILN
FT                   RIQKELDIKVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNI
FT                   NDLANAVKPVVLPGEEMKVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVT
FT                   SVLQTAAGRMIFAKPKLLEKAL"
FT   gene            108751..109446
FT                   /gene="ispD"
FT                   /locus_tag="BL03265"
FT   CDS_pept        108751..109446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BL03265"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /function="Biological Process: isoprenoid biosynthesis,
FT                   Molecular Function:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL03265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21738"
FT                   /db_xref="GOA:Q65PD2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD2"
FT                   /protein_id="AAU21738.1"
FT                   /translation="MNYEVVIPAAGQGKRMNAGKNKLFIEAKGIPVIIHTLKVFENHDA
FT                   CKRIILVINEQEFGEFNTLLKTYHFKTPIEMVPGGRERQQSVFAGIKAAGKEETVLVHD
FT                   GARPFIKREYIEQLVEKAKETGAAIVAVPVKDTIKRVQDGEIAGTIERSSLWAAQTPQA
FT                   FRLSILMNAHLEAEAKGFLGTDDASLVEEAGGTVAIIQGDYQNIKLTTPDDLLVAEAIL
FT                   EAEKRNEHV"
FT   gene            109439..109915
FT                   /gene="ispF"
FT                   /locus_tag="BL03266"
FT   CDS_pept        109439..109915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BL03266"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="Molecular Function: 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase activity, Biological Process:
FT                   terpenoid biosynthesis"
FT                   /note="MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BL03266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21739"
FT                   /db_xref="GOA:Q65PD1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD1"
FT                   /protein_id="AAU21739.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGITIPYEKGLLGHSDADVLLHTI
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLRHVWMIVKEKGYTLGNLDCTIIAQKP
FT                   KMAPYIEDMRARIAEGLEAEISQINVKATTTEKLGFTGRAEGIAAQASVLLQKV"
FT   gene            109997..111454
FT                   /gene="gltX"
FT                   /locus_tag="BL03267"
FT   CDS_pept        109997..111454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BL03267"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="Molecular Function: glutamate-tRNA ligase
FT                   activity, Molecular Function: ATP binding, Cellular
FT                   Component: cytoplasm, Biological Process: glutamyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL03267"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21740"
FT                   /db_xref="GOA:Q65PD0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD0"
FT                   /protein_id="AAU21740.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIED
FT                   TDRKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKTYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQAARGEMPRYSGKCRNLTKEEQEKLEAEGRQPSIRFKVPQGE
FT                   VIRFDDIVKGEISFETDGIGDFVIVKKDGTPTYNFAVAVDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYNALGWDIPAFGHMTLIVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFI
FT                   TLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPAVFDTHKLKWVNNQYVKKLDLDQVIEL
FT                   TVPHLQKAGKVSEELSGSEQEWVRKLISLYQEQLSYGAEIVELTELFFKDDIQYNREAR
FT                   TVLEEEQVPEVLRVFAEKLEQLDSFTADEIKASIKAVQKETGHKGKKLFMPIRVATTGQ
FT                   THGPELPQSIELLGKDTVLKRLHNIIQ"
FT   gene            111756..112406
FT                   /gene="cysE"
FT                   /locus_tag="BL03268"
FT   CDS_pept        111756..112406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BL03268"
FT                   /product="serine acetyltransferase"
FT                   /function="Cellular Component: cytoplasm, Biological
FT                   Process: cysteine biosynthesis from serine, Molecular
FT                   Function: serine O-acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL03268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21741"
FT                   /db_xref="GOA:Q65PC9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC9"
FT                   /protein_id="AAU21741.1"
FT                   /translation="MFFKMLKEDVDVVFDQDPAARSYIEVILTYSGLHAIWAHRIAHAL
FT                   YKRKRFFIARAISQIARFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIEDDALISTGAKVLGSITVGRGAKIGAGSVVLHDVPECSTVVG
FT                   IPGRVVVQNGKKIRRDLNHQDLPDPVADRFRELENEIRQLKQELRRKEREDEL"
FT   gene            112403..113806
FT                   /gene="cysS"
FT                   /locus_tag="BL03269"
FT   CDS_pept        112403..113806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BL03269"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /function="Molecular Function: cysteine-tRNA ligase
FT                   activity, Biological Process: cysteinyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL03269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21742"
FT                   /db_xref="GOA:Q65PC8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC8"
FT                   /protein_id="AAU21742.1"
FT                   /translation="MTLTLYNTLTRKKEPFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVFDTVRKYLEYKGYEVQYVSNFTDVDDKLIKAANELGEEVPVIAERFIKAYFEDVGSL
FT                   GCTKADCHPRVTENMDEIIDFIQTLIDKGYAYEADGDVYYKTRSFEGYGKLSHQSVDEL
FT                   RSGARIQVGEKKEDALDFTLWKAAKDNEISWDSPWGKGRPGWHIECSAMARKYLGDSID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKPFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KEHDPQVLRFFMLSVHYRHPINYSVELLENTKNAFGRLKTAYSNLQHRLKSSTNLTEGD
FT                   SEWLEKIEEQRKAFQTAMDDDFNTANAISVLFDLAKHANYYLQEKNTAEHVIQAFIQLF
FT                   DEICSVLGFSLKEQELLDKDIEELIEKRNEARRNRDFATSDQIRDQLKSMNIILEDTPQ
FT                   GTRWKRGES"
FT   gene            113809..114225
FT                   /gene="yazC"
FT                   /locus_tag="BL03270"
FT   CDS_pept        113809..114225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazC"
FT                   /locus_tag="BL03270"
FT                   /product="putative Ribonuclease III, conserved hypothetical
FT                   YazC protein"
FT                   /function="Molecular Function: RNA binding, Molecular
FT                   Function: ribonuclease III activity, Biological Process:
FT                   RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BL03270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21743"
FT                   /db_xref="GOA:Q65PC7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PC7"
FT                   /protein_id="AAU21743.1"
FT                   /translation="MNLETIKDAKQLNGLALAYMGDAVLEVYVRHHLLKQGMTRPNDLH
FT                   RQSRRYVSAKSQASMLFALEEQEFFTEEEQAVLRRGRNAKSGTVPKNTDVQTYRYSTAF
FT                   EAVIGYLFLENREDRLNELIKAALEKRDGREEVK"
FT   gene            114222..114971
FT                   /gene="yacO"
FT                   /locus_tag="BL03271"
FT   CDS_pept        114222..114971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacO"
FT                   /locus_tag="BL03271"
FT                   /product="putative tRNA/rRNA methyltransferase YacO"
FT                   /function="Molecular Function: RNA methyltransferase
FT                   activity, Biological Process: RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:BL03271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21744"
FT                   /db_xref="GOA:Q65PC6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PC6"
FT                   /protein_id="AAU21744.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSGRELYKLWMAENTVKGQAQQVVDLA
FT                   AKNGVTIHYVPRKKLDQMVSGQHQGVVAQVAAYEYAELDDLFQKAEDRNEQPFILVLDE
FT                   IEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLSRTL
FT                   EEMKGRGIWVVGTDASGQQDYRSLDGNMPLALVIGSEGKGMGRLVKEKCDFLIRLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRSPLGE"
FT   gene            115073..115489
FT                   /gene="yacP"
FT                   /locus_tag="BL03272"
FT   CDS_pept        115073..115489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="BL03272"
FT                   /product="conserved hypothetical protein YacP"
FT                   /db_xref="EnsemblGenomes-Gn:BL03272"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21745"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A4"
FT                   /protein_id="AAU21745.2"
FT                   /translation="MIQKMAEYQSYTGFRVIVVFDAHLVKGIEKKKVNHRVEVIFTREN
FT                   ETADERIEKLVSDLNSIQTQIHVATSDYTEQWAIFGQGALRKSARELLREVEAIERQIE
FT                   NRVKQITSERPAGKIPLSEDVLRIFEKWRRGDLD"
FT   gene            115553..116224
FT                   /gene="sigH"
FT                   /locus_tag="BL03273"
FT   CDS_pept        115553..116224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BL03273"
FT                   /product="RNA polymerase sigma-30 factor (sigma-H)"
FT                   /function="expression of vegetative and early
FT                   stationary-phase genes, Molecular Function: transcription
FT                   factor activity, Biological Process: transcription
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BL03273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21746"
FT                   /db_xref="GOA:Q65PC4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PC4"
FT                   /protein_id="AAU21746.1"
FT                   /translation="MNLQNNQGKFSKEQFSKERFCQLEDEQVIEMVHVGDSDALDYLIT
FT                   KYRNFVRAKARSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTSFKAFAELCITRQII
FT                   TAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDVISGAKVMNPEELIINQEEFDDIE
FT                   LKMGELLSDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLELREIS
FT                   L"
FT   gene            116307..116456
FT                   /gene="rpmG"
FT                   /locus_tag="BL07083"
FT   CDS_pept        116307..116456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BL07083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL07083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97342"
FT                   /db_xref="GOA:Q65PC3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC3"
FT                   /protein_id="ABP97342.1"
FT                   /translation="MKKKVTLACKNCGNRNYTTMKSSAALAERLEVKKYCNNCNSHTVH
FT                   LETK"
FT   gene            116492..116671
FT                   /gene="secE"
FT                   /locus_tag="BL05006"
FT   CDS_pept        116492..116671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BL05006"
FT                   /product="preprotein translocase subunit"
FT                   /function="Biological Process: protein targeting,
FT                   Biological Process: intracellular protein transport,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21747"
FT                   /db_xref="GOA:Q65PC2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PC2"
FT                   /protein_id="AAU21747.1"
FT                   /translation="MGIIKFLKNVGKEMKKVTWPKGKELTRYTITVITTVIFFAIFFAL
FT                   IDSGITQLIRLIVE"
FT   gene            116849..117382
FT                   /gene="nusG"
FT                   /locus_tag="BL05007"
FT   CDS_pept        116849..117382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BL05007"
FT                   /product="transcription antitermination factor"
FT                   /function="Molecular Function: transcriptional elongation
FT                   regulator activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL05007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21748"
FT                   /db_xref="GOA:Q65PC1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PC1"
FT                   /protein_id="AAU21748.2"
FT                   /translation="MEKKWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVELVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTALLPG
FT                   EAEKILKRMGLEERKTEIDFELKETVKVIDGPFADFTGTIEEIDHDKNKVKVFVNMFGR
FT                   ETPVELEFTQVDKL"
FT   gene            117552..117977
FT                   /gene="rplK"
FT                   /locus_tag="BL05008"
FT   CDS_pept        117552..117977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BL05008"
FT                   /product="ribosomal protein L11"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: ribosome, Biological Process:
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL05008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21749"
FT                   /db_xref="GOA:Q65PC0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC0"
FT                   /protein_id="AAU21749.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TSDQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   gene            118079..118777
FT                   /gene="rplA"
FT                   /locus_tag="BL02802"
FT   CDS_pept        118079..118777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BL02802"
FT                   /product="ribosomal protein L1 (BL1)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL02802"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21750"
FT                   /db_xref="GOA:Q65PB9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB9"
FT                   /protein_id="AAU21750.1"
FT                   /translation="MAKKGKKYVEAAKLVDRTKAYDVNEAIELVKKTNTAKFDATVEAA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDADYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEEGKLVENFATMYDTILKAKPAAAKGVYVKNVSVTSTMGPGI
FT                   KVDPSTFNVK"
FT   gene            119039..119539
FT                   /gene="rplJ"
FT                   /locus_tag="BL02801"
FT   CDS_pept        119039..119539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BL02801"
FT                   /product="ribosomal protein L10 (BL5)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: ribosome, Biological Process:
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02801"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21751"
FT                   /db_xref="GOA:Q65PB8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB8"
FT                   /protein_id="AAU21751.2"
FT                   /translation="MSSAIETKKVVVEEITSKLKESKSTIIVDYRGLNVAEVTELRKQL
FT                   REANVEFKVYKNTMTRRAVEQAELDGLNDFLTGPNAIAFSTEDVVAPAKVLNEFAKKHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALATKAVAEQKEE
FT                   QGA"
FT   gene            119584..119955
FT                   /gene="rplL"
FT                   /locus_tag="BL02800"
FT   CDS_pept        119584..119955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BL02800"
FT                   /product="ribosomal protein L12 (BL9)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: ribosome, Biological Process:
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02800"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21752"
FT                   /db_xref="GOA:Q65PB7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB7"
FT                   /protein_id="AAU21752.2"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEKTEFDLVLAGAGDQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
FT   gene            120095..120700
FT                   /gene="ybxB"
FT                   /locus_tag="BL02799"
FT   CDS_pept        120095..120700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxB"
FT                   /locus_tag="BL02799"
FT                   /product="hypothetical protein with SAM binding motif"
FT                   /function="Molecular Function:
FT                   S-adenosylmethionine-dependent methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02799"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21753"
FT                   /db_xref="GOA:Q65PB6"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q65PB6"
FT                   /protein_id="AAU21753.1"
FT                   /translation="MTDHYYSEKPSAKSSRSMWAFRLRNRTFTFISDSGVFSKREVDFG
FT                   SRLLIEAFREPDAEGDFLDVGCGYGPIGLSLAADFEDRMVHMIDVNERAVELSKENALN
FT                   NQIDNIKIYQSDLFANVEPAKKFASIITNPPIRAGKKTVHAIFEKSAEHLRPSGELWVV
FT                   IQKKQGGPSAIEKLKELFADVEVVQKKKAYYIIKAKKV"
FT   gene            120951..124532
FT                   /gene="rpoB"
FT                   /locus_tag="BL02798"
FT   CDS_pept        120951..124532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BL02798"
FT                   /product="RNA polymerase (beta subunit)"
FT                   /function="Molecular Function: DNA binding, Molecular
FT                   Function: DNA-directed RNA polymerase activity, Biological
FT                   Process: transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BL02798"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21754"
FT                   /db_xref="GOA:Q65PB5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB5"
FT                   /protein_id="AAU21754.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGENEYLRNTLD
FT                   KDNTENTDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGAILDRRTLDKVLPYLENGIGFKKLYPNGGVVED
FT                   EVTLQSIKIYAPTDQEGEQTINVIGNAYIEEGVKNITPSDIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSFAKVNRFGFIETPYRRVDPETGKVTPRIDYLTADEEDNYVVAQ
FT                   ANARLNDDGSFVDDSIVARFRGENTVVPKDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPESPIVGTGMEYVSAKDSGAAVICRHPGIVERVEAKNIWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVEKGEILADGPSMEKGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARRLGLHVAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSSDEEEIEMRDLEDDEDAKQN
FT                   EGLSLPNDEESEELVSADAERDVVTKE"
FT   gene            124592..128191
FT                   /gene="rpoC"
FT                   /locus_tag="BL02626"
FT   CDS_pept        124592..128191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BL02626"
FT                   /product="RNA polymerase (beta subunit)"
FT                   /function="Molecular Function: DNA-directed RNA polymerase
FT                   activity, Biological Process: transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BL02626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21755"
FT                   /db_xref="GOA:Q65PB4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB4"
FT                   /protein_id="AAU21755.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLDKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERPGAVGEGMIFK
FT                   DTDEALLAYQNGYVHLHTRVAVAVNSLKNETFTEEQRSKLLITTVGKLIFNEILPPSFP
FT                   YMNEPTKSNIEEKTPDRFFLDYGADVKEAIKNQEINPPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQGKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDTIQGKLMKSLDEINPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKAITEGTEVIERLEERLVGRFARKPVKHPETGEVLVNENELIDED
FT                   KAIEIVEAGIEEVWIRSAFTCNTSHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATISEIDGVVAEINEVRDKQQ
FT                   EIVVQGEVESRSYTAPYNARLKVTEGEKISRGQVLTEGSVDPKELLKVTDITTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTEVLPGTLLDIHQFTEANKKVL
FT                   LEGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMLNYRKVKPVLQVQSSDEMVPAE"
FT   gene            128311..128559
FT                   /gene="ybxF"
FT                   /locus_tag="BL05009"
FT   CDS_pept        128311..128559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxF"
FT                   /locus_tag="BL05009"
FT                   /product="putative ribosomal protein L7AE family"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: ribosome, Biological Process:
FT                   protein biosynthesis"
FT                   /note="ribosomal protein L7AE family"
FT                   /db_xref="EnsemblGenomes-Gn:BL05009"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21756"
FT                   /db_xref="GOA:Q62ZQ2"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZQ2"
FT                   /protein_id="AAU21756.1"
FT                   /translation="MSYDKVSQAQSIIIGTKQTVKALKRNSVKEVVVAKDADPCLTSGV
FT                   INLANEQGVPVSMAESMKKLGKACGIEVGAAAVAIIQ"
FT   gene            128664..129080
FT                   /gene="rpsL"
FT                   /locus_tag="BL01060"
FT   CDS_pept        128664..129080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BL01060"
FT                   /product="ribosomal protein S12 (BS12)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21757"
FT                   /db_xref="GOA:Q65PB2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB2"
FT                   /protein_id="AAU21757.1"
FT                   /translation="MPTINQLVRKGRVSKVETSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRAQGRSKYGTKRPKKK"
FT   gene            129246..129716
FT                   /gene="rpsG"
FT                   /locus_tag="BL01059"
FT   CDS_pept        129246..129716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BL01059"
FT                   /product="ribosomal protein S7 (BS7)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21758"
FT                   /db_xref="GOA:Q65PB1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB1"
FT                   /protein_id="AAU21758.1"
FT                   /translation="MPRKGPVAKRDVLPDPLYNSKLVTRLINKMMIDGKKGKAQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            129766..131844
FT                   /gene="fusA"
FT                   /locus_tag="BL01057"
FT   CDS_pept        129766..131844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BL01057"
FT                   /product="elongation factor G"
FT                   /function="Molecular Function: translation elongation
FT                   factor activity, Molecular Function: GTP binding,
FT                   Biological Process: translational elongation, Molecular
FT                   Function: GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL01057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21759"
FT                   /db_xref="GOA:Q65PB0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB0"
FT                   /protein_id="AAU21759.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVGTLRDRLEANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYYYEDDLGTRSEAREIPAEYKDKAEELRASLIEAVAELD
FT                   EELMMKYLEGEEITVDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVPAIKGTLPDSDEEVTRESSDDAPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   RNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVILES
FT                   MEFPEPVIHVAIEPKSKADQDKMSTALAKLAEEDPTFRAHTDPETGQTIIGGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRASAQVEGKFVRQSGGRGQFGHVWIEFSPNEE
FT                   GKGFEFENAIVGGVVPREYIPAVQAGLEDALQNGVVAGYPVIDIKAKLFDGSYHDVDSN
FT                   EMAFKIAASMALKNAASKCNPVILEPISKVEVVIPEEYMGDIMGDITSRRGRVEGMEGR
FT                   GNAQVVRAMVPLSEMFGYATALRSNTQGRGTFTMVFDHYEEVPKSIADEIIKKNQGE"
FT   gene            131964..133154
FT                   /gene="tufA"
FT                   /locus_tag="BL01055"
FT   CDS_pept        131964..133154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="BL01055"
FT                   /product="elongation factor Tu"
FT                   /function="Molecular Function: GTP binding, Molecular
FT                   Function: translation elongation factor activity, Molecular
FT                   Function: GTP binding, Biological Process: translational
FT                   elongation"
FT                   /db_xref="EnsemblGenomes-Gn:BL01055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21760"
FT                   /db_xref="GOA:Q65PA9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA9"
FT                   /protein_id="AAU21760.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSRNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYE
FT                   FPGDDVPVIKGSALKALEGDAQYEEKIFELMAAVDEYIPTPERETDKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEIQRGQVLAQPGTITPHKKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIQLPEGVEMVMPGDNIEMTVELISTIAIEDGTRFSIREGGRTVGSGVVSSIIE"
FT   gene            133476..133784
FT                   /gene="rpsJ"
FT                   /locus_tag="BL01054"
FT   CDS_pept        133476..133784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BL01054"
FT                   /product="ribosomal protein S10 (BS13)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21761"
FT                   /db_xref="GOA:Q65PA8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA8"
FT                   /protein_id="AAU21761.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            133823..134452
FT                   /gene="rplC"
FT                   /locus_tag="BL01053"
FT   CDS_pept        133823..134452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BL01053"
FT                   /product="ribosomal protein L3 (BL3)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21762"
FT                   /db_xref="GOA:Q65PA7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA7"
FT                   /protein_id="AAU21762.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTSENDG
FT                   YEAIQIGFDDKREKLANKPEKGHVAKAETAPKRFVKELRGVDMDAYEVGQEVKVDIFSN
FT                   GEIVDVTGTSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLVKGNVPGAKKSLVTVKSAVKSK"
FT   gene            134480..135103
FT                   /gene="rplD"
FT                   /locus_tag="BL01052"
FT   CDS_pept        134480..135103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BL01052"
FT                   /product="ribosomal protein L4"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21763"
FT                   /db_xref="GOA:Q65PA6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA6"
FT                   /protein_id="AAU21763.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNDSVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALSSKVNDNNLIVLEDLNLDAVKTKEMAAILKGLSIEKKALIVTADANETV
FT                   ELSARNLPGVTVVEANGINVLDVVGHEKLVMTKAAVEKVEEVLA"
FT   gene            135103..135390
FT                   /gene="rplW"
FT                   /locus_tag="BL01050"
FT   CDS_pept        135103..135390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BL01050"
FT                   /product="ribosomal protein L23"
FT                   /function="Molecular Function: RNA binding, Molecular
FT                   Function: structural constituent of ribosome, Cellular
FT                   Component: intracellular, Cellular Component: ribosome,
FT                   Biological Process: protein biosynthesis (GO:0006"
FT                   /db_xref="EnsemblGenomes-Gn:BL01050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21764"
FT                   /db_xref="GOA:Q65PA5"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA5"
FT                   /protein_id="AAU21764.1"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEKKYTFEVDVKANKTEVKDAVEQ
FT                   IFGVKVEKVNIMNYKGKFKRVGRYSGMTNKRRKAIVKLTEDSKEIEIFEA"
FT   gene            135422..136255
FT                   /gene="rplB"
FT                   /locus_tag="BL01049"
FT   CDS_pept        135422..136255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BL01049"
FT                   /product="ribosomal protein L2 (BL2)"
FT                   /function="Molecular Function: RNA binding, Molecular
FT                   Function: structural constituent of ribosome, Biological
FT                   Process: protein biosynthesis, Cellular Component: large
FT                   ribosomal subunit, Molecular Function: transfe"
FT                   /db_xref="EnsemblGenomes-Gn:BL01049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21765"
FT                   /db_xref="GOA:Q65PA4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA4"
FT                   /protein_id="AAU21765.1"
FT                   /translation="MAIKKYKPTSNGRRGMTSSDFAEITTDQPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATVEYDPNRSANIALINYVDGEKRYI
FT                   LAPKGLQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRATIGQVGNEQHELINIGKAGRSRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
FT   gene            136313..136591
FT                   /gene="rpsS"
FT                   /locus_tag="BL01048"
FT   CDS_pept        136313..136591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BL01048"
FT                   /product="ribosomal protein S19 (BS19)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21766"
FT                   /db_xref="GOA:Q65PA3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA3"
FT                   /protein_id="AAU21766.1"
FT                   /translation="MARSLKKGPFVDDHLMTKIEKLNEADKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   gene            136609..136953
FT                   /gene="rplV"
FT                   /locus_tag="BL01047"
FT   CDS_pept        136609..136953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BL01047"
FT                   /product="ribosomal protein L22 (BL17)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21767"
FT                   /db_xref="GOA:Q65PA2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA2"
FT                   /protein_id="AAU21767.1"
FT                   /translation="MQQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNHTPKAAS
FT                   PIIEKVLKSAIANAEHNYEMDANNLVVTQAYVNEGPTLKRFRPRAMGRASQINKRTSHI
FT                   TIVVSEKKEG"
FT   gene            136957..137613
FT                   /gene="rpsC"
FT                   /locus_tag="BL01046"
FT   CDS_pept        136957..137613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BL01046"
FT                   /product="ribosomal protein S3 (BS3)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21768"
FT                   /db_xref="GOA:Q65PA1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA1"
FT                   /protein_id="AAU21768.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREFINQR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRISFRRAQKQQIQRTMRAGAQGIKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK"
FT   gene            137615..138049
FT                   /gene="rplP"
FT                   /locus_tag="BL01044"
FT   CDS_pept        137615..138049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BL01044"
FT                   /product="ribosomal protein L16"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21769"
FT                   /db_xref="GOA:Q65PA0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA0"
FT                   /protein_id="AAU21769.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQAQESSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
FT   gene            138039..138239
FT                   /gene="rpmC"
FT                   /locus_tag="BL01043"
FT   CDS_pept        138039..138239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BL01043"
FT                   /product="ribosomal protein L29"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21770"
FT                   /db_xref="GOA:Q65P99"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P99"
FT                   /protein_id="AAU21770.2"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKSIARMKTVIREREIAANK"
FT   gene            138264..138527
FT                   /gene="rpsQ"
FT                   /locus_tag="BL01042"
FT   CDS_pept        138264..138527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BL01042"
FT                   /product="ribosomal protein S17 (BS16)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21771"
FT                   /db_xref="GOA:Q65P98"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P98"
FT                   /protein_id="AAU21771.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHSLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            138568..138936
FT                   /gene="rplN"
FT                   /locus_tag="BL01041"
FT   CDS_pept        138568..138936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BL01041"
FT                   /product="ribosomal protein L14"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21772"
FT                   /db_xref="GOA:Q65P97"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P97"
FT                   /protein_id="AAU21772.2"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGDVVRAVVVRSKSGARRNDGSYIKFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDNNFMKIVSLAPEVL"
FT   gene            138972..139283
FT                   /gene="rplX"
FT                   /locus_tag="BL01040"
FT   CDS_pept        138972..139283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BL01040"
FT                   /product="ribosomal protein L24 (BL23) (histone-like
FT                   protein HPB12)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21773"
FT                   /db_xref="GOA:Q65P96"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P96"
FT                   /protein_id="AAU21773.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGVILAAFPKKDRVIVEGVNMVKKHS
FT                   KPTQANPQGGILNQEAPIHVSNVMPLDPKTGEVTRVGYKVENGKKVRIAKKSGQVLDN"
FT   gene            139309..139848
FT                   /gene="rplE"
FT                   /locus_tag="BL01039"
FT   CDS_pept        139309..139848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BL01039"
FT                   /product="ribosomal protein L5 (BL6)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21774"
FT                   /db_xref="GOA:Q65P95"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P95"
FT                   /protein_id="AAU21774.1"
FT                   /translation="MNRLKEKYNKEITPALMKKFEYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGISKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQLGMPFQK"
FT   gene            139871..140056
FT                   /gene="rpsN"
FT                   /locus_tag="BL01038"
FT   CDS_pept        139871..140056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BL01038"
FT                   /product="30S ribosomal protein S14"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21775"
FT                   /db_xref="GOA:Q65P94"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P94"
FT                   /protein_id="AAU21775.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            140088..140486
FT                   /gene="rpsH"
FT                   /locus_tag="BL01037"
FT   CDS_pept        140088..140486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BL01037"
FT                   /product="ribosomal protein S8 (BS8)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21776"
FT                   /db_xref="GOA:Q65P93"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P93"
FT                   /protein_id="AAU21776.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFIEDNKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   ILSTSQGVLTDKEARAKQAGGEVLAYVW"
FT   gene            140516..141052
FT                   /gene="rplF"
FT                   /locus_tag="BL01036"
FT   CDS_pept        140516..141052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BL01036"
FT                   /product="ribosomal protein L6 (BL8)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01036"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21777"
FT                   /db_xref="GOA:Q65P92"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P92"
FT                   /protein_id="AAU21777.2"
FT                   /translation="MSRVGKKLLEIPSGVTVTLNDNTVTVKGPKGELTRTFHPDMKIKI
FT                   EDNVLTVERPSDNKEHRALHGTTRSIIGNMVEGVSKGFERGLELVGVGYRASKSGNKLV
FT                   LNVGYSHPVEIVPENGIEIEVPSQTKVVVKGTDKERVGATAANIRAVRSPEPYKGKGIR
FT                   YEGEMVRRKEGKSAK"
FT   gene            141084..141446
FT                   /gene="rplR"
FT                   /locus_tag="BL01035"
FT   CDS_pept        141084..141446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BL01035"
FT                   /product="ribosomal protein L18"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21778"
FT                   /db_xref="GOA:Q65P91"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P91"
FT                   /protein_id="AAU21778.2"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTPERPRLNVFRSNKHIYAQVI
FT                   DDVNGVTLVSASTLDKDFNAENGSDTAAAAKVGELVAKRASEKGITNVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            141465..141971
FT                   /gene="rpsE"
FT                   /locus_tag="BL01034"
FT   CDS_pept        141465..141971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BL01034"
FT                   /product="ribosomal protein S5"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21779"
FT                   /db_xref="GOA:Q65P90"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P90"
FT                   /protein_id="AAU21779.1"
FT                   /translation="MNMRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKN
FT                   GHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
FT                   TGVIAGGPVRAVLELAGVSDILSKSLGSNTPINMIRATVQGLSELKRAEDVAKLRGKSV
FT                   EELLG"
FT   gene            141985..142164
FT                   /gene="rpmD"
FT                   /locus_tag="BL01033"
FT   CDS_pept        141985..142164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BL01033"
FT                   /product="ribosomal protein L30 (BL27)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21780"
FT                   /db_xref="GOA:Q65P89"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P89"
FT                   /protein_id="AAU21780.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRITVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEL"
FT   gene            142195..142635
FT                   /gene="rplO"
FT                   /locus_tag="BL01032"
FT   CDS_pept        142195..142635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BL01032"
FT                   /product="ribosomal protein L15"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Biological Process: protein biosynthesis,
FT                   Cellular Component: large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BL01032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21781"
FT                   /db_xref="GOA:P35138"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35138"
FT                   /protein_id="AAU21781.1"
FT                   /translation="MKLHELKPAEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEFAVVNLDKLNSFAEGTEVTPELLLETGVISK
FT                   LKSGVKILGDGKLEKKLTVKANKFSASAKQAIEAAGGTAEVI"
FT   gene            142637..143932
FT                   /gene="secY"
FT                   /locus_tag="BL01031"
FT   CDS_pept        142637..143932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BL01031"
FT                   /product="preprotein translocase subunit"
FT                   /function="Biological Process: protein secretion, Molecular
FT                   Function: protein translocase activity, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21782"
FT                   /db_xref="GOA:Q05207"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05207"
FT                   /protein_id="AAU21782.1"
FT                   /translation="MFKTISNFMRVKDIRNKIIFTLLMLIVFRLGSFIPVPHVNTEVLK
FT                   AQDQMSVFGILNTFGGGALFNFSILAMGIMPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNMAGGALITDPGVGTYLLIAIVLTAGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVAGIPQTINQIYAQQFVDAGDQLFLQIIKVVVILV
FT                   AILAIVVGVIFIQQAVRKISIQYAKGSGRSPVPGGQSTHLPLKVNPAGVIPVIFAVAFI
FT                   TTPRTVATFFGSNDVTNWIQKTFDYTHPVGMGVYAALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVIAILPVLFVNIAGLPSSAQIGG
FT                   TSLLIVIGVALETMKQLESQLVKRNYRGFMKH"
FT   gene            143986..144639
FT                   /gene="adk"
FT                   /locus_tag="BL01030"
FT   CDS_pept        143986..144639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BL01030"
FT                   /product="adenylate kinase"
FT                   /function="Molecular Function: phosphotransferase activity,
FT                   phosphate group as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:BL01030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21783"
FT                   /db_xref="GOA:P35140"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35140"
FT                   /protein_id="AAU21783.1"
FT                   /translation="MNLVLMGLPGAGKGTQAERIVEDFGIPHISTGDMFRAAMKEETDL
FT                   GLEAKSYIDKGELVPDEVTIGIVRERLGKNDCDGGFLLDGFPRTVAQAEALEEILKGLG
FT                   KSIDHVINIQVDKDALMERLTGRRICKNCGATYHLVFNPPAKENVCDKCGGELYQREDD
FT                   NEATVSTRLEVNMKQTQPLLDFYEDKGYLVNIDGQKHINEVYADIKELLGGRDK"
FT   gene            144636..145382
FT                   /gene="map"
FT                   /locus_tag="BL01029"
FT   CDS_pept        144636..145382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BL01029"
FT                   /product="methionine aminopeptidase"
FT                   /function="Molecular Function: methionyl aminopeptidase
FT                   activity, Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21784"
FT                   /db_xref="GOA:Q65P85"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P85"
FT                   /protein_id="AAU21784.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKKHIKPGISTKELDQIAE
FT                   RFITKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGKRVLRDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGTISDDDQKLLDVTEESLYRGLKEAKPGERLSNISHAIQTYVESEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGTRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITDAGFEILTKA"
FT   gene            145393..145722
FT                   /locus_tag="BL05010"
FT   CDS_pept        145393..145722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21785"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P84"
FT                   /protein_id="AAU21785.1"
FT                   /translation="MYRKTPEIGQFVRMTRGREMNQYAVVIDIVDHHHVLVADGEKRKF
FT                   HSPKKKNINHLTFYDCVSPEVQNSINETGRVTNGKLRFSLLKFVREQVTDLKKGEHLNG
FT                   ERRCN"
FT   gene            145700..145918
FT                   /gene="infA"
FT                   /locus_tag="BL01028"
FT   CDS_pept        145700..145918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BL01028"
FT                   /product="initiation factor IF-I"
FT                   /function="Molecular Function: translation initiation
FT                   factor activity, Biological Process: translational
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BL01028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21786"
FT                   /db_xref="GOA:Q65P83"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P83"
FT                   /protein_id="AAU21786.1"
FT                   /translation="MAKDDVIEVEGTVVETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            145952..146065
FT                   /gene="rpmJ"
FT                   /locus_tag="BL05011"
FT   CDS_pept        145952..146065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BL05011"
FT                   /product="ribosomal protein L36 (ribosomal protein B)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis, Molecular Function: structural constituen"
FT                   /db_xref="EnsemblGenomes-Gn:BL05011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21787"
FT                   /db_xref="GOA:Q65P82"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P82"
FT                   /protein_id="AAU21787.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            146088..146453
FT                   /gene="rpsM"
FT                   /locus_tag="BL01026"
FT   CDS_pept        146088..146453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BL01026"
FT                   /product="ribosomal protein S13"
FT                   /function="Molecular Function: RNA binding, Molecular
FT                   Function: structural constituent of ribosome, Cellular
FT                   Component: intracellular, Cellular Component: ribosome,
FT                   Biological Process: protein biosynthesis (GO:0006"
FT                   /db_xref="EnsemblGenomes-Gn:BL01026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21788"
FT                   /db_xref="GOA:Q65P81"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P81"
FT                   /protein_id="AAU21788.2"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQILKEAGVSEDTRV
FT                   RDLTEEELGKIRDVIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            146474..146869
FT                   /gene="rpsK"
FT                   /locus_tag="BL01027"
FT   CDS_pept        146474..146869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BL01027"
FT                   /product="ribosomal protein S11 (BS11)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21789"
FT                   /db_xref="GOA:Q65P80"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P80"
FT                   /protein_id="AAU21789.1"
FT                   /translation="MAAARKTNTRKRRVKKNIESGIAHIRSTFNNTIVTITDVHGNALS
FT                   WSSAGALGFKGSKKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            147044..147988
FT                   /gene="rpoA"
FT                   /locus_tag="BL01025"
FT   CDS_pept        147044..147988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BL01025"
FT                   /product="RNA polymerase (alpha subunit)"
FT                   /function="Molecular Function: DNA binding, Molecular
FT                   Function: DNA-directed RNA polymerase activity, Biological
FT                   Process: transcription, Molecular Function: DNA binding,
FT                   Molecular Function: DNA-directed RNA polymera"
FT                   /db_xref="EnsemblGenomes-Gn:BL01025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21790"
FT                   /db_xref="GOA:Q65P79"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P79"
FT                   /protein_id="AAU21790.1"
FT                   /translation="MIEIEKPKIETVEISDDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILNIKKLALKIYSEEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLGQNASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIFTPVSRVSYQVENTRVGQITNYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   gene            148066..148428
FT                   /gene="rplQ"
FT                   /locus_tag="BL01024"
FT   CDS_pept        148066..148428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BL01024"
FT                   /product="ribosomal protein L17 (BL15)"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21791"
FT                   /db_xref="GOA:Q65P78"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P78"
FT                   /protein_id="AAU21791.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTEARAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVADAEKNQDALQKLFSDVAPRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
FT   gene            148570..149415
FT                   /gene="cbiO1"
FT                   /locus_tag="BL01023"
FT   CDS_pept        148570..149415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO1"
FT                   /locus_tag="BL01023"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21792"
FT                   /db_xref="GOA:Q65P77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P77"
FT                   /protein_id="AAU21792.1"
FT                   /translation="MNQERLIAAEDITFRYQKDADRPALDHVSFHVSKGEWLAIVGHNG
FT                   SGKSTLARALNGLILPDEGSIKVGGIKLTEETVWDVRKKVGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENSGVPREDMVERVDWAVQQVNMQEFLDQEPHHLSGGQKQRVAIAGVLAARPDI
FT                   MILDEATSMLDPMGREEVLDTVRRLKDQGMVTVISITHDLNEAAKADRIIVMNSGRKFA
FT                   EGTPQEVFRLNQDLIKIGLDLPFSFQLTQMLKESGLALKGDHLTQEGLVNELWTLKSKM
FT                   "
FT   gene            149391..150260
FT                   /gene="ybaE"
FT                   /locus_tag="BL01022"
FT   CDS_pept        149391..150260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="BL01022"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21793"
FT                   /db_xref="GOA:Q65P76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P76"
FT                   /protein_id="AAU21793.1"
FT                   /translation="MDIEIKDVEHRYQMKTPFERLAIYDVNAVIKEGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLKPTKGQIRLGEDVLEAGKKNKHLKALRKKVGIVFQFPEHQLFEETIL
FT                   KDIAFGPINFGMSREKAEEKAREMLKLVGLGAELSDRSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPRGRKEIMDMFYSLHKQRNLTTILVTHSMEDAAAYADELIVMHKG
FT                   TVKAKGTPRELFSRKDDIAALGLDLPETIKFQKRLEETLGITFKAPILTIEEAASEVKA
FT                   LFQEENAL"
FT   gene            150257..151054
FT                   /gene="ybaF"
FT                   /locus_tag="BL01021"
FT   CDS_pept        150257..151054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaF"
FT                   /locus_tag="BL01021"
FT                   /product="Cobalt transport protein"
FT                   /function="Biological Process: cobalt ion transport,
FT                   Biological Process: vitamin B12 biosynthesis, Molecular
FT                   Function: cobalt ion transporter activity"
FT                   /note="ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21794"
FT                   /db_xref="GOA:Q65P75"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P75"
FT                   /protein_id="AAU21794.1"
FT                   /translation="MMDNIIIGKYVPGKSVIHRLDPRTKLLTIFLFVFIVFFANNTETY
FT                   ALLGLFTVAAAALSGVPVRFLIKGMKPVFWIVLFTFLLHIFMTREGPVLADLGLFKIYE
FT                   QGLVQGIFISLRFVYLIMITTILTLTTTPIEVTDGLEHLLGPFKKLKLPVHELALMMSI
FT                   SLRFIPTLIEETDKIMKAQMARGVDFANGPVKERVKAIVPLLVPLFVSAFKRAEELATA
FT                   MEARGYRGGEGRTKYRQLTWKWKDTSVLLILAVLGVLLILLRT"
FT   gene            151065..151808
FT                   /gene="truA"
FT                   /locus_tag="BL01020"
FT   CDS_pept        151065..151808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BL01020"
FT                   /product="pseudouridylate synthase I"
FT                   /function="Molecular Function: pseudouridylate synthase
FT                   activity, Biological Process: tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BL01020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21795"
FT                   /db_xref="GOA:Q65P74"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P74"
FT                   /protein_id="AAU21795.1"
FT                   /translation="MRMKCTISYDGHLFYGYQVQPGQRTIQDELEKALQTLHKAKERIP
FT                   VVSSGRTDSGVHAVGQTIHFDSPLSIPEAKWPYALNALLPDDISVRKAEAVNDQFHARF
FT                   SAKRKEYRYMIYRGRHPDVFKRYYAYHVPYDLDMEKVKEASRYLVGTHDFTSFCATKTE
FT                   VKDKVRTVHELEWSDTGDGLQMRIVGSGFLYNMVRIIAGTLLDVGTGKFSPGDIEKMIL
FT                   AKNRDAAGRTAPAHGLYLWRVIYDN"
FT   gene            151969..152406
FT                   /gene="rplM"
FT                   /locus_tag="BL01019"
FT   CDS_pept        151969..152406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BL01019"
FT                   /product="ribosomal protein L13"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21796"
FT                   /db_xref="GOA:Q65P73"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P73"
FT                   /protein_id="AAU21796.1"
FT                   /translation="MRTTPMANASNIERKWLVVDAAGKTLGRLSTEVASILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHQAQKPEVYELRG"
FT   gene            152427..152819
FT                   /gene="rpsI"
FT                   /locus_tag="BL01018"
FT   CDS_pept        152427..152819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BL01018"
FT                   /product="ribosomal protein S9"
FT                   /function="Molecular Function: structural constituent of
FT                   ribosome, Cellular Component: intracellular, Cellular
FT                   Component: ribosome, Biological Process: protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21797"
FT                   /db_xref="GOA:Q65P72"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P72"
FT                   /protein_id="AAU21797.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIIVNNREISEHIPSAALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGFSGQAGAIRHGIARALLEADPEYRSTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            complement(152870..153328)
FT                   /gene="yizA"
FT                   /locus_tag="BL01013"
FT   CDS_pept        complement(152870..153328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yizA"
FT                   /locus_tag="BL01013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21798"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P71"
FT                   /protein_id="AAU21798.1"
FT                   /translation="MKGLFQYNWEVRHAWFKWCLSQPQEELVKKRSGGMGSIKKNLFHI
FT                   VDVEVSWIYAILEKPDIQPDYSHYQTIQQIARFSDLHRSEIESVIFNYSSAFEHLPVKA
FT                   AWSDEVCTQGDILRHLIAHEIHHIGQISVWTRESGSAPVSASYIGRKI"
FT   gene            153440..153883
FT                   /gene="ybaK"
FT                   /locus_tag="BL01017"
FT   CDS_pept        153440..153883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BL01017"
FT                   /product="conserved hypothetical protein YbaK"
FT                   /db_xref="EnsemblGenomes-Gn:BL01017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21799"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P70"
FT                   /protein_id="AAU21799.1"
FT                   /translation="MGTVVSFNNEKQKKQINLEKQLLRELSLEKMLNSAEECFAPLFHF
FT                   FSKHTDILYDGCIDFAIEAYLLGAEYGKFGYHGEPVHRAMIRSEKEEKQLLHELYEYAV
FT                   SWSEAFNVQAAYEPLYYACEYFIQSWWKEGFSQRERRFKLRLR"
FT   gene            153976..154689
FT                   /gene="cwlD"
FT                   /locus_tag="BL01016"
FT   CDS_pept        153976..154689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BL01016"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /function="cell wall hydrolase, Molecular Function:
FT                   N-acetylmuramoyl-L-alanine amidase activity, Biological
FT                   Process: peptidoglycan catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21800"
FT                   /db_xref="GOA:Q65P69"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P69"
FT                   /protein_id="AAU21800.1"
FT                   /translation="MKKKIKWLGFLLGFVVLLCLFQYQFNNDDSWRSWNLPLSGKIIYI
FT                   DPGHGGADGGASSGELLEKDVALEVSLRIRDYLQEQGALVMLTREDDHDLAPEETRGLS
FT                   RRKAEDLRKRVDMINNSEADLYLSIHLNAIPSARWSGAQSFYYGQYEENERAAKFIQDE
FT                   LRHNLENTTRKAKRIHGIYLMQNVKKPGALVEIGFLSNPEEAKQLAKPKYQDKIAASVY
FT                   KGVLRYFTEDRDPPE"
FT   gene            154775..155836
FT                   /gene="mrp"
FT                   /locus_tag="BL01015"
FT   CDS_pept        154775..155836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="BL01015"
FT                   /product="putative ATP-binding protein Mrp"
FT                   /db_xref="EnsemblGenomes-Gn:BL01015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21801"
FT                   /db_xref="GOA:Q65P68"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P68"
FT                   /protein_id="AAU21801.2"
FT                   /translation="MLREDDVKKIVGDLDEPFLHKPLRELDAVKEIKIKPEKRHVSVKV
FT                   ALAKTGSAEQMQLQQEIVIRLKEAGAETVGLRFEELPEEVVMSYQESAKGQDQSLLNSE
FT                   KQPVFLAVASGKGGVGKSTVSVNLAVSLARIGKKVGLIDADIYGFSVPDMMGITVRPTI
FT                   EGEKVVPVERFGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFHEVEWGDVDYIILDLP
FT                   PGTGDVALDVHSMLPSCKEVIVSTPHPTAAFVAARAGAMALKTDHEIVGIVENMAYYES
FT                   VKTGEKEYVFGKGGGEKLAEELGVPILGKIPLKQPDWDDSEFAPSVYDESHPTGAIYLD
FT                   IAKKIDESIGAKA"
FT   gene            complement(155890..156471)
FT                   /gene="gerD"
FT                   /locus_tag="BL01012"
FT   CDS_pept        complement(155890..156471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BL01012"
FT                   /product="GerD"
FT                   /function="germination response to L-alanine and to the
FT                   combination of glucose, fructose, L-asparagine, and KCl
FT                   (early stage)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21802"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P67"
FT                   /protein_id="AAU21802.1"
FT                   /translation="MFKTAMLSISCFLFLSVTACAPTDQAAEMDYDQTKKMVVDILKTD
FT                   DGKKAIQEILNDDKLNETLVMDEKTVKETVEKTMTSKKGAEFWKKVFEDPKFAEGFAKT
FT                   LQNEHEKVLKKLMKDPEYQKMLMQVMQDPEMAKKYGELVRSQEFRSHLQEVISDTLTSP
FT                   LYRKQFEEELKKAAAESMKEEMKGGEEKQS"
FT   gene            156586..157185
FT                   /gene="kbaA"
FT                   /locus_tag="BL01014"
FT   CDS_pept        156586..157185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BL01014"
FT                   /product="kinB signaling pathway activation protein KbaA"
FT                   /function="activation of the KinB signaling pathway to
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:BL01014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21803"
FT                   /db_xref="GOA:Q65P66"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P66"
FT                   /protein_id="AAU21803.1"
FT                   /translation="MKSRNLVRFFFSVLGVGALTTSIVGFAIEWGRYKELFLSFEVLEI
FT                   LSVLFWFIGVGMIFSVIAQMGFVIFLTIHRFALEIFRSHSLWNSIQLFLIIFVAFDLVY
FT                   LRFLFFEKDGGSIIPYIWLPLFILAVGIAAAYAKQKQSSKKTFVSALFLMFVFTVMEWF
FT                   PALRVNEEDWLYLMLLPLLACNAFQLLMLPKFQARA"
FT   gene            complement(157194..157958)
FT                   /gene="pdaB"
FT                   /locus_tag="BL01011"
FT   CDS_pept        complement(157194..157958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BL01011"
FT                   /product="Polysaccharide deacetylase,Carbohydrate Esterase
FT                   Family 4"
FT                   /function="Biological Process: carbohydrate metabolism,
FT                   Molecular Function: hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds"
FT                   /db_xref="EnsemblGenomes-Gn:BL01011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21804"
FT                   /db_xref="GOA:Q65P65"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P65"
FT                   /protein_id="AAU21804.1"
FT                   /translation="MNHFYVWHIKRIKQLIIIMIAAFATASFFYVQNLLPLPVFSTEGG
FT                   AKAVYRGDSDTNEVALTFNISWGDQKAMPILDTLKANGIKDATFFLSASWAERHPDVVE
FT                   RIRKDGHQIGSMGYAYKNYSQMKKSEIKKDLAKARHSFQKLGLDDLTLLRPPTGQFNKD
FT                   VLDVAKQYGYTVVHYSINSDDWTNPGVQKIVQNVNGTVNAGDIVLFHASDSAKQTKEAL
FT                   PEIVHHLRSKGLKNVTVSELIANTDAKSSEVK"
FT   gene            158304..159849
FT                   /locus_tag="BL_rrna_0010"
FT   rRNA            158304..159849
FT                   /locus_tag="BL_rrna_0010"
FT                   /product="16S ribosomal RNA"
FT   gene            160022..162952
FT                   /locus_tag="BL_rrna_0011"
FT   rRNA            160022..162952
FT                   /locus_tag="BL_rrna_0011"
FT                   /product="23S ribosomal RNA"
FT   gene            163085..163120
FT                   /locus_tag="BL_rrna_0012"
FT   rRNA            163085..163120
FT                   /locus_tag="BL_rrna_0012"
FT                   /product="5S ribosomal RNA"
FT   gene            163244..163318
FT                   /locus_tag="BL_trna_0008"
FT   tRNA            163244..163318
FT                   /locus_tag="BL_trna_0008"
FT                   /product="tRNA-OTHER"
FT   gene            163321..163393
FT                   /locus_tag="BL_trna_0009"
FT   tRNA            163321..163393
FT                   /locus_tag="BL_trna_0009"
FT                   /product="tRNA-Thr"
FT   gene            complement(163780..164949)
FT                   /gene="pbpX"
FT                   /locus_tag="BL02713"
FT   CDS_pept        complement(163780..164949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="BL02713"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02713"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21805"
FT                   /db_xref="GOA:Q65P64"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P64"
FT                   /protein_id="AAU21805.1"
FT                   /translation="MARTYRTRIKKRKKQKTKRRLIIFSFLVVCGLIYLALPSGMRDHQ
FT                   ENQLQATEKKAQPEAKKKPTQNETKKSKIVTKNDNAQLDQYLKSIGFSGTALIVEDGKV
FT                   VTSKGYLYANREEMVPNTPDTVFYVGSSQKAIIATAILQLEEKGLLSVNDPVSKYLPNF
FT                   PNGSKITLYHFLTHTSGIRGHKEGRGYISPEDLIKDIEKRGVKYPTGKWDYRDSNYSVL
FT                   AYIVSMVSGEPVDQYIKKHIFKPAGMKHAGFYKTFAKESNPSTGYKLNLQKKLYTPDMP
FT                   DLSQLYGAGDIYMTAYDMYLFDKALYERKIISNESFMKMFTPNKATYGMGFYVSPGSYS
FT                   SHGVMPGYNILNSFSLTGSRYVILFSNIQNNIKSFGSVNNRIFSILNGF"
FT   gene            165124..165345
FT                   /locus_tag="BL05012"
FT   CDS_pept        165124..165345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21806"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P63"
FT                   /protein_id="AAU21806.2"
FT                   /translation="MNKLLYRSMEDGIPVEIIYMKKSGFSKRAILVKEIKNGYVKAFCF
FT                   QKQQIRMFKIESILSVFPYKKRNSAHYA"
FT   gene            165457..166434
FT                   /gene="ybaS"
FT                   /locus_tag="BL02696"
FT   CDS_pept        165457..166434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="BL02696"
FT                   /product="Bile acid:sodium symporter"
FT                   /function="Biological Process: sodium ion transport,
FT                   Molecular Function: bile acid:sodium symporter activity,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02696"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21807"
FT                   /db_xref="GOA:Q65P62"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P62"
FT                   /protein_id="AAU21807.1"
FT                   /translation="MLQTINKTLGKIMPLLTPLSVVSGVLLADYLNGLASLVPWIFAFM
FT                   TFAGSLGANFQSLKTAVAHPLPMFLALFVLHIFMPVLAWSTGHLVFSGDSLTITGLTLG
FT                   VVIPTGITSMIWAAMYKGNIGLTLSIILVDTILSPFIVPFSLSILAGAHVEMDVIGMMK
FT                   GLVGMIVIPSLLGMLVNQFSTPERTVRLSANCAPFSKVGLAAVVAINSSVVAPYLKNVD
FT                   LKFLTIAVTVFLVAFTGYLTAWLIGRLMKRPQEEIVALIFTGGMRNISAGAVLATSFFP
FT                   PQVAVPVVIGMLFQQILAALFGHLLARSELKKAHHLDKKTSLPS"
FT   gene            166469..166882
FT                   /gene="yxaJ"
FT                   /locus_tag="BL02697"
FT   CDS_pept        166469..166882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxaJ"
FT                   /locus_tag="BL02697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02697"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21808"
FT                   /db_xref="GOA:Q65P61"
FT                   /db_xref="InterPro:IPR020204"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P61"
FT                   /protein_id="AAU21808.1"
FT                   /translation="MKTNRVSVMIWTLISAFLFCSMIVAASLSPLAHSGPHANEFGTLG
FT                   MWAAIGTVLLFYMLPLAVYMAGFDAMKFVMAVLCGIGLIITLTMSPVFVLIGAIGGNAS
FT                   ALLGVAGLCVLLAIVNVIWLVVAFRRTSASASF"
FT   gene            complement(166898..167767)
FT                   /locus_tag="BL02714"
FT   CDS_pept        complement(166898..167767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02714"
FT                   /product="Phenazine biosynthesis PhzC/PhzF
FT                   protein,Aminoacyl-tRNA synthetase, class I"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: biosynthesis, Molecular Function: tRNA
FT                   ligase activity, Molecular Function: ATP binding,
FT                   Biological Process: tRNA aminoacylation for protein tra"
FT                   /db_xref="EnsemblGenomes-Gn:BL02714"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21809"
FT                   /db_xref="GOA:Q65P60"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P60"
FT                   /protein_id="AAU21809.1"
FT                   /translation="MDFYLVDVFAETKYTGNQLAVFKAEKNLSSDEMQKIAREINFSET
FT                   TFILGKQGNGGYDVRIFTPEKEIPFAGHPTLGTAFIIKNEIETEPSSNVILNVTAGAIP
FT                   VTFEKGADQIIWMKQNPPVFNRTFDKEMMAGVIGIDTSDMDSNFPIQEVSTGLPAVIVP
FT                   LNSLNAVKKCKINKDRFEAFMKETEASLLVFTTETYHEQNHINARVFCDCFSVPEDPAT
FT                   GSAIGGLAGYLLHHGYFNQHYLSIRAEQGFEINRPSLLHLEAQITENSTEIHVGGNVHL
FT                   IAKGSWQI"
FT   gene            complement(167873..169102)
FT                   /gene="ybbC"
FT                   /locus_tag="BL02715"
FT   CDS_pept        complement(167873..169102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BL02715"
FT                   /product="conserved hypothetical protein YbbC"
FT                   /db_xref="EnsemblGenomes-Gn:BL02715"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21810"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P59"
FT                   /protein_id="AAU21810.1"
FT                   /translation="MGKKAIWLLAGMFVFSTLTAAAAFPDKEKKAKVSPGIEVLMNKKS
FT                   ILKGKRVGLITNPTGVNSTLTSSIDLLHQAPGIELTALYGPEHGVRGDAQAGDKVDSYI
FT                   DEKTGLPVYSLYGDTRKPTPEMLKNVDVLLFDIQDVGTRFYTYIYTMAYAMEAAKENDI
FT                   PFIVLDRPNPQNGLKVEGPVLDPDYSSFVGMYPVPLSHGMTAGELAKLFNDEFNIGADL
FT                   TVIKMKGWKRQMFFEDTGLPFVLPSPNMPTPDTSIVYPGTGLIEGTNMSEGRGTTKPFE
FT                   LIGAPYMKSTELAEKLNGLKLPGVRFRAASFNPTFSKHQNKLCHGVELYVTNRSAFKPV
FT                   NTGIAIIKTVHDLYPDDFEFLPSGNFNRLIGNGWVKTMIEQGASIDEIAKKYEAEQKRF
FT                   MNIRKKYLLY"
FT   gene            complement(169102..171033)
FT                   /gene="ybbD"
FT                   /locus_tag="BL02716"
FT   CDS_pept        complement(169102..171033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="BL02716"
FT                   /product="Glycoside hydrolase, family 3"
FT                   /function="Molecular Function: hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds, Biological Process:
FT                   carbohydrate metabolism"
FT                   /note="probable beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02716"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21811"
FT                   /db_xref="GOA:Q65P58"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P58"
FT                   /protein_id="AAU21811.1"
FT                   /translation="MKRFLQCALIALLLSSLALQPAAREAEAKQRPEQNIKQMVSSMSL
FT                   EEKIGQMLMPDFRNWKKKGESSAKGLTEMNDEVAGIIEKYRLGGVILFAENVTGTEQTV
FT                   RLTDGLQQASPDIPLFITIDQEGGIVTRLESGTNLAGNMAVGASRSSKNAFRSGKIIGK
FT                   ELSSLGINVNFSPVLDVNNNPDNPVIGVRSFSSKPELTSKLGIQMMKGLQDEQMIATAK
FT                   HFPGHGDTAVDSHYGLPLVPHNEKRLRSVELAPFQKAIDAGIDMIMTAHVQFPAFDDTT
FT                   YKSKKDGEDIMVPATLSKKVMTDLLRKDLSFKGVVVTDALNMKAISDNFGQEEAVVMAV
FT                   KAGVDIALMPAQVTSLETEKNLARVFEALLTAVKNGDIPMEQIDQSVERILQLKIDRGI
FT                   IDHTGSEPLQKKIKYALKTVGSSKHMKYEKKMARDSATILKNDKSTLPFKPKKGDTVLI
FT                   LAPYEEQTAAIAKTISKIRKNIKVVEYRFAEKTFEEEIQKKIDEADYVITGSYVIKNDP
FT                   VVNDGVIDDSIQDSSKWATAFPRAAMKYAQANGKKFVLMSLRNPYDTANFEEAEAVIAV
FT                   YGFKGYANGRFRQPNIPAGVEAIFGKAKPKGTLPVDIPSVTRPGETLYPYGYGLNIKNG
FT                   KPLHKGGS"
FT   gene            complement(171049..172395)
FT                   /gene="ybbE"
FT                   /locus_tag="BL02717"
FT   CDS_pept        complement(171049..172395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbE"
FT                   /locus_tag="BL02717"
FT                   /product="putative beta-lactamase YbbE"
FT                   /db_xref="EnsemblGenomes-Gn:BL02717"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21812"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P57"
FT                   /protein_id="AAU21812.1"
FT                   /translation="MISAAASLLLLTCFFPLPSTAQTAIGNETKQRLTYPVLTKAKTPE
FT                   EAGFSSKKLKAVDRLIEQDVKAGFPGAALILIKDGKIIKKEVYGYKQKYNGLIALKHPK
FT                   KMKANTMFDLASNTKMYAVNFALQHLVSTGKLDLNKNISQYLPDFKDHPEDDVKGKNRL
FT                   RVIDLLHHNAGFPASWNYYDPKSAGHLYSQSRSKTLEYLVKTPLAYEPGTKQIYSDIDY
FT                   MLLGLIIEKITNERLDTFVENRFYRPLGLRHTLFNPLQKGFKRSHFAATERLGNTRDGT
FT                   ISFPNIRTYTLQGEVHDEKAFYSMEGVSGHAGLFSTVDDAAVLLQVMLNGGGYGRQHLF
FT                   SSSVISQFTEPSKTNPTYGLGWRLNGNTDMEWMFGKHASSKAYGHTGWTGTVTIIDPVY
FT                   QIGIVLLTNKKHSPVINPKENPNQFEGDEFATGKYGSVITAVYEALHHQ"
FT   gene            complement(172463..173830)
FT                   /gene="ybbF"
FT                   /locus_tag="BL02718"
FT   CDS_pept        complement(172463..173830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="BL02718"
FT                   /product="Phosphotransferase system PTS, EIIB
FT                   domain,Phosphotransferase system, EIIC"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: transport, Biological Process:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, Cellular Component: membrane, Molecular Functio"
FT                   /note="probable PTS sucrose-specific enzyme IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BL02718"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21813"
FT                   /db_xref="GOA:Q65P56"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P56"
FT                   /protein_id="AAU21813.1"
FT                   /translation="MSDEKKYAGLARLILQHIGGPSNVADHTHCMTRLRITPVNSQKTD
FT                   IDSIKALEGVIGVVEEETLQIILGTGVVQHVSDEFGKLLKSAEHVDLKESAAKHKAEIS
FT                   KKNATPFKLFLRRIASIFIPLIPALVASGLITGITKAVIQAGWLAETSQTAIILTVIGS
FT                   GLFTYLGILVGINTAKEFGGSPALGGLAGILIINPAVGEISLFGEALLPGRGGLIGILF
FT                   AAAFIAFLEKRVRRLVPHSLDIIITPTVSLLITGIVTYVVFMPVGGLISDAITSGLLAI
FT                   LDLGGIIAGFVLGATFLPLVVTGLHQGLTPVHMELINSIGDDPLLPILAMGGAGQVGAA
FT                   FAIYFKTKKAKLKRAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGVGGAFQAY
FT                   FKIATVSIGVSGLPLSFLVHTHQVLLYILGLFISYAAGFVLTYSFGFKDDMAVEFD"
FT   gene            complement(173857..174705)
FT                   /gene="ybbH"
FT                   /locus_tag="BL02719"
FT   CDS_pept        complement(173857..174705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbH"
FT                   /locus_tag="BL02719"
FT                   /product="probable transcriptional regulator YbbH"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent, Molecular Function: sugar binding,
FT                   Biological Process: carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02719"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21814"
FT                   /db_xref="GOA:Q65P55"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P55"
FT                   /protein_id="AAU21814.1"
FT                   /translation="MAAGGLEIIQNMLHKLPQSERKLAEYILKNPHEIVNGTIQEVSSS
FT                   AKTSGAAAIRLCKSLGLKGFQDLKMRVAGDLMKPSDQGYRDIEPQEPLHSIVQKTTSNS
FT                   IQAIRDTFENIDHEELQKAIQILINAETVHFCGIGASGIVAQDAQQKFLRINKKATAFS
FT                   DMHLVATLIANAGENDVLFAISHSGETQEIANAVRLAKKHGIKTIGLTRLGQSAVASLS
FT                   DIALYTSCSNEAPFRSAATSSRLTQLYMIDLLFLGMAAERYEDIIQYIDQTKAAIRMMG
FT                   I"
FT   gene            complement(174724..175638)
FT                   /gene="ybbI"
FT                   /locus_tag="BL02720"
FT   CDS_pept        complement(174724..175638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbI"
FT                   /locus_tag="BL02720"
FT                   /product="putative sugar phosphate isomerase YbbI"
FT                   /db_xref="EnsemblGenomes-Gn:BL02720"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21815"
FT                   /db_xref="GOA:Q65P54"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P54"
FT                   /protein_id="AAU21815.1"
FT                   /translation="MENSHLGSLTTERRNERSKRIHQAETIDMLKIMNDEDKTVAEAVQ
FT                   EVLPDVKTAVDYAVGSLKKGGRIIYIGAGTSGRLGVLDAAECPPTFSISPESVIGIIAG
FT                   GEKALYNAVEGAEDHEAFGRRDLEAVNLSNNDTVIGIAASGRTPYVLGALKYAKKTGAK
FT                   AISLTCNENSAISQAADHSIEVVVGPEVIAGSTRMKAATAHKMILNMISTAAMIKMGKV
FT                   YENLMVDVKVSNDKLKERAIRIIQTVTGMPNETAAQALEMSNNQVKTAIIMLKTNEDAA
FT                   AAEKLLEKSEGDIEKALSIYEKS"
FT   gene            complement(175813..176265)
FT                   /gene="ybbK"
FT                   /locus_tag="BL02721"
FT   CDS_pept        complement(175813..176265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BL02721"
FT                   /product="conserved hypothetical protein containing DUF523
FT                   domain YbbK"
FT                   /db_xref="EnsemblGenomes-Gn:BL02721"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21816"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZJ2"
FT                   /protein_id="AAU21816.1"
FT                   /translation="MILVSSCLAGVECRYNGSHSYVEKINKLVEEKKAVMACPELLGGF
FT                   QTPREPAEIIGGTGEDVLDGKAVIKTQSGNDVTDLYVKGAYQTLEMARQIKADTIVLKE
FT                   NSPSCGSSHIYDGSFSSKKIAGNGLTAALLKKEGFRVISEHQIDEL"
FT   gene            176448..176521
FT                   /locus_tag="BL_trna_0010"
FT   tRNA            176448..176521
FT                   /locus_tag="BL_trna_0010"
FT                   /product="tRNA-Glu"
FT   gene            176672..176747
FT                   /locus_tag="BL_trna_0011"
FT   tRNA            176672..176747
FT                   /locus_tag="BL_trna_0011"
FT                   /product="tRNA-Val"
FT   gene            176806..176878
FT                   /locus_tag="BL_trna_0012"
FT   tRNA            176806..176878
FT                   /locus_tag="BL_trna_0012"
FT                   /product="tRNA-Thr"
FT   gene            176887..176971
FT                   /locus_tag="BL_trna_0013"
FT   tRNA            176887..176971
FT                   /locus_tag="BL_trna_0013"
FT                   /product="tRNA-Tyr"
FT   gene            176976..177047
FT                   /locus_tag="BL_trna_0014"
FT   tRNA            176976..177047
FT                   /locus_tag="BL_trna_0014"
FT                   /product="tRNA-Gln"
FT   gene            177173..178087
FT                   /locus_tag="BL02698"
FT   CDS_pept        177173..178087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02698"
FT                   /product="arginase"
FT                   /function="Molecular Function: arginase activity,
FT                   Biological Process: arginine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02698"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21817"
FT                   /db_xref="GOA:Q65P52"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P52"
FT                   /protein_id="AAU21817.1"
FT                   /translation="MLKQQISMIGVPMDLGQLRRGVDMGPSAIRCAGVNERLECLCQDI
FT                   EDLGDMTIGQREDEKEGGEPASEELRNLKAITKASVKLAETVDNIVASGAFPLVLGGDH
FT                   SIAIGTLAGLAKHYQNLGVIWYDAHADLNTKETSPSGNIHGMPLAISLGIGHEGLTAIY
FT                   GKEAKIKAENIVIIGARSLDDGEKELIRDKGIKVYTMHEIDRLGMTRVMEETIDYLRGR
FT                   TDGVHLSLDLDALDPNDAPGVGTPVAGGISYRESHLAMEMLEESKLITSAEFVEVNPIL
FT                   DEKNRTAEAAVALMGSLFGEKLL"
FT   gene            178313..178876
FT                   /gene="sigW"
FT                   /locus_tag="BL02699"
FT   CDS_pept        178313..178876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="BL02699"
FT                   /product="RNA polymerase ECF(extracytoplasmic
FT                   function)-type sigma factor (sigma-W)"
FT                   /function="probably activates a large stationary-phase
FT                   regulon that functions in detoxification, production of
FT                   antimicrobial compounds or both (pbpE-racX, yteI, yuaG,
FT                   yknXYZ, ydjP, yfhM), Molecular Function: DNA binding,
FT                   Molecular Function: transcription factor activity,
FT                   Biological Process: transcription initiation, Biological
FT                   Process: regulation of transcription, DNA-dependent,
FT                   Molecular"
FT                   /db_xref="EnsemblGenomes-Gn:BL02699"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21818"
FT                   /db_xref="GOA:Q65P51"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P51"
FT                   /protein_id="AAU21818.1"
FT                   /translation="METMIKKRIKQVKKGDRNAFADIVDIYKDKIYQLCYRMLGNAHEA
FT                   EDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   TMYSQVAADVALPEDEVVSLELHSTIQEKILRLPDKYRTVIVLKYIDELSLIEISEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   gene            178890..179510
FT                   /gene="rsiW"
FT                   /locus_tag="BL02700"
FT   CDS_pept        178890..179510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BL02700"
FT                   /product="antisigma factor RsiW"
FT                   /function="controls induction of genes in the sigW regulon"
FT                   /db_xref="EnsemblGenomes-Gn:BL02700"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21819"
FT                   /db_xref="GOA:Q65P50"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P50"
FT                   /protein_id="AAU21819.1"
FT                   /translation="MSCPEHIVQLMHKYLDGDILPEDETRLKEHLQSCEGCKKHLHEME
FT                   KSIALVQSTSHLTAPANFTANVLANLPKEKRTASINRWLKAHPFLVAAALFAILMGGSF
FT                   FSSWKNDHDFSVSSQPNLVVKNNTVIVPEGEVVKGDVTVKNGKLIIEGKVDGDVTIVNG
FT                   EKYTASAGQVTGQIHEINEVFDWIWYKIKSTGKSVFGVKESKE"
FT   gene            179676..180497
FT                   /gene="ybbP"
FT                   /locus_tag="BL02701"
FT   CDS_pept        179676..180497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="BL02701"
FT                   /product="conserved hypothetical containing domain DUF147
FT                   YbbP"
FT                   /db_xref="EnsemblGenomes-Gn:BL02701"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21820"
FT                   /db_xref="GOA:Q65P49"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P49"
FT                   /protein_id="AAU21820.2"
FT                   /translation="MAFEDIPFLQYLGDAVDILLVWYVIYKLMMVIRGTKAVQLLKGIV
FT                   VIVLVRLASQYLGLSTLQWLVDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   EEEQQQKTIDAITKAIKYMAKRRIGALLTIERETGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNDEVAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTVVVS
FT                   EETGGISVAKNGDLHRDLSEEALKNMLEAEFKKNSRETSSNRWYWRAKKNG"
FT   gene            180490..181806
FT                   /gene="ybbR"
FT                   /locus_tag="BL02702"
FT   CDS_pept        180490..181806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="BL02702"
FT                   /product="conserved hypothetical protein YbbR"
FT                   /db_xref="EnsemblGenomes-Gn:BL02702"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21821"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P48"
FT                   /protein_id="AAU21821.1"
FT                   /translation="MDKFLNNPWAVKVVALLFAFLLYFAVHSAQAPTPKKPGESFFPTS
FT                   TTDEATLTDIPVKSFYDDENYVVTGVPQTVNVTIKGPTGTVKKVRQVKDFEIYADMQNL
FT                   KTGRHKVELKARNVADGLTLTINPSVTTVTIEEKTTKEFPVEVDFYNKNKMKDGYTPEL
FT                   PIINPKNVSVTGSKAVIDRIQNIKATINLEGVDQTVEKEAKLTVYDKDGNVLPVEVSPS
FT                   VVKITVPVTSPSKKIPVKVDRKGSLPDGISISSLDISPGEVTVYGPQNVLDSLEFVEAD
FT                   EIDLSKIKDDTELEAGIKVPDGAKKVSPEKVKIKVKVDKEEEKKLKNVSIKTAGLNDSR
FT                   DLEFLDPKSGKLDITAKGSTAAIEKLQPSDVELYVNVADLDDGEHNVKLEVNGPQNMTW
FT                   SLPRQSIRVKISSQTTQNEKNNGQDEEEENHSEKDSQPS"
FT   gene            181827..183173
FT                   /gene="glmM"
FT                   /locus_tag="BL02703"
FT   CDS_pept        181827..183173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BL02703"
FT                   /product="putative Phosphoglucosamine mutase GlmM"
FT                   /note="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02703"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21822"
FT                   /db_xref="GOA:Q65P47"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P47"
FT                   /protein_id="AAU21822.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKDKERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQELEIERLMDQPEDHLPRPVGADLGMVNDYFEGGQKYLQFL
FT                   KQSADEDFTGIHVALDCAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALAEFVKEKGADVGMAFDGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLTDNTVV
FT                   STVMSNLGFYKALEAEGIKSVQTAVGDRYVVEAMKKGGFTLGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTIKMTGKPLSELAAEMQKFPQLLLNVKVTDKHKVTENEKVKAVIEEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCEKYVGRIADVVKAEMGAE"
FT   gene            183616..185418
FT                   /gene="glmS"
FT                   /locus_tag="BL02704"
FT   CDS_pept        183616..185418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BL02704"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /function="Molecular Function:
FT                   glutamine-fructose-6-phosphate transaminase (isomerizing)
FT                   activity, Cellular Component: cytoplasm, Biological
FT                   Process: carbohydrate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02704"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21823"
FT                   /db_xref="GOA:Q65P46"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P46"
FT                   /protein_id="AAU21823.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEDGVHVF
FT                   KEKGRIADLRAAVDANVKSQAGIGHTRWATHGEPSRLNAHPHQSASGRFTLVHNGVIEN
FT                   YVQLTREYLHDVTLKSDTDTEVVVQVIEQFVNNGLDTEEAFRQTLMLLKGSYAIALFDH
FT                   ENKETIYVAKNKSPLLVGLGDNFNVVASDAMAMLQVTNEYVELMDKEMVIVTDKKVVIK
FT                   NLDGELMSRASYIAELDASDIEKGTYPHYMLKEIDEQPLVMRKIIQTYQDENGKLSIPG
FT                   DISNAVAEADRVYIIACGTSYHAGLVGKQFIETWAKVPAEVHVASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQVKKLGHKALTLTNVPGSTLSREADYTLLLNAGPEIAVAST
FT                   KAYTAQIAVLAILAAVTAESRGKELGFDLVKELGIIGNAMEALCDQKDEMEMIAREYLT
FT                   VTRNAFFIGRGLDYFVCLEGSLKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVTARGANPCVISLKGLEEADDRFVLPEVHPELAPLVSVIPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            185609..185932
FT                   /locus_tag="BL02705"
FT   CDS_pept        185609..185932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02705"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21824"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P45"
FT                   /protein_id="AAU21824.1"
FT                   /translation="MNNETYIEVNRTSQLMNKMRKFTVLIDGVEAGKIKDGGRLRIDLE
FT                   PGEHEIQVKIDWCVSQALRFTLDEGEVLKFRCGSPVRGWKMFFGLFYVLADPEKYSFIE
FT                   LEE"
FT   gene            complement(186075..186683)
FT                   /locus_tag="BL02722"
FT   CDS_pept        complement(186075..186683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02722"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21825"
FT                   /db_xref="GOA:Q65P44"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P44"
FT                   /protein_id="AAU21825.1"
FT                   /translation="MFNLILKDIILQKKTLAASFLVLCVYLMLDISPIWVGVVFSIVIS
FT                   MYAFSIDEKSSIHMLLNSLPYTRKEIVSSKYIVVVLFTSMVAAAIFIVHFIIHREFTIW
FT                   KDILLMVAIVMTAASFMLPFCYKFKSNYLVIASIAAFGLYMLTINFLVQNLNDQIREFI
FT                   HMLLTLQNTFLYLIVAISIITLYGCSWLLSIRIYRNKVF"
FT   gene            complement(186664..187545)
FT                   /locus_tag="BL02723"
FT   CDS_pept        complement(186664..187545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02723"
FT                   /product="ABC transporter,ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Biological Process: transport,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02723"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21826"
FT                   /db_xref="GOA:Q62ZI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZI2"
FT                   /protein_id="AAU21826.1"
FT                   /translation="MDNVIELRHVHKSFDGFQLKDFSMSVKKGFITGFIGGNGVGKSTT
FT                   IKLIMNLLQPDSGTITVFGMNYKEHEKEIKQRIGFVFDSNIFYEHLTLAKMKDIVKRSY
FT                   VNWDEQVFNDYVNTFNLPLTKKIKTFSKGMIMKASLTVALSHHAELIIMDEPTSGLDPI
FT                   FRRELLEILHQLMQDGDKTIFFSTHITTDLDKIADYITFIDKGEHIFTKDFYEIEEQYA
FT                   IVKGGMELLDRETEQEFIAVRKSTHGFEALTANKSRTEKIFGDMALIEKPTLEDIMFYT
FT                   KKGAKEHVQLNS"
FT   gene            complement(187545..187922)
FT                   /locus_tag="BL02724"
FT   CDS_pept        complement(187545..187922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02724"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BL02724"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21827"
FT                   /db_xref="GOA:Q65P42"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P42"
FT                   /protein_id="AAU21827.1"
FT                   /translation="MKIIISNSSKQPIYEQIYTQIKDQILANELKPGQPLPSMRQLAKD
FT                   MNVSLITSKRAYEELEKNGFIYSVVGKGSFVSDQNDEIMKEGKMKAIEEQLSAVIKNSK
FT                   DIGVTLTELKDLLTILYQEEE"
FT   gene            188211..188405
FT                   /locus_tag="BL05013"
FT   CDS_pept        188211..188405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21828"
FT                   /db_xref="GOA:Q62ZI0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZI0"
FT                   /protein_id="AAU21828.2"
FT                   /translation="MNTIGVCVSQITDKLKMTQSTASQYLAILLRAGLIKAERIGKYTY
FT                   YKRDEEAIGKLADFLKTEI"
FT   gene            188550..189722
FT                   /gene="ybcL"
FT                   /locus_tag="BL02706"
FT   CDS_pept        188550..189722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="BL02706"
FT                   /product="probable transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /note="Major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BL02706"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21829"
FT                   /db_xref="GOA:Q65P40"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P40"
FT                   /protein_id="AAU21829.1"
FT                   /translation="MFSTWKIYLLAIISFLVGTSEYIISGILDQIAHTLGITLAAAGQL
FT                   ITIFSLVYAVFTPVLMALTASMDRRKLMMYALGLFVIGNILAFTLPGYGWFVAARVVMA
FT                   LGAGMVVVTALTIAAKIAPAGKQGSAIATVVMGFTASLIIGVPLGRMTAEALGWKSVFG
FT                   GIALLGFIAMIVLFLTLPHTEGDKPVPLLQQLSLLKKRKVAMGLSVTFFWLGGYSVAYT
FT                   YLSPYLLTVSGISGNLLSGVLLIFGIASLVGSKFGGYSTDKWGVPFTLVGGMALHIIAL
FT                   ILLSLVTHSYVGVLLILILWSFAAWSTGPTQQYHLATLEPELSGVLLGINQSMMQFAMA
FT                   AGAGIGGIFVEKVSLASITWFGALGVMIAIVVVLTTFSSRKAAHVREISS"
FT   gene            complement(189971..190375)
FT                   /locus_tag="BL02725"
FT   CDS_pept        complement(189971..190375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02725"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21830"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P39"
FT                   /protein_id="AAU21830.1"
FT                   /translation="MNFQLEEAIEILERTPQTLSQLLTGLSNPWISCDEGEDTWNAFDV
FT                   VGHLIEGEKNNWLPRIKMIVTKGATETFPPFDRFSQLNQNDGKTIEQLLNEFAEIRRAN
FT                   LKTLRQILDPETDFEQTGMHPEFGIVKLRE"
FT   gene            complement(190404..192140)
FT                   /gene="bmrA"
FT                   /locus_tag="BL02726"
FT   CDS_pept        complement(190404..192140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmrA"
FT                   /locus_tag="BL02726"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02726"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21831"
FT                   /db_xref="GOA:Q65P38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P38"
FT                   /protein_id="AAU21831.1"
FT                   /translation="MKTENNNSMKPFFSMILTSGVPRLALSAGLTASLVTTLVGLSIPL
FT                   LTREMVDGFSANSINLALSGILALVFIVQAVCDGFSTYFLSYAGQKVVASLRERMWFKL
FT                   LRLPVRYFDEKTSGETVSRVVNDTGIVESLISDHFPQFVSGIITIVGSVVILLIMDWKM
FT                   TLLMLISVPITTFIMIPLGMKMQRISKTMQDETASFTGHVQQTLSEIRLMKASNAEHTE
FT                   KMKGLSGISKLFQYGLKEARIFALVSPFMHLVIMIVIVAIIGYGGIRVSEGTMSAGSLI
FT                   AFLLYLFQIIFPITSFTMFFTQLQKAKGATERIIEIMHSEEEEGQEGLEMDISNLPIHV
FT                   ENVTFTYAGGEPVLRGVSFDVDPGQMIAFVGPSGGGKTTMFGLLERFYEPDSGAINIGE
FT                   TPISKLSMKSWRSQIGYVSQDSPMMSGTIRENLCYGLDHADSIDDQELWKVAEMAYADT
FT                   FIKQFPEQLDTEVGERGVKLSGGQRQRIAIARAFLRDPKILMMDEATASLDSQSEAIVQ
FT                   QALARLMEGRTTFVIAHRLSTIVNADQIMFIEKGEITGRGRHHELIASHALYREFAERQ
FT                   LT"
FT   gene            192335..192979
FT                   /gene="ywbO"
FT                   /locus_tag="BL02707"
FT   CDS_pept        192335..192979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywbO"
FT                   /locus_tag="BL02707"
FT                   /product="DSBA oxidoreductase YwbO"
FT                   /function="Molecular Function: protein disulfide
FT                   oxidoreductase activity, Cellular Component: periplasmic
FT                   space (sensu Gram-negative Bacteria)"
FT                   /note="Conserved protein B.clausii gene name: FrnE"
FT                   /db_xref="EnsemblGenomes-Gn:BL02707"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21832"
FT                   /db_xref="GOA:Q65P37"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P37"
FT                   /protein_id="AAU21832.1"
FT                   /translation="MTINIKVYSDYVCPFCFLGKDQLEKAIEGKDVEVEWLPFELRPRP
FT                   SEQLDPLNDPAKLAMWDGAIKPRIEAWGVNMKLPNVSPHPYTDLAHEGYHFAKEHGKGK
FT                   AYNDRVYKAFFQEEQDIGDIDVLTSLAKEAGLDEHAFKEALSARTYQDVQRKALQHAYE
FT                   EAGITAVPTFIIGNERIAGAAAKEVFEQAIEKESRQKPVDGLQCDLDGNNC"
FT   gene            193053..193472
FT                   /locus_tag="BL02708"
FT   CDS_pept        193053..193472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02708"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21833"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZH5"
FT                   /protein_id="AAU21833.1"
FT                   /translation="MTLHHFIAADRELPLGSFRDQTEEGLISIVKLDPGYEMVKTKLSK
FT                   PFVYEATGCLHRPGNDIRALFSYINSNIPEGEDIEVYSCWDGEEDKEKDDRLDFFIDIE
FT                   NLQLGKHVKLDKKKYIDEIAGLFYFEERQLVKIRK"
FT   gene            193547..194071
FT                   /locus_tag="BL02709"
FT   CDS_pept        193547..194071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02709"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02709"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21834"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P35"
FT                   /protein_id="AAU21834.1"
FT                   /translation="MSDHKAVHSVQAKAEGKTLVMERSFEAPRELVFKAFSGSVHLESW
FT                   WGPKGWQTANSRFEFQPDGVWLYCMECRDQNQGEFYGRKSCGKAVFQEIAAPEKIVYTD
FT                   MFTDEEGNVVPGMPEILNEVYFQERDVGTKLITRSHFSSPKELQQLLDKGMVEGFSSQL
FT                   ERLEDYLKAIR"
FT   gene            194180..195070
FT                   /gene="aadK"
FT                   /locus_tag="BL02710"
FT   CDS_pept        194180..195070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aadK"
FT                   /locus_tag="BL02710"
FT                   /product="aminoglycoside 6-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02710"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21835"
FT                   /db_xref="GOA:Q65P34"
FT                   /db_xref="InterPro:IPR007530"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P34"
FT                   /protein_id="AAU21835.1"
FT                   /translation="MRTEQEIIDLVLKVAREDSRVRAVGMNGSRTNPNVPRTNPNVPKD
FT                   PFRDYDIVYVVTDMQSFLDEPGWVDVFGERIIMQTPEAMELFPNELGNRFSYLMLFTDG
FT                   SRIDLILVPLEEKLEYSREDGLTVILLDKDQDLPVIPPPTDREYWVQKPSPQCFADCCN
FT                   EFWWTSTYVAKGLWRQEILYALDHLNLVRAMLLKMLEWKVGFETGFSLSIGKNAKFLDR
FT                   YVDQNTWERLLETYPPADYKRVWNSLFKMWELFEETAAAVAEHLNEQYLFAEAEKVRQY
FT                   LRRVQQLKPDAKEID"
FT   gene            195134..196081
FT                   /locus_tag="BL02711"
FT   CDS_pept        195134..196081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02711"
FT                   /product="conserved hypothetical kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02711"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21836"
FT                   /db_xref="GOA:Q65P33"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P33"
FT                   /protein_id="AAU21836.1"
FT                   /translation="MFSIKKMLQNHYGIDSVNISPEQGGWTALAYQVTDGEAAFFLKVY
FT                   DKNRASTAKWAALIDDYIPVLGWLGDHTALNGRLPVPLLTTAGEYKCEDDDAVYMLYEY
FT                   IAGETIGDQPLGKGCVEKLAGIIAELHRYDETIPVKTEGIKEKYDISFLDEMTQWLDHL
FT                   PCELATLIQPYSGAIRDMMESALSLADDLKCSGRRLALCHTDVHGWNLMKTGGELILID
FT                   WEGLKLAPVEADLMFFANQPYAQEFLRVYCETHKGFEIDQNALRFYQIRRRLEDIWEFT
FT                   EQLAFDIQTEKEKAETMSLLKNELEAIKDSKTGY"
FT   gene            196104..196823
FT                   /gene="yfnB"
FT                   /locus_tag="BL02712"
FT   CDS_pept        196104..196823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfnB"
FT                   /locus_tag="BL02712"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 YfnB"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: phosphoglycolate phosphatase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02712"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21837"
FT                   /db_xref="GOA:Q65P32"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P32"
FT                   /protein_id="AAU21837.1"
FT                   /translation="MKNYRTLFFDVDDTLLDFGAAEKSALRMLFEEQQIRLTAEIEANY
FT                   KRINQGLWRVFEKGEMDRDQVVNTRFSLLFKEYGLEADGVLLEKKYRSFLEEGHQLIDG
FT                   AFELIKSLRDQYDLYIVTNGVSKTQYKRLQASGLYPMFKGIFVSEDTGFQKPMKEYFDY
FT                   VFERIPHFSVDQGLIIGDSLTADIEGGRLAGLDTCWMNPGMIANDTGIVPTYQIQKLDE
FT                   LYYILNIEKESAAGHCL"
FT   gene            197117..198487
FT                   /gene="ybxG"
FT                   /locus_tag="BL05014"
FT   CDS_pept        197117..198487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BL05014"
FT                   /product="Amino acid permease YbxG"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21838"
FT                   /db_xref="GOA:Q65P31"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P31"
FT                   /protein_id="AAU21838.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSSSTIKWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPLAGYMTAWSNWFQWVIVGMS
FT                   EIIAVGEYMKYWFPDLPAWIPGIIAMAILGGANLVSVKSFGEFEFWFAMIKIVTIVLMI
FT                   AAGFGIIFFGFGNGGQAIGFSNLWSHGGFFTGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRHAIQSIIWRILIFYIGAIFVIVTVYPWDELNAIGSPFVSTFAKVGITAA
FT                   AGIINFVVMTAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFTKISRNGVPLYGTIAVLIG
FT                   LAIGVVLNYIAPPNIFVYVYSASVLPGMIPWFVILLSHIGFRKAKGAEIDKHPFKMPFA
FT                   PVTNYLTIGFLLMVLVGMWFNNDTRVSLIVGVIFLAVVAASYYVFGIGKRASADGNK"
FT   gene            complement(198871..200169)
FT                   /gene="citM"
FT                   /locus_tag="BL00913"
FT   CDS_pept        complement(198871..200169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citM"
FT                   /locus_tag="BL00913"
FT                   /product="secondary transporter of divalent metal
FT                   ions/citrate complexes"
FT                   /function="Molecular Function: citrate transporter
FT                   activity, Biological Process: citrate transport, Cellular
FT                   Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00913"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21839"
FT                   /db_xref="GOA:Q65P30"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P30"
FT                   /protein_id="AAU21839.1"
FT                   /translation="MLAILGFFMMLVFMVLIMTKRLSVLTALVLTPIVFALIAGFGFSD
FT                   VGDMMISGIQQVAPTAVMIMFAILYFGIMIDTGLFDPMVTKILKMVKGDPLKIVVGTAV
FT                   LTMLVALDGDGSTTYMITTSAMLPLYLLLGIRPIILAGIAGVGMGIMNTIPWGGATPRA
FT                   ASALGVDPAELTGPMIPVIVSGMLCMIGVAYMLGKAERKRLGVIELKHPAGANETAAAA
FT                   EDEWKRPKLWWFNLLLTLSLIGLLISGKVSLTVLFIIAFCIALIVNYPNLDHQRQRISA
FT                   HSSNVLAIGSMIFAAGVFTGILTGTKMVDEMAISLASMIPEQMGGFIPMIVALTSGIFT
FT                   FLMPNDAYFYGVLPILSETAVAYGVNKVEIARASIIGQPIHMLSPLVPSTHLLVGLVGV
FT                   SIDDHQKFAIMWAVLAVIVMTGCALLIGSISIY"
FT   gene            complement(200374..201291)
FT                   /gene="yflP"
FT                   /locus_tag="BL00912"
FT   CDS_pept        complement(200374..201291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflP"
FT                   /locus_tag="BL00912"
FT                   /product="YflP"
FT                   /db_xref="EnsemblGenomes-Gn:BL00912"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21840"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZG8"
FT                   /protein_id="AAU21840.1"
FT                   /translation="MSGDERQSSAPRPPGGPVEIVVPAEPSGGWDLTAQAIQSVLKQKQ
FT                   VIKSEVKIVYKPGSGGDKGWKYINSSDTYTIGMTSSLMLSNYILGQSKLKTDDFTPLAI
FT                   LAKEWQTIALPKGSEIKSGKDLLNEIKKNPGKVKIGFSPGLGNDDQLSFVRAADMYGVD
FT                   PFNIQYLQYESSEELIQALIRHEIDAASMTLSEAKTYERSGSITLGAVTSDKRLPAYPH
FT                   VPTWREQGIPFVFSHWRGVLGPKNMTKEEISYWDQVFKKITSSPEWKQKINEQEWESYY
FT                   LNSKETQRFLEEQSAFYQNIMAGD"
FT   gene            complement(201336..202016)
FT                   /gene="citT"
FT                   /locus_tag="BL00911"
FT   CDS_pept        complement(201336..202016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="BL00911"
FT                   /product="two-component response regulator"
FT                   /function="involved in the response to the environmental
FT                   Mg-citrate complex (positive regulation of citM)"
FT                   /db_xref="EnsemblGenomes-Gn:BL00911"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21841"
FT                   /db_xref="GOA:Q65P28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P28"
FT                   /protein_id="AAU21841.2"
FT                   /translation="MIDIVIAEDDFRVAQIHERLIEQLDGFNIIGKAANAKETMEILEV
FT                   RKADLLLLDIYMPDEMGTTLIPVIRKRFPEVDIMIITAATETCHLQESLRAGIVHYLIK
FT                   PVTAEKFKQVLLQYKKKRQTLLSQPQVSQSMIDQIFGDFSSGSRQAEDLPTGINSITLQ
FT                   KIRDVLRDAAKGMTAEELGEKMGASRTTARRYAEYLVSKEEARAELEYGIIGRPERKYY
FT                   LADE"
FT   gene            complement(202013..203623)
FT                   /gene="citS"
FT                   /locus_tag="BL00910"
FT   CDS_pept        complement(202013..203623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citS"
FT                   /locus_tag="BL00910"
FT                   /product="two-component sensor histidine kinase"
FT                   /function="involved in the response to the environmental
FT                   Mg-citrate complex, Biological Process: signal
FT                   transduction, Molecular Function: kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00910"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21842"
FT                   /db_xref="GOA:A5A6A3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A3"
FT                   /protein_id="AAU21842.2"
FT                   /translation="MVKKRVNFSLQTKIMGLIAALLILVIGLLTVTFAVQQTKEGRKQS
FT                   EQLAVQTAKTISYMPPVKELFQKKRGHKGEAQEVIEQMKEQTGAYTIYVLNEKGEIKIA
FT                   SEKRGQTKLTRSRKILFGGSHISKTKNDGRMVIRGSAPIIQEQSGYSKVIGSVSVDFLL
FT                   NETEQRIKENVRKLSFMAVLVLLIGFAGAAALAKSIRKDTLGLEPQEIASLYRERNAML
FT                   RAIKEGIIATNREGVVTMMNVSAAEMLRLPEPVVNRPIDDILPGAGIMSVLQQRQMLLN
FT                   QEVCVNDQVFILNTKMMLQNGQTYGIVVSFRQKTELKRLIDTLTEVQKYSEDLRAQTHE
FT                   FSNKLYVILGLLELGEYEAAIDLIKEEYAIQNEQHDILFKNIHSQQVQAILLGKMGKAS
FT                   EKKVKLSIDENSTLEPLPEHIGMSHLITIIGNLIDNAFEAVAEQNVRLVSFFITDIGRD
FT                   IVIEVADTGCGVAPDKMKAIFERGYSSKGMKRGYGLANVKESVRELGGWIEVANQKGGG
FT                   AVFTVFIPKEKQTREGESI"
FT   gene            complement(204127..205023)
FT                   /locus_tag="BL00909"
FT   CDS_pept        complement(204127..205023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00909"
FT                   /product="transcriptional activator of the cysJI operon"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BL00909"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21843"
FT                   /db_xref="GOA:Q65P26"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P26"
FT                   /protein_id="AAU21843.1"
FT                   /translation="MNLHALRLFYSVAETGSVTQAAKQLSISQPAVTSQIKKLEREIDC
FT                   TLFVPKGRGILLTQSGAELAKQAKRLFSLEKEIESYVEQLREGSIGKLRIASTFLPANY
FT                   LLPRWLSRFKQQFPKTEVEITTTNFQKACEQLINYEADIGLIGGTTEFGPFLKGTLLLE
FT                   DDMLFVVNQKHKFASKHVALEEIVKEPFVFREEGSFSREKLISLCNLHNAGKPNMGVQI
FT                   NGLNETIRTVMEGYGVTFVSALEVNEYIARGDIAKVHVDKAVIKNPISLCVRTEDHLSP
FT                   SALNFIQMIDSTDEYPL"
FT   gene            205146..206363
FT                   /locus_tag="BL02410"
FT   CDS_pept        205146..206363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02410"
FT                   /product="hypothetical protein"
FT                   /note="may be related to nikS, involved in the assembly of
FT                   antibiotic nikkomycin"
FT                   /db_xref="EnsemblGenomes-Gn:BL02410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21844"
FT                   /db_xref="GOA:Q65P25"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P25"
FT                   /protein_id="AAU21844.1"
FT                   /translation="MSTLILNKTAYSKSPYDVWLKGLDEPVAMLTSTDRADECRNYDVI
FT                   EAFDDYPVNGCIEMRALELNETYHFKTIIASSEFDMLRAGKLRSLLGIKGQSYKSALLF
FT                   RNKILMKEQVRKAGVKVPDFKKIDSAADLYTFVQTFGFPVVVKPIYGSGSVDTTVLRNR
FT                   QDVWNVLAKGLPDHLEVESFIEGDMYHIDGLILDEEIVLSWPSRYINGCLAFQDHQFLG
FT                   SLQLELKNPLTRRLTDFVQKALAALPVPNTTTFHAEVFHTPDDELVFCEVASRTGGAMV
FT                   REATVQTFGFDINEVCVKAQCGLEFHIPEVDNNPDRLSGWLLIPPKDGVLKEIKPAPAA
FT                   DWIAKQNISAQAGDRFHGSSSSVDAIASCLIIGRTEAELRGRISRLATWFHDHTVWEKN
FT                   SDVCAI"
FT   gene            206347..207573
FT                   /locus_tag="BL00139"
FT   CDS_pept        206347..207573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00139"
FT                   /product="Sugar transporter superfamily"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21845"
FT                   /db_xref="GOA:Q65P24"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P24"
FT                   /protein_id="AAU21845.1"
FT                   /translation="MFAQFKAFSRLHPLIRFLLIGTLVTKAAKSMTTPFLALYLHMKTG
FT                   ADFGTIGLVIGLGYFSSTVGGVVGGALSDKIGRKKVMLSSIFIWSFVFILFGLVHDFMW
FT                   FLLLNILSWLCHSCFEPVSKALMAELSEREMRFRIFSLRYLAINVGAAVGPLLGAYFGL
FT                   AKTGTPFIITGLVYFGYAILLSLMMIRLTTVKETKIAPEKVQAGSVLKTLKQDKALRLY
FT                   IAGGILFLFSYSQMESTLLQYLNNDFANGVKIFSTLITLNAVTVILLQVPLTRLFERYK
FT                   SLTTISIGTVFCILGNIGFSIANGWIVFMLSMFVLTIGEILCFPSMNVLLDELAPDHMK
FT                   GAYYGMQNLYNIGEFLGPWLGGMMLALYGGKAVFLIAACSVFLALGAYHVGRRKFLSAQ
FT                   HYGVSPFSY"
FT   gene            207644..207892
FT                   /gene="csgA"
FT                   /locus_tag="BL00138"
FT   CDS_pept        207644..207892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="BL00138"
FT                   /product="sporulation-specific SASP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21846"
FT                   /db_xref="InterPro:IPR020255"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P23"
FT                   /protein_id="AAU21846.1"
FT                   /translation="MDTTLGYLRESLSNHLEHGIGQNIYRKIVSGRYANEEEFVEHLEE
FT                   REMEFLNQVLEHEMKYALNEQDHKRTRELNEVYELLF"
FT   gene            207909..208100
FT                   /gene="ybxH"
FT                   /locus_tag="BL00137"
FT   CDS_pept        207909..208100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxH"
FT                   /locus_tag="BL00137"
FT                   /product="conserved hypothetical protein YbxH"
FT                   /db_xref="EnsemblGenomes-Gn:BL00137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21847"
FT                   /db_xref="InterPro:IPR035314"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P22"
FT                   /protein_id="AAU21847.1"
FT                   /translation="MGAIERNGYTFEPEYSVTRQNGAIHVYRRGRFVEEIPFEFHGEFP
FT                   EHDLIEELVNHYCYENKI"
FT   gene            complement(208221..208487)
FT                   /gene="ybyB"
FT                   /locus_tag="BL00132"
FT   CDS_pept        complement(208221..208487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybyB"
FT                   /locus_tag="BL00132"
FT                   /product="conserved hypothetical protein YbyB"
FT                   /db_xref="EnsemblGenomes-Gn:BL00132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21848"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P21"
FT                   /protein_id="AAU21848.2"
FT                   /translation="MKQKNLISGLAVVAGVTAYMLKDETNRQKLKSYLQNVKEKIPYFS
FT                   EKHNVDSFPVEKAGHPSPHDIEDNKMVSEGSMYPVQYYDEKKK"
FT   gene            complement(208545..210422)
FT                   /gene="yyaL"
FT                   /locus_tag="BL00131"
FT   CDS_pept        complement(208545..210422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yyaL"
FT                   /locus_tag="BL00131"
FT                   /product="conserved protein YyaL"
FT                   /note="similar to Clostridium sp. thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21849"
FT                   /db_xref="GOA:Q65P20"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P20"
FT                   /protein_id="AAU21849.1"
FT                   /translation="MAHESFEDEEVAKLLNEKFVSIKVDREERPDVDSIYMTICQMMTG
FT                   QGGWPLNVFLTPDQKPFYAGTYFPKTSRFNRPGFVEVVKQLSDTFAKNREHVEDIAEKA
FT                   ANNLRIKAKSDAGDSLGEDILRRTYQQLINSFDAAYGGFGSAPKFPIPHMLTFLLRYHQ
FT                   YSGEENALYSVMKTLDSMANGGIYDHVGYGFARYSTDDEWLVPHFEKMLYDNALLLIAY
FT                   TEAYQITKNERYKQISEQIITFVRREMTDEKGAFYSALDADTEGVEGKYYVWSKEEVLE
FT                   TLGDELGELYCAVYNITQEGNFEGHNIPNLIYTRLEDIKDEFALTDEELQNKLEEARTK
FT                   LFEKRQERTYPHVDDKVLTSWNALMIAGLAKAAKVYNAPEYLEMARAAAEFIENKLIQD
FT                   GRIMVRYRDGEVKNKGFIDDYAFLLWAYIELYEASLDLTDLRKAKKLEADMKGLFWDEE
FT                   HGGFYFTGSDAEALIVRDKEVYDGALPSGNGVLAVQLSRLGRLTGDLSLHDQAAKMFAA
FT                   FHGDVSAYPSGHTNFLQGLLSQFMPQKEIVVLGKRNDPDRQKIVSALQQAFQPNYAVLA
FT                   AESPDDFKGIADFAAEYKAVDNKTTVYICENFACRQPTTNIDEALDQLV"
FT   gene            complement(210461..210622)
FT                   /gene="yyaO"
FT                   /locus_tag="BL00130"
FT   CDS_pept        complement(210461..210622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yyaO"
FT                   /locus_tag="BL00130"
FT                   /product="Peptidase M14, carboxypeptidase A"
FT                   /function="Molecular Function: carboxypeptidase A activity,
FT                   Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21850"
FT                   /db_xref="GOA:Q65P19"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P19"
FT                   /protein_id="AAU21850.1"
FT                   /translation="MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFDKAKSENKP
FT                   VLVSIGYS"
FT   gene            211122..213041
FT                   /gene="thrZ"
FT                   /locus_tag="BL00136"
FT   CDS_pept        211122..213041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrZ"
FT                   /locus_tag="BL00136"
FT                   /product="threonyl-tRNA synthetase"
FT                   /function="Molecular Function: threonine-tRNA ligase
FT                   activity, Molecular Function: ATP binding, Biological
FT                   Process: threonyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BL00136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21851"
FT                   /db_xref="GOA:Q65P18"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P18"
FT                   /protein_id="AAU21851.1"
FT                   /translation="MSESLIKVQFKEGNTKEFPKGITIKRIAESISTTLRKHAVVAKVD
FT                   EKFVDLSYTLDKDVKLDIFTLDSKEGLSVLRHTSTHILAHAVKRLYSSVSLGIGPVIED
FT                   EFFYDLKLEHSLSPEDLLAIEREMEKIIKENIEIKRIVVSYEEAEKLFEENNEPLKLEI
FT                   LRGIPKGQEITLYQQGEFIDLCRGPHLPSTGFIKAFKLTRVSGAYWRGNRQKEVLQRVY
FT                   GVAFKKKDDLNEYLYFLEQAAKHDHRQLGKQLDLFMFSEEAPGMPFYLPKGQIVRKELE
FT                   KLSRELQNNASYDEVHTPFMMNYRLWEKSGHWDHYQENMYFSEVDNTKFAIKPMNCPGH
FT                   MLIFKNNLYSYRDLPIRLAEYGQVHRHEFSGSLNGLLRVRTFCQDDAHIFVREDQIESE
FT                   IKKVFHLIDQVYRTIGFEYSVELSTRPDDSLGNNHLWEVSEGSLKNVLDDLAIKYQVNE
FT                   GDGAFYGPKIDFHIKDALKRSHQCGTIQLDFQMPEKFDLTYINHNNEKVRPVVIHRAIF
FT                   GSIDRFFGILIEHFAGVFPVWLAPIQVQIIPISHIHLEYCLGIKSELKQHGIRVQINES
FT                   NQKLGYKIREAQVQKIPYTLVVGDNEIKENGVNVRKYGEEQQKNVSIESFKKNILQQIK
FT                   TRSV"
FT   gene            213368..214042
FT                   /locus_tag="BL00134"
FT   CDS_pept        213368..214042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21852"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P17"
FT                   /protein_id="AAU21852.1"
FT                   /translation="MTLLKKQYEMFKCVTDENYLKEYKKQNHFDWVNFDFFRKLHFNKR
FT                   AIRFNHVFPKTKEKTREWEKFVKNFCNQHNYTGQRVEEDADSFVNFLSKKKGNESYIAQ
FT                   LAKHELNIYLVTIGKGNGFVDAFCYPITCFNITSTETKKHNYLYIKGKQGVRVFKIEQS
FT                   VAIWIENYKNLLCIKEATNLTHNSLNTQEKNQLKIAIDNFKKLGLLDIWKRESINEKSK
FT                   QH"
FT   gene            214020..215210
FT                   /locus_tag="BL00133"
FT   CDS_pept        214020..215210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21853"
FT                   /db_xref="GOA:Q65P16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P16"
FT                   /protein_id="AAU21853.1"
FT                   /translation="MKSLNNIKNKIVIVGTVDSLGAAIVWTGLPLYAYSITGSFLYTSS
FT                   LFFTSAIARILATFFGGYLADVSSSKRIMLRCLSINWFFYSLLFLGLSLGLTWIIFPIM
FT                   LISQCFSTISIMNQNLWFNSLCSKETLASEISGRNSWFLISKTVGFSLGPLMYHWLNAY
FT                   SLIINLLTILIAITLILTIKDLGYVNNKKKKESIFSSFKEVYKNQLLKRLNIIEILNGL
FT                   TFPVLTSLSIYILEKNLNASSLIISLFWLIGGVGAITANLMLSRLKLFKLQYIHQFIIS
FT                   FVLVVGGLLLMTIASYSFVYLIGFSLFTLGTPIINNLLRSKVFIFAPSHMKGKVTSVIT
FT                   SSSDLGTIIALSLSWIVVEKFGVLIFMSFVILTSVSRICLFFYTLHKVENKVDVEG"
FT   gene            215214..216032
FT                   /locus_tag="BL05015"
FT   CDS_pept        215214..216032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21854"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P15"
FT                   /protein_id="AAU21854.1"
FT                   /translation="MSNCIGVGLSFRQNFFKDLDVIKQDVDFLEIISERYFDKKNEEEL
FT                   NTIRNYFPLIPHGLSLSIGTYEPLSKKKEKQISNLLAELQINSYTDHLAMSSVKDIELL
FT                   DFFPVMYKEETFEFLINKYDQLKKGRLKNLYLENITYTFNWHNNDFSELDFWYKLLNET
FT                   NIGMLLDVSNLYINSINHKYDPYAFFDKLPKDKINYLHVAGFIRNKYGFLIDSHSEPVH
FT                   KEVWKLAEYIIKKAPVKGVILERDLNYQNYHDVKNDIKIIKSLVYKYQTN"
FT   gene            216329..217271
FT                   /pseudo
FT                   /gene="yrkA"
FT                   /locus_tag="BL00768"
FT                   /note="frameshift or internal stop,conserved hypothetical
FT                   hemolysin YrkA, frameshifted, internal deletion of 200
FT                   amino acids and an insertion of 230 bp"
FT   gene            218220..219503
FT                   /gene="ydeG"
FT                   /locus_tag="BL05016"
FT   CDS_pept        218220..219503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeG"
FT                   /locus_tag="BL05016"
FT                   /product="Major facilitator superfamily"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21855"
FT                   /db_xref="GOA:Q65P12"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P12"
FT                   /protein_id="AAU21855.2"
FT                   /translation="MAGYSERTVESYIDSPDRLKRLYKRVLFIVSLSQIFGGAGLAAGI
FT                   TVGALLAKQMLGTDAFSGVPSALFTLGSAGAAFGVGRLSQRYGRRTGLTAGFMVGGIGA
FT                   IGVVAAAVINSIILLFVSLLIYGAGTATNLQARYAGTDLADKKQRAKAISVTMVMTTFG
FT                   AVAGPNLVDVMGKFASIIGVPPLAGPFILSAAAFILAGLVLYILLRPDPLEIAKKIETY
FT                   RQENKLADESKSAGASDDQKGITIGAAVMVLTQIVMVAIMTMTPVHMQHHGHSLGDVGI
FT                   VIGFHIGSMYLPSLVTGILVDKIGRTAISIASGVTLLLAGAVAALAPSDSLVLLIVALS
FT                   LLGLGWNFGLISGTAQIIDSTEPSTRAKVQGTLDVLIALAGASGGALSGMVVAHSSYAV
FT                   LSLAGGLLSLALIPAVIWPRRKTNTQKG"
FT   gene            complement(219528..220301)
FT                   /locus_tag="BL05017"
FT   CDS_pept        complement(219528..220301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05017"
FT                   /product="SAM (and some other nucleotide) binding
FT                   motif,Generic methyltransferase"
FT                   /function="Molecular Function:
FT                   S-adenosylmethionine-dependent methyltransferase activity,
FT                   Molecular Function: methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL05017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21856"
FT                   /db_xref="GOA:Q65P11"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P11"
FT                   /protein_id="AAU21856.2"
FT                   /translation="MRKNAATEEAIQRWNRFADSYAANHTEQGDIHKEVFLNPVIFSLI
FT                   ETVKNQKVLDAGCGEGYLSRMLAAREAVVTAVDYSTRMLEIAKERTPDGLHIHYRHGNC
FT                   EDLHFLDEQSFDIIISNMVIQDLANDEKAFQEMHRLLKDGGCFIFSILHPCFVTPESGW
FT                   ERTKDGQKLHWNVDRYFYEGAYEQPLGGEEKMFLFHRTLTSYINTIIKAGFQLEAVEEP
FT                   RPSKEMLKKYPSFEEDLRCPDFIVFKLRKPGGDVR"
FT   gene            220469..221341
FT                   /locus_tag="BL07000"
FT   CDS_pept        220469..221341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL07000"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97343"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P10"
FT                   /protein_id="ABP97343.1"
FT                   /translation="MKMLVTGATGKLGSKIVEKLLETVPADQLAVSVRNPEKAEALRAR
FT                   GVDVRHGDFDRPETLESAFRGIDRLLIISADGDNETRIRQHGNAVAAAERAGVRFIAYT
FT                   SIANARESKNFLAPTHKATEEAILQTGIPYSFLRNNWYLENEMSSIQGVLAGAPWVTSA
FT                   ENGKVGWALQQDYADAAAAVLSGEGHENTVYELSGKLLTQEEIASALGEVLGKEVPVQH
FT                   VDDAAYRDIMKNAGVPDFLIPMVVDIQKGIREGTLEVESDDFEKVLGRPLTPIKEGLAQ
FT                   IVARISEAK"
FT   gene            complement(221696..222202)
FT                   /locus_tag="BL05018"
FT   CDS_pept        complement(221696..222202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21857"
FT                   /db_xref="GOA:Q65P09"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P09"
FT                   /protein_id="AAU21857.2"
FT                   /translation="MQNRADGSKINIQKTKGERVWNAFGYFFYLGSIILLAAVWGSLPE
FT                   KVPAHYNALGEVDRWGSKWELFILPGIGLIILLFMQFLEKHPEIHNHPKRLNETNAEHF
FT                   YLLSRKLINRLKNACLIIFSLILIESVSIALDWGSGFGGWFLPIALLGTVMLVAIGLIQ
FT                   QRKIK"
FT   gene            222440..224073
FT                   /pseudo
FT                   /gene="yqeW"
FT                   /locus_tag="BL00173"
FT                   /note="frameshift or internal stop,frameshifted, possible
FT                   phosphate:Na+ symporter"
FT   gene            224224..224484
FT                   /gene="yubF"
FT                   /locus_tag="BL00172"
FT   CDS_pept        224224..224484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yubF"
FT                   /locus_tag="BL00172"
FT                   /product="conserved protein YubF"
FT                   /db_xref="EnsemblGenomes-Gn:BL00172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21859"
FT                   /db_xref="GOA:Q65P07"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P07"
FT                   /protein_id="AAU21859.1"
FT                   /translation="MHKYRRRNTTAFTVMSYFTFFAGVFLFGIGLYNADNLQLNEKGYY
FT                   IAVMILVAVGAILTQKVTRDNAEDNEIIAEQERRQNLSSGE"
FT   gene            complement(224518..225489)
FT                   /pseudo
FT                   /gene="ybfF"
FT                   /locus_tag="BL00165"
FT                   /note="frameshift or internal stop,degenerate frameshift"
FT   gene            complement(226191..226610)
FT                   /locus_tag="BL00164"
FT   CDS_pept        complement(226191..226610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21860"
FT                   /db_xref="InterPro:IPR017021"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P03"
FT                   /protein_id="AAU21860.1"
FT                   /translation="MREETKCALIIDESLPLGLIANTAAILGAALGKNKPDLIGETVTD
FT                   GSGIDHLGIVKIPIPILKGNAELLHQLSQKLLTDEFNDILTVDFTDVAQSIHTYEAYIE
FT                   AFQSTAASDYRYFGIGICGDKKKVARLTGSLGLLR"
FT   gene            complement(226607..227515)
FT                   /gene="ybfH"
FT                   /locus_tag="BL00163"
FT   CDS_pept        complement(226607..227515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfH"
FT                   /locus_tag="BL00163"
FT                   /product="conserved hypothetical membrane protein YbfH"
FT                   /function="Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21861"
FT                   /db_xref="GOA:Q65P02"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q65P02"
FT                   /protein_id="AAU21861.1"
FT                   /translation="MKTRRETAGHLAAVITIIIWGTTFVSTKVLLEDFPPVDILFYRFL
FT                   IGLIVLIMVHPHVLTFRSWRQEALFAGAGLCGVTLYFLLENIALTLTYASNAGMIVAVI
FT                   PMITAVLAHFLLSGEKLEPRFFIGFAAAFTGLALIFFNGQMMLKLNPLGDILAAASAFV
FT                   WAAYAILMKKISTFGYHTIQCTQRIFLYGLLFMVPALFLFDFRFDASPFSSPVNWLNIL
FT                   FLGAGASALCFVTWNWSVGVLGAVKTSAYIYMVPVITIAASVIILQEKLTWVAFCGGAL
FT                   TLAGLYISETKPKPQLKEEQI"
FT   gene            complement(227512..228307)
FT                   /pseudo
FT                   /gene="ybfI"
FT                   /locus_tag="BL00161"
FT                   /note="frameshift or internal stop,authentic frameshift"
FT   gene            228423..228836
FT                   /locus_tag="BL00171"
FT   CDS_pept        228423..228836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21862"
FT                   /db_xref="GOA:Q65NZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ9"
FT                   /protein_id="AAU21862.1"
FT                   /translation="MKKKWIASIAFTMMLGIGITIYCLFFEHSKLSELTSDGEWELSYS
FT                   KERGDQYWNGYVSKKTSEDAELKRVVFFVNGKETVDYEKDEQEEGGTHSDIVNVVWLGD
FT                   APEKSEQFEAVVERNQNGEYHKERIKLTAKNGL"
FT   gene            228898..229365
FT                   /locus_tag="BL00170"
FT   CDS_pept        228898..229365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00170"
FT                   /product="conserved hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21863"
FT                   /db_xref="GOA:Q65NZ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ8"
FT                   /protein_id="AAU21863.1"
FT                   /translation="MDKEYITELISSKLRLIRAESGYTQEKMANVLGMSKKTLVQIEKG
FT                   RSAAGWAHVVAVCALFRNSEVLQAVLGDEPLEVVETVAHRSIDRPKGKTLGGKVWWRDI
FT                   EKKGEFRLQQNLISHHYRILDSYDDLWFSTFEKQDAVARLDELLNEQDGVE"
FT   gene            complement(229500..230012)
FT                   /locus_tag="BL00160"
FT   CDS_pept        complement(229500..230012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00160"
FT                   /product="Hypothetical Bipartite response regulator,
FT                   C-terminal effector"
FT                   /db_xref="EnsemblGenomes-Gn:BL00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21864"
FT                   /db_xref="GOA:Q62ZE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZE4"
FT                   /protein_id="AAU21864.2"
FT                   /translation="MKHVGGILILSEDLQLLSCNRAALHWLNILRGWESIGSEAVPRPV
FT                   RAVCTRAAAETTAPAKTVISIPGHSCLSIKASRLDGFGPSGQIAVSFEPASPAETIPLI
FT                   AEAYSLSDREKDIAYRVIRGLSTKAIGDELHISAYTVQDHLKSFFLKTGAGNRRELMWK
FT                   LLDDVLE"
FT   gene            230256..231311
FT                   /locus_tag="BL00169"
FT   CDS_pept        230256..231311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00169"
FT                   /product="putative Iron-containing alcohol dehydrogenase"
FT                   /function="Molecular Function: iron ion binding, Biological
FT                   Process: metabolism, Molecular Function: oxidoreductase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21865"
FT                   /db_xref="GOA:Q65NZ6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ6"
FT                   /protein_id="AAU21865.1"
FT                   /translation="MQPEDIVRSGPNQYVCREGIVKELPSFANAFERPVIISGVKSFKA
FT                   FTRYTTPPADWKVVQHTGCSSLNKIKKAAEEAESADVIIGIGGGTVLDTAKAAADLLNI
FT                   EVMTIPTIPGTCAASTPLSVIYDDEGNFSGVQYQKRSSYLTLVDPLLLLSSPVAYVKSG
FT                   IGDTLAKWYEAEAIIRNTADSLSIMVQTGLRQSVYIRDILLTESLKAIESLEKGESSPA
FT                   FTNVLEAVIALAGTVGGYAGRYGRMAGAHAIHNGLTFIPETHRVLHGQKVAYGILVQLA
FT                   LEGRTDEIAELIPFYEGLGFPRRLSDLGILENIEAAKRIIAAHAARPDESLCLMGSFHE
FT                   ADVIAAIESLE"
FT   gene            231484..233190
FT                   /gene="yvaQ"
FT                   /locus_tag="BL00168"
FT   CDS_pept        231484..233190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvaQ"
FT                   /locus_tag="BL00168"
FT                   /product="putative transmembrane receptor taxis protein
FT                   YvaQ"
FT                   /function="Molecular Function: signal transducer activity,
FT                   Biological Process: signal transduction, Cellular
FT                   Component: membrane"
FT                   /note="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:BL00168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21866"
FT                   /db_xref="GOA:Q65NZ5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ5"
FT                   /protein_id="AAU21866.1"
FT                   /translation="MKSPRWNNITIGGKYGIIFFVMLTAFLTSVLITYGLLKDTSQTVQ
FT                   DTKSKNETAVQSAKLMSLYQNKYLHIPEYIINAQDEKLTDYMKYSQEFADTAKKLKKEL
FT                   HSDEQLDMFDQIIENNHSLDEYFFSEIVPNVQQINTEKFLTLQKKANKLKEETMTLGES
FT                   LKENAVKTNVESIGQAQSNMTKTIYILGVSILISAIVSAGLLIIVSRQIKKNLKRVVAA
FT                   SEEIAKGHLNFEALDYKGKDEIGQLSQAVNHMGGSLREMIVEVSGIAAEVDKQCLTFTS
FT                   VSADVREGSEQIAVTVEELANGATNQANEAANISEQTQELTGQIQHAHESGETLARFSK
FT                   EVLHVSVDGDKQMAQSLEQMNVINHVMEASVEKVSVLEEQTQSIHKLVEMITGMAEQTN
FT                   LLALNASIEAARAGDAGKGFAVVAGEVKRLAEEVKSSVGSITEIVTAIQTETSSMAGDL
FT                   KTGFSEVHKGKNQIETSGRYFSEIKNKVTDMAGRVSDISEALSHFRRSSEEINGSVEHI
FT                   AAISEESAAGSEEISASVHEQSGSIEKMDESARLLGEMVERMNVMIKRFKL"
FT   gene            233219..234280
FT                   /locus_tag="BL00167"
FT   CDS_pept        233219..234280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00167"
FT                   /product="putative D-xylose-binding protein"
FT                   /function="ribose transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL00167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21867"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A2"
FT                   /protein_id="AAU21867.2"
FT                   /translation="MSIYVKRGLLALALFSLLTAVAGCSFNSAEKSANREEKVKLIADS
FT                   DKLYVGFAIDTLKEERWYKDKEAFEKEVKNLGGEVKTLAANGNKEVQIQQAELLISEGV
FT                   DVLVVVPADADAAAEIVKKAHSAGVKVISYDRLIRNADVDYYVSFDNEKVGELQAEAIV
FT                   KKAKKGNFVYIGGSSLDNNAVLFRNGAMKVLEPLKRQGKVKLVLDEYTKDWLPEEAKKN
FT                   MKKALNKTRDIDAVIAANDGTAGGVIEALQEAGLAGKIPVSGQDAEIQGVRRIVNGTQT
FT                   MTVYKPIPALAKKSAEMAVQAAKGEAIQTDTTVENGKAKVPAILLEPYAVTKGNINETV
FT                   IKDGHLSKKDINK"
FT   gene            complement(234319..235086)
FT                   /locus_tag="BL00159"
FT   CDS_pept        complement(234319..235086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00159"
FT                   /product="putative lytic transglycosylase YomI"
FT                   /db_xref="EnsemblGenomes-Gn:BL00159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21868"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ3"
FT                   /protein_id="AAU21868.1"
FT                   /translation="MKKSISSLMIGLLAVVLGACSSNHDDQQSQASDQAKTAQSGQQDQ
FT                   EKQIKAMQKKLDQQKVDDTKTVAVVNDEKITGKDYNSVLSTAQMQYQQTGQDPTSKDAA
FT                   QQIKKQAIDSLIGQALITQEADKKGYKASEKEIEKQLDESKKQYKNEQDFEEAVKKAGL
FT                   NMNTLKSDIADSIKTEKYIDKELPTDQVTDKEIKDYYDQFAAQQKDSGQKNTPAFDDVK
FT                   QQIQDMLKQQKRQEKLGQQVEKLKKSADVKVEI"
FT   gene            complement(235241..236005)
FT                   /locus_tag="BL01778"
FT   CDS_pept        complement(235241..236005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01778"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21869"
FT                   /db_xref="GOA:Q65NZ2"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ2"
FT                   /protein_id="AAU21869.1"
FT                   /translation="MFEDERLNRLIYLYTPLYAEDFPIILFWIPKSGCTTLNRWFFFQN
FT                   GLLEDVNRRCAGEVHHYRNAIYTQKPNYVKDLLTDLREGKKDTYKVVRNPFRRAVSSFL
FT                   AAICSPNFICLFNSDINTGLSFTQFLHHLKDLGTDINAIDRHLGPQYIEGEEEFVTNYI
FT                   YLEQFSAQIREIENKYKLLKSPLSQLSQSPHHLSDIMIKKGKFADTVLTMSTFDWAFPT
FT                   FESFYNDETKELVHDIFAKDFEVYGFDSKHIK"
FT   gene            236331..237218
FT                   /locus_tag="BL01635"
FT   CDS_pept        236331..237218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01635"
FT                   /product="putative soluble quinoprotein glucose
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21870"
FT                   /db_xref="GOA:Q62ZD8"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62ZD8"
FT                   /protein_id="AAU21870.1"
FT                   /translation="MQIRMTEYQVPDPESGPYGITVCANGRIWFTEQKGNRIGMLTESG
FT                   DITEYTIPTESAGASIITSGIDGELWFTEYKAGKIGKITPQGKITEYALPPGAAPFGIA
FT                   AGCDDAMWYTDMAGHQIGRLSSSGEITEYKLPKPGAFPSFITRGADGALWFTQNQSGSI
FT                   GRITADGDISEYPLPQEQSGPVGITAGPDGALWFTEINANQIGRITVSGKISEYQLPTA
FT                   HARPHAIAAGGDGALWFTEWGAGQIGRITVDGDITEYPIPTADSEPHGIAAGSAHSIWF
FT                   AEECGRIGKISIQN"
FT   gene            complement(237255..237635)
FT                   /gene="ycbP"
FT                   /locus_tag="BL01779"
FT   CDS_pept        complement(237255..237635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BL01779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01779"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21871"
FT                   /db_xref="GOA:Q65NZ0"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NZ0"
FT                   /protein_id="AAU21871.1"
FT                   /translation="MEHVKALAIKGIMTIVILYLVLGLGFSFSFENTLFITIVLGAVSY
FT                   LLGDLFILPKTNNITATLADLGVAFLVVWLMALAMGTAANTAALAAFFAAVAMAIGEYI
FT                   FHFYLMNKGLGSPNRRMETRTE"
FT   gene            complement(237662..239116)
FT                   /gene="ybgF"
FT                   /locus_tag="BL01780"
FT   CDS_pept        complement(237662..239116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="BL01780"
FT                   /product="Amino acid permease YbgF"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01780"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21872"
FT                   /db_xref="GOA:Q65NY9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY9"
FT                   /protein_id="AAU21872.1"
FT                   /translation="MEQSNTNRQNFQRKMQTRHLIMLSLGGVIGTGLFLSSGYTISQAG
FT                   PAGTILAYLAGALIVYLVMLCLGELSVAMPVTGSFHMYASRFIGPGTGFTVAWLYWLTW
FT                   AVALGSEFTAAGLLMQRWFPDTSVWMWSAVFAALIFALNAVSVRFFAESEFWFSSIKVL
FT                   AIILFIILGGAAIFGIIPIQNADAAPLLSNFAGEGGLFPNGFLPIFMAMLSVNFAFSGT
FT                   ELIGIAAGESAEPEKNIPKAIKTTLWRLVLFFIGTIFVLSCLIPVKEAGVIKSPFVDVF
FT                   DRIGVPYAADIMNFVILTALLSAANSGLYACSRMLWSLSKEKTLHPVFQKLTSRGIPLN
FT                   ALIFSMLGGILSLLSSVFAPDSVYIVLVSISGFAVVAVWMSIAASQFMFRRRFLAEGNT
FT                   ADDLKYRTPLYPAVPIAAFLLCLASCIGIAFDPNQRIALFCGVPFMALCYTIYYATNRK
FT                   NSWNPSEPVKNASLHVSFSEYEEKKN"
FT   gene            complement(239116..240063)
FT                   /gene="ybgG"
FT                   /locus_tag="BL01781"
FT   CDS_pept        complement(239116..240063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="BL01781"
FT                   /product="Homocysteine S-methyltransferase YbgG"
FT                   /function="Molecular Function: homocysteine
FT                   S-methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01781"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21873"
FT                   /db_xref="GOA:Q65NY8"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY8"
FT                   /protein_id="AAU21873.1"
FT                   /translation="MTNPIRTSLQQFSVIILDGAMATELERYGCDLNDSLWSAKILIEN
FT                   PELIKQVHLDYFRAGADCAITASYQSTVEGFTKRGLSEQEALHLIRESVRLAAEARDEF
FT                   WAAPENREGRPKPFVAASVGPYGAFLADGSEYQGNYGVTEDELADFHRRRMGALIEAGA
FT                   DILACETIPCLSEAKAIVHLLKEFPDTHAWISFSAKDGRHISDGTKAGECAKWLDQHDQ
FT                   VAAVGVNCTRLEHVSSLIGGIKKHTAKPIIVYPNSGEQYDPETKTWHGAACKASFGESA
FT                   RSWYNQGAQLIGGCCRTTPEDIKAVAAWARKLEV"
FT   gene            240273..241013
FT                   /locus_tag="BL01636"
FT   CDS_pept        240273..241013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01636"
FT                   /product="Hypothetical YdjC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21874"
FT                   /db_xref="GOA:Q62ZD4"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZD4"
FT                   /protein_id="AAU21874.1"
FT                   /translation="MKKLIINADDFGYSRGVNYGIIDAYKLGILTSATFMTNMPGAGHA
FT                   ARLARESPGLGIGVHLVLTCGRPLLSDHRTIVDSKGSFRNLAFYQGAFTIDADEVYREW
FT                   KTQIETCINMGLKPDHLDSHHHINAYPGISDVFLSLAKEYRLPVRRNMESAIITEKGVK
FT                   TTDSFSPVLEAALKGEEAVSELFEKHNTVEVMTHPAYLDKELLTNSSYTYPRVDELEFL
FT                   TDPDVVIRLNKLADVQLVSFRNLT"
FT   gene            241027..242400
FT                   /locus_tag="BL01637"
FT   CDS_pept        241027..242400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01637"
FT                   /product="phosphotransferase system (PTS)
FT                   N-acetylglucosamine-specific enzyme IICB component"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: transport, Biological Process:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21875"
FT                   /db_xref="GOA:Q65NY6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY6"
FT                   /protein_id="AAU21875.1"
FT                   /translation="MKHILQLLGKSLLIPITVLPIAGLLLRLSAEDMLDIPLFQASGVI
FT                   LNNMDVLIAIGIAMGFARSKDKGIPALTGYLAITVLKEGIGILNPDLDMSVFGGVLAGL
FT                   MAAFIYNQFQHARLPSMFSFFGGEKFPITMIVLVTIPVAGFFSVVWPYAEAAIDAFSQS
FT                   LVGLGAFGVFVFGFLNRFLLPFGLHHVMNTYIYFGLGRYETASGEAVTGEITRFLNGDP
FT                   TAGYFLGGFFITMMFGIPAIALAIAHAARTRKKETKALMSSGAATSLITGITEPVEFTF
FT                   LFTSPLLYFLHSVYTGLAGAVLCLLGIRHGFSWGAGAIDYLLNLNLSDGGLLIIPVGVA
FT                   FFALYYVTFYFVIIKRNVPVIGREQETPEGDRLQQSMAAGILKYMGGRENVVTCENCIT
FT                   RLRLKLKDTSLADEAQLKRLGAHGVIIIDRHHIQIVIGTDAGTVKKDLQNLIDESAPD"
FT   gene            242522..243298
FT                   /gene="mtaA"
FT                   /locus_tag="BL01639"
FT   CDS_pept        242522..243298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaA"
FT                   /locus_tag="BL01639"
FT                   /product="transcriptional regulator"
FT                   /function="positive regulation of multidrug-efflux
FT                   transporter genes"
FT                   /note="MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21876"
FT                   /db_xref="GOA:Q65NY5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY5"
FT                   /protein_id="AAU21876.1"
FT                   /translation="MKKDEYYSIGVFSEMTGTSIRTLHYYDEIGLLKPEKETGTGRRLY
FT                   TDRDAKDLQKIICFKFLGYSLEQIRAFMKDACFDAGLIEALQEQKRVLEERKEHIETGL
FT                   KAIDRTIGLLEEEEEIDSSVFMSLLNSIQTEKEQREWLEQQVSKSFADDVFGKSEEEMA
FT                   KLDQEYVRLSKEAKRLMGKPVDDPEVQDMADRYMKTSLEFVGEGVLSALGQMETIESRQ
FT                   LAEKFPSPFTKEEEEWLQRVFEYYMIHNDFCPESGG"
FT   gene            complement(243341..244063)
FT                   /locus_tag="BL01782"
FT   CDS_pept        complement(243341..244063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01782"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01782"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21877"
FT                   /db_xref="GOA:Q65NY4"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY4"
FT                   /protein_id="AAU21877.1"
FT                   /translation="METVKEILVVYGRIITILPLLLVVTLFMGKRSIGEMPVFDFLIII
FT                   TLGAVVGADIADPKIEHLHTAAAVAAIALLQRLASNLMIKYRTLGRLITFEPTIVIKNG
FT                   TFIVGNLKRIKYSVDNILQMLREKDVFNVSDVEMAFVEANGNLTVYKKPNKMEITAEDM
FT                   GIQKSSGEFSYPVIVDGKVYTSVLQQLNVTESWLKNQLKKKGLERMDEIFFASVNQNHE
FT                   LHVSLDNQTTKIEPELLH"
FT   gene            complement(244051..244761)
FT                   /locus_tag="BL01783"
FT   CDS_pept        complement(244051..244761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01783"
FT                   /product="putative carbonic anhyrdase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01783"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21878"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY3"
FT                   /protein_id="AAU21878.1"
FT                   /translation="MKLSSKLILGLTVSSLAGKFLEKLLIQDNVSPNITASFNQEADIP
FT                   DIDASSYIHHFASVIGSVVIGRNVFIGPFSSIRGDVGLKIFISHDCNIQDGVVLHGLKN
FT                   YEYNSPVTEHSVFKDRESYSIYIGEKVSLAPQCQIYGPVRIDKNVFVGMQSLVFDAYIQ
FT                   EDTVIEPGAKIIGVTIPPKRFVSAGRVISNQEDANRLPEITDSYPYHDLNSKMTSVNLE
FT                   LAKGYKKEERQWKL"
FT   gene            complement(245285..245683)
FT                   /gene="yjgA"
FT                   /locus_tag="BL01784"
FT   CDS_pept        complement(245285..245683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgA"
FT                   /locus_tag="BL01784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01784"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21879"
FT                   /db_xref="GOA:Q65NY2"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY2"
FT                   /protein_id="AAU21879.1"
FT                   /translation="MNMKRSRIGRLALTFAAMAAGLASRKTADMLPDIVNVYLGDALWA
FT                   LMIFFGAGFLFKNAKTASAALIALVFCFMIECSQLYHAPWIDNIRAAPLGGLILGYGFL
FT                   WSDLLAYVLGVSAGAAGEMLFRKRKRQP"
FT   gene            complement(245828..247258)
FT                   /gene="glnT"
FT                   /locus_tag="BL01785"
FT   CDS_pept        complement(245828..247258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnT"
FT                   /locus_tag="BL01785"
FT                   /product="Sodium:alanine symporter"
FT                   /function="Molecular Function: sodium:amino acid
FT                   transporter activity, Biological Process: sodium ion
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01785"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21880"
FT                   /db_xref="GOA:Q62ZC8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZC8"
FT                   /protein_id="AAU21880.1"
FT                   /translation="MQQFLQEVIGVTNDFLWSKLLIIMLLASGLFFTFKSKFFQVRLLK
FT                   DMFRVLKEGTPDKNGISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIAII
FT                   GSASSFVESTLAQIYKIKDKDGFRGGPAYYMEKGLKKRWMGAVFAVLITLSFGIVFNAV
FT                   QSNTITVAFENSFGTDRLTLGIIITIVFGIITFGGIKRIAKLSEYIVVCLAVLYIGVAV
FT                   FVMLMNITKLPDVISLIIGHAFGLEQAAGGAIGAALMNGIKRGLFSNEAGMGSAPNAAA
FT                   AATTSHPVKQGLVQALGVFTSTLVICSSTAFIILFSDAYKEPGLSGIELTQASLSTHIG
FT                   AWASGFLAIMVFLFSFSTLIGNYYYGETNIEFLHTNKAWLFIYRICVLAMVIFGSVSKV
FT                   QLVWDLADLFMGLMVIVNLIAIFLLSKVAFAALKDYVKQRKAGKDPVFYKDVIKNHEGI
FT                   ECWEHSGTEQKSESKNAI"
FT   gene            complement(247283..248266)
FT                   /gene="glsA"
FT                   /locus_tag="BL01786"
FT   CDS_pept        complement(247283..248266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BL01786"
FT                   /product="Glutaminase"
FT                   /function="Molecular Function: glutaminase activity,
FT                   Biological Process: glutamine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01786"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21881"
FT                   /db_xref="GOA:Q65NY1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NY1"
FT                   /protein_id="AAU21881.1"
FT                   /translation="MNEVLEERYDARFWQSRLEDLVEHYRPFSSSGRNAEYIPALGKID
FT                   SNQLGICVIGSDQTMIKAGNSDVSFTLQSISKVISFIAACLTKGISYVLDRVDVEPTGD
FT                   AFNSIIRLEMHKPGKPFNPMINAGALTVSSILPGESALGKIESLHDVIEKMIGKRLEIN
FT                   EEVFRSEWQTAHRNRALAHYLKETGFLEADVEETLEVYLKQCSMEGSTEDIALIGMILA
FT                   NDGYHPFRREHVIPKDVARLTKALMLTCGMYNASGKFAAFVGIPAKSGVSGGIMCAVPA
FT                   SVKREQPFQHGCGIGIYGPAIDDYGNSMTGGMLLKHIAREWDLSIF"
FT   gene            248659..249984
FT                   /gene="glnK"
FT                   /locus_tag="BL01640"
FT   CDS_pept        248659..249984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="BL01640"
FT                   /product="Two component Histidine kinase"
FT                   /function="Biological Process: signal transduction,
FT                   Molecular Function: kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01640"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21882"
FT                   /db_xref="GOA:A5A6A1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A1"
FT                   /protein_id="AAU21882.2"
FT                   /translation="MGGNRGSVMTKAARLVKKDGYILMVMMLTVPLAGELKFYPLNETF
FT                   RVSFGVPTFFFLLLLLRNVPAVLSGFLTGAAVVGFRVLLDGFGPGQIDWLSSFYYHYPT
FT                   FFFYFTYAFLFYLAKVKRFQFRPLYIGFLGFGIELIADGAELAVQYMMFESTVTPGKIR
FT                   DMMAIAFSHSFIVLSFFNVMKLYETQSREKQIREQNEHMLMIVSNLYEETVHLKKTLKN
FT                   TEEITNESYQLYRLLNRQSDNNSSVRQISQKVLRLAGEIHEVKKDNQRIFAGLSKLISK
FT                   ESFRDYMAAEDLVRLVTGINRKYAESLEKDIDFHYSIDGEHPKYHVYTVLSVINNIMAN
FT                   AVEAIQKQGSIRLSLYRRGDDMLECRVEDDGPGIPEKVGDVVFEPGYTSKYDEFGTPST
FT                   GIGLSYVKETVEELGGSIRFRNDASGVVFTIRLPVQQLIQKG"
FT   gene            249991..250926
FT                   /gene="glnL"
FT                   /locus_tag="BL01641"
FT   CDS_pept        249991..250926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="BL01641"
FT                   /product="CheY-like,Response regulator receiver"
FT                   /function="Molecular Function: two-component response
FT                   regulator activity, Biological Process: two-component
FT                   signal transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21883"
FT                   /db_xref="GOA:Q65NX9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX9"
FT                   /protein_id="AAU21883.1"
FT                   /translation="MRFFIADDDRAVRSILKQIIEDEDLGEVAGEAEDGCDLEGHVLNL
FT                   QQIDILFVDLLMPLRDGIETVRHLHGVFSGKIIMISQVESKEMIGEAYSLGIEYYIHKP
FT                   INRIEILNVIQKVKERIELERSIHDIQSSLNRLVSLGGGGKNGFREKSIQETGEFLLSE
FT                   LGIVGESGSQDLIAILQYLFDDEQTSLYEKDFPPLKQIFHQIAVQKLGPAASPAEINRE
FT                   VKASEQRIRRAVSHSLNHFASLGLTDFSNPRFESYASRFFDFTVISKKMKELQKDSAAV
FT                   LPSARVNTKKFIQVFFLEAKRLSESAGKRG"
FT   gene            complement(250969..251505)
FT                   /gene="ynaD"
FT                   /locus_tag="BL01787"
FT   CDS_pept        complement(250969..251505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynaD"
FT                   /locus_tag="BL01787"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /function="Molecular Function: N-acetyltransferase
FT                   activity"
FT                   /note="acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01787"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21884"
FT                   /db_xref="GOA:Q65NX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX8"
FT                   /protein_id="AAU21884.1"
FT                   /translation="METLYTERLTLRKMELEDADVLCQYWSDPEVTKYMNIAPFTDVSQ
FT                   ARDMIQMINDLSLEGQANRFSIIAKETGEVIGTCGFNMIDQENGRAEIGYDLGRNHWGK
FT                   GFASEAVKKLIDYGFTSLNLNRIEAKVEPENTPSIKLLNSLSFQKEGLLREYEKAKGRL
FT                   IDVYMFSLLKREYAG"
FT   gene            complement(251601..253400)
FT                   /gene="blaRI"
FT                   /locus_tag="BL01788"
FT   CDS_pept        complement(251601..253400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaRI"
FT                   /locus_tag="BL01788"
FT                   /product="Penicillin-binding protein, transpeptidase
FT                   domain,Peptidase M56, BlaR1"
FT                   /function="Molecular Function: penicillin binding,
FT                   Biological Process: cell wall biosynthesis (sensu
FT                   Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01788"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21885"
FT                   /db_xref="GOA:Q65NX7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX7"
FT                   /protein_id="AAU21885.1"
FT                   /translation="MSSSFFIPFLVSQILLSLFFSLIILIKKLLKAQITVGTHYHLSVI
FT                   SLLALIAPFLPFHYLKSNHFDWILNLGGASSTLSHTRSTDKTAEAIGQHANWVQDFSMS
FT                   IEQSSFKMIDSAFFAVWILGIAVMLIATLYSNRKIGKIKKSLQMVNNKELLTLFRTCKE
FT                   EIRFHQKVILGCSPLIKSPITFGVVRPYIILPKDISMFSADEMKCVLLHELYHCKRKDM
FT                   LINYFLCLSKIVYWFNPLVWYLSKEAKTEMEISCDFAVLKTLDKKLHLKYGEVILKFTS
FT                   LKQRTSSLVAASEFSSSYKHIKRRIVTVVNFKAASPLLKVKSALVFALVLGIILAGTPS
FT                   VSILTMQRDTHFLSGANVEYEDDSTFFDGFSGGFVLFDSNRKKYTIYNRKESTARFAPA
FT                   STYKVFSALLALESGIITKNNSQMTWDGTQYPYKEWNQDQDLFSAMSSSATWYFQKLDR
FT                   QIGEDHLRRYLKSIHYGNEDFSGPANYWLDGSLQISPLEQVNMLKKFYDNEFDFKQSNI
FT                   QTVKDSIRLEESNGRILSGKTGTSVINGELHAGWFVGYVETAENTFFFAVHIQGEKRAA
FT                   GSTAAEIALSILDKKGIYPSASR"
FT   gene            complement(253402..253788)
FT                   /gene="blaI"
FT                   /locus_tag="BL01789"
FT   CDS_pept        complement(253402..253788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaI"
FT                   /locus_tag="BL01789"
FT                   /product="putative beta-lactamase repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01789"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21886"
FT                   /db_xref="GOA:Q65NX6"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX6"
FT                   /protein_id="AAU21886.1"
FT                   /translation="MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQ
FT                   TMLLRLIKKGALNHHKEGRVFVYTPNIDENDYIEVKSHSFLNRFYNGTLNSMVLNFLEN
FT                   DQLSGEEINELYQILEEHKNRKKE"
FT   gene            254211..255134
FT                   /gene="blaP"
FT                   /locus_tag="BL01642"
FT   CDS_pept        254211..255134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaP"
FT                   /locus_tag="BL01642"
FT                   /product="beta-lactamase precursor"
FT                   /function="Molecular Function: aspartic-type endopeptidase
FT                   activity, Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01642"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21887"
FT                   /db_xref="GOA:Q65NX5"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX5"
FT                   /protein_id="AAU21887.1"
FT                   /translation="MKLWFSTLKLKKVAAVLLFSCVALAGCGSNHSNASHSAEKDEKTE
FT                   MKDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIED
FT                   LNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLK
FT                   KELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLI
FT                   DWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDK
FT                   KDAKYDDKLIAEATKVVVKALNMESK"
FT   gene            255479..257230
FT                   /gene="phoD"
FT                   /locus_tag="BL01643"
FT   CDS_pept        255479..257230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BL01643"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /db_xref="EnsemblGenomes-Gn:BL01643"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21888"
FT                   /db_xref="GOA:Q62ZC0"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZC0"
FT                   /protein_id="AAU21888.1"
FT                   /translation="MTHEGPLEEWMKKLSEESLKDNTFDRRRFIQGAGKIAGLSLGLAI
FT                   AQSMGAMEVNAAPRFSEYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPNEAVSVKW
FT                   ELAEDERFRRVVKRGTEKATPHLAHSVHAEVSGLKPNHVYYYRFKCGNQLSPVGKTKTL
FT                   PAPGADVAKFTFAFASCQQYEHGYYTAYQHMAKEKLDLVFHLGDYIYEYGPNEYVSKTG
FT                   NVRTHSGPEIMSLLDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANVIPEKG
FT                   QSVEAFIKRRAAAYQAYYEHMPLRRQSLPNGPDMQLYRNFSYGNLADISVLDTRQYRDD
FT                   QANGDGNKPPSDESNDPKRTLLGAEQEAWLFDNLSRSEAHWNIIAQQIFFAQWNFGTSA
FT                   APIYSMDSWDGYPAQRKRVIDFIKSQKLNNIVVLTGDVHASWANNLLVDFDNPKSDIFG
FT                   VEFVGTSITSGGNGADKRADTDKILSNNPHIKFFNDYRGYVRCTVTPEEWRTDYRVVPY
FT                   VTEPGAAVSTRASYVYHKDYTGLKRTASNIVPGGVKKSNEVEEDRFLAHTRAHQKQVKQ
FT                   KEKKVTQ"
FT   gene            257252..257464
FT                   /gene="tatAD"
FT                   /locus_tag="BL05019"
FT   CDS_pept        257252..257464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAD"
FT                   /locus_tag="BL05019"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="Biological Process: protein transport, Cellular
FT                   Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21889"
FT                   /db_xref="GOA:Q65NX3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX3"
FT                   /protein_id="AAU21889.1"
FT                   /translation="MLSNIGIPGLILVLVIALIIFGPSKLPEIGRAFGKTLTEFKSATK
FT                   SLVSADDNEIGQGSDAKKQSDPSAR"
FT   gene            257535..258269
FT                   /gene="tatCD"
FT                   /locus_tag="BL01644"
FT   CDS_pept        257535..258269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BL01644"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="involved in the secretion of PhoD"
FT                   /db_xref="EnsemblGenomes-Gn:BL01644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21890"
FT                   /db_xref="GOA:Q65NX2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX2"
FT                   /protein_id="AAU21890.1"
FT                   /translation="MKKRETHLIAHLEELRQRIIKTLLTFILFLITGFLFVQDIYDWLI
FT                   RDLDEKLAVLGPGDILWVYMMIAGVLAIAATIPVAAFQTWRFVAPALTDHERRTALFYI
FT                   PGLFIFFILGIVFGYFVLFPLVLQFLIGLSAGHFQTMFTAEHYFRFMMNLTLPFGFLFE
FT                   MPLIVMFLTSLGILNPAKLSKMRKISYFALIVVSVVITPPDFISDVLVIVPLLVLYELS
FT                   ISLSAFIYRKKTAAQQGAEAQG"
FT   gene            258465..259391
FT                   /gene="kdgD"
FT                   /locus_tag="BL01645"
FT   CDS_pept        258465..259391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgD"
FT                   /locus_tag="BL01645"
FT                   /product="Probable 5-dehydro-4-deoxyglucarate dehydratase
FT                   KdgD"
FT                   /db_xref="EnsemblGenomes-Gn:BL01645"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21891"
FT                   /db_xref="GOA:Q65NX1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NX1"
FT                   /protein_id="AAU21891.2"
FT                   /translation="MSQLRKAPEGILGFPVAPFNREGKLEEEALYENIRFLLDEGLEAV
FT                   FIACGSGEFQSLSTKEYEQMVEIAVSAADGKVPVYTGVGGNLSTALEWARISEEKGADG
FT                   YLILPPYLIHGEQEGLYQYTKTIIESTDLNAIIYQRDNAVLTLEQIQRLTDLEQLVGLK
FT                   DGIGDMALNISLSYTIGDRLGWLNGMPMAEVTMPAYAPIGFTSYSSAISNYIPHISRMF
FT                   YEALLNGNDRLVKEIYEQVIIPINEIRKLRKGYAVSLIKAGMEIMGLHVKNTARPPIVP
FT                   VEKEHCRQLENILKNAMARYPKTTAAL"
FT   gene            259413..260879
FT                   /gene="ybcD"
FT                   /locus_tag="BL01646"
FT   CDS_pept        259413..260879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcD"
FT                   /locus_tag="BL01646"
FT                   /product="Aldehyde dehydrogenase YbcD"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21892"
FT                   /db_xref="GOA:Q65NX0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NX0"
FT                   /protein_id="AAU21892.1"
FT                   /translation="MSVAAESKTYFNFINGRWVKAESGGMEQSLNPADTRDIVGLVQKS
FT                   SIEDVDRAVEAAKQAKKAWRKLSGAERGQFLYKAADIMEQRLDEIAECATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGLRKTGDVIPSTDSSAFMYTDRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALIYGNTVVIKPATETAVTCLKVISCFEEAGIPSGVVNAVTGPGSSAGQRLAE
FT                   HPDVNGITFTGSNQTGKIIGRTAFERGAKYQLEMGGKNPVIVADDADLDIAVEAVISGA
FT                   FRSTGQKCTATSRVIVLNGVYDRFKEKLLQQTKEITIGDSLKEDVWMGPIANKQQLDNC
FT                   LSYIAKGKQEGADLIFGGERLADGKYENGYYIRPAIFDNVTSGMTIAQEEIFGPVIALI
FT                   KADTLEEALETANDVKFGLSASIFTQNIRRMLSFTDEIEAGLIRVNAESAGVELQAPFG
FT                   GVKQSSSHSREQGEAAKEFFTAVKTVFVKP"
FT   gene            260920..262296
FT                   /gene="gudP"
FT                   /locus_tag="BL01648"
FT   CDS_pept        260920..262296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudP"
FT                   /locus_tag="BL01648"
FT                   /product="D-galactonate transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21893"
FT                   /db_xref="GOA:Q65NW9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW9"
FT                   /protein_id="AAU21893.1"
FT                   /translation="MKKNRAASPDTAGKRSSVRWFVVSMLFLVTSINYADRATLSIVGD
FT                   SVQHELGLSSVAMGYVFSAFGWAYVVGQIPGGWLLDRFGSKIVIAASIFFWSLFTLLQG
FT                   ALGFFAAGTAVILLFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAIFNSAQYFA
FT                   LVIFSPLMGWLAHSFSWHTVFVIMGALGIAMSFIWLKTIYEPKKHPRINAAELAYIEEG
FT                   GALVSMDEGKNAEKKEKESQWPYIKQLLRSRMLLGVYIAQYCITTLTYFFLTWFPVYLV
FT                   QARGMSILEAGFVASLPAICGFLGGLLGGFVSDFLLKKGCSITVARKTPIILGMLMSCS
FT                   MIICNYADSSWLVVSIMSLAFFGKGFGALGWAVVSDTSPKECAGLSGGIFNTFGNIASI
FT                   TTPIIIGYIVNATGSFNGALVFVGANAIAAVLSYLFLVGPIKRIELQKEKDPADTTLSM
FT                   "
FT   gene            262334..263701
FT                   /gene="gudD"
FT                   /locus_tag="BL01649"
FT   CDS_pept        262334..263701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BL01649"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism"
FT                   /note="glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21894"
FT                   /db_xref="GOA:Q65NW8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW8"
FT                   /protein_id="AAU21894.1"
FT                   /translation="MNTNIHQHVKEEKASQTPSIADMRVIPVAGRDSMLLNLSGAHGPF
FT                   FTRNIVILKDSSGALGVGEVPGGERIRQTLEQAKPLVIDQPLGAVQSILQSVRRRFKDR
FT                   DAGGRGVQTFDQRTTIHAVTALEAALLDLLGKFLGVPVAALLGEGQQRDKVKMLGYLFY
FT                   IGDRKRTTLPYISEQEANDDWFHLRREEALTPEAIVRLAEAARERYGFHDFKLKGGVLS
FT                   GEEEIEAASALAKRFPKARITLDPNGAWSLEEAIALCKGKRDVLAYAEDPCGAEAGYSG
FT                   REIMAEFRRATGIPTATNMIATDWRQMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   EWGLIWGSHSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTKQPFSIADGYV
FT                   QVPDQPGLGIEIDMERVEKANELYEKMTAGERNDAAAMQFLIENWRFDPKRPCLVR"
FT   gene            263796..264509
FT                   /gene="ycbG"
FT                   /locus_tag="BL01650"
FT   CDS_pept        263796..264509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbG"
FT                   /locus_tag="BL01650"
FT                   /product="putative regulatory protein YcbG"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01650"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21895"
FT                   /db_xref="GOA:Q65NW7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW7"
FT                   /protein_id="AAU21895.1"
FT                   /translation="MEEDMETLQVESVNRKTLAKQVVERIVHLLSSGQLKPGDKLPTEI
FT                   ELMEKLNVSRPVLREALISLETLGIIKRKTRDGTYFNDKIGIQPFSVMLALAVDNLPAI
FT                   IEARMALELGLVTIAAEKINDSQLERLQETIDIIANSTDNHYGEADKEFHRIIALSANN
FT                   PVLEGMIQSLLITHAKIDSQIPYRERDRTVEYHTNILKALQQRDPYQAYHHMYEHLKFV
FT                   RDKILNGLRDEKNNH"
FT   gene            264598..266124
FT                   /gene="garD"
FT                   /locus_tag="BL01651"
FT   CDS_pept        264598..266124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BL01651"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase,
FT                   N-terminal,D-galactarate dehydratase/Altronate hydrolase,
FT                   C-terminal"
FT                   /function="Molecular Function: hydro-lyase activity,
FT                   Molecular Function: hydro-lyase activity"
FT                   /note="galactarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01651"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21896"
FT                   /db_xref="GOA:Q65NW6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW6"
FT                   /protein_id="AAU21896.1"
FT                   /translation="MLVNQTETPLYIKVNEKDNAAIIANAGGLPQGTVFPCGLKLQERI
FT                   PQGHKVALTDITQGGAVIRYGEIIGYAVKPIEKGGWISESHIMLPEAPPLDELPIANKV
FT                   PKPAPLLEGYTFEGYRNEDGSVGTRNVLGIMTSVQCVAGVLDYAVKRIKEELLPKYPNV
FT                   DGVAALNHQYGCGVAINAPEAKIPIRTIQNIARHPNFGGEAMVIGLGCEKLLPTKIEPE
FT                   GDAENILSLQERQGFQQMIQSIMEMAEERLKRLNERKRMTCPASDLVIGLQCGGSDAFS
FT                   GVTANPASGYAADLLVRAGATVLFSEVTEVRDAVHLLTPRAVNEEVGRALIREMAWYDR
FT                   YLERGESDRSANPSPGNKKGGLANVVEKSLGSIAKSGSSPISAVLAPGERAVQKGLIFA
FT                   ATPASDFVCGTLQLASGMHLQVFTTGRGTPYGLEMAPVLKVATRQSLSEDWHDLIDVNA
FT                   GRIATGEASIEEVGWEIFRTILDVASGRKTWAEHWGLSNDLCLFNPAPVT"
FT   gene            266299..266980
FT                   /pseudo
FT                   /gene="ycbL"
FT                   /locus_tag="BL01652"
FT                   /note="frameshift or internal stop,authetic frameshift"
FT   gene            266982..267917
FT                   /pseudo
FT                   /gene="ycbM"
FT                   /locus_tag="BL01653"
FT                   /note="frameshift or internal stop,authetic frameshift"
FT   gene            268012..268935
FT                   /gene="ycbN"
FT                   /locus_tag="BL01654"
FT   CDS_pept        268012..268935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /locus_tag="BL01654"
FT                   /product="ABC transporter YcbN"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01654"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21899"
FT                   /db_xref="GOA:Q65NW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW2"
FT                   /protein_id="AAU21899.1"
FT                   /translation="MTYIVQTSGLTKTFKGQEVVSNVSMHIRKGEIYGFLGPNGAGKTT
FT                   IMKMLTSLVKPTSGEINILGHKLTNRSYEILGKIGSMIEYPIFYENLTAKENLNLHCEY
FT                   MGYHNKAKIQEVLDMVNLKNIDSKPVKTFSLGMKQRLGIARAILTKPYLLILDEPINGL
FT                   DPIGIKEIRNLFQVLSKEYGMTLLISSHILNEVEQIADTIGVIRDGRLVEEVSMESVRG
FT                   RNTEYIELVTPNQLHACFVLEHELQIANFKILNDKTIRIYDAEASQTAISKALILNDVE
FT                   IESMNKKHTSLEDYFLSLINGNAVNA"
FT   gene            268950..269633
FT                   /gene="ycbO"
FT                   /locus_tag="BL05020"
FT   CDS_pept        268950..269633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbO"
FT                   /locus_tag="BL05020"
FT                   /product="conserved hypothetical protein YcbO"
FT                   /db_xref="EnsemblGenomes-Gn:BL05020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21900"
FT                   /db_xref="GOA:Q65NW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NW1"
FT                   /protein_id="AAU21900.1"
FT                   /translation="MLNLMRIEMKKLKLGWYIRGAVFANFIIFGFLWMVTCTEGKETFQ
FT                   TIDETFLLIGTFVRAVFIVFGAVLISKLVISEFKNKTILVMFTYPINRKKLLAAKLLIA
FT                   GGLTFVTILISNACVAVGFFLLNSIYGIIPGELTASIASQQALKMIVFAFGAAGTSLVP
FT                   IFFGMRKYSTAATIISSVVIIMPISSTGPGFSISSIVYIPLSLAAVGLFFSFLAVRRIE
FT                   KIDVF"
FT   gene            269726..270346
FT                   /locus_tag="BL05021"
FT   CDS_pept        269726..270346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21901"
FT                   /db_xref="GOA:Q62ZA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZA7"
FT                   /protein_id="AAU21901.2"
FT                   /translation="MYSRFIVPDRIRGKNLPQAKMSMADAASMLLVIGIFVRSVFIVFA
FT                   GVLIAKLVIGEYKNRTITVMFTYPVSRKKLMAAKLLLTGGLTFLTMIVSELILAFIFSQ
FT                   LNDVYQFSPEKLTMHDVGNEIGSMLIYAASSTGLSFIPLYFGMRKQSVPATIVTSCILT
FT                   TLIGQQSDEFPLASIIYIPISLALVGIAIAFWSIRKIDQEDVL"
FT   gene            270442..271521
FT                   /gene="yetN"
FT                   /locus_tag="BL01657"
FT   CDS_pept        270442..271521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yetN"
FT                   /locus_tag="BL01657"
FT                   /product="conserved hypothetical protein YetN"
FT                   /db_xref="EnsemblGenomes-Gn:BL01657"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21902"
FT                   /db_xref="InterPro:IPR025006"
FT                   /db_xref="InterPro:IPR025012"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV9"
FT                   /protein_id="AAU21902.1"
FT                   /translation="MEFEIRYISFYVIQVDGKDEQANKQYKHFQTLDTEEFENSELKDF
FT                   LDGELKKIVKRKAERHPKSEQVPTKIGRFITEPGHELDSNPNYNLFHKTKLAETKEEFN
FT                   ELSEQFVRTYLDTSAVRGGVFLVATAVPRKYFDDTFVFVMKCDFEPKVATIADESSLIR
FT                   KVEMAITTKNMKSIQYPHMPEEGMTEESEVKIHQASHARYFEDFLKFVEYGESMPEIMK
FT                   SQVMNMVQEHVYEAFEDKSEELQQFEHDLEIWEASEKREIQERLDTHQVIEASAQIVEH
FT                   MPEAELKMKLGETEIKGLLAEFGDSIHLAKVNGRYVALIEAETISFEKGSSPVEFYKPE
FT                   GLHEVIERIRNKIDREDEK"
FT   gene            271679..272863
FT                   /gene="ybdO"
FT                   /locus_tag="BL01658"
FT   CDS_pept        271679..272863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BL01658"
FT                   /product="conserved hypothetical protein YbdO"
FT                   /db_xref="EnsemblGenomes-Gn:BL01658"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21903"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV8"
FT                   /protein_id="AAU21903.1"
FT                   /translation="MRLNSQYIRTQLMVQNILKRNAADTTLKNVSSDITAVAKKASSQA
FT                   GRASKESLSKLNYSKDSIVNHAGAFRRAYEAANDRTVTDTGKETKINAQNPYVSESDIR
FT                   KKILDEKYSKINAMNKTKPDPLGYIKDKYKNPNSPYFRNDLSAAERQAAYDNETEWLFK
FT                   GKAQSYNMQDAAFRNVTFNGEVETENEKVYQRSQVNKQLQALLDQYHIAIPADAALTFT
FT                   ITPIDYQVKVSGTDDEQLIHQIEQILQSGENSKQLFLHIMKSLSSDSAQYSKEAHQKYQ
FT                   TVREIYEVTGYHLKDLEVVDGRYVTPSGRDLLEVYKEELEKDPVLKKTAHLAIAHYGAE
FT                   LNRLAEAEYDSVPDFILSIDYSNGSLRDTGQKKSYGTGDTAWLRELKRRTGVND"
FT   gene            273274..274185
FT                   /gene="ycbJ"
FT                   /locus_tag="BL01659"
FT   CDS_pept        273274..274185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BL01659"
FT                   /product="putative Macrolide 2'-phosphotransferase"
FT                   /note="mphBM in S.aureus"
FT                   /db_xref="EnsemblGenomes-Gn:BL01659"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21904"
FT                   /db_xref="GOA:Q65NV7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV7"
FT                   /protein_id="AAU21904.1"
FT                   /translation="MTTVNEQIEHTLKLAEKHGLRLKRKHAEINESGMDFQVVFAEDEA
FT                   GKSWVLRKPRRDDVIERAVYEGKVLKLLQNRLPAAVPDWRIHTPELIAYPELPGVPAAV
FT                   IDMDIKNYVWNMEHEPPAEAFTRSLAKTLALLHGIDHKDAEEAGMHVMNPDDVRQTKAE
FT                   HMERIKSELGVSAELWERWQKWLSDDSYWPEHTVFIHGDLHPPHILIDQHQSITGLLDW
FT                   TEAKIADPAKDFLLYQTILGEAETARLISYYEEEGGRVWPRMKEHIKEMQAAYGIEIGM
FT                   FALQTKQEEHLKMALDALGVTQ"
FT   gene            complement(274219..274638)
FT                   /gene="ywhA"
FT                   /locus_tag="BL01790"
FT   CDS_pept        complement(274219..274638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywhA"
FT                   /locus_tag="BL01790"
FT                   /product="putative transcriptional regulator"
FT                   /note="probable transcriptional regulator (MarR family)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01790"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21905"
FT                   /db_xref="GOA:Q65NV6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV6"
FT                   /protein_id="AAU21905.1"
FT                   /translation="MNHHRIEANLLDHAFTKYLRSSKKLDEETIPKSITSGKGFILRII
FT                   YRHGTCTIKEILQEVALSPSATTTALNHLEKEGLVIRSRNNDDRRTVWIELSQEGTRIA
FT                   AQMVENRQALIDKLFGKLSEEEKKAFFAVIEKVMM"
FT   gene            274916..276427
FT                   /gene="ydaB"
FT                   /locus_tag="BL01660"
FT   CDS_pept        274916..276427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /locus_tag="BL01660"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism"
FT                   /note="similar to feruloyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01660"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21906"
FT                   /db_xref="GOA:Q62ZA2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q62ZA2"
FT                   /protein_id="AAU21906.1"
FT                   /translation="MSTLQQLINHHMETSDGLEALSGGDRTFTFKAYHQRVNQLAHYLL
FT                   EEGVQKGDHIAVLCKNNHHFPVILLASLKIGATVVPLSWQLTSYELKGILNNCRPKVMF
FT                   YDLEFADILTPLREQLQFCLMIEAGAGMNTTEQFESLFKNRPLKVEAEQVTEHDLALML
FT                   FTSGTTGNPKGCMVNHGSLAAYLTEVNVKSKQLKGTRFLASHPLYHMSSLNHVFQAAFE
FT                   GIALYFLWDPEPFEILQEIEKKRIHMMMAFPSVYTYMLEEMKRHPFDLSSVKMLVSGGT
FT                   KVPARLIKEYNDHGIMMVQGYGSTEAWTVSVWRPDMGWDKVTSAGKPIPQVSIKIEDPD
FT                   THEELPTGEVGEVVVKSPYVFEGYYQNPSATQKVLKDGWFYMGDSGKLDEDGFLYITGR
FT                   YKDVIVYGGDNIYPDQVEEIIDQVPGVVESAVIGVPDEMYGEVPRAYVVKNESAGLKKE
FT                   DIIAYCKERLSDYKIPEIVFIDSLPKNRLGKIVKKDLRELAVKGQ"
FT   gene            276556..277770
FT                   /locus_tag="BL01661"
FT   CDS_pept        276556..277770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01661"
FT                   /product="putative Proteinase inhibititor I4, serpin"
FT                   /function="Molecular Function: serine-type endopeptidase
FT                   inhibitor activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01661"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21907"
FT                   /db_xref="GOA:Q65NV4"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV4"
FT                   /protein_id="AAU21907.1"
FT                   /translation="MKSKWSAMVVIAGLLLLAGCGALKEADPPRGRSAQKTEASFSEAE
FT                   QRFALALFQDMIKEEGSRKNIFLSPYSIQQALLMTANGAAGDSRKELLSTLHLSQADMA
FT                   SINGISKSVNRSLETLPHGEFSSANSIWTKRELKESFQDAIKGLGDAYQLQIDPNRATE
FT                   EINSWVKKKTKDRIDQIVDKVSSNTIAYIINAVYFKESWKHPFDPHMTAEQPFYSADGS
FT                   AKKHPMMTQTNRFPYLENEHFQAVKLPFQDEGLSLAVFLPKKAANLEQLLTGMTHDQWR
FT                   ALQKGWTMKQVELKLPRFSFQTDYMLNEPLKRLGMKNVFSSANFSNMFTGHGAAQINKV
FT                   RHKTFIKVDEAGTEASAATAVEIIESAPVPEVTMTADHPFYFAIVDEASGMILFLGSVA
FT                   EPKDD"
FT   gene            277881..278708
FT                   /locus_tag="BL01663"
FT   CDS_pept        277881..278708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01663"
FT                   /product="antibacterial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01663"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21908"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV3"
FT                   /protein_id="AAU21908.1"
FT                   /translation="MKKSLFLFVFSLFLMAIPAFSASANVYEDEYEPNNSFAEAYDVGL
FT                   WKYKTISATIHSESDKDYYKFYATKGEQLAIHLKNIPANTDYDLYLFKDAYGYPAVGSS
FT                   ERMGNQNEIIRLDVPETGRYIAVVMSKDGSYDGWGFYRLEFIDRMKSGAYTANLSPSSI
FT                   SSPGQGVVSPVAAVNLANASAIPEGATVKSVSAEGTIYPSLGHTYREVLNKEEGVWHTS
FT                   VSGGTLFPDLKPELALPVKTTWNVRYYSLAWSSSTWRSPQLKINYQYDSTYGW"
FT   gene            278757..279599
FT                   /locus_tag="BL01664"
FT   CDS_pept        278757..279599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01664"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21909"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="UniProtKB/TrEMBL:A5A6A0"
FT                   /protein_id="AAU21909.2"
FT                   /translation="MKGAPMNIRDRVKLSLYSEQLMKPAAANVPAKTKGSKRMPASQTD
FT                   TLSISKQAESAQKNAPSLRSQMNGVQFEIYNLYVDRQRLNSQIEGALRESGISLSESEH
FT                   LTLHVDGHNRITVEGIEDEQKRTRIEAVLNDSDKRFGARLLGHAELIGEQNGTPLDKQA
FT                   YEKWHVNEFLKTVAGLSLADVSLDERGELEGGNEKLTRVIESAKDPKSDLEKSFQNILK
FT                   KLKNVLAKGPDTILDRSASFGYAGGTLIDLNVSKGFSAGQLNEWLDDPFLREVLLNNF"
FT   gene            279729..280481
FT                   /gene="mtaB"
FT                   /locus_tag="BL01665"
FT   CDS_pept        279729..280481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaB"
FT                   /locus_tag="BL01665"
FT                   /product="transcriptional regulator (MerR family)"
FT                   /function="positive regulation of multidrug-efflux
FT                   transporter genes (bmr and blt)"
FT                   /note="transcriptional activator of multidrug-efflux
FT                   transporter genes"
FT                   /db_xref="EnsemblGenomes-Gn:BL01665"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21910"
FT                   /db_xref="GOA:Q65NV1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV1"
FT                   /protein_id="AAU21910.1"
FT                   /translation="MKMKVKEVADLVGISVRTLHHYDEIGLLAPSETTEAGYRLYSDDD
FT                   LEKLQQILFFRELDFPLKKIKSILENPSFDKNEALQLHRKALLEKRSRLDQMIATIDKT
FT                   IQFAKGEINMTNEEKFAGFDFSQNPYEEEARERWGDEAVDRSKAYIESMSEGERKKMEQ
FT                   QYDAIYRKIAALREGAPDSEEAQAAIKEWYDFLNNNTGHSYSLEAFKGLGQMYVADKRF
FT                   TKNIDQYGAGLAKFMCDAMTVFADRNQE"
FT   gene            280694..280873
FT                   /locus_tag="BL01666"
FT   CDS_pept        280694..280873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01666"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21911"
FT                   /db_xref="GOA:Q65NV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NV0"
FT                   /protein_id="AAU21911.1"
FT                   /translation="MNTYLTGILFVLSGILLLNLAVLSGINGVLWGLVLGGSIIFNLIG
FT                   VVLLMRYINEKSHT"
FT   gene            280893..281237
FT                   /locus_tag="BL01667"
FT   CDS_pept        280893..281237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01667"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01667"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21912"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU9"
FT                   /protein_id="AAU21912.1"
FT                   /translation="MKKTAENYLPLTQATYYILLSLTQPLHGYGIMQRVESMSEGEVKL
FT                   GPGTLYGALSKLEKQGLIKKEGETGDNRRKQYILTNEGWAVVELEFKRLSKLVAISQSI
FT                   FQKEGDTSNE"
FT   gene            281230..281745
FT                   /locus_tag="BL01668"
FT   CDS_pept        281230..281745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01668"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21913"
FT                   /db_xref="GOA:Q65NU8"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU8"
FT                   /protein_id="AAU21913.1"
FT                   /translation="MSKKRKRKFRFFLAWQDRKEEDWLNEMAKQGWMLKSFFLFIYTFE
FT                   KTKPSNTVYRLDYKTTSNLDQEEYIHIYEDAGWKHVTQFLNWHYFAADPSQVQTNVIYT
FT                   DRESEAEKYNGLLKVLYAALASVFLSSGLPILIIGIPGYFYWIAAFNLFVLCLLIVCIL
FT                   KVRRKTRI"
FT   gene            282162..282323
FT                   /gene="rtpA"
FT                   /locus_tag="BL05022"
FT   CDS_pept        282162..282323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtpA"
FT                   /locus_tag="BL05022"
FT                   /product="inhibitor of TRAP, regulated by T-BOX (trp)
FT                   sequence RtpA"
FT                   /db_xref="EnsemblGenomes-Gn:BL05022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21914"
FT                   /db_xref="GOA:Q65NU7"
FT                   /db_xref="InterPro:IPR031538"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="PDB:3LCZ"
FT                   /db_xref="PDB:3LD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU7"
FT                   /protein_id="AAU21914.1"
FT                   /translation="MVIATDDLETTCPNCNGSGREEPEPCPKCSGKGVILTAQGSTLLH
FT                   FIKKHLNE"
FT   gene            282343..283287
FT                   /gene="ycbK"
FT                   /locus_tag="BL01669"
FT   CDS_pept        282343..283287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbK"
FT                   /locus_tag="BL01669"
FT                   /product="hypothetical membrane protein YcbK"
FT                   /function="Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01669"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21915"
FT                   /db_xref="GOA:Q65NU6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU6"
FT                   /protein_id="AAU21915.1"
FT                   /translation="MSRAEKSTAEQSGHIQHGVRKAAGVVFMVFGTMCFASKSIFVKWA
FT                   YEQGAQPEAVLLYRQLFAAPLFWLIFIVYRSKLPAKPEKAEIFKACAAGLLCFFLSPLL
FT                   DFIGLHGVSATVERMIVMSYPMFVLIITAFVNKKMVSGKTFAAILLVNAGLFLAVGGWD
FT                   VQALEANLSGAFLILLSAVAYAAYLVVAGGLVRQIGGIRMNAYGMSAASLAMAGYALLR
FT                   SLREQPGIVLSYPPAMYGFFMIIAAVTTVIPFLFMLEGMKRIGAERGAVISMIGPVLTI
FT                   FGGVLFLNERLTPVQWLGCLLVHLTVSLLEYRK"
FT   gene            complement(283339..283731)
FT                   /gene="yczC"
FT                   /locus_tag="BL01791"
FT   CDS_pept        complement(283339..283731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BL01791"
FT                   /product="conserved membrane protein YczC"
FT                   /db_xref="EnsemblGenomes-Gn:BL01791"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21916"
FT                   /db_xref="GOA:Q62Z92"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z92"
FT                   /protein_id="AAU21916.1"
FT                   /translation="MQYARFWVRAGAWLIDCVLAVGLHFSSAWIFGDGSHEVAAAALLV
FT                   YVLYPLLMPLTKLQGTIGKAIFRIRIVSDDTGRRIKLWQAFVRYIVSWVHIFFGLLYLT
FT                   VVFSGTKQAVHDFAARTYVMKTSDTE"
FT   gene            283945..285012
FT                   /gene="yccF"
FT                   /locus_tag="BL01670"
FT   CDS_pept        283945..285012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="BL01670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01670"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21917"
FT                   /db_xref="GOA:Q65NU4"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU4"
FT                   /protein_id="AAU21917.1"
FT                   /translation="MGKVKRNMPCPCGSGLKYKKCCGKAEGAFPAVAVQELKQIQKDVM
FT                   EFAFTEHKDTIDQFLNQYSFLSDLDQSAQKICVFNLGVWGVFARPLADGGLTIFEDFLQ
FT                   KKGSSILRSQTKEAVQSWKDLSPALLRVKHITDGGIRFEDAVTNEELTVRMNVKREGPF
FT                   VGEYVLGFPIKIGSHTEFFLQFTIYPAKMADALKDRLSEALNRFTEEGGTKEQLMREDF
FT                   HHVLMHLCRQEESTPSEQVSEDIEWANEMEKETALVFEKGMLDEGHSEPFVSWAVGLWK
FT                   SYCAKKAPVIKKTEAFAAALEYFINTISKSEKSISQAKLAKKYGVSASTVSNRFKDIEA
FT                   VLQDELDHHLELMPS"
FT   gene            285138..285854
FT                   /gene="spaF"
FT                   /locus_tag="BL01671"
FT   CDS_pept        285138..285854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaF"
FT                   /locus_tag="BL01671"
FT                   /product="ABC transporter SpaF"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Biological Process: transport,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01671"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21918"
FT                   /db_xref="GOA:Q62Z90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z90"
FT                   /protein_id="AAU21918.1"
FT                   /translation="MSTILLETRHLQKKFGRSQAVSDVSLSVEKNSIYGLLGPNGAGKS
FT                   TTLKLLTGILNPTAGDILFEGRQWKRSVLKDIGSLIESPPLYDNLTAYENAKVHAALLG
FT                   LPDARITEVLKTVDMHHTGKKKAGQFSMGMRQRLGIAIALLNRPKLLILDEPTNGLDPI
FT                   GIQELRELIRSFPEQGMTVILSSHILSEVEQIADHIGIISGGYLGYQGKINKGDDLERL
FT                   FMDVVKSTREKEGGEK"
FT   gene            285851..286609
FT                   /gene="spaE"
FT                   /locus_tag="BL01672"
FT   CDS_pept        285851..286609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaE"
FT                   /locus_tag="BL01672"
FT                   /product="SpaE"
FT                   /db_xref="EnsemblGenomes-Gn:BL01672"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21919"
FT                   /db_xref="GOA:Q65NU2"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU2"
FT                   /protein_id="AAU21919.1"
FT                   /translation="MIGYYVKAENLKFKRTFSRKMIFIVPLINICFAFLMNPGFFVAGT
FT                   YNWWSVILMPVMIALLCAQSHQKEKKASNYNGIFSSPVDLHQIWYAKISVIALYSLASQ
FT                   AVFLGFMVGMQFVIPQFSSIHLTVIAANLLLWLTTLWEIPVCLWIARKYGFISAVLFNM
FT                   LGTIILGIMSASSPFWWLNPWSWPIRVMCPTIGIHPNGVPLENGDPLTSWAVVPPAVVL
FT                   SVLLFAILARLTRRSFSPAVDRKSIKREAV"
FT   gene            286611..287381
FT                   /gene="spaG"
FT                   /locus_tag="BL01673"
FT   CDS_pept        286611..287381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaG"
FT                   /locus_tag="BL01673"
FT                   /product="SpaG"
FT                   /note="also annotated as lantibiotic permease"
FT                   /db_xref="EnsemblGenomes-Gn:BL01673"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21920"
FT                   /db_xref="GOA:Q65NU1"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU1"
FT                   /protein_id="AAU21920.1"
FT                   /translation="MLLFFRCLAADFQKTKRTSFIWLHLSVPVICAGVFLLYFYNRQPD
FT                   PYQLYRTYFEAIAIALPLLIGIVCGMTASLEEQAGRFQVLLGGTAPKLTAYLSKVTLLL
FT                   IMNIFAVFLAIGLYLLGLRALFHVPNLPSSLFLEAGAWLAAGSVTLYFIYFLISCTFGM
FT                   GASILAGGAGLLMTALMNTGLGDVIWKYNPWAWGIRLTGYKGIDRFVQIDPSLRSVLDG
FT                   EIKQGAFIMVFAIIAVFALSIIWFIRWEGRKAFE"
FT   gene            287403..288065
FT                   /gene="spaR"
FT                   /locus_tag="BL01674"
FT   CDS_pept        287403..288065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaR"
FT                   /locus_tag="BL01674"
FT                   /product="SpaR"
FT                   /note="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01674"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21921"
FT                   /db_xref="GOA:Q65NU0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NU0"
FT                   /protein_id="AAU21921.1"
FT                   /translation="MAKILAVDDEKDILVLIQNILRRDQHQVHTLSQVNTESLDVFSGY
FT                   DLILLDVMMPGMDGFELCEKIRPLVDCPILFLTAKTEEEAIVKGLLTGGDDYISKPFGV
FT                   LELSARVNAHLRRERREKYETKRVISGFLFHFDSKEVFIHDQKLNLTKNEFKICELLAQ
FT                   HKGRTFTREEIYDHVYGLEGNALYSTITEFIRTIRKKCKEHNRDPIKTVWGVGYRWE"
FT   gene            288056..289426
FT                   /gene="spaK"
FT                   /locus_tag="BL01675"
FT   CDS_pept        288056..289426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaK"
FT                   /locus_tag="BL01675"
FT                   /product="two-component sensor histidine kinase SpaK"
FT                   /function="two component sensor kinase, signal
FT                   transduction"
FT                   /note="similar to Subtilin biosynthesis sensor protein spaK
FT                   in Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01675"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21922"
FT                   /db_xref="GOA:Q65NT9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT9"
FT                   /protein_id="AAU21922.1"
FT                   /translation="MGIIRKKKTLRRELIKYMLTLSFSLIAITALYVLVNMIGMNAGLF
FT                   YPANYNEIEAEKLKPRLQSAEQITEDMIPDTMLYAILDKKSKQKTAGNMKETNLSIVRK
FT                   KIESRPYVSFSQKGYMIIERKDEYCVLEYPLRAEFRSPLLRRFLPNYELTSICIIVLLL
FT                   ITVVFTVTTRFANRLKEHFQTLNTIAEQIKKQNLNFTPEFSNIKEFDHVISSLMDMRNA
FT                   LQASLRAQWHLEKTKKEQIGALAHDIKIPVTIIKGNAELLSLSPQNQEQSEYIRYILDA
FT                   GQKIEQYIDQLIHLSKTEEALHTEYREGAVKTLVESVLHETEAYIGNKSIDIVLKEQNL
FT                   EGKKAVFDKQLLHRALMNIMTNAADHTPEGGRIDFEAVCTADQLIFTITDSGKGFSQDG
FT                   LQKAAELFYMEDKARTSNGHYGMGLTFALRVVKLHQGDLAIKNSEAGGGQVQVTIPL"
FT   gene            complement(289499..290383)
FT                   /gene="ytlI"
FT                   /locus_tag="BL01792"
FT   CDS_pept        complement(289499..290383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytlI"
FT                   /locus_tag="BL01792"
FT                   /product="transcription regulatory protein YtlI"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01792"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21923"
FT                   /db_xref="GOA:Q65NT8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT8"
FT                   /protein_id="AAU21923.1"
FT                   /translation="MDFKTLKTFHKIVACGSFNRAAEELNYAQSTVTMQIKKLEEDLGI
FT                   RLLERGKTFRLTEAGRLFFEESRHIVKDIDHLQHHMADLLLGEGGNIRLGAVEPIASCE
FT                   LPQILGRFLADYPKIRVSVDIANSSALGERLVQGSLDLAVCSTPAMGTDLYFEPLYAEE
FT                   LVVLLPEGHPAGNNERIHLKDIREHRLLITANNCTYRKKVEIAFQELPGSQMNTMEIGS
FT                   MTALKNYVAAGLGVALIPKSIVSPPPPGTIVRFIDDDPISVTFGILCKTAAFPLKQADA
FT                   KLYQYLKQELGEP"
FT   gene            290493..290888
FT                   /gene="yusQ"
FT                   /locus_tag="BL01677"
FT   CDS_pept        290493..290888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yusQ"
FT                   /locus_tag="BL01677"
FT                   /product="4-oxalocrotonate tautomerase YusQ"
FT                   /function="Biological Process: aromatic compound
FT                   metabolism, Molecular Function: isomerase activity,
FT                   Biological Process: aromatic compound metabolism, Molecular
FT                   Function: isomerase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01677"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21924"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT7"
FT                   /protein_id="AAU21924.1"
FT                   /translation="MPFVRMDLLKGRSKEELRRISRSVHQAMTEAIDVPEDDYFQVITQ
FT                   HDEEEFFFDPSYMNIKRTKDLIYIHITMKERPIEKKLALYQRIAERLQKNAGIRQEDVM
FT                   IIAAENVKENWSFGNGTAQLASVERER"
FT   gene            290892..291632
FT                   /gene="yusR"
FT                   /locus_tag="BL01678"
FT   CDS_pept        290892..291632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yusR"
FT                   /locus_tag="BL01678"
FT                   /product="putative Short-chain dehydrogenase/reductase
FT                   YusR"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: oxidoreductase activity"
FT                   /note="similar to 3-oxoacyl- acyl-carrier protein
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01678"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21925"
FT                   /db_xref="GOA:Q65NT6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT6"
FT                   /protein_id="AAU21925.1"
FT                   /translation="MEMKNKTALVTGGGTGIGRAVSLSLANRGAAVVVNYSRSKAEAEE
FT                   TVGMIESQGGRALAVKADVSKISEVQDMFDRAVGEFGTVDLLVNNASITRHIELDDLEG
FT                   ASEEVWDELYAVNVKGMFNCARAAAPFMKRNKQGAIVNVGSIAGLTGSGSSLPYAVSKA
FT                   AVHGLTKSLAHALAPDIRVSCVAPGAVSTRWWEGNEEKMKRLSQKLPLERIAEPEDIAL
FT                   LICALLEQETVTGQILTADCGQTL"
FT   gene            291720..293804
FT                   /locus_tag="BL01679"
FT   CDS_pept        291720..293804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01679"
FT                   /product="putative methyltransferase"
FT                   /function="Molecular Function:
FT                   S-adenosylmethionine-dependent methyltransferase activity,
FT                   Molecular Function: methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01679"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21926"
FT                   /db_xref="GOA:Q65NT5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT5"
FT                   /protein_id="AAU21926.1"
FT                   /translation="MRRLQSLEAIEKVKNGDYHVLRDAEWLKYLVLTEEQNINLERISS
FT                   LENMPQNPVFLYVEQTLSILEKADIPELEKEIIEEVLIWSEAAKCGQPHKRKEWREKGF
FT                   QLAIHNIGSAQIYADRRQAYMPERQDIEELIHILIVTHGLVGQYIRGETRYRQFTPLID
FT                   WIETSELQHIDIRRVLYVLNKCIIEAVSPALWDSIERDVNRVIGQICTGERNKDWPFAE
FT                   RIRKLRGQALDSGEDSSRYERFLREHSAEDTLRRFFQRIDLWYVESALSSFSFEEFVKI
FT                   FLLVLRSVNPLSVKHISFEPLMKDMYRDYQGVRHINVYKKRIIEACLKEMSISDLLYGE
FT                   VPVNEHVSLAVQPFDQASEIVGVTFSFSQAGLKLIEFCQEAEKSPLYERAIVLLYDFFE
FT                   FRKDSFDRLQNEAAYLSDMNGAEDYKKKIADYAVGERMLDIGAGGGVMLDLLTDQHPEA
FT                   EVIGIDLSVNVIEELQKRKVREHKPWHVKQADALDLPEYFEQESVDTIVFSSILHELFS
FT                   YIPYEGKKFNHLVIAQALKSSFDILKPGGRIIIRDGIMTENKEETRRIRFKDPDGMDFL
FT                   KRYVHDFKGRKVQMLEAEKDAAVLFVNDAMEFLYTYTWGEEAYPHEVQEQFGYFTPSEF
FT                   RRCIEKELGERANILVFEHYVQEGYEEHLYPKIELTDRLGRRVPLPDSTCFIVIEKKHL
FT                   "
FT   gene            complement(293815..294891)
FT                   /gene="ycdA"
FT                   /locus_tag="BL01793"
FT   CDS_pept        complement(293815..294891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdA"
FT                   /locus_tag="BL01793"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01793"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21927"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT4"
FT                   /protein_id="AAU21927.1"
FT                   /translation="MRSKKFFLMMLLMIVAVVSTACGGSKSASGEKEDTKKADNAEVKI
FT                   LSSEYTLPDDSSTNLHENELILKINVSVKNTGKEPLMVDKSQFSLYEGDSKMSDVSVYD
FT                   ERNKRLRSSTLNSDKEVDGNIYYIVEKGKKFQLEYTPDMYGENKADPVKFEIDGGSDEL
FT                   LKTAKKLEDPAKALLAYTDVTIFGKDNNNFDKLVDENKREVVTDYLEGAQKSIVRSLGY
FT                   YDEEDVDKKKLNKLISAIQNAYQEKSQVKAVTKSISGDEATVEATVTPIDNTDVQKKVK
FT                   KRLEDYVKDSGKDFMSRDELINPAIDIMSEEIKKAEATSSEKTVEVKLEKSKNDKWKID
FT                   ADNYKTEQYFSSFLKSNN"
FT   gene            complement(295507..296907)
FT                   /gene="ycgA"
FT                   /locus_tag="BL01794"
FT   CDS_pept        complement(295507..296907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="BL01794"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /function="Molecular Function: C4-dicarboxylate transporter
FT                   activity, Biological Process: C4-dicarboxylate transport,
FT                   Cellular Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01794"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21928"
FT                   /db_xref="GOA:Q65NT3"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT3"
FT                   /protein_id="AAU21928.1"
FT                   /translation="MSNGTPQKTKLHFPHTYALIFFIIILAALASYFIPSGEFKRVEED
FT                   GQTVIVQGSYKQTDAGPVGFFEMFKAIPEGMIQSADIIFYIFLIGGAFGIIHQTGMIRA
FT                   GVHVLVQRLKKRGFLLIPVTMFVFSIGGATIGLSEETIIFIPIGIAVARALGYDSMTGL
FT                   AMISLGAAAGFTGGMLNPFTVGIAQTIAEVPVFSAFGYRLAVYAAMLGFSIFYVMRYAQ
FT                   QVKAHPNTGLMYGSETEINEETAAGHADLSFTGRHGLVLLITALGFGINMFGVFQWGWF
FT                   LSELSAGFLIIGFAAGLAGGRGINNTFHSFVDGMKQVVYGALIVGFARAIVIVLENGHI
FT                   IDTIINSLASAISSLPNEISAIGMFAVQIAINTFIPSGSGQAATTMPLMAPLADLLGFE
FT                   RQIAVFAYQYGDGITNSIIPTSGVLLASLSIAGVPYERWVKFVWKLIAGWIIIGAAAIV
FT                   IAMIIGIK"
FT   gene            297032..298207
FT                   /gene="hipO"
FT                   /locus_tag="BL01680"
FT   CDS_pept        297032..298207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipO"
FT                   /locus_tag="BL01680"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01680"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21929"
FT                   /db_xref="GOA:Q65NT2"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT2"
FT                   /protein_id="AAU21929.1"
FT                   /translation="MKKQIEKEIENIREELLHISQYIGNHPELGHEEFKASKILSEELK
FT                   KHGFQVELGTCGLATAFTAEFDSGRPGPSIGFMAEYDALPDLGHACGHNLIGTMAVGAA
FT                   IGVSKVIASCGGKVYVYGTPAEETKGGKVTMAEQGVFDHLDAAMMVHPYCRHEKSGTSL
FT                   AMDAIQFEFFGKASHAAGAPHEGINALDAVIQTFNGINALRQHILPDARIHGIIPEGGK
FT                   AANVVPDYAVAQFYVRGTERAYVNELLDKVKNCAKAAALATGARLESSFYELSYDDLKT
FT                   NETLSDAFTQNMIELGVDPDSIHEKADGGGSVDMGNVSQIAPSIHPYVQICDEPYACHT
FT                   PEFREAAMSSRGFEGLMLGAKSMAFTAYDVLINEELLKKIKEEFNLLKALA"
FT   gene            complement(298419..298871)
FT                   /gene="yvbK"
FT                   /locus_tag="BL01795"
FT   CDS_pept        complement(298419..298871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvbK"
FT                   /locus_tag="BL01795"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /function="Molecular Function: N-acetyltransferase
FT                   activity"
FT                   /note="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01795"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21930"
FT                   /db_xref="GOA:Q65NT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT1"
FT                   /protein_id="AAU21930.1"
FT                   /translation="MNIRRLHPEHEPPLDLLLTADPSEKLVNDYLERGQCYTAEIDRRI
FT                   AGVYVLLPTRPETAELVNIAVKEDLQGKGIGRQLVMHAIETAKAQGFKTIEIGTGNSSI
FT                   GQLALYQKCGFRITGIDRNFFLRHYEKPIYENGMRCIDMIRLSLDL"
FT   gene            298971..300470
FT                   /locus_tag="BL01681"
FT   CDS_pept        298971..300470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01681"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase (subunit A)"
FT                   /function="formation of correctly charged Gln-tRNA(Gln)
FT                   through transamidation of misacylated Glu-tRNA(Gln),
FT                   Molecular Function: amidase activity"
FT                   /note="similar to gatA from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01681"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21931"
FT                   /db_xref="GOA:Q65NT0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NT0"
FT                   /protein_id="AAU21931.2"
FT                   /translation="MNISDYVKHDAVALSKLIKHGEVTVNELIDAAFSRLEEVNPELNA
FT                   VIRTRKEQVKIESKQLDIRHQPFAGVPILLKDISQALKGEPLTAGAKLLSSYKPKRDSN
FT                   FVAKLRGAGFLFLGQTNTPEYGLKNISEPELYGPSRNPWNTDYSPGGSSGGSAAAVAAG
FT                   IVPLAGASDGGGSIRIPASFTGLFGLKPTRGRTPVGPGAGRQWQGASIDFVLSRTVRDS
FT                   AALLDILQTIQPEAAFQTPLFPGQYEEDMKKGLERPLKIAFSVESPVGTPVSDEAKQAV
FT                   RRTVRWLEAQGHHVEEQTNGVDGIRLMENYYLMNSGEISAMILGMEKTLGRAITVQDVE
FT                   IVTWVLNEAGKKVSAAEFTASLASWDRAAAQMAAFHETYDLYVTPATAYPAPKVGELTH
FT                   TEKEAEALLKVSELEKIEQQSLIYQMFLKSLTYTPFTQLANLTGQPAMSVPVHLTNEGL
FT                   PLGVQVTAPKGKEHWLLRTAHLLEQSDLWIGMKGNPMLGSL"
FT   gene            complement(300493..302328)
FT                   /locus_tag="BL01796"
FT   CDS_pept        complement(300493..302328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01796"
FT                   /product="neutral zinc metallopeptidase"
FT                   /function="Biological Process: proteolysis and
FT                   peptidolysis, Molecular Function: metallopeptidase
FT                   activity, Molecular Function: zinc ion binding"
FT                   /note="also annotated as Oligoendopeptidase F, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BL01796"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21932"
FT                   /db_xref="GOA:Q65NS9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS9"
FT                   /protein_id="AAU21932.1"
FT                   /translation="MEKVAEKRPKRCEVPEELTWNLTDLFSSYETWEDALVKIEEDLAS
FT                   IGSFKGRLHEGAGVLLDCLSLREILLKRLVRAAAYTHLRKSEDLTNPVNQADASRMAAL
FT                   QAKINAGLSFIQSEILEFPENQVETYIKNEKGLEPFSKMLTEIMELKPYKLAPETEEAL
FT                   AVLGEIHDAPYKIFGMAKLADMQFSPIQDRNGNTLANSFALYEGKYMFSPDTHIRRTAF
FT                   DSFTNTLQTYKNTIAAIYETEVKKQVSMSRLRGYESVTHMLLQPQSVTLEMYRNQLDVI
FT                   KNELAPHMRKYAALKKRVLDLDEMRFCDLQAPLDHDFSPKTTYEQAGRMILDALQVMGP
FT                   EYTEVMETALTERWVDLADNIGKSTGAFCSSPYGAHPFILMTWTDTMRDAFTLAHELGH
FT                   AGHFYFANREQRIMNVRPSLYFIEAPSTMNEMLLAQHLFSKTNDPKMKRWVINQLMGTY
FT                   YHNFVTHLLEGEYQRRVYELAEQGHALTASVLSEQTSAVLSEFWGSGVKVDEGASLTWM
FT                   RQPHYYMGLYPYTYSAGLTASTIVSQQIKEEGRPAVDRWLNVLKAGGTMKPLDLLKHAG
FT                   VDMSTDQPIRRAVTYVGTLVDELEKLYDKKEDRPD"
FT   gene            complement(302441..302710)
FT                   /locus_tag="BL01797"
FT   CDS_pept        complement(302441..302710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01797"
FT                   /product="conserved membrane protein"
FT                   /function="Cellular Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01797"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21933"
FT                   /db_xref="GOA:Q65NS8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS8"
FT                   /protein_id="AAU21933.1"
FT                   /translation="MFGFIWSLIIGGILGWLAGLIIRRDVPGGIIGNIIAGFIGSWLGS
FT                   MILGRWGPVVGGFNIIPALIGAIILIFIVSLVMRSMGGRNRNAQ"
FT   gene            302881..304596
FT                   /locus_tag="BL01682"
FT   CDS_pept        302881..304596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01682"
FT                   /product="penicillin-binding protein"
FT                   /note="BL01682 similar to pbpX from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01682"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21934"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS7"
FT                   /protein_id="AAU21934.1"
FT                   /translation="MKQSLKALKGFRAFAEEKMKEWNVPGAAVAVIKEDEIIMAEGFGF
FT                   RDKERKLKVNPETVFAIGSASKAFTTAAMAVLADEGKMEWDKPVREYLPEFKMHDPVAT
FT                   ERMTPRDLACHRSGLPRHEMMWYNSSFSREELFRRIRYLEPNQDFRSKWQYQNLMYMTA
FT                   GYLAGRIAGTTWEDLVHERLFKPLHMTSSSFSVEDMQKLSDFAFPYQENNGTVEKIPFR
FT                   NIDAIGPAGSINSNAVDMANWLLLQLGSEKFNGVLSDGSLHELHTPCISCDSIIKAKEL
FT                   PVCSYGLGWFVEPYRGRHMIHHGGNIDGFSSLVAFMPYEKIGIVILTNMNGSFLPNVLA
FT                   YNIFDRLLGLEEIDWSGRLKGEAEKIMKAALGVDRTADLTKIEGTNPSHALKDYTGVYE
FT                   HPGYGEIKIELKDGVLQALFNSFVMPLKHYHYNIFEMKMPLTEMAMLASFDTDIHGHIS
FT                   RLSIPFEMAEGAREIEFVRKPDQQLYDPEFLASLTGKYALGDGTDVVVSLRNNRTLWVS
FT                   LPGQPDYELEPYRELTFQIKNLPGFSVRFEAGDSGQVTGLRFIQPNGEFPAVRK"
FT   gene            complement(304656..305978)
FT                   /gene="ysfD"
FT                   /locus_tag="BL01798"
FT   CDS_pept        complement(304656..305978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysfD"
FT                   /locus_tag="BL01798"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain"
FT                   /function="Molecular Function: electron transporter
FT                   activity, Molecular Function: iron ion binding, Biological
FT                   Process: electron transport"
FT                   /note="glcF in Bacillus thuringiensis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01798"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21935"
FT                   /db_xref="GOA:Q65NS6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS6"
FT                   /protein_id="AAU21935.1"
FT                   /translation="MTTADERKVIEQQFKQRMDEEELLNCMRCGFCLPSCPTYIESGFQ
FT                   ESHSPRGRIALMKAVVDGTIEPDEDVERSLELCLGCRACEPVCPSGVNYGRLLEEARDI
FT                   IQQNKKHAFPVKVLRRAVFKGLFPHPNRIRALTGMLGLYQRSGMQNVIRKSGLLRLLPD
FT                   HLAKMEAVLPKVPNMKQLKKRPHLLPAIGERKKRAAFFSGCLMDTLFLDTNMATIELLR
FT                   LAGCEIIIPEQQTCCGALHGHSSEKSEAILLAKRNIQAFEDSNADFIITNAGGCGAFLK
FT                   EYDHLLKDDSEWRERAASFTGKLKDFSSVLLELNFDQQSLELPEQIVTYQDSCHLRNVM
FT                   KTSAEPRRLIRSIKGIEFKEMKNAESCCGSAGIYNIVESEMSMKILDTKMEAAAATRAA
FT                   TIVTANPGCLLQMKLGIERAGLTDRVRAVHLADLLLEAVQK"
FT   gene            complement(305975..307387)
FT                   /gene="ysfC"
FT                   /locus_tag="BL01799"
FT   CDS_pept        complement(305975..307387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysfC"
FT                   /locus_tag="BL01799"
FT                   /product="Glycolate oxidase subunit GlcD"
FT                   /function="Molecular Function: glycolate oxidase activity,
FT                   Cellular Component: glycolate oxidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:BL01799"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21936"
FT                   /db_xref="GOA:Q65NS5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS5"
FT                   /protein_id="AAU21936.1"
FT                   /translation="MISSQVRSKLIEIVGSANYDDSNAGRLVYSYDATPQFQSMPDAVI
FT                   APRSKEEVSRIVKICNTHRIPIVPRGSGTNLCAGTCPTEGGIVLLFKHMNQILEIDEEN
FT                   LTITVQPGVITLDLIHAAEEKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDY
FT                   VMALEIVLANGDIIRTGGKLAKDVAGYDLTRLFVGSEGTLGVITEATLKLIPAPETKKT
FT                   VLALYQDIDSAAQTVSNIIAHKIIPTTLEFLDQPTIQVIEDFAKIGLPVHAKAVLLIEQ
FT                   DGTEDAVRRDIAVIEEICKKGNAVSVQTAQTEAEAENLREARRTALSALARLKPTTILE
FT                   DATVPRSEIAEMVKAINSIAEKHQISICTFGHAGDGNLHPTCTTDVRNSEEMKRVEQAF
FT                   EDIFKKAVELGGTITGEHGVGEMKAPYLELKLGNAGIAAMKAVKQALDPNNIMNPGKIF
FT                   AKDSRKRVVVTR"
FT   gene            complement(307511..307813)
FT                   /locus_tag="BL01800"
FT   CDS_pept        complement(307511..307813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01800"
FT                   /product="Phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system"
FT                   /db_xref="EnsemblGenomes-Gn:BL01800"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21937"
FT                   /db_xref="GOA:Q65NS4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS4"
FT                   /protein_id="AAU21937.1"
FT                   /translation="MKIALVCSAGMSTSILVKKMREEAENRSLKAEINAYAEADLPSDL
FT                   DEIDVILIGPQVRYLKGQMTERAKPYHTPVAVIDQMAYGMMDGAKVLNQAISLAT"
FT   gene            complement(307810..308142)
FT                   /locus_tag="BL01801"
FT   CDS_pept        complement(307810..308142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01801"
FT                   /product="phosphotransferase system (PTS) lichenan-specific
FT                   enzyme IIA component"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: transport, Biological Process:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, Cellular Component: membrane"
FT                   /note="BL01801 similar to licA from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01801"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21938"
FT                   /db_xref="GOA:Q65NS3"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS3"
FT                   /protein_id="AAU21938.1"
FT                   /translation="MADTLQLEQVSFEIILHAGNARSSAMEALQLVKHHECETGYQKIQ
FT                   EAESELNQAHQAQTRLLQKEAQGAGLSPNLLLIHAQDHLMTAITVKDLAKEMIDLYQEL
FT                   GKGREK"
FT   gene            complement(308159..309445)
FT                   /gene="ywbA"
FT                   /locus_tag="BL01802"
FT   CDS_pept        complement(308159..309445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywbA"
FT                   /locus_tag="BL01802"
FT                   /product="PTS lactose/cellobiose IIC component,PTS system
FT                   cellobiose-specific IIC component"
FT                   /function="Molecular Function:
FT                   protein-N(PI)-phosphohistidine-sugar phosphotransferase
FT                   activity, Biological Process: phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system, Cellular Component:
FT                   integral to membrane,Molecu"
FT                   /note="putative PTS cellobiose-specific enzyme IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BL01802"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21939"
FT                   /db_xref="GOA:Q65NS2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS2"
FT                   /protein_id="AAU21939.1"
FT                   /translation="MKQNKMMAFIESNIMPIAGRIGSQRHLIAIRDGFIAIMPLIIIGS
FT                   LAILVNNFPIPAFQNFMTGLFGEGWTAVGGAIWNGSFALLSLLAVAAVSFKLAESYHTD
FT                   GLSAALIGVGAFAVLTPTTEDFGFSMTWLGAQGLFVGLIVALLSTEVFRLFSKNEKLKI
FT                   KMPEGVPDGVTKSLNALLPAAVILSTAGLCNALIVHFSGQSIHELVFSTIQEPLQGLSN
FT                   TVGSALIFTFLNHLLWFFGLHGTNILGPIMESVYLPLIQENQHLFSQGMSAFEVPYIVT
FT                   KPFFDSYVFMGGSGTTLALLAAILIAVKSKHYKTIGKVSLAPGLFNINEPVLFGLPIVL
FT                   NPIMFIPFILIPLILTITSYIALASGLVPKTVAILPWTTPPIVSGYLVTGGSVRGVFLQ
FT                   IFNLVLATLLYLPFIKAAQRSALHQTENE"
FT   gene            complement(309432..310766)
FT                   /locus_tag="BL01803"
FT   CDS_pept        complement(309432..310766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01803"
FT                   /product="Glycoside Hydrolase Family 4"
FT                   /function="Molecular Function: hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds, Biological Process:
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01803"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21940"
FT                   /db_xref="GOA:Q65NS1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS1"
FT                   /protein_id="AAU21940.1"
FT                   /translation="MALKVVVIGGGSSYTPEIIEGIIKRHHQFPVNEIVLVDIEEGKEK
FT                   LRIVSELAKRMIRHAGVPIELSHTIDRAKALKGADFVTVQIRVGGLKARALDEKIPLSH
FT                   GLIGQETNGAGGMFKALRTIPFMLDIARDIHEICPEAWLINFTNPAGIVTEALLKHGPH
FT                   QKVVGVCNIPYNMKNSIAEIFGVDVNLVMIEFAGINHFVFGKRVWIDGIDRTEETIELL
FT                   LNDHFGYSPSNIAALPWNRQFLRSLRMLPSPYHQYYYQHEDALAKDIEAYNNKGTRAET
FT                   VMEVERQLFERYKDAKIHEKPKELESRGGAYYSESACSLMNSLYHHSMDIQTVNTLNKG
FT                   SIPDLPDDAVIEVNSVITKSGPIPLTVGKLPDAISGPIILMKKFEQLVIEAAVTGDYDT
FT                   AYLAMITNPLVSSDHKAQKVLDEMLEAHKRYLPQFFEEVRAHETK"
FT   gene            310928..311656
FT                   /gene="ybgA"
FT                   /locus_tag="BL01683"
FT   CDS_pept        310928..311656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="BL01683"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BL01683"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21941"
FT                   /db_xref="GOA:Q65NS0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NS0"
FT                   /protein_id="AAU21941.1"
FT                   /translation="MAKQPQLHSQIKQDIVDKIESGYYPPGSLLPTESEFCKIYDVSRT
FT                   TLRTALNHLLMEGAIYRKQGKGTFVAKGKVKQILSSSSLRYAEQLKAQGFKPKIKVVDL
FT                   QKIKPSEKLQTRLGIDAEQMVYQVKRIRYADDEEIQFETAYIRTDLVPEVTEEMANISL
FT                   YQCISRQGNNIKRTEEQIKIVISDEEIAHHLNITQGTPCFQISTQTFLASEEVVEYSMA
FT                   YFRGDRVEFFIERDYGQRGK"
FT   gene            311661..312395
FT                   /locus_tag="BL01684"
FT   CDS_pept        311661..312395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01684"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21942"
FT                   /db_xref="GOA:Q62Z66"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z66"
FT                   /protein_id="AAU21942.1"
FT                   /translation="MKSLIINADDFGFSRGVNLGIIEAFQHGVLTSTTLMVNMQEADHA
FT                   VELARQNPELGVGIHLTLTAGRPILGGLHTITDEEGNFRKLLYYQGFFDIDLEEVYREW
FT                   KAQIEKALSCGLNPTHIDSHHHIHTYGNLPEVFVEVAKEYDLPCRKVNHDHPSLWKGVR
FT                   SNDAFELKVDRLKDLSSFFNDYQDAAVIEVMCHPAYVDKCLLEKSSFHYPRAYELSLLT
FT                   EPSLKAALQHCPDIRLTSYAGL"
FT   gene            312798..314594
FT                   /gene="chi"
FT                   /locus_tag="BL01685"
FT   CDS_pept        312798..314594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chi"
FT                   /locus_tag="BL01685"
FT                   /product="conserved protein, Glycoside Hydrolase Family 18"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: carbohydrate metabolism"
FT                   /note="chitnase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01685"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21943"
FT                   /db_xref="GOA:A5A699"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A5A699"
FT                   /protein_id="AAU21943.2"
FT                   /translation="MKIVLINKSKKFFVFSFIFVMMLSLSFVNGEVAKADSGKNYKIIG
FT                   YYPSWGAYGRDFQVWDMDVSKVSHINYAFADICWEGRHGNPDPTGPNPQTWSCQDENGV
FT                   IDAPNGTIVMGDPWIDAQKSNPGDVWDEPIRGNFKQLLKLKKSHPHLKTFISVGGWTWS
FT                   NRFSDVAADPAARENFAASAVEFLRKYGFDGVDLDWEYPVSGGLPGNSTRPEDKRNYTL
FT                   LLQEVRKKLDAAEAKDGKEYLLTIASGASPDYVSNTELDKIAQTVDWINIMTYDFNGGW
FT                   QSISAHNAPLFYDPKAKEAGVPNAETYNIENTVKRYKEAGVKGDKLVLGTPFYGRGWSG
FT                   CEPGGHGEYQKCGPAKEGTWEKGVFDFSDLERNYVNQNGYKRYWNDQAKVPFLYNAENG
FT                   NFITYDDEQSFGHKTDFIKANGLSGAMFWDFSGDSNRTLLNKLAADLDFAPDGGNPEPP
FT                   SSAPVNVRVTGKTATSVSLAWDAPSSGANIAEYVVSFENRSISVKETSAEIGGLKPGTA
FT                   YSFTVSAKDADGKLHAGPTVEVTTNSDQACSYDEWKETSAYTGGERVAFNGKVYEAKWW
FT                   TKGDRPDQSGEWGVWRLIGGCE"
FT   gene            314685..316766
FT                   /gene="chiA"
FT                   /locus_tag="BL01686"
FT   CDS_pept        314685..316766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiA"
FT                   /locus_tag="BL01686"
FT                   /product="Chitinase precursor, Glycoside Hydrolase Family
FT                   18"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01686"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21944"
FT                   /db_xref="GOA:Q65NR7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR009470"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR7"
FT                   /protein_id="AAU21944.1"
FT                   /translation="MKKAASSFLSCMLLLALFIPNRQISAETSSERPDCRPEGLWDSGV
FT                   EHVPYCDVYDKDGREKLANQLDRRIIGYFTSWRTGKGNQDRYLVSDIPWKYLSHINYAF
FT                   AHIGEDHRISVGEEADENNPSIGMTWPEHPDVKMDQTLPYKGHFNLIHQYKDRYPDVKV
FT                   LAAVGGWAETGGYVDKDGKRIPSGGFYSMTTNGDGSVNHKGIHTFAESVVAFLRKYEID
FT                   GIDIDYEYPTSMQDAGNPADWNIANPRRNGLNKSFEALMKTLREKLDQASAEDGKYYML
FT                   TIAAPSSAYLLRGMETFKPLRYVDYVNIMSYDLHGAWNEFVGPNASLFDNGEDAELKQS
FT                   NIYTTPEYEGIGYLNTDWAYHYFRGAVESGRINIGVPYYTRGWKNVTGGANGLWGRAKS
FT                   ADCPQGLRQCGDGATGIDNIWHDKDEQGNEIGAGANPMWHAKNLEKGIAGSYLERYGLS
FT                   KADLTGVYKRHYDAGLAAPWLWNPEKKVFLSTEDEESIKTKADYVIDKGIGGVMFWDLS
FT                   GDYDWYPERNGSKGEYGIGNTLTRTMYHKFSDTTPYDNRLSTSPLPDESLDAEVELTNF
FT                   PLGDQNYPIHPVMKLINNSDVTITGGSFIEFDAPTSTSPRFRSWSGDHVEVISKGHTGP
FT                   NIGGLTVDFHRIRVTLSIWKTIKPGEEAEFQLVYYLPISGPSNFTISIDGKKYRLKGN"
FT   gene            complement(316825..317775)
FT                   /gene="blaSE"
FT                   /locus_tag="BL01804"
FT   CDS_pept        complement(316825..317775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaSE"
FT                   /locus_tag="BL01804"
FT                   /product="Glutamyl Endo peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01804"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21945"
FT                   /db_xref="GOA:P80057"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80057"
FT                   /protein_id="AAU21945.1"
FT                   /translation="MVSKKSVKRGLITGLIGISIYSLGMHPAQAAPSPHTPVSSDPSYK
FT                   AETSVTYDPNIKSDQYGLYSKAFTGTGKVNETKEKAEKKSPAKAPYSIKSVIGSDDRTR
FT                   VTNTTAYPYRAIVHISSSIGSCTGWMIGPKTVATAGHCIYDTSSGSFAGTATVSPGRNG
FT                   TSYPYGSVKSTRYFIPSGWRSGNTNYDYGAIELSEPIGNTVGYFGYSYTTSSLVGTTVT
FT                   ISGYPGDKTAGTQWQHSGPIAISETYKLQYAMDTYGGQSGSPVFEQSSSRTNCSGPCSL
FT                   AVHTNGVYGGSSYNRGTRITKEVFDNLTNWKNSAQ"
FT   gene            317949..318722
FT                   /gene="ycdF"
FT                   /locus_tag="BL01687"
FT   CDS_pept        317949..318722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BL01687"
FT                   /product="Glucose 1-dehydrogenase II"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01687"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21946"
FT                   /db_xref="GOA:Q65NR5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR5"
FT                   /protein_id="AAU21946.1"
FT                   /translation="MYSDLKGKTAIVTGSSKGIGKAVAERFGKEKMNVVVNYHSDPGGA
FT                   REAVDNIQAAGGNALAIEADVSSEEDVKKLINSAVEHFGSLDVMVNNSGFNGAGAFPHE
FT                   LELDEWQKVIDVNLTGAFLCAREALKYMADRRMKGSILNISSVHQQIPRPKNVHYSASK
FT                   GGMKLLTETLALDYADKGIRVNAIAPGTIATESNEDLEGSRKSEQLKKIPMNEFGEPEQ
FT                   VASAAAWLVSQEAAYVTGATLFVDGGMTLYPSQLE"
FT   gene            318889..319707
FT                   /locus_tag="BL01688"
FT   CDS_pept        318889..319707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01688"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01688"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21947"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR4"
FT                   /protein_id="AAU21947.1"
FT                   /translation="MQNNIVHIAFGESAGGSINMMLKQSGGTHEKSLIVLPELFSIGPL
FT                   QKLEAKEGRVNRYEWLKTYLNDRFHESGKRYSRFEVAVSALSGIPEQASVFIWTGDHAH
FT                   EQTGLRFVHHILRQMNLAVFHLNTTKFFPHTRSSGELNDENLRFIYEQGDQAAVTAAEG
FT                   RRLAEEWTALSQQTSVLRVWEDGRIKSVKEDFFDSFIIEKLAQLQKNRSANTFINCLSL
FT                   IGEVIGHLEENIGDEFIEYRILELIRKGIFEMKGTTKGMRYFNVRLKNVM"
FT   gene            319807..321204
FT                   /gene="ycdC"
FT                   /locus_tag="BL01689"
FT   CDS_pept        319807..321204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="BL01689"
FT                   /product="hypotehtical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01689"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21948"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR3"
FT                   /protein_id="AAU21948.1"
FT                   /translation="MVREQLKQKAQSISKVPPHYQLMIEDYGEKYEKERRVFFAWQDIE
FT                   EPERDISVELDHQGRLISLTKEYEPVVEEALPDERLLQIALQFTEQHYPNAPYEFVFHE
FT                   KKVTEQFVRFTYVQTVLDLPLPQTGFYVRVAKNGEVIEFRYNGGTSSFSIPKQIADKQS
FT                   VTADYLEHVQFELAVEKIRSELYEGGDDLPHLIYEADLPFFSYPADITEKRQMKPAADD
FT                   EEEEDTLPLPVLPEADRHADIDDMIGFTPSMRKIRETDLGESIGTVWRLGDDPEPRDRS
FT                   IAGYFETWNQNTLKIVKDKNSGKLKGIASFIKSEGPPVLSGEDCLKRALQFLYRLYPDA
FT                   DRLFRMHPAENDGDRSNAFFQFDLQYKGVPLRLGSANISINRTTGRVVGYHGPEIEPET
FT                   LIDLSPSPSISEEEAKAVFAAAFDVKLQWERDYSREKDDFYRLVYRPVYPYFIDAHDGK
FT                   AFMSKNI"
FT   gene            complement(321258..322109)
FT                   /locus_tag="BL01805"
FT   CDS_pept        complement(321258..322109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01805"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /function="Molecular Function: thiosulfate
FT                   sulfurtransferase activity, Biological Process: sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL01805"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21949"
FT                   /db_xref="GOA:Q62Z59"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z59"
FT                   /protein_id="AAU21949.1"
FT                   /translation="MSVLKSPEWVYKRLMEKTDQTVIVDVRFHLTKPDEGRKAYTKGHV
FT                   PGAVFIDLKEDLSRNPEEHGGRHPLQDPDLLAAKLGKIGIDRQTDVVVYDDSGGMFAAR
FT                   FWWQLHYLGHDSVYIMDGGLSNWIKAGYEVNAEDPRPSEREFKPALRENELLDAKEVLK
FT                   RIGREGSILIDARDPSRYTGETEPLDHRAGHIPGAKNFFWKGNLTEGGLWKSKEQLRQH
FT                   YAALDPGSEIVVYCGSGVSACPNVLGLKEAGFENVKLYAGSWSDWISYPDHPISTGAED
FT                   DI"
FT   gene            322267..322695
FT                   /gene="cwlJ"
FT                   /locus_tag="BL01690"
FT   CDS_pept        322267..322695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BL01690"
FT                   /product="cell wall hydrolase"
FT                   /function="cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01690"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21950"
FT                   /db_xref="GOA:Q65NR1"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR1"
FT                   /protein_id="AAU21950.1"
FT                   /translation="MAVVQASSKDISLLARLLRAEAEGEGVQGMLMVGNVGINRIRANC
FT                   SDFVGLRTIPQMIHQPHAFEAVTHGYFYQRARESERRLARRAVNGERLWPAKFSLWYFR
FT                   PAGACPAQWYNQPHVGRFKSHCFYEPTAEECENVYNTF"
FT   gene            complement(322742..323731)
FT                   /gene="yceB"
FT                   /locus_tag="BL01806"
FT   CDS_pept        complement(322742..323731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BL01806"
FT                   /product="putative monooxygenase"
FT                   /note="Bacterial luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BL01806"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21951"
FT                   /db_xref="GOA:Q65NR0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NR0"
FT                   /protein_id="AAU21951.2"
FT                   /translation="MQLSILDQVPISKGSDAHSALKHSAELAELADQWGYKRYWFAEHH
FT                   STRGLASTAPEIMIAHIAAKTANIRVGSGGVLLPQYSPFKVAENFRQLEALYPGRIDLG
FT                   IGRSPGGTTKTRLALTDGVHKSLHEFPRQLQDLVSFLTDSVPSGHDYFGIKASPLTDSP
FT                   PEVWLLGLGENSAKLAGSMGAGYVFGHFISPARGKNAFQSYRESFRPSPFFKRPQSLAA
FT                   VFVVCAESDEKAEELCLSQDLWLLRVEKGLDSLVPSIEEAKSAAYTAADKKKLAQNRSR
FT                   MVIGSPQTVKRKLLELSERYQTDEFMILTNVYRFEDKKQSYERLAELF"
FT   gene            324043..325401
FT                   /gene="cwlO"
FT                   /locus_tag="BL01691"
FT   CDS_pept        324043..325401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlO"
FT                   /locus_tag="BL01691"
FT                   /product="putative peptidoglycan hydrolase,
FT                   DL-endopeptidase II family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01691"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21952"
FT                   /db_xref="GOA:Q65NQ9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NQ9"
FT                   /protein_id="AAU21952.1"
FT                   /translation="MKKKVYTFGLASILGTASLFTPFMNNTASAETSQQKQEIQQKRSE
FT                   VNSGIESKRKEIAKLQDEQKKLEGKIQELDKKALETSNKIEDKEKENKKTKKEVEALKK
FT                   EIKETEKRIEERSKVIKNRVRSLQENGGSQNYLNVLLGAQSFGDFITRATAVSTIVDAD
FT                   KDLLDEQEKDKNKLEKAMSDLNTKLDEIQKTLADLKTLKSDLDKQLKEQANLSKQLQTK
FT                   QAAAESELSDLKKEAGSLTKEEAALEQKLKEERAAAAAAAKAKEESATAEKSDSGSSSS
FT                   SNSGSVSKSDGSSNSGSSSSKKSSSPSRNYSSGSVVSSNGNAIEAAISTGSSIVGRSPY
FT                   KWGGGRSQADIDNRRFDCSSFVRWAYASAGVELGFGATTSTLVGKGRAVSASEMKRGDL
FT                   VFFDTYKTNGHVGIYLGNGTFLNDNSSRGVSVDSMSNPYWKKAFNGVVRRVVE"
FT   gene            complement(325453..326265)
FT                   /locus_tag="BL01807"
FT   CDS_pept        complement(325453..326265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01807"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BL01807"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21953"
FT                   /db_xref="GOA:Q65NQ8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ8"
FT                   /protein_id="AAU21953.1"
FT                   /translation="MNLSLYKQMLRTNMKGIMSYGVGSAFYILLILGIYPSIAGNAEDI
FT                   EKMIKSMPEGFLNAFGFENGLGNLEDFISGEYYGLIFIVILSIFSVMLSTKLLAKRVDQ
FT                   GSMAYILSAPTTRGKVAFTQAAVLTTGLLIIMAVTTAAGLAGYHLMLGGDYDFNVSRFL
FT                   VLNLLGFLLFFAVGGISFLFSAISNDEKRALGLSGGITFLFFSFDLLGKLSEKTEWLRS
FT                   LSVFSLFRPGDIVNGSTDIAQVSLVLAAVGFAAFALSILIFKKRDLPL"
FT   gene            complement(326262..327149)
FT                   /locus_tag="BL01808"
FT   CDS_pept        complement(326262..327149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01808"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01808"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21954"
FT                   /db_xref="GOA:Q65NQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ7"
FT                   /protein_id="AAU21954.1"
FT                   /translation="MLTVERLTKKFSNGKGIFDLSFHVQKGEVFGFLGPNGAGKSTTIR
FT                   HIMGFMKPDQGDIKVNGMDVLKQQGDIQRHIGYLPGEIAFIEGMTGKQFLDFMADMHGL
FT                   KDTAKRNDLIERLQFDVHTPIRKMSKGMKQKVGIVAAFMHSPEVIILDEPTSGLDPLMQ
FT                   KVFIEIVLEEKAKGTTFLMSSHSFPEIERTCDRAAIIKDGIIIAVKDIHELQSMQRKVF
FT                   EVTFENTGDIPAFMNSSLQIESRTDNRVKVAVLGNHDQFIKETAKYHIRHIDASSQSLE
FT                   EIFMNYYNRKGTAQ"
FT   gene            327299..327886
FT                   /locus_tag="BL01692"
FT   CDS_pept        327299..327886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01692"
FT                   /product="transcriptional regulator"
FT                   /note="Homeodomain-like"
FT                   /db_xref="EnsemblGenomes-Gn:BL01692"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21955"
FT                   /db_xref="GOA:Q65NQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ6"
FT                   /protein_id="AAU21955.1"
FT                   /translation="MNGFEKRALLIKEKIKKTALDMLKTWEPKRIRITDIAKEANVSQV
FT                   TIYNYFGSKEALLKEVFKDYIDQSISEFEEYMNKDISVKEKIELMILQKRAANNQKFAL
FT                   TVIKEVMIEDSEIMDYVKQQYDEKIIPLMLQMIEEGHRTGEISSKITAESFLIFMNMII
FT                   EHSKTLGKAFEKNRKFTEEMLHIFFYGLCGRP"
FT   gene            327989..329884
FT                   /locus_tag="BL01693"
FT   CDS_pept        327989..329884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01693"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21956"
FT                   /db_xref="GOA:Q65NQ5"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ5"
FT                   /protein_id="AAU21956.1"
FT                   /translation="MKHSFFFFMFIAFFLVTGFSEAGKSFSIERADIRATVKENGDLSV
FT                   EEVYRYDFKGSFEGATRSFSEETASRLKNFKAYLLPDHRRKGGQAIPLKTKKEDGTYFA
FT                   YSASKDETKNVMFRYVIEDAAQKFEDTSILIHSFYQKANTDFGRVKIEVRLPDSVKARD
FT                   IHAFLREKGNGKITKVNDSSVTYETGLYRAGTGSELRIYFPQSALKEAVRHPSYQTKDE
FT                   LLKEERDEAKRYAERDERIAGAERMILIFSGIVGFMVIMAVMLSFLKKRRRAMLSFEEL
FT                   ESFDPVLVAFLYKKGRFTDRDLLAGLLSLYQRGLVTMQKVQAEERFLDDPKAPDDTYEF
FT                   EFSGSKADLPKPDQLLIEKLFEQTGSDTYMFRLDSLSGPTEEECKHKEQLGKYERKRII
FT                   LQNVVQKWTESVRQAPEFRELFQENRWLRMLSLSLLSVHTGLLLFILYADVVHQAGFMA
FT                   ACVIFGFALSAGIVLAKSKLYTILFLAGLFLASVFTDSVHTILYYGICVGLSILLIAFI
FT                   PAVKESRYASICRRSILSWRNHLRKEDLFSGRSLSQNEKTMIFAIVLEVEDESAVWLNQ
FT                   SANRLDYASPVLGMAAAGCLHYPFYSWQLPDSQQHAGAYDAGGSGAGGGDGAGAF"
FT   gene            complement(329916..330398)
FT                   /locus_tag="BL01809"
FT   CDS_pept        complement(329916..330398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01809"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21957"
FT                   /db_xref="InterPro:IPR025444"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ4"
FT                   /protein_id="AAU21957.1"
FT                   /translation="MGKTIINKPFTAAPEDEVVVFVIGMRVNKWHAVHKWWPVFTAMPP
FT                   MIKELYQNKNLGFLAMESFINFRTICLIQYWRSFEDLTAYAKGDKHMAAWRRFYQKTAA
FT                   SGAVGIYHETYSVPKGRYEAFYHNMPVFGLAKAYGHQPVTRGTKTAEQRMRGTEII"
FT   gene            complement(330391..330954)
FT                   /locus_tag="BL01810"
FT   CDS_pept        complement(330391..330954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01810"
FT                   /product="transcriptional regulator"
FT                   /note="BL01810 similar to padR from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01810"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21958"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ3"
FT                   /protein_id="AAU21958.1"
FT                   /translation="MTKRNHTTYALLGLITAGYRTGYEMKRMIDQSLNHFWKISYGQIY
FT                   PALRQLTEAGWAAASPALSDKKQDRKEYMITAEGQKALQSWLEEPINDIASEKNEFLLK
FT                   LFFSKEESREKTALKVKEYQQKLEERLEAYKAIEQSILSCSSHSKDREYWLFTLDYGKR
FT                   TTSAGIEWCEATINRLNGKEGTNG"
FT   gene            331271..331873
FT                   /gene="yceC"
FT                   /locus_tag="BL01694"
FT   CDS_pept        331271..331873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BL01694"
FT                   /product="putative stress response protein YceC"
FT                   /function="Biological Process: response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:BL01694"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21959"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ2"
FT                   /protein_id="AAU21959.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKILVGLGWDPVASGSGGFFGKLFG
FT                   GGTPNIDCDASVLMLENGRVTENKNVIYFGNLRSRCGSIEHTGDNLTGEGSGDDEQIIV
FT                   DLQKVPSHIHKLVFVVNIYDCVKRSQHFGMIENAFIRIVNMNDRSEMVKYNLRDDYSGR
FT                   TSLIAGEIYRDGAEWKFTAVGEGTNDTSITEIVKRYA"
FT   gene            331902..332483
FT                   /gene="yceD"
FT                   /locus_tag="BL01695"
FT   CDS_pept        331902..332483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BL01695"
FT                   /product="putative stress response protein YceD"
FT                   /function="Biological Process: response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:BL01695"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21960"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ1"
FT                   /protein_id="AAU21960.1"
FT                   /translation="MAISLAKGQKIDLTKTNPGLSKVVVGLGWDVNQYDGGADFDLDAS
FT                   VFLLNAEGKCSSEKDFIFYNQTEGAGGAVIHTGDNRTGEGEGDDEQVKINLNAVPADIQ
FT                   KISFVITIHEAEARRQNFGQVSNAYVRVINEDSNEELIRYDLGEDFSIETALITGELYR
FT                   HGGEWKFSAIGSGYQGGLARIATDFGLQVG"
FT   gene            332559..333137
FT                   /gene="yceE"
FT                   /locus_tag="BL01696"
FT   CDS_pept        332559..333137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BL01696"
FT                   /product="putative stress response protein YceE"
FT                   /function="Biological Process: response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:BL01696"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21961"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NQ0"
FT                   /protein_id="AAU21961.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKALIGLGWDTNKYTGGADFDLDAS
FT                   AFLVDQNDRCINDHDFVFYNNLEHPSGAVIHTGDNRTGEGEGDDEQIIVDFSKIPAHVE
FT                   KIGITVTIHEAESRSQNFGQVSNAFVRLVDESTNEELLRFDLGEDFSIETAVVVCELYR
FT                   HGGDWKFNAIGSGFSGGLASLCRNYGLQV"
FT   gene            333203..333976
FT                   /gene="yceF"
FT                   /locus_tag="BL01697"
FT   CDS_pept        333203..333976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceF"
FT                   /locus_tag="BL01697"
FT                   /product="Integral membrane protein TerC family, YceF"
FT                   /function="Cellular Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01697"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21962"
FT                   /db_xref="GOA:Q65NP9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP9"
FT                   /protein_id="AAU21962.1"
FT                   /translation="MDLFHHIMSIYASFFDWEMWVEVLTDPVSWGLIGSLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLIGAYFFRFLFIGLGMILIKFWWIKLLGAAYLAW
FT                   LVIKHFFIGEGDDEANAIKKDSWMVRVFGVFWATVISVELMDLAFSVDSILAAFAVSEK
FT                   VWVLLIGGMLGILMMRTVAKFFLTLIDKVPELETTAFVLIGIIALKMAASVWHIEMPHS
FT                   VFFIILIIAFAATFIIHYMNKQKAVKEQTAASKEE"
FT   gene            334070..335251
FT                   /locus_tag="BL01698"
FT   CDS_pept        334070..335251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01698"
FT                   /product="Putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01698"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21963"
FT                   /db_xref="GOA:Q65NP8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP8"
FT                   /protein_id="AAU21963.1"
FT                   /translation="MQYFDFLSASQKEDVFFKLPGTVTKDSPKRILEYALGAALYVPGN
FT                   RKDIADVIINNKYPELCSVVFCLEDSIGDCEVLQAENNLVSQADMIYQAQKLQNINSDV
FT                   LPLMFIRVREPEQMLELGNKLGRALHLFAGFVFPKFSMLNAEHYLDTLTKLSQESGIVL
FT                   YGMPIFETPDLLAMETRAKALQELKSTLGFYQDIILNIRIGATDLCGLYGLRRKPETPI
FT                   YDILVISDFIKDIVNYFGLQFVISGPVWEYFGDASRTVPPFAPNWAEAGESSLVINRYM
FT                   DGLINETLLDLANGIHGKSVIHPSQIKAVQSLHVISMEDYLDALSIVESADGTRGVVKS
FT                   SFSNKMIEIKPYLSWAKKILLKAEIYGVYHENRSYTDILRASKPFSNLGSFGS"
FT   gene            335396..335617
FT                   /locus_tag="BL07080"
FT   CDS_pept        335396..335617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07080"
FT                   /product="hypothetical protein"
FT                   /note="BLi00359"
FT                   /db_xref="EnsemblGenomes-Gn:BL07080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97344"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP7"
FT                   /protein_id="ABP97344.1"
FT                   /translation="MMKIVDLTSSEILSSQQACEEWGIDSSTLRKRAHDFPAGTIRKFG
FT                   TTYAVTRAGMCAVFGRKSDTDSEERGDG"
FT   gene            335623..337227
FT                   /gene="yceG"
FT                   /locus_tag="BL01699"
FT   CDS_pept        335623..337227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="BL01699"
FT                   /product="conserved hypothetical protein YceG"
FT                   /db_xref="EnsemblGenomes-Gn:BL01699"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21964"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP6"
FT                   /protein_id="AAU21964.1"
FT                   /translation="MNQEINIQNALVNDDEWKQIIKKPLPERTPYEKNSHLTISRLAGR
FT                   ILGTPHDETDYYIYLHELYASGDVHVLSETLDKTISPERFQAIQRIHMVNQKEKGLSVN
FT                   RFAAFLDGEQLIPKHPDPAMHRHLRKALIEVLQLFQSFHEKGLNDPDFRRVLLDLVKWM
FT                   GNHLEKWLKGADCETAMPKVVWYGDTTKSQRYFLYYLMLVGCDVLLFHPEGKDEFRQLD
FT                   PEQKLSFVFTYPDTSALEPFPTEKPQRKATVAYRSAKELDTVLHNEDSLMYKPWQFREH
FT                   TPASVTLKTTYDELFLIAKERAFIRPNFQASKSTVNIPNLFAMVMGVSSNEKEYWDRLQ
FT                   TLTEYKESHTIRRFPFTKEETSNYQFHYSDALDQTGMIDPGRLMESNIWRYKHLPEGVQ
FT                   RGIAQAVSRMCKSPKMLALNNEKTADVQLYLFTQAVQLPAALLNMIQTFDYSQTVPKLI
FT                   LYHTEQTGTLTRSDAAALLLLNEIGIDIIIYNPPGHKCIDHYIDRQHFDTHWLDEMSFN
FT                   QEFKEPSIVRKFINKIF"
FT   gene            337244..338338
FT                   /gene="yceH"
FT                   /locus_tag="BL01700"
FT   CDS_pept        337244..338338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BL01700"
FT                   /product="putative signal peptide binding protein YceH"
FT                   /function="Molecular Function: RNA binding, Cellular
FT                   Component: signal recognition particle, Biological Process:
FT                   protein targeting"
FT                   /db_xref="EnsemblGenomes-Gn:BL01700"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21965"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP5"
FT                   /protein_id="AAU21965.1"
FT                   /translation="MANPNETSIVNISKEEEITVEKAEDIRAKLRQEPDVQALARQIDV
FT                   KNQVELLEFGKEPALEISKFSDRILSMMRTNSVTDSGAMLTQLGKIMDRFDKNDFEEQK
FT                   GLLSKLFKRGNSMIEKIFKKYQTLGGEIEKINVEISKYKDEMTKSTVTLDEMYESNLKY
FT                   YVELEKYVVAGQMKIEELQRLIPEYEAKAASGNQMAQMELDTLRNGIQALEERVYDLDM
FT                   ARMVAIQTAPQIRLLQRGNTKLIGKINSAFIITIPIFKNGIIQAVTAKRQKLVADSMSE
FT                   LDRRTNEMLKRNAENISSQSVEIARMSGRPSIDIETIEQSWNTIVKGMQETKQIEDENK
FT                   RLREEGAKRILELQDNMKKAALNG"
FT   gene            338489..339190
FT                   /locus_tag="BL01701"
FT   CDS_pept        338489..339190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01701"
FT                   /product="integral membrane protein"
FT                   /function="Cellular Component: membrane, Biological
FT                   Process: cytochrome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01701"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21966"
FT                   /db_xref="GOA:Q62Z42"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z42"
FT                   /protein_id="AAU21966.1"
FT                   /translation="MAALWLAFGGGFLSFISPCCLPLYPSFISYITGISVGDLKNRHAK
FT                   HIKQSVMIHAAAFLAGFSVIFYILGFSASSVGLLFLQYHNLIRMLGGIFFVVMGLFLLG
FT                   VFRPAFMMKERRFSIRKGKIGLLNSMLVGMIFAAGWTPCIGPIFGTIAYANFQNPDFGS
FT                   AFMMITAYSLGFAIPFLLMAFFIGNIRPLMKYSNMLMKIGGALMIVIGILLYTDNMIWI
FT                   NIWYSNLTNLF"
FT   gene            complement(339210..339896)
FT                   /locus_tag="BL01811"
FT   CDS_pept        complement(339210..339896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01811"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:BL01811"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21967"
FT                   /db_xref="GOA:Q65NP3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP3"
FT                   /protein_id="AAU21967.1"
FT                   /translation="MEWKNPWNKKQLVCLFLIAFAAVPIFIEYLLKNALDLLLGEGMLS
FT                   AMLMSIAMAAVFILSLYYIALKPDRLSWREIGISRFAPAYLIQIAGWTVFLIVMTFAVM
FT                   EILIWFGAGYENTKTKTITADPSWLSIAMSFASACIVSPIYEELFYRGFLYRWFRAEFG
FT                   VVWALVASSALFMIAHIPTYNTLAVNFGTGLVFAWTYEKTRSIIPAMIIHSLFNAILLF
FT                   FTILLT"
FT   gene            339983..340720
FT                   /gene="mtaC"
FT                   /locus_tag="BL01702"
FT   CDS_pept        339983..340720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaC"
FT                   /locus_tag="BL01702"
FT                   /product="transcriptional regulator"
FT                   /function="positive regulation of multidrug-efflux
FT                   transporter genes"
FT                   /note="similar to mta from Bacillus subtilis,MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01702"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21968"
FT                   /db_xref="GOA:Q62Z40"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z40"
FT                   /protein_id="AAU21968.1"
FT                   /translation="MKEELTTGRVAKMMGISVRTLRYYDQIGLLKPGSTLPNGRRQYSK
FT                   EDLLELEKIMILKSAQFSLEHIKTLMNQLDTISIIEMHKRRLNSEIEQLTKSLEHTNTL
FT                   LNMYQIEGSLSWEDLLKLVRQPRHKPWKESFSEEEAEILAERLPKAESDDFITKQWLSI
FT                   IKRIKLCLKQEVPPESEWGKQIAEDIICLSDHSFKGHEDLADRFWEVRKSEEPNGLYPL
FT                   DSGIMEFAERAIESAFHDSGGSG"
FT   gene            complement(340820..342025)
FT                   /gene="nasA"
FT                   /locus_tag="BL01812"
FT   CDS_pept        complement(340820..342025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="BL01812"
FT                   /product="nitrate transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01812"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21969"
FT                   /db_xref="GOA:Q65NP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NP1"
FT                   /protein_id="AAU21969.1"
FT                   /translation="MKLADLRKSGHAPSLLSSFLYFDVSFMIWVLLGALGVYVTADFDL
FT                   SPSQVGLIVAIPTLAGSFFRIALGILTDRFGPKKTAVGGMLVTMIPLLWGWQFGSSVAE
FT                   LYIIGILLGVAGASFSASLPMASRWYPPHLQGLAMGIAGAGNSGTLLATLFGPRLAEQV
FT                   GWNGVMGLALIPLTLVLFSYFLMAKEPPNQPAPKPLKDYFAVFKERDTWYFCLLYSVTF
FT                   GGFVGLSNFLSYFFASQYAVPAVRAGEFVTLVVASGSCLRPVGGLIADKIGGVRLLQFL
FT                   FIGVALCMFSVSMLPSLGVVTAALFIGMGCLGMGNGAIFQFVPQRFQQEIGMVTGIVGA
FT                   AGGIGGFFLPNILGTLKQITGTYSSGFLTFTVIAFLALGLLLFAQAGWKKQWKAEEKSI
FT                   RI"
FT   gene            342464..343423
FT                   /gene="ldh"
FT                   /locus_tag="BL01703"
FT   CDS_pept        342464..343423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BL01703"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="Molecular Function: L-lactate dehydrogenase
FT                   activity, Biological Process: glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01703"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21970"
FT                   /db_xref="GOA:Q65NP0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NP0"
FT                   /protein_id="AAU21970.1"
FT                   /translation="MRNQKVNRTVLIGAGFVGSSYAFTLINQGITDELVIIDLNKDKAM
FT                   GDVMDLNHGKAFAPHPVKTWYGTYDDCKEADIVCVCAGANQKPGETRLDLVEKNLKIFK
FT                   GIIGEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDTARFRYLLSEY
FT                   FGVAAHNAHGYIIGEHGDTELPVWSHANIGGVPVSDLLKRNEKYKAEDLDELFDNVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAIYRNEEAILTVSAHLDGEFGENDVYIGVPAVVGR
FT                   CGAREIVELDLNEKEKQQFKHSAGVLKAILKPHFELQA"
FT   gene            343467..345095
FT                   /gene="lctP"
FT                   /locus_tag="BL01704"
FT   CDS_pept        343467..345095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BL01704"
FT                   /product="L-lactate permease"
FT                   /function="Molecular Function: lactate transporter
FT                   activity, Biological Process: lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL01704"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21971"
FT                   /db_xref="GOA:Q62Z37"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z37"
FT                   /protein_id="AAU21971.1"
FT                   /translation="MKMWQQIYDPFGNLFISAFAAILPILFFLLALTVLKMKGIIASFL
FT                   TLAVSFIVAVFFFHMPAAKAVSAVLLGIANGLWPIGYIVLMAVWLYKISVKTGKFKVIR
FT                   ASIAGISSDQRLQLLLIGFSFNAFLEGAAGFGVPIAISAVLLVELGFKPLKAASLCLIA
FT                   NAASGAFGAIGIPVITGAQMGGLTPVELSRTLALMLPVIAFFVPFLLVFILDGFKGIRE
FT                   TLPALLVLSGSYTAVQTLTMISLGPELADILAALISMGALALFLKKWQPRHIYRETGNE
FT                   HVPAEKYRAADIMNAWSPFYILTAVIAVWSLPGFKGLFQEGGFLKQTTILFNMPFLHRE
FT                   VLKTPPISPEQAPLDAVMKLDFISATGTAILIAVIITIVMSRNISFRGGLSSLKETVKE
FT                   LWLPVLTICFVMGFANLANYAGLSSTIGLALAKAGDIFPFVSPVLGWIGVFITGSVVSN
FT                   NALFGHLQAVTGAQIGTSSALLLAANTAGGVMAKLISPQSIAIATAAVKETGQESKLFS
FT                   QTVKYSLVLLFIICIWTFALSKLGI"
FT   gene            345202..345843
FT                   /gene="ycgF"
FT                   /locus_tag="BL01705"
FT   CDS_pept        345202..345843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /locus_tag="BL01705"
FT                   /product="Lysine exporter protein"
FT                   /function="Molecular Function: lysine permease activity,
FT                   Biological Process: amino acid transport, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01705"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21972"
FT                   /db_xref="GOA:Q65NN8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NN8"
FT                   /protein_id="AAU21972.1"
FT                   /translation="MLNIFLSYVFLGLSLAAPVGPVNAAQIDRGMKGGFFHAWLFGLGA
FT                   VTADVLYMALIYFGVAQFLTAPFLKTFLWLFGFFVLTYTGIESLVKAKEVSLMRGAGEK
FT                   GSYRKSFLSGLVISLSNPLSIMFWLGIYGSILAKTVEAYESYQLLICSSGILIGLFLWD
FT                   LAMSFLAGTFRTFLSPRMIQGTTWLAGISLIVFGCYFGYQGILELLQAGR"
FT   gene            complement(345844..347178)
FT                   /gene="ycgH"
FT                   /locus_tag="BL01813"
FT   CDS_pept        complement(345844..347178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BL01813"
FT                   /product="Amino acid/polyamine transporter I YcgH"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01813"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21973"
FT                   /db_xref="GOA:Q65NN7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NN7"
FT                   /protein_id="AAU21973.1"
FT                   /translation="MKRQAKKGDLKWWQLSMIGVGCTIGTGFFLGSSIAIKKSGFSVLA
FT                   AFLLAALGTFLVFQQLAKLTADHPVEGSFCSYAREAFGNWAGFSNGWVYWSSEMLIIGS
FT                   QLTAISLFTRHWFNEIPLWVFASIYAILGLIVIFTGRSSFEKTENILAVLKTAAILMFI
FT                   IIAVLALCGLLPGKTPEVQFPDRVHELFPFGFMGLWTGLIYTFYAYGGIEVMGLMAIHL
FT                   KDPKDSSKSGSLMLITLAVVYVVSIGLAMLLVPRGTFTEQNSPFITSLKDFHLDLIMDI
FT                   FNGIFIIAGFSTLTASLFAVTTLMGTMAKNGDAPACFAKKEKAKVSWPALGLTVLVLAA
FT                   SIVLSLILPKQLYEHMTTAASLMLLYNWMFILLSSKKLTKPKMKGNVQIVTALVLILFA
FT                   VSGTLFEKNSRPGFFVSLLFLAVIAAVTMLMKKKWADQEEKNGQT"
FT   gene            347344..348162
FT                   /gene="nadE"
FT                   /locus_tag="BL01706"
FT   CDS_pept        347344..348162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BL01706"
FT                   /product="NH3-dependent NAD+ synthetase"
FT                   /function="Molecular Function: NAD+ synthase
FT                   (glutamine-hydrolyzing) activity, Molecular Function: ATP
FT                   binding, Biological Process: NAD biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01706"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21974"
FT                   /db_xref="GOA:Q65NN6"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN6"
FT                   /protein_id="AAU21974.1"
FT                   /translation="MTLQEKIMQELNVKPSIEPKQEIEKRVGFLKSYLKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVEELREEGIQAEFIAVRLPYGVQQDEDDAQLALKFIQPDKSF
FT                   AFDIASTVGSFAAQYQSVTGEALADFHKGNVKARVRMITQYAIGGQNQLLVIGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRSLLEELGAPERLYTKSPTADLLDEKPQQSDE
FT                   TELGLTYDNIDDYLEGKAVSSEVAEAIEKRYKASEHKRQVPASMFDDWWK"
FT   gene            348285..348818
FT                   /gene="aroK"
FT                   /locus_tag="BL01707"
FT   CDS_pept        348285..348818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BL01707"
FT                   /product="shikimate kinase"
FT                   /function="Molecular Function: shikimate kinase activity,
FT                   Molecular Function: ATP binding, Biological Process: amino
FT                   acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01707"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21975"
FT                   /db_xref="GOA:Q65NN5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN5"
FT                   /protein_id="AAU21975.1"
FT                   /translation="MNAAIRDKNIVLIGFMGVGKTTIGQLVSKKLGRDFIDIDHEIEKD
FT                   FQMTIPEMFQQKGEAFFRQTEKEYIFQMCEHTMGNIVSLGGGAFQQEEIRKKCLEHCFV
FT                   IFLDLRWENWKQRMDLLIENRPVLHNRTIEEMKQLFNERKSIYAFHHLKVETDNRSAEE
FT                   TADYIVEMLKLGQS"
FT   gene            349110..349880
FT                   /gene="ycgL"
FT                   /locus_tag="BL01708"
FT   CDS_pept        349110..349880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BL01708"
FT                   /product="conserved hypothetical protein YcgL"
FT                   /db_xref="EnsemblGenomes-Gn:BL01708"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21976"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NN4"
FT                   /protein_id="AAU21976.1"
FT                   /translation="MKQRIEEELKNIEATYGVKILYAVESGSRAWGLPSQDSDYDVRFI
FT                   YVHQKDWYLSIDAKRDVIELPIDDSLDISGWELTKALRLFRKSNPPLLEWLSSGTVYYE
FT                   AYSLAEKMRRLKSRAFSPVSCMYHYLNMASGNFRDYLTREEVKIKKYFYVLRPILACQW
FT                   IESRRTVPPIEFQVLLDELTEDGPLKTEIHQLLERKKKGEEFNLEPQNPILHEFIEREL
FT                   ERLQTVAKAYKTDHEDLTQELDRLFRETLDEVWA"
FT   gene            350230..351147
FT                   /gene="ycgM"
FT                   /locus_tag="BL01709"
FT   CDS_pept        350230..351147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="BL01709"
FT                   /product="putative proline dehydrogenase YcgM"
FT                   /db_xref="EnsemblGenomes-Gn:BL01709"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21977"
FT                   /db_xref="GOA:Q65NN3"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NN3"
FT                   /protein_id="AAU21977.1"
FT                   /translation="MEVITRDFFLFLSKSSILNRLARNWGSSVATGKIIGGKDFEASIP
FT                   IIKGLNEQGLTVTVDHLGEFVNSREVARERTQECIRAIQLIAQEQLNSHVSLKMTSLGL
FT                   DIDLDLVRDNMNSILECAEQHQVMVTIDMEDEVRCQKTLDLFKEFRQKYEYVSTVLQAY
FT                   LYRTEQDLEELNSLNPFFRLVKGAYKESPKVAFPDKKDVDENYKKLIKKQLLSGHYTAI
FT                   ATHDDKMIDFAKEIANEHQIGKDRFEFQMLYGMRSKTQLELVKEGYNMRVYLPYGDDWY
FT                   GYFMRRLAERPANIAFAFKGMTKK"
FT   gene            351171..352721
FT                   /gene="ycgN"
FT                   /locus_tag="BL01710"
FT   CDS_pept        351171..352721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgN"
FT                   /locus_tag="BL01710"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase 2
FT                   YcgN"
FT                   /function="Molecular Function: 1-pyrroline-5-carboxylate
FT                   dehydrogenase activity, Biological Process: proline
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01710"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21978"
FT                   /db_xref="GOA:Q65NN2"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:3RJL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN2"
FT                   /protein_id="AAU21978.1"
FT                   /translation="MTTPYKHEPFTNFGIEENRKAFEKALETVNNEWLGQSYPLVIDGE
FT                   RYETENKIVSINPANKEEVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFR
FT                   AVAKVRRKKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREG
FT                   ERNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVL
FT                   EESGLPKGVVNFVPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKVQPGQTHL
FT                   KQVIAEMGGKDTVVVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKR
FT                   VIEITESKKVGEPDSADVYMGPVIDQASFNKIMDYIEIGKEEGRLVSGGKGDDSKGYFI
FT                   EPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITKNRDHIN
FT                   RAKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   gene            352876..354300
FT                   /gene="ycgO"
FT                   /locus_tag="BL01711"
FT   CDS_pept        352876..354300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgO"
FT                   /locus_tag="BL01711"
FT                   /product="Na+/solute symporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01711"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21979"
FT                   /db_xref="GOA:Q65NN1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NN1"
FT                   /protein_id="AAU21979.2"
FT                   /translation="MVGMLYIGYYAYKRTANLSDYMLGGRTLGPAVTALSAGASDMSGW
FT                   LLMGLPGAMFATGLSGSWIVIGLVLGAWANWIFVAPRLRSYTEVAGNSITIPAFLENRF
FT                   HDKSKILRIFSGVVIITFFTFYVSSGMVSGGVLFNSIFNLDYHAGLWIISGVVVAYTLF
FT                   GGFLAVSWTDFVQGIIMFVALILVPIVTVIQTGGPGEAFSEIQSIDPNLLNIFKGTSVL
FT                   GIISLFSWGLGYFGQPHIIVRFMAISSIKETKKARRIGMGWMIFSSAGALLTGLLGIAY
FT                   YSKNGLHLDDPETIFIQLGNILFHPLITGFLISAILAAVMSTISSQLLVTSSSLTEDLY
FT                   KTLFKRSASDKELVFFGRLSVLAVSIVGLCLAWTKNNTILGLVSYAWAGFGASFGPVVI
FT                   LSLFWKRMTKWGALAGMVAGALTVIIWAEAGLSDVLYEMIPGFAASLLFVFVVSLLTSK
FT                   PEQQVLDEFEQYKQTL"
FT   gene            354461..355705
FT                   /gene="ycgP"
FT                   /locus_tag="BL01712"
FT   CDS_pept        354461..355705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgP"
FT                   /locus_tag="BL01712"
FT                   /product="YcgP"
FT                   /db_xref="EnsemblGenomes-Gn:BL01712"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21980"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z28"
FT                   /protein_id="AAU21980.1"
FT                   /translation="MEELLEQVVSLSNINEIIDFISGELKKPVILESADFFLLAYNSYY
FT                   INHFDAANQQTIFSKKCPLPIFEKFVEEGIIDQLKTIPTPFRVKQIEEIGLNQRVVVSA
FT                   KHKDEIMGYIWVQEIEDNLSDEELDFLYQASFHVGKIIYKKKRLKQEKEEQAEELYKKA
FT                   INDQFQTEKELKAAADKANVVLPAVFTVMVLQVVDGEDELLEDLKETIRSYLNLKDNIS
FT                   HVLEDHSNIAIIVGSVSRKRSALAAASELINRLLTHLRSQMLPLILIGVGNEYSSLLSL
FT                   GKSYREALQVTKAAEITGSQEHIPYEYQKLGLFKYLDQIAAKNDHLQYVNPDLQLLKEK
FT                   DKESHTEFLRTLEIYLVNNCKVKPSAEQLFIHQNTLNYRIKQILEMTSIDLNDFNTRCQ
FT                   LFIDLMLMKKAGYKS"
FT   gene            complement(355743..356588)
FT                   /gene="ycgQ"
FT                   /locus_tag="BL01814"
FT   CDS_pept        complement(355743..356588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /locus_tag="BL01814"
FT                   /product="YcgQ"
FT                   /db_xref="EnsemblGenomes-Gn:BL01814"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21981"
FT                   /db_xref="GOA:Q65NM9"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM9"
FT                   /protein_id="AAU21981.1"
FT                   /translation="MFRTFILMLFTFFFFHLHASGNLTKYINMKYAYLSYIAIILLAIL
FT                   TAVQFYIYMKSSDEKGCNHECGCGHDHDHEKDKPFLQRMFIYFVFFFPLCTGLFLPAAT
FT                   LDSNIVKSKGFSFKAIEQPEHYAQTQYLRPDTSIYYGQDGYDELMNKALKKYKEKQHIT
FT                   LKDDDFLKGMETIYHYPGEFLDRTLEFDGFAFKGEAISDKQLFVLRFGIIHCIADSGVY
FT                   GMLVEFPENMDIKDDQWLHVKGTLSSEYYQPFKSTIPVLKVKDWSAIKEPKDPYVYRTY
FT                   "
FT   gene            complement(356593..357480)
FT                   /gene="ycgR"
FT                   /locus_tag="BL01815"
FT   CDS_pept        complement(356593..357480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgR"
FT                   /locus_tag="BL01815"
FT                   /product="putative permease YcgR"
FT                   /note="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01815"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21982"
FT                   /db_xref="GOA:Q65NM8"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM8"
FT                   /protein_id="AAU21982.2"
FT                   /translation="MASQSFLQLNSIFISILIEAIPFVLIGVFISGLIQMFVTEEMMAK
FT                   IIPKNRFLAVLSGTFAGVLFPACECGIVPIARRLLLKGVPLHAAVAFMLTAPIINPIVL
FT                   FSTFIAFGNKWDVVFYRGGLAIAVSLIAGLIISYQFKGNQLIENGTHGHHHHVHESQSF
FT                   LQKLGGTLRHAVDEFFSVGKYLIIGAFVAAAMQTYIKTSTLLAIGQNDVSSSLVMMGLS
FT                   FVLSLCSEVDAFIASSFSSTFSLGSLIAFLVFGAMVDIKNLLMMLGIFKKRFVFVLIPY
FT                   IAVIVLAGSLLVKG"
FT   gene            357671..358627
FT                   /gene="cah"
FT                   /locus_tag="BL01713"
FT   CDS_pept        357671..358627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BL01713"
FT                   /product="cephalosporin C deacetylase, Carbohydrate
FT                   Esterase Family 7"
FT                   /function="Molecular Function: catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01713"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21983"
FT                   /db_xref="GOA:Q65NM7"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM7"
FT                   /protein_id="AAU21983.1"
FT                   /translation="MQQPYDMPLEQLYQYKPERTAPADFKEFWKGSLEELANEKAGPQL
FT                   EPHEYPADGVKVYWLTYRSIGGARIKGWYAVPDRQGPHPAIVKYHGYNASYDGDIHDIV
FT                   NWALHGYAAFGMLVRGQNSSEDTEISHHGHVPGWMTKGILDPKTYYYRGVYLDAVRAVE
FT                   VVSGFAEVDEKRIGVIGASQGGGLAVAVSALSDIPKAAVSEYPYLSNFQRAIDTAIDQP
FT                   YLEINSFFRRNTSPDIEQAAMHTLSYFDVMNLAQLVKATVLMSIGLVDTITPPSTVFAA
FT                   YNHLETDKEIKVYRYFGHEYIPPFQTEKLAFLRKHLK"
FT   gene            358720..359142
FT                   /locus_tag="BL01714"
FT   CDS_pept        358720..359142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01714"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BL01714"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21984"
FT                   /db_xref="GOA:Q65NM6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM6"
FT                   /protein_id="AAU21984.1"
FT                   /translation="MNTEQTIEVMNQNWTDIYYHLHMKHDDQLSHQAVRMLQHIEKNRF
FT                   VTIGHLARLLDVSHNTASEHVKRLIQKGLVQKNRDSSDERKVYVTLTPEGEEAVKRHTR
FT                   LNPKKLQKVLEQLNEEEVEMVKTAFSLLSREAKSCF"
FT   gene            359133..359474
FT                   /locus_tag="BL01715"
FT   CDS_pept        359133..359474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01715"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21985"
FT                   /db_xref="GOA:Q65NM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM5"
FT                   /protein_id="AAU21985.2"
FT                   /translation="MFLIVKIGVSAILIAIITEIARKSPEMGGMIAALPLVSLLSLFWL
FT                   SVQGESLKHLSQFAKGVLWGFPATAVLLLIVVLSLKASFPVIISVVFGICGWGGCLMLQ
FT                   KALIHAIFG"
FT   gene            complement(359578..360138)
FT                   /locus_tag="BL01816"
FT   CDS_pept        complement(359578..360138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01816"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21986"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z22"
FT                   /protein_id="AAU21986.2"
FT                   /translation="MPAGRHIVYIITQTFMFDPKAECDCKWNRDADYVAPYYFELISHA
FT                   PHPDRLPAHPAYIEPVNCQIYSGSASQTGLIYLSDKAGNPVEKSGREGLYISLVNQEAH
FT                   RLKGYLYYFQNGEYQEFMISQTKAQAFSYELAPETVQTYPINLKILGSNYFRFLSTSIP
FT                   PDGAYRDAPFPARMIYYSRLYTW"
FT   gene            complement(360441..361124)
FT                   /gene="yckA"
FT                   /locus_tag="BL01817"
FT   CDS_pept        complement(360441..361124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BL01817"
FT                   /product="Amino acid ABC transporter, permease protein
FT                   YckA"
FT                   /db_xref="EnsemblGenomes-Gn:BL01817"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21987"
FT                   /db_xref="GOA:Q65NM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM3"
FT                   /protein_id="AAU21987.1"
FT                   /translation="MGSIQWEYIFNAELAAKSFPYVMQGIWNTLFISFASMFAGLILGF
FT                   FIALGRMSGLALLRWPARIYISFMRGVPILVILFILYFGFPYIGIQFTALAAALIGFSI
FT                   NSAAYIAEIIRSALSSVDRGQWDAAKSVGFSYWQTMRHVIVPQSVRIALPPLANVMLDL
FT                   VKASSLAAMITVPELFQQAKIVGGREFDYMTMYILVALIYWAICSGIALLQDFLEKRTE
FT                   VYIKK"
FT   gene            complement(361136..362011)
FT                   /gene="yckB"
FT                   /locus_tag="BL01818"
FT   CDS_pept        complement(361136..362011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BL01818"
FT                   /product="putative extracellular solute-binding protein
FT                   YckB"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   periplasmic space (sensu Gram-negative Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01818"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21988"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM2"
FT                   /protein_id="AAU21988.1"
FT                   /translation="MNKLHTYKRITLLITVLALALITAACSTAQNKAENKKTAWDEIKE
FT                   KGKIVVATSGTLYPTSYHDTDSGKDKLTGYEVEVIREAAERLDLDVEFKEMGFDGMLTA
FT                   VGSGQVDAAANDITMTDDRKEKFLFSTPYKYSFGTAIVRKKDLSGIHTLEDLKGKKAAG
FT                   AATTVYMDIARKYGAEEVIYDNATNDQFLKDVANGRTDVILNDYYLQKLALAAMPDLDL
FT                   TIHPDLKYYPHQQGMIMKKGNTELKKQFDKTIDEMLKDGTIKKISKKFFGGADVSKKQD
FT                   IDYIDVDVNK"
FT   gene            362195..362746
FT                   /locus_tag="BL01716"
FT   CDS_pept        362195..362746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01716"
FT                   /product="NAD(P)H dehydrogenase"
FT                   /function="Molecular Function: NAD(P)H dehydrogenase
FT                   (quinone) activity, Biological Process: electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL01716"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21989"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM1"
FT                   /protein_id="AAU21989.1"
FT                   /translation="MKNILIINGHEAYPHARGQLNHTIFTAMADKLSEKYEVKKTVVAD
FT                   GYQIPEEHEKFKWADAVIYQTPVYWFSVPALFKKYIDEIYEYGLFYQGSEDYGRGGLFT
FT                   DKKYMFSTTWNAPKDVFSKAGTFFEGKSLDEALFHLHKMQEFIGMKPLKTFSVHDVISN
FT                   PQVDQYLADLDAHLKEVFSI"
FT   gene            362843..363568
FT                   /locus_tag="BL01717"
FT   CDS_pept        362843..363568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01717"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL01717"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21990"
FT                   /db_xref="GOA:Q65NM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NM0"
FT                   /protein_id="AAU21990.1"
FT                   /translation="MFLKKLTLLREGVPSYAKYPFSIPAIQHLKELTFQKNVTFFVGEN
FT                   GSGKSTLLEAIADKCEFNTAGGGRNNTYEVYGSGSALGDYIRLSWLPKVTNGFFLRAES
FT                   FYHFATHIDEVDITGFRSYGGRSLHEQSHGESFLSLFKHRFKEKGIYLLDEPEAALSPA
FT                   RQLAFLKIIHDLTKSSQAQFIIASHSPILLGYPEAEIFSFDGEQIAEVNYEDTDHYTLT
FT                   KYFLQHREKLLAELFLDDV"
FT   gene            363638..365074
FT                   /gene="yckE"
FT                   /locus_tag="BL01718"
FT   CDS_pept        363638..365074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckE"
FT                   /locus_tag="BL01718"
FT                   /product="putative Glycoside Hydrolase Family 1 YckE"
FT                   /function="Molecular Function: hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds, Biological Process:
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01718"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21991"
FT                   /db_xref="GOA:Q65NL9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL9"
FT                   /protein_id="AAU21991.1"
FT                   /translation="MIHQRLRPFPDHFLWGSASAAYQIEGAWNEDGKGLSVWDVFTKIP
FT                   GKTFKGSNGDIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRIFPQGRGEANESGLRFY
FT                   DDLINELLAHDIEPVLTLYHWDLPQALMDEYGGFESRRIIEDFNAYCVTLYKRYGGRVK
FT                   YWVSLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIDSFRRYVPDGKIG
FT                   PSFAYSPAYPLSSRPDDILAFENAEEFTNYWWLDMYCRGTYPDIPLKYLKEKGWAPTIE
FT                   DGDMELLAKGKPDFVGVNYYQTITYEMNPLDGVSEGKMNTTGQKGSNQETGMPGLYKTK
FT                   RNPHLETSNWDWAIDPIGLRIGLRRISSRYGLPLFITENGLGEFDKVENDGTIHDDYRI
FT                   AYLRAHLEQCRQALNDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYINRDEENVKDLKR
FT                   IKKDSFYWYQNVIQTNGEEL"
FT   gene            complement(365113..365511)
FT                   /gene="nin"
FT                   /locus_tag="BL01819"
FT   CDS_pept        complement(365113..365511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nin"
FT                   /locus_tag="BL01819"
FT                   /product="Nin"
FT                   /function="inhibition of the DNA degrading activity of
FT                   NucA"
FT                   /db_xref="EnsemblGenomes-Gn:BL01819"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21992"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z16"
FT                   /protein_id="AAU21992.1"
FT                   /translation="MIKKWEAQEMTMSYHQFTVYQKGGKPPVMDWTDEDIKRGYTTGEH
FT                   AVSFEALENTASSVEVRLNAQKQVPSFNRRVTVPFEVLYDGVEIASVLSKKLTCDIPQG
FT                   AYQLTCYTIMPDHSGTAQITYLLDFKQA"
FT   gene            complement(365529..365975)
FT                   /gene="nucA"
FT                   /locus_tag="BL01820"
FT   CDS_pept        complement(365529..365975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BL01820"
FT                   /product="nuclease NucA"
FT                   /db_xref="EnsemblGenomes-Gn:BL01820"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21993"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL7"
FT                   /protein_id="AAU21993.1"
FT                   /translation="MDKIKSLLITLLAVAVVIIGIVSGDFFTSEHQPSGRQNGSNYDEV
FT                   LIFPSDRYPETGAHIRKAIKKGHSEICTIDRDGAAERRKDSLKDVPSKSGYDRDEWPMA
FT                   MCEEGGTGASVEYISPSDNRGAGSWVGNQVSDYPDGTKVLFKIN"
FT   gene            366274..366444
FT                   /locus_tag="BL07081"
FT   CDS_pept        366274..366444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07081"
FT                   /product="hypothetical protein"
FT                   /note="BLi00390"
FT                   /db_xref="EnsemblGenomes-Gn:BL07081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97345"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL6"
FT                   /protein_id="ABP97345.1"
FT                   /translation="MLRKLLKALQNGKNRRYSSSDYGRKSYKKYSSSDYKRKGYGHRHY
FT                   KRKHKKFFGSS"
FT   gene            366450..367253
FT                   /locus_tag="BL01719"
FT   CDS_pept        366450..367253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01719"
FT                   /product="Tyrosine protein kinase"
FT                   /function="Molecular Function: protein-tyrosine kinase
FT                   activity, Molecular Function: ATP binding, Biological
FT                   Process: protein amino acid phosphorylation, Molecular
FT                   Function: protein kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01719"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21994"
FT                   /db_xref="GOA:Q62Z14"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:Q62Z14"
FT                   /protein_id="AAU21994.1"
FT                   /translation="MKTLIRWLFDRPLKKGTVLEGRYRINRVLGMGNYGITYLAEELGR
FT                   SGFRVIKQQRKTKAWTSAGRRSFNREAEILRELDLPAAPRLYEVLRAAGERFIVMEYIE
FT                   GKTFEDLLFYDGRVFDEQQTISILKEVLHSVSLLHSRGIIHRDLRIPNLIVNRGTIRII
FT                   DFGLACRLTERERVDNRHPEKKLMRAVSVKSDFYALGHFALFLLYSGFTPSDEEEKCWE
FT                   EELSISSGLKSVLRKMLQIDLPYERAEDIIGDLISCTAEKKKLPF"
FT   gene            complement(367273..368973)
FT                   /pseudo
FT                   /gene="tlpC"
FT                   /locus_tag="BL01821"
FT                   /note="frameshift or internal stop,authentic frameshift"
FT   gene            complement(369073..369813)
FT                   /gene="yqcG"
FT                   /locus_tag="BL01823"
FT   CDS_pept        complement(369073..369813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqcG"
FT                   /locus_tag="BL01823"
FT                   /product="Endoplasmic reticulum targeting sequence YqcG"
FT                   /db_xref="EnsemblGenomes-Gn:BL01823"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21995"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL2"
FT                   /protein_id="AAU21995.1"
FT                   /translation="MKVYEAETLISAMKQRSDEYKNLREQLVSLKKALNSVAELDEFQG
FT                   KGADAIKAFYRDLSGVVDGWLDLTDMQIQFLNGVSSAAENAGLSEDTFVDVQFLEQELA
FT                   NVHIHSQNMVSAQQQELSNILGQIDDLISLQPFSSDEIKQQLDAANQNRKDTIKAVEDL
FT                   DGLLKREYSASEHIQQMIQTDYSALIDATGKGKNASPLNYNSHIYQNSEVYKMKHRMHQ
FT                   EARSYIANKQKQYETGKAEKAEEL"
FT   gene            370217..372271
FT                   /locus_tag="BL01720"
FT   CDS_pept        370217..372271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01720"
FT                   /product="Hydantoin utilization protein A"
FT                   /function="Molecular Function: hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01720"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21996"
FT                   /db_xref="GOA:Q65NL1"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL1"
FT                   /protein_id="AAU21996.1"
FT                   /translation="MNEEGYRLGIDIGGTFTDLTLLNPADGSMTAVKTPTVPEDPARGI
FT                   INGLALLKTRGVQPSEIHHFVHGMTIGLNTLLQRKGADIALFVTEGFRDILSLQRLRLP
FT                   VPYDFRSRMPEPLIPRKNVFPIQERMLYDGSEKLPLHMEDIDEAVGQALRKGLKGIVVS
FT                   FLHSYRNPLHERQAAERIRQIAPELEVATSAELWPQMREYERTVMSVANLYIKPNIHHY
FT                   FGTLKERLVQEGISAQPFITQSNGGLMDIESAAEAPVKTLFSGPAAGVIGSIRTAEAAG
FT                   EANIITFDVGGTSADISIVEKGEPTFTQSNQISGFPIAIPSVAMYSIGAGGGSVAWIDS
FT                   GGLLKVGPESVGSDPGPACYGKGTKAALTDAFLICHYLNPNRFAAGNMKLYRERAEKAL
FT                   LPVAEYLGTDVEQAADKMIQVALANMYTELSNVMEQHGFDPREFSLMAFGGAGPVTANF
FT                   LAEEIQAKNVLIPPHPGTLSALGALTADFIYDAVCSRQVLLEQIKTAELKVEFMRLQEQ
FT                   AETWLRKQRADMVTEASLLYLLDARYKGQAYEIELPVSPEWLEGESTSEIADSFHLLHG
FT                   KQYGHSDGKASIELMNMRVRIIGKTPKPPGGKGCQSNLPEAEPVSQRKIIMKGGTYQAS
FT                   VYRRPDLRSGQRIDGPAIVEQDDTTTLILPNWSGKTDHAGNLIIERKES"
FT   gene            372274..374268
FT                   /locus_tag="BL01721"
FT   CDS_pept        372274..374268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01721"
FT                   /product="Hydantoin utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BL01721"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21997"
FT                   /db_xref="GOA:Q65NL0"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NL0"
FT                   /protein_id="AAU21997.1"
FT                   /translation="MRTDPARLEMMRSYFNAIAAGMGHVIERTSFTTFVKESADFATAL
FT                   ATPEGEFFVYPKTVGVTIFLGLSLKRVIEESGPFEPGDIILTNDPYTTDGLATHLPDIH
FT                   VVKPIFLEGEIISYAWCFVHCSDVGGLVPASISPTATDIHQEGLRIPPARIYKKGRENR
FT                   DILKVLRANSRVPDLNEGDIHAMVAAVNTAENRLTEMVGKFGKEAVQQGMDDLLEQAAM
FT                   RAGRVISRIPEGSYSFSDYLDDDMVSDVPIRLAVTANVSGGEITLDFSDCDPQVKTAFN
FT                   LVTNGSKHSFLYQGLINYIISEDPYIPINGGLTRPIQVIAPKGTLVHPEYPAAVGIRHS
FT                   ITMRLYNAVLGALAKALPKAVPAAGAGQSAIVVLSVPDESTGSRKMSVVEPMGGGGGGQ
FT                   HDMDGADGIDHASGFLKNTPIESLEQHIDIHVRRYELIKNTAGAGFHRGGHAIGLEFEA
FT                   AAPESIVTARGMERMRFHPWGLAGGTAGALGRVRLYPDQPQEKTMSKIDVLKLNKGDVI
FT                   SIHSPGGGGWGNPFRREAESILGEVEAGLLSPEAAYHQYGVAVKENGAGSFIIDLEETA
FT                   EIRKKKAGEHRKQWDFGIAREEYERCWTEEASSTLARLLRQLPAHQRSHVKHLVHRYFS
FT                   KEHNGPISKSEVAAAVEKLAGKNNTGMVR"
FT   gene            374271..375353
FT                   /locus_tag="BL01722"
FT   CDS_pept        374271..375353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01722"
FT                   /product="putative extracellular solute-binding protein"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL01722"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21998"
FT                   /db_xref="GOA:Q65NK9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK9"
FT                   /protein_id="AAU21998.2"
FT                   /translation="MKSKISALFILSLAAVLLLSGCGGNGSQESKQSDTVVIGVYGGDW
FT                   EKHIKPSLESFEKETGLKVKVVAGTDSEWFTKLKASNGRNAPYDLLILQPDTIHRAQSA
FT                   GLLAPIDQEKVPNVRDLYHSVQKRFTDDGKQYAAGFSMGQLGIVYRKDLVPQEPKRWTD
FT                   LWNSSYKGHVAISSPAYSAGLQFFVGLINAQGGLESNGKDVDKAFNSLADLKNNITAYP
FT                   DNPGSIQTLLERGDAWVVPFWDGRAFSLQDAGLDLGFAYPEEGAVAAVASWALMKGSPN
FT                   QDNAYKLLNHLLSPEVQGDFADRTFYGMANKKVKYSDKLKGKIKVGEDYYRNLKWVDYE
FT                   VAAKDLGDWTNRWNQVLGGK"
FT   gene            375363..376481
FT                   /locus_tag="BL01723"
FT   CDS_pept        375363..376481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01723"
FT                   /product="multiple sugar-binding transport ATP-binding
FT                   protein"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="BL01723 similar to msmX from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01723"
FT                   /db_xref="EnsemblGenomes-Tr:AAU21999"
FT                   /db_xref="GOA:Q65NK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK8"
FT                   /protein_id="AAU21999.1"
FT                   /translation="MSAIQIRHVSRHFGNTIALEDVQLEVKEGEFFSLLGPSGCGKSTL
FT                   LNIIAGFLEPTSGFVYIGGRDVTDLPPYDRHIGMVFQDYALFPHLSVFDNVAYGLKVRK
FT                   WPRRKIEERVMECLALVRLEAFANRMPHQLSGGQQQRVAIARALAVQPSVLLLDEPLSN
FT                   LDAKLRKEMQTELRSIQKRVGITTILVTHDQEEALSLSDRIGILGCGRLQQLGTPLDVY
FT                   RTPANQFVAEFIGQVNLLKARASKIQPSSGGYGYETVDFEVYEGVPLTFEINQELSKKT
FT                   SVLFMVRPERISVSFEKQKNRLIEMPATITEVSYAGHDLRLKAAVFKGEWIIQAPDPQF
FT                   PRLPKAGDQVYLSLEPGDFVPLDVKEDADEGC"
FT   gene            376468..377334
FT                   /locus_tag="BL01724"
FT   CDS_pept        376468..377334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01724"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01724"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22000"
FT                   /db_xref="GOA:Q65NK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK7"
FT                   /protein_id="AAU22000.1"
FT                   /translation="MRAVEQKRFYWFLLVPVLLFLGVFLVLPLVLLLLLSFRDVDAMMN
FT                   TLDTYSFSQYVEVFSSDVYLKTIGITIWTALKTTVLCLVMAYPAAYLLVKAPTGRLRAL
FT                   FYILLVSPLLTSVVIRTFSWIVLLSQNGIVNEALISMKMIEKPLPLLWNMNAVIIAYVQ
FT                   VMLPFAVLPLASSLSEVKPDLKFASMSLGAGRLRTFFFVTLPMTVPGLLTGAMIVFSLS
FT                   AGSYITPLLVGGRMQPLLPLSIYQQVMQVFHLPLAAAMSITLLAVVSVVIGILGIFQKR
FT                   WEARING"
FT   gene            377327..378139
FT                   /gene="lam"
FT                   /locus_tag="BL01725"
FT   CDS_pept        377327..378139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lam"
FT                   /locus_tag="BL01725"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01725"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22001"
FT                   /db_xref="GOA:Q65NK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK6"
FT                   /protein_id="AAU22001.2"
FT                   /translation="MGRRLRRMRRGKWIDACVWTAGLLVYFFLALPVFVIILSAFSPDE
FT                   YPKFPPSGISLRWFAGVFSSSGWMESIWVSFMLLLVVTHLAVILGTVAAYALARLNFPG
FT                   KQAIQAFVLSPLMIPQIALGVSFLYLLTMIGVNGTFAGLAAGHMLISLPYVVRTVGVSM
FT                   ANVDQKLELASMNLGAGPWHTFFHVILPLIKPGIIAGAVFASVTSFGEISISLFVSSPA
FT                   VTPVPVRTFSYIDQTFDPSVHAISVIFITVSVIALIIIERTIGLSKTM"
FT   gene            378877..389619
FT                   /gene="lchAA"
FT                   /locus_tag="BL01726"
FT   CDS_pept        378877..389619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAA"
FT                   /locus_tag="BL01726"
FT                   /product="lichenysin synthetase A"
FT                   /function="surfactin production and competence"
FT                   /db_xref="EnsemblGenomes-Gn:BL01726"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22002"
FT                   /db_xref="GOA:Q65NK5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK5"
FT                   /protein_id="AAU22002.1"
FT                   /translation="MGNTFYPLTHAQRRIWYTEKFYPGTSVSNLSGFGKLKSASGIDSG
FT                   LLTEAIRKFVRTNDTMRFRLMFEGEDEPKQYIAEDEPFQIEYFDASESGGADGVLKWGQ
FT                   AEARRPLPLYDSPLFKFAVVRISEEESWFFAKVHHIISDGISMTILGNRITDIYLKLAK
FT                   GETDLEPVQSSFTEHIQSELEYENSKRFQKDKAYWNAQYEAIPEPVSLKASDTYQIQLD
FT                   AARFSKEISPDLYKKIQTYCNEHNISVLSLFLSILHIYMHRVTGQKDVVLGTFMGNRTN
FT                   AKEKQMLGMFVSTIPMKASIEVHQDFSAFVQERMKDQLKIIRHQKYPYNLLINDLRERQ
FT                   PHVSKLFAVSLEYQVMQWQQKETVSFLTEPIFSGSEVNDISIHVKERWDTGTLAIDFDY
FT                   REELFTSEEMAVLYERLMTLLEDALLSPQKTIAELEIVPAFEKERLLKRASSQTIAYDK
FT                   NMTLHGLFEQKAADHPEKTAVVYEGQKLSYRELNEQSSRLAMALRRRGIGPDAPAAIVM
FT                   ERSERVITAMMGVLKAGGAYVPIDPGFPEERIRFMLEDSKAKAVITDSGLTFETAETVQ
FT                   FSEALSESRENGYPSSAAGAGHLAYIIYTSGTTGRPKGVMIEHRQVHHLVRGLQQAVGT
FT                   YDQDDLKLALLAPFHFDASVQQIFTSLLLGQTLYIVPKKTVSDGRALSDYYRRHQIDVT
FT                   DGTPAHLQLLAAADDLSGVKLRHMLVGGEALSRVATERLLQLFAETAESVPAVTNVYGP
FT                   TETCVDASSFTITNRTDLQYDTAYVPIGRPIGNNRFYILDENGALLPDGVEGELYIAGD
FT                   GVGRGYLNLPDMTRDRFLKDPFVSGGLMYRTGDTARWLPDGTVDFIGRRDDQVKIRGFR
FT                   IELGEIESVLQGAPAVEKAVVLARHETGGSLEVCAYVVPKQGGKIHIQGLREHLSKHLP
FT                   DYMIPSCFVELNEIPLTASGKVDRKALLRHEVSVSGTAEYAAPRNECEEKMVGIWQEVL
FT                   GAEQVGIHDQFFDLGGHSLKAMTMLAKIHKAFGVEVPLQVLFEKPTVAALSGFVSEAEK
FT                   DGFAVIEPAPESDDYPLSLAQQRIYIVSQLEGVGYNMPAAAMLEGTLDSGRLEAAFQKL
FT                   IDRHEALRTSFTVVDGEPRQTVHQRVQFKIEKVKAEGKPIEQIAKSFVRRFDLAKAPLM
FT                   RAGLVSLADGRHLLLFDMHHLVSDGVSISIILNELAALYNGEELPELRLHYKDYAFWQR
FT                   AQAQEGFQKEEAYWESMFAGELPVLQLMTDEPRPPVQSFEGDRVSAVLPKDLKEKLAVL
FT                   AEQNGATLYMVMLSAYNMLLAKYSGQEDVIVGTPAAGRRHSDLEGIIGMFVNTLAIRSK
FT                   VDPGRTFADFLNDVKKTVIDAFEHQDYPFERLAEKFGASRDLSRHPIFDTMFILQNAWE
FT                   DIPLLGDLHLSIYETNFNIAKFDLTLQAKEEQGELILDLDYSTKLFKKDTAERMLKAYL
FT                   NLLEDMAADPMLRIGEYSLLTEEETNRQLVAFNPATSDYPREKTIVQLFEEQAAERGGY
FT                   PALQFEDKVWSYDELNRKANQLARRLRESGVQAGTTAAILTARSAEMVIGILAVLKAGG
FT                   AYVPIDPDHPEKRVQHFFKDSGAAVLLTQKAMKPLAEAAEFGGDILFVEDENLYMGDAS
FT                   DLRLPISPEAMANLTYTSGTTGTPKGNMVSHRNILRTVKNANYLEVMESDIVLSISNYV
FT                   FDAFMFDVFGSLLNGAKLVIAPKDTILDMSRLAHVLEKEKITILMITTALFNLLTDMRP
FT                   DSLKGLRRVLFGGERASVDHVRRALKTVGRGRLLHMYGPSESTVFTTYHPVNEVPDDAQ
FT                   AIPIGKPVSNTEVLILDSFGNVQPAGVAGELCVGGDGLVRGYFNRPELTAEKFTAHPFK
FT                   TGEKIYRTGDMARWLADGCLEFIGRIDHQVKIRGQRIELGEIEHHLLTHDMVQEAAVLA
FT                   VDTGAGDQMICAYFTADQELSSQELRRHAAEGLPGYMIPSVFMQLDELPLTGNGKIDRR
FT                   ALPEPDIAQAAQKEYTAPRSGTEAQLADLWQEVLNVPKIGVHDNFFELGGHSLLGMTLI
FT                   ARIQQEMNVDLQLKDLFQAPTIESLAQAAAKSEKKSAVYIEAAPDRETYPVSSAQKRLY
FT                   VLQQIEGAEKSYNMPAVLQLEGKLDLKRLESAAQMLIKRHEAFRTTFEIRNGEPVQRIW
FT                   EAAELTIDVIDADEQEAEKLIKEFIRPFDLTKAPLFRMSIIRVTEEKHLLLVDMHHIIS
FT                   DGASVSVLIDEMTRLYAGEALEPLRIQYKDYAVWQQHLLTERHKMQEEYWLKELDGELP
FT                   VLTLPTDYPRPSVQTFEGSRISFSLKPELVQQLRRLAKETESTLYMVLAASYSTFLSKL
FT                   SGQSEVIFGSPAAGRPHADLSRIIGMFVNTLAIRTRPEGDKPFSAFLEEVKETTLGAFE
FT                   HQDYPFEELIEKLNIQRDMSRNPLFDAVFSMQNADLKDLSMEGVTLKPYDFAHQTAKFD
FT                   LTLTAAEEDGLLVFEMEYNTDLFKRESIKRWSGYWVNLLEAVAETPDASLSDLSLLDEA
FT                   EKRRIVQKWNETKLAVPQDKTVHELFEAQVLRTPDRGAAVYNGVKWTYKELNARANRLA
FT                   RLLIEKGAGPEQRVGIMVKPSLEMAAGVLAILKAGAAYVPIDPGYPAERIGYVLKDSGA
FT                   ELLLTQTNLAVPEEFSGETLLLDSMLSEEITNDDEVNPQAGTQPNNLAYLIYTSGTTGQ
FT                   PKGVMVEHQSLVNLCYWHNDAFAVTEQDKSAKYAGFGFDASVWEMFPYWIAGAELHIID
FT                   EAIRMDITRLNEYFEENGITITFLPTQLCEQFMELDNQSLRVLLTGGDKLKRIEKRNYT
FT                   LVNNYGPTENTVVATSTAIDPDEGMLSIGKPIANTRAYVLGQNNEVQPVGVAGELCIAG
FT                   RGLARGYLNKPEETAKRFTEDPFVPGERMYRTGDAVKWLEDGRLEYIGRIDQQVKIRGF
FT                   RIELSEIEVQLARLSEVQEAVVTDIEDAYGNKALCGYVVADEQLDTESLARKLGQTLPD
FT                   YMVPAYWVQLDELPVTANGKVDRRALPQPDVEAQTAEYKAPRTETEQLLADIWQDVLGI
FT                   DRIGVTDNFFALGGDSIKGIQMASRLQQHGWKLEMKDLFQHPTIGELSAYVQAADDQPI
FT                   DQNPVEGEVTLTPIQRWFFERKFTNEHHWNQSVMLHAPSGFDPEAAGKALTKMIEHHDA
FT                   LRMVYQRNGDGIVQYNRGLEETAVRPEVIRFNESGAELEAAVLKESNRIQSSINLTEGP
FT                   LLKAAIFETDQGDHLLIVIHHLVVDGISWRILLEDFAAGYAQAEKGEPIILQEKTHSFA
FT                   EYAARLKEYARSKAFAKEIGYWQEVEKAETASLPKDDEAEDKRMHHTKTAEFSLSKEET
FT                   EQLMTKVHEAYNTEMNDILLTALGLALKEWTGQEDFIICLEGHGREDIMEGLNISRTVG
FT                   WFTSQFPALIQLRHSEDIGYQIKQIKEELRHIPNKGIGYGIYRYLTEEGKKAQPIKHDI
FT                   SFNYLGQFAEMADSGLFTRSALPSGDPLSPETEKPNALDIVGYIENGILTMSIAYHSLE
FT                   YKESTVAAVAASFKTYLLQLIDHCLELDGGELTPSDLGDDELTLEELDKLMEIF"
FT   gene            389639..400405
FT                   /gene="lchAB"
FT                   /locus_tag="BL01727"
FT   CDS_pept        389639..400405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAB"
FT                   /locus_tag="BL01727"
FT                   /product="lichenysin synthetase B"
FT                   /function="surfactin production and competence"
FT                   /db_xref="EnsemblGenomes-Gn:BL01727"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22003"
FT                   /db_xref="GOA:Q65NK4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK4"
FT                   /protein_id="AAU22003.1"
FT                   /translation="MGKQKIQKVYPLTPMQEGMLYHAMLDPESSSYFTQLELVIDGEFD
FT                   LGIFEKSVNQLVRSYDILRTVFVHQQLQKPRQVVLAERQAIVEFEDLADLDEERQKTRI
FT                   DRYKQEVQAAGFNLAKDMLFKTAVFRLDRKKYHLVWSNHHIVMDGWSMGILMKRLFQNY
FT                   EAFRANRTVPLDQGKPYADYIKWLGRQDKDEAASYWEHRLSGLESPSVIPGGKTRPDSG
FT                   SYRNEEFTFVWDKDMVDALQKAANRYHVTAPNLFQAIWGTVLAKYNRSEDVVFGTVVSG
FT                   RPSEIDGIEHMAGLFINTIPVRLRVDQNASFAELFKQAQQHAIDAERYDYLPLYEIQKQ
FT                   SALDGRLISHLVAFENYPLDKELESGTIHERLGFSIKAAGAFEQTNYDFNLIVYPGAEW
FT                   TIKLKYNGEAFDAAFIEQAAGHLTRLAEEAIANPESKAGSADMLSKQEQQTLLAFNQTK
FT                   TGYPREKTIPELFEEQVEASPDKTAVAADGRSLTYRRLNEKANQLARRLKARGLMHGNA
FT                   AAIMMERSLEAAVSMLAVLKAGGVYVPIDPGYPEERIRFLLEDSGAKIVLTKDSPQISL
FT                   EGYEVLAANAVDAEKEDAANLVHANKPGDLAYYIYTSGSTGKPKGVMVEHRNIVRLVKN
FT                   AGYIPLKSDVKMAQTGAVSFDASTFEVFGALLNGGTLYPVPKETLLDGKRFRVFLEETG
FT                   ITTMWLTSPLFNQLAQQDPGMFATLNDLIIGGDALVPGIVNRVKRESPELSLWNGYGPT
FT                   ENTTFSTCFFIDQAYERTIPIGKPIGNSTAYIVDEHGALQPIGVPGELCVGGDGVARGY
FT                   LNQPELTDEKFVGDPFAEGKRMYRTGDLAKWLPDGNIEFLGRIDHQVKVRGFRIELGEV
FT                   EAALARLEGISEAAAVIRENNTGETEICAYYTAVGARPAAQLRTELSRSLPEYMIPAHL
FT                   IELDSMPLTANGKVDKRQLPAPIAEETDRFEAPKNETEKILAAIWEEILGIKQPGIDDN
FT                   FFSIGGHSLKAMMLTAKIQEQLQKEVPIKVLFEKPTIRELAEFLQGETKEKTAPIAPAP
FT                   SRANYPVSSAQRRMYILNQLEEASTSYNVPAVLLLEGELDKERLEDAFRALISRHETLR
FT                   TSFELIDGEIVQTIHQDAVFHLTESVADEAEAEAAIRGFIRPFQLNKAPLVRAELVKLE
FT                   EKRHLLMIDMHHIITDGSSTGILIRDLASFYHGEEAPAPKLHYKDFAVWQNGPEHQEKL
FT                   KEQEQYWLDIFKGELPVLDLPYDFPRPSKRSFEGDRVVFGINRKLTADVQKLLSEADAT
FT                   LYMFLLAAFNILLSKYASQEDLIVGSPVAGRTHPDLHNIPGMFVNTLALRNRPEGEKTF
FT                   KEFLQEVKETSLQGFAKQDYPLEELIEKLPLPRDTSRNPLFSVFFNMQNMEIPTLKLGD
FT                   LQISSYSVRHRTAKFDLSLEAVEHDGEIGLSFDYAVSLFKEETIRRWSGHFLNVIKTIC
FT                   ENPGIKLRDIELLSDKERGLLLEEVRRSRAERLEERPFHVRFEEKAAEMPDQPAVVCGE
FT                   TILTYRGLDERANQIANVLRSEGIGKDDVVGIMLDRSAEVAAAILGVMKSGGAFLPIDP
FT                   EMPTSRIQYMLEDSKARWLLTEHSHQAALADWYNGRLIDVRNDTLMASKKRPHLIHDGA
FT                   SLAYIIYTSGTTGQPKGVQLEHRNLANYVSWFISEARLSASDKTMLLSSYAFDLGYTSL
FT                   FPVLLAGGELHIVRKETYTEPETFIHYIGEQGITYIKLTPSLFHTVVQPQSFALAKGLQ
FT                   SLRLIVLGGEKINPKDVERFHSRYPDTRFINHYGPTETTIGAIAKPVEPGMIRQFAERP
FT                   TIGRPISGAGALVLDASRRLVPAGAAGELYITGSGLARGYVNNRELTAAKFIENPYTPG
FT                   TFMYRTGDLVRRLPNGEIEFLGRTDDQVKIRGYRIELKEIEEAFIGLEHIERAVVLSFT
FT                   ADSGLDELCAYIQAKRQLPVSEMRERLSERLPSYMIPSYFVTVDKMPLAANGKVDRSAL
FT                   PEPQGLSGQSDSYRAPSTEFEKALCGIWEEVLGVRPVGLDDNFFDLGGHSLKGMMLTAE
FT                   IQSKLGKKVPLKTLFDCPTAGLLARSIEADGQAEQSGIQPAEKRDWYPVSSAQQRMYAL
FT                   HHIEKNGTGYNMPSVLMLEGVLDTDRLRRAFADLVNRHESLRTAFVEIDGRTVQIVHEK
FT                   ADIDLKVIHIHEEDAEAQINRFIRPFDLSTAPLIRAELLSISSARHLLLIDTHHIIADG
FT                   VSRSLFVKEIAQLYKGASLPEPKLHYKDYAVWQQQPDQQENIRKQEDFWLRQFKETVPE
FT                   LSLPLDFPRPPVQSFAGDRVHFKVSKGTALKIRRLMAKTNTTLNIVMLAVFNLFLSRLA
FT                   GQKDIVVGSAAAGRTNADLKDVPGMFVNSLALKNHVPDQASFSGFLEEVKNNSLAALDH
FT                   QDYPFEELIAKLDLPRDMSRNPLFNVMLTTEDPDKETLDLDGLIIKPYETSHAAAKFDL
FT                   TLGAFEKDDEIGLQFEYATDLFKKQTIERWSGYLLNLLEAIAENPDASLSDLSLLDEAD
FT                   KRRILYEWNETVLDVPQNKTVHELFEAQVLRTPDRGAAVYNGVQWTYKELNARANRLAR
FT                   LLIEKGAGPEQRVGIMVKPSLEMAAGVLAILKAGAAYVPIDPGYPAERIGYVLKDSGAE
FT                   LLLTQSGLTMPDAFTGEVIDLNREASILAGELYPEDDINPSAEAQSDNLAYLIYTSGTT
FT                   GQPKGVMVEHQSLVNLCYWHNDAFTVTEQDKSAKYAGFGFDASVWEMFPYWIAGAELHI
FT                   IDEAIRMDITRLNEYFEENGITITFLPTQLCEQFMELDNQSLRVLLTGGDKLKRIEKRN
FT                   YTLVNNYGPTENTVVATSTAIDPDEGMLSIGKPIANTRAYVLGQNNEVQPVGVAGELCI
FT                   AGRGLARGYLNKPEETAKRFTEDPFVPGERMYRTGDAVKWLEDGRLEYIGRIDQQVKIR
FT                   GFRIELSEIEVQLARLSEVQEAVVTDIEDAYGNKALCGYVVADEQLDTESLARKLGQTL
FT                   PDYMVPAYWVQLDELPVTANGKVDRRALPQPDVEAQTAEYKAPRTETEQLLADIWQDVL
FT                   GIDRIGVTDNFFALGGDSIKGIQMASRLQQHGWKLEMKDLFQHPTIGELSSYVQAADAK
FT                   PIDQGPVEGEVTLTPIQRWFFERKFTNEHHWNQSVMLHAPSGFDPELVEQTLAALTEHH
FT                   DALRMVYQKNNGRLIQYNRGPDDRSFAFRVVDLRYVTDIETEIAAQANRLQASLDLENG
FT                   PLVKAEQYQTAEGDHLLIVIHHLVIDGVSWRILLEDFASGYSQAAQQHDVVFPDKTNSF
FT                   KDWAEALEAYAQTERFLKTADYWRRLEQERICELPKDRAAAERKAENTSAVKFELSEAE
FT                   TRLLLTKVHEPYGTDINDILLSALSLTIREWTNGSNICINMEGHGREEIIPGMNISRTT
FT                   GWFTAQYPVVLKSQAAAGLPETIKNVKETLRRIPDKGIGYGILRYLTDRKKAGAIFSIK
FT                   PDISFNYLGQIDREVQTGFFGPSPYDMGRQVSERSEALYALSFSGIISKEKFILSCSFN
FT                   TEEYDRQTIQELMDRFKAFLTALIDHCTAKEEREFTPSDFSAGDLEMEEMGDLFDVLEE
FT                   NLK"
FT   gene            395880..396050
FT                   /gene="comS"
FT                   /locus_tag="BL07084"
FT   CDS_pept        395880..396050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comS"
FT                   /locus_tag="BL07084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL07084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97346"
FT                   /db_xref="UniProtKB/TrEMBL:A4VF76"
FT                   /protein_id="ABP97346.1"
FT                   /translation="MDRQNKAGFSLPKNATGIPFHPLSNGCMPSIILKRTERATTCRLF
FT                   SCWKAYLIRIA"
FT   gene            400463..404311
FT                   /gene="lchAC"
FT                   /locus_tag="BL01728"
FT   CDS_pept        400463..404311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAC"
FT                   /locus_tag="BL01728"
FT                   /product="lichenysin synthetase C"
FT                   /function="surfactin production and competence"
FT                   /db_xref="EnsemblGenomes-Gn:BL01728"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22004"
FT                   /db_xref="GOA:Q65NK3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK3"
FT                   /protein_id="AAU22004.1"
FT                   /translation="MSQFKKEHVQDIYYLSPMQEGMLFHTLLHPGQGFYIEQISMQVKG
FT                   SFQKDVLEKSMNVIIGRYDIFRTVFVHEKMKRPVQVVLKERSFQAEEIDLSGLSEAEQN
FT                   ERIEDYKRKDKEKGFNLSKDIPMRTAVFKKGQDRYEWVWSYHHILLDGWCFGIVVQELF
FT                   EVYNALRENRPYSLGPVRPYKEYIKWLESQDKQKSLVYWEHHLAGFEGQTTFSEQRKNP
FT                   EQAGNQPEELLFTLPKEDTEAFTQLAKAHHTTLSTALQAVWSVLLSRYQRSRDLIFGTV
FT                   VSGRPADIQGVEHMVGLFINVVPKRATFGPQTTFTELVADLQKQALEAEPHQYVPLYEI
FT                   QSHIAAPNLIDHIIVFENYPLQEANKQQKEKNLGFTMDEISVFEKSNYDLNLLASPGEE
FT                   MMLKLAYNRNIFEPSFILRLKEQLLTAIREVIRDPEQPLDDICVVSKKEKERLLHEFNG
FT                   QVQRKQIGLTIPQWFEQYAEALPEKPAVSAAGRTLTYRELNEKANKVAHLLRKKNVGRG
FT                   EPVALLFRRSPEMVIAILAVLKAGGAYLPIDPEYPEARIQYMLEDSGAVCMLTQEELAG
FT                   RAASLSFHKHTILIDDPAVSAESGRNLEIAAEPDDLAYIMYTSGTTGKPKGNLTTHANI
FT                   TRVVKETNYISLSEKDTLLSLSNYAFDGFTFDLYGALLNGAKLVVADQATILHIGKLTE
FT                   AIQKENITVMFVTTALFNLLVDAGTGWMKGIRKVLFGGERSSVSHVKKAFAAMGPDRII
FT                   HVYGPTETTVFATFYPVNRMEDSAVSIPIGKPINETNAYILTENNRLQPIGAVGELCLS
FT                   GTGVSRGYLNRPELTAEKFAPHPFNSGETMYRTGDLARWLPDGNIDFIGRIDDQVKIRG
FT                   HRIELGEIEEQLMRCQGVKEAVVTARKSGNGDAALTAYVVPVQGTEVANEEVRRQLARR
FT                   LPAYMVPAAYIMLEELPLTANGKVNRRLLPEADGRPNSTERRAPRNATEEKLAVIWSEV
FT                   LGRQQIGIDENFFEIGGHSLKAMAVASRMLKDLAIDVPVNVLFEMPTIEGLAAYIDQGG
FT                   HVDEVKKTVFNQASTRHLFAFPPVLGYGIMYGKLAEQMPEYRIHAFDFIESDDRAVRYA
FT                   EAISDLQPEGPLTLIGYSAGCGLAFEVAQALEKNGRKVEKLLMIDSYMKNDVSDLEGRS
FT                   IEADTAALMEANKDNEYMKIKTVADGIAKKMTAYYSYFVNLVHQGTVSSEIHLIKSEHA
FT                   KPLPAWLSLWKEGTESSYDEYQGAGRHDEMLADGFVKSNADLIRQILGERAAVIGGA"
FT   gene            404315..405055
FT                   /gene="lchAD"
FT                   /locus_tag="BL01729"
FT   CDS_pept        404315..405055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAD"
FT                   /locus_tag="BL01729"
FT                   /product="thioesterase LchAD"
FT                   /function="surfactin production and competence, Molecular
FT                   Function: catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01729"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22005"
FT                   /db_xref="GOA:Q65NK2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK2"
FT                   /protein_id="AAU22005.1"
FT                   /translation="MNEIIKQFGAPASGMQLICFPFAGGYSASFRPLHEHLKTDFDMLA
FT                   IEPPGHGTNRMALVDNLEKLADLYIAALKPRLSSQFVLFGHSMGGMVVYRLAQKLEQEG
FT                   IFPAAAVISAIQPPHIQRQKVSHQKDDAFLDHLIQLGGIPKELAEHREMMNFFLPSFRA
FT                   DYRALETFCHTDHTPLRSPVHILNGDRDEKCMRDALGWKKWANTIDFHYFKGGHMYLLS
FT                   ETEQVAAKLKTIAAASRSTAVPTM"
FT   gene            complement(405102..406013)
FT                   /gene="ycxC"
FT                   /locus_tag="BL01824"
FT   CDS_pept        complement(405102..406013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxC"
FT                   /locus_tag="BL01824"
FT                   /product="conserved membrane protein YcxC"
FT                   /function="Cellular Component: membrane, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01824"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22006"
FT                   /db_xref="GOA:Q65NK1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK1"
FT                   /protein_id="AAU22006.1"
FT                   /translation="MNKSAYAAALLYAFIIGFSFFFVKLALTAASPVDILAHRFTVAFL
FT                   AALIPLLLGWVKIAISIKDALKVLPLALFYPVMFFAFQVFGLVYTSSSEAGIIQAAIPI
FT                   FTMIFAAYFLNERFTKRQFFFTVLSAAGVACIFMMKSAGTGSSDLRGAALILLSALSSA
FT                   GYSVLARKMTRTFSSLELTYVTTGAGFLFFNGIAGISHMSDGTLSGFFAPFTDPVFVLS
FT                   VLYLGVLSSFATSFLSNYALSKIEAAKISMFNHLATLVTILAGIIWLGESLEWFHFAGT
FT                   GMIIAGIIGATMVRRENRLKKS"
FT   gene            406149..407498
FT                   /gene="ycxD"
FT                   /locus_tag="BL01730"
FT   CDS_pept        406149..407498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxD"
FT                   /locus_tag="BL01730"
FT                   /product="probable transcriptional regulator YcxD"
FT                   /note="probable transcriptional regulator (GntR family)
FT                   with an aminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BL01730"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22007"
FT                   /db_xref="GOA:Q65NK0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NK0"
FT                   /protein_id="AAU22007.1"
FT                   /translation="MHKYVALMNELEDMIEDKSFQEGDRLPSIRALAIRFKVSKSTVIR
FT                   ALNELERRHLIYSVPKSGYYVVKKTNQRPNSGKAVIDFAASAPDPDVFPYIDFQHCINK
FT                   AIDTYKNDLFIYGTPKGLPSLIQAVQKELANSQVFAKEEHIFITSGVQQALALLASMPF
FT                   PNRKRKVLIEQPSYHLLIKYLEVHGIPAVGIERTAEGIDMDELERIFQTEDIKFFYTMP
FT                   RFHNPLGTSYTEREKTAIVKLAEKYDVYIAEDDFLGDLENDKKADPLHYYDISSHVIYL
FT                   KSFSKIIFPGLRVGAAVLPDSLTIVFNRYKQLLDIDSSMLSQAALEIYLKSGMFEKHKQ
FT                   KIRSSYQKRSCLLHDLLKECSASLGDVFEFHPPAQPAIHTHIELDRTIPASRLIKSLQK
FT                   RDVLLEPVNAHYMPAFPKRNLLKINTSNVKEEDIRSGIERLRQAVETAYF"
FT   gene            complement(407510..408190)
FT                   /gene="sfp"
FT                   /locus_tag="BL01825"
FT   CDS_pept        complement(407510..408190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfp"
FT                   /locus_tag="BL01825"
FT                   /product="phosphopantetheinyl transferase"
FT                   /function="phosphopantetheinylates a serine residue in each
FT                   of the seven peptidyl carrier protein domains of the first
FT                   three subunits of surfactin synthetase (SrfABC)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01825"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22008"
FT                   /db_xref="GOA:Q65NJ9"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ9"
FT                   /protein_id="AAU22008.1"
FT                   /translation="MKIYAVYMDQLPEAGQFNRMMAMVSEEKRKKVGRYRYPEDASRTL
FT                   IGEVLARHIISETFHLPNEQIRFTEGRYGKPAAEGLNDFHFNISHSGKWIVCGAGAQPI
FT                   GVDVEKIKPINFDIAKRFFSPSEHDDLMEKDESERLSYFYHLWTMKESFIKQAGKGLSL
FT                   PLDSFSVKLNEQGRASVETPPGYPPCYIQAYEIDPGYKMAVCSAAPEFPGRIVMKSCAE
FT                   LSML"
FT   gene            408290..409075
FT                   /gene="ybbA"
FT                   /locus_tag="BL01731"
FT   CDS_pept        408290..409075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="BL01731"
FT                   /product="Putative carbohydrate esterase, Family 1, YbbA"
FT                   /db_xref="EnsemblGenomes-Gn:BL01731"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22009"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YZ9"
FT                   /protein_id="AAU22009.1"
FT                   /translation="MIDGTLIKDTCFGRELLIYLPPSYGSGENRYPVLYVHDLGDLFDP
FT                   AYSNSLRSIEKLFSSQEVPELLLVGVAPKDRESEYTPFPKRHLLPNKREYGGKGNEYAA
FT                   FLANRLKPHIDRHYRTNPSREQTGIIGKSFGGLISVYTAFLASETFGKIGSLSGSFWFE
FT                   GITEFMKNNRFENKHLRIYMDVGSTEGTDRDNLQKEMIPRTKEAFSLLTESAASEKELK
FT                   FVIDEGGSHRLERFAKRFPEAVKWLFGSCHNSARNGRSF"
FT   gene            409321..409704
FT                   /locus_tag="BL01732"
FT   CDS_pept        409321..409704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01732"
FT                   /product="putative regulatory factor, effector protein"
FT                   /note="AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01732"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22010"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ7"
FT                   /protein_id="AAU22010.1"
FT                   /translation="MVDAAFKYGYSTPESLSGGLQPPSRHQPFTGPRKRRTLRAFPRLS
FT                   FHIQIKGVEDMDYKIVEKEPFQVIGKALEVTVKDGQNKKDIPAFWNELNHNGFTDSLKP
FT                   HIGPLGFLGVCMDFNDQPDTFNF"
FT   gene            complement(409988..410650)
FT                   /gene="yczE"
FT                   /locus_tag="BL01826"
FT   CDS_pept        complement(409988..410650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczE"
FT                   /locus_tag="BL01826"
FT                   /product="YczE"
FT                   /note="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01826"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22011"
FT                   /db_xref="GOA:Q65NJ6"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ6"
FT                   /protein_id="AAU22011.1"
FT                   /translation="MKRELVLRWLFYFVGLIVLSFGVSLTIEGKVLGIGPWDAFHYGLY
FT                   MLLGLTVGQWAIIVGAVIVGLTSLFTKAWPKIGAVLNMLLIGIFIDFFTYILPDPETYI
FT                   SSTVVFVIGVIFIGYGVGIYVSADLGAGPRDSLMLLISEKTGWNVQWVRNGMELTILLI
FT                   GWLLGGPIGIGTVLTAILTGLILRFSLPQSKQLLKAAMAGRRIRAAKPVHMSLKKNG"
FT   gene            410906..411436
FT                   /locus_tag="BL01733"
FT   CDS_pept        410906..411436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01733"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22012"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ5"
FT                   /protein_id="AAU22012.1"
FT                   /translation="MKKLYISAVLGLLFVFVGGTKIHAQEPQNNNGVLDENKFIDETVY
FT                   SYTQPISIQDGEVTTQAKKYIKTVSVNRSYKSLLNIVVARHYSDTTFTYGSGKLYKSPR
FT                   ALSNDWWTLPPNFKSGSSKSWDWYNTGKGATGRSNLQVRYTWGVPTPWGPVGSNYSSRI
FT                   KVSFKSNGSWYTN"
FT   gene            411463..412392
FT                   /locus_tag="BL05023"
FT   CDS_pept        411463..412392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05023"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL05023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22013"
FT                   /db_xref="GOA:Q65NJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ4"
FT                   /protein_id="AAU22013.2"
FT                   /translation="MGTIGINFKNIQHQYRTKDVLRGVSFHADPSSITFLAGENGAGKT
FT                   TLIKVALGLISPKAGNALFDGQSVGEIREKISCVFDEPPVYPNESGLDNLKFLSGIHSL
FT                   DRKWSQEVCAMLKLDEGLLKQKAKALSLGQRHRLAVAAALLRKPKYLFLDEPSIGLDPP
FT                   SWQLVQIALKQMTARGCAILITGQNYDAIENLADNIAILQSGKIIFSGPIVKLVQAFPV
FT                   YVRIVTDDHREIAVQFPEAEPDSSGIYRIVCESGEQARAVIDQVRRSTLNFQELSTEKA
FT                   SMGKMVTDIYKDGFQSEKRGLTYESVQN"
FT   gene            412373..413272
FT                   /locus_tag="BL01734"
FT   CDS_pept        412373..413272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01734"
FT                   /product="putative transcriptional regulator"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01734"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22015"
FT                   /db_xref="GOA:Q65NJ3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ3"
FT                   /protein_id="AAU22015.1"
FT                   /translation="MNPFKIETNQLKNSMLVRVCIALLFCCFIWGLLTLYQSAEGEERR
FT                   QEKIHQSVIDEVKKNGAEEELENGGLEIEKNDDIARSMYIGLHPSVTPNLFLLILANIG
FT                   PIVFIIIGSHLVGSEYHQGTVKMKAAHIGWRKAVSGKLCALLSLVIVMVIAALLLGLAG
FT                   GWLAWTFATAHSDLAASLEVNAAVSYPILILFLMIGLTFYSVLGMTVTLLTKSRLAGVL
FT                   ISLAIPYAEQMMSLPFLPLTAYQSLMVHHFIYVDGSIIGQPYLTEPMGEPGAWAVLVCW
FT                   LFVVIAVQQFAAKKQQIL"
FT   gene            413291..413464
FT                   /locus_tag="BL05025"
FT   CDS_pept        413291..413464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22016"
FT                   /db_xref="GOA:Q62YZ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YZ2"
FT                   /protein_id="AAU22016.2"
FT                   /translation="MIFLVRLICLAFLACLALLFYAPFLAMPVWIALIIALIVCLYLAF
FT                   IEEMKEWRRRKH"
FT   gene            413969..415630
FT                   /locus_tag="BL01735"
FT   CDS_pept        413969..415630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01735"
FT                   /product="Putative L-2,4-diaminobutyrate decarboxylase"
FT                   /function="Biological Process: proteolysis and
FT                   peptidolysis, Molecular Function: peptidase activity,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01735"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22017"
FT                   /db_xref="GOA:Q65NJ2"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ2"
FT                   /protein_id="AAU22017.1"
FT                   /translation="MQQRNTPDVQRWFPSEDGNEAKRNEFLSLIEQLIEGVDNLKNPDQ
FT                   VNLGGEKNREGFFYEKLVAESRIPHEGAPMKEVNEELLKLLHGHPYHTKYFFTNILPMA
FT                   SIPGILGMLTAFMVNGNNLWDVYGPAGAEAEVKVTAMMSKLAGYDAETSGGYTTWGGQG
FT                   AVYSGLRIAIAKMAPSSLKEGVPGNFYAFCSEAAHYSLYKSMEAAGLGSDHLIKVKTNL
FT                   DHSMDTEDLREKLRQVCEAGGIPVYIVATTGTTDAIGIDDVSAVRRAAEETAKSFGLPV
FT                   PHIHADSALGGFFAFFNEYDLNENALSFSPGVLSMIKPIQEKMRHLHAADSLCFDFQKL
FT                   GQTPYVTSLFLVKDRNDLKRIDLDPDETPYVGHRGYGDYHTGYTLECSRMASSISMYSA
FT                   LMAFGYEGYQKLLAQFLEVNLHFREQLSRQIPEADIVNPDNCGMSTLFRIYPEGAPRFE
FT                   DEISGACTIEELERNNALTEKLFEKLGTKRDKMFFGDTKKHLLVKSCEGVELPLCVSKF
FT                   FVISPYTMPEHVPGIIDYLKETIEEVFREHGSLMTN"
FT   gene            415645..417369
FT                   /gene="tlpB"
FT                   /locus_tag="BL01736"
FT   CDS_pept        415645..417369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpB"
FT                   /locus_tag="BL01736"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01736"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22018"
FT                   /db_xref="GOA:Q65NJ1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ1"
FT                   /protein_id="AAU22018.1"
FT                   /translation="MKTLKKKLTEHISVKIMIGVALVLLITIASFSAVFTFISKDLSEQ
FT                   LKQQFQNRLYTDIHLAENQIKRLDGNPLEIDSADGPLYKQTKMAVDSLKKKNKLENIYI
FT                   LSNEGGKERILVLSDTPDDFGTDYSFSPEMKEALTTNKETVSDVYEDEYGIHQSIFLPL
FT                   ENGSGEKVGILGIDLDASVIPETAAKAKWYTIAISAFVLLLGMVMAYFLGSYIAKPIRQ
FT                   LMKASEKIADGDLSADISVKSRDEAGKLAESFKRMSENLQQLIGHISASSEEVSKTSLQ
FT                   LKNVSAESSESAAQVAESMNSMSEGINEVVSSVSDCHTSAAEIDQQLTHVTEKVNEMKN
FT                   VAEGVSKDSKTGQELVEETLRQTQTIKNVMEESKQAASEMQNHTEEIEKVIGMISSIAE
FT                   QTNLLALNASIEAARVGEEGQGFAVVAGEVRKLSERSADAALSVSQLVAGTQESSRLVM
FT                   ERIQEGNEAVDKGQILINGTYENFSGIFKGISQFAERTDQLLQSLLKVEKSYQTISSAM
FT                   EQISAVTEEQAAGSEEVAAAAEQQSAGMQEIASAIQQLSALSEELNQAASKFKLAAE"
FT   gene            complement(417408..418151)
FT                   /gene="yckI"
FT                   /locus_tag="BL01827"
FT   CDS_pept        complement(417408..418151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckI"
FT                   /locus_tag="BL01827"
FT                   /product="ABC transporter YckI"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01827"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22019"
FT                   /db_xref="GOA:Q65NJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NJ0"
FT                   /protein_id="AAU22019.1"
FT                   /translation="MLAIKGLNKSFGENEILKKIDLNIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGILSFDDFTIDFSKKNKPADLLRLRRKSGMVFQAYHLFPHRTVLENVME
FT                   GPVKVQKRNKEEVKKEAVQLLQKVGLEDKMDLYPFQLSGGQQQRVGIARALAIKPELML
FT                   FDEPTSALDPELVGEVLKVMKDLANEGWTMVVVTHEIKFAQDVADEVVFIDGGVIVEQG
FT                   PPEQIFSAPKEERTKQFLNRILNPV"
FT   gene            complement(418167..418871)
FT                   /gene="yckJ"
FT                   /locus_tag="BL01828"
FT   CDS_pept        complement(418167..418871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckJ"
FT                   /locus_tag="BL01828"
FT                   /product="ABC transporter permease protein YckJ"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="3-TM region,
FT                   His/Glu/Gln/Arg/opine,Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BL01828"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22020"
FT                   /db_xref="GOA:Q65NI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI9"
FT                   /protein_id="AAU22020.2"
FT                   /translation="MFLSNIQAAAIGQAIPWDLVRESFWPIFLRGIYYSIPLAILSFIF
FT                   GMIIALITALARMSKSRILRAVFGIYVSAIRGTPLLVQLFIIFYLFPAFQVTIDPFPSA
FT                   IIAFSLNVGAYASEIIRASILSVPKGQWEAAYSIGMTQKTALTRVILPQAVRVSIPPLS
FT                   NTFISLVKDTSLASQILVAELFRKAQEIGAGNLDQILIIYMEAAFIYWIICFVLALVQQ
FT                   QIERRLDRYVAK"
FT   gene            complement(418858..419664)
FT                   /gene="yckK"
FT                   /locus_tag="BL01829"
FT   CDS_pept        complement(418858..419664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckK"
FT                   /locus_tag="BL01829"
FT                   /product="putative extracellular solute-binding protein,
FT                   family 3 YckK"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   periplasmic space (sensu Gram-negative Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01829"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22021"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI8"
FT                   /protein_id="AAU22021.2"
FT                   /translation="MKKAIFAVLLTLLITVMAACGASGDNSKDKNAAGDSLWSSIKDKG
FT                   VLTVGTEGTYEPFTFHDKKTDKLTGYDVEVMQEVAKRLNLKAEFKETQWDSMFAGLNSK
FT                   RFDVVANQVGKKDREDQYDFSDSYTTSQAVVVTKADNNDVKSEGDVKGKKAAQSLTSNY
FT                   NDLAKNAGAEIEGVEGMAQAFQLIQQGRVDLTYNDKLAVLNYLKTSGNKNLKIAFETGE
FT                   PQTTHFAFRKGSGELVDKVNSALKDMKEDGTLAKIAKKWFGEDVSK"
FT   gene            complement(419793..421205)
FT                   /gene="rocR"
FT                   /locus_tag="BL01830"
FT   CDS_pept        complement(419793..421205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR"
FT                   /locus_tag="BL01830"
FT                   /product="transcriptional activator of arginine utilization
FT                   operons"
FT                   /function="positive regulation of arginine utilization
FT                   operons (rocABC, rocDEF, rocG), Molecular Function:
FT                   transcription factor activity, Biological Process:
FT                   regulation of transcription, DNA-dependent,Molecular
FT                   Function: signal transducer activity, Biological Process:
FT                   signal transduction"
FT                   /note="transcriptional activator of arginine utilization
FT                   operons (NtrC family)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01830"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22022"
FT                   /db_xref="GOA:Q65NI7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI7"
FT                   /protein_id="AAU22022.1"
FT                   /translation="MLKDYDFLKLIFQGIIDEIDIGLHVVDENGTSVVYNKKMSQIEGM
FT                   DVGDVLGKNVLDVFTFASQHDSTLLQALHHGKTNKNVKQTYFNNKGQEITTVNHTFPIM
FT                   ENGNTKGAVEIAKDVTKLERLIRENMNKTESTKYTFDSLIGVSPAFKEVIEHAKRATRT
FT                   SSSILIVGDTGTGKELFAQSIHNGSQRSTGPFISQNCAALPESLVEGLLFGTVKGAFTG
FT                   AVDRPGLFEQADGGTLLLDEINSLDFRLQAKLLRAIQEKTIRRIGASKDTPIDVRIIAT
FT                   MNEDPVDAVSGQRLRKDLYYRLSVVTLFIPPLKDRKEDIMPLTQHFIDKYNALFQMEVK
FT                   GFEEEVRRFLLSYDWPGNVRELEHLIEGAMNLMSYEDKIELTHLPLQYRTKPAAKEQLP
FT                   QQGYDLFAPLPSASAAPLKEQIENAEKYYIQKTVKKCNYNVSQAARVLGISRQSLQYRL
FT                   KKWKIRFDQESE"
FT   gene            421447..422649
FT                   /gene="rocD"
FT                   /locus_tag="BL01737"
FT   CDS_pept        421447..422649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocD"
FT                   /locus_tag="BL01737"
FT                   /product="ornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01737"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22023"
FT                   /db_xref="GOA:Q65NI6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI6"
FT                   /protein_id="AAU22023.1"
FT                   /translation="MTVLSKSEKIMKQTAHFGANNYHPLPIVISEAEGAWVKDPEGNRY
FT                   MDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKVASLTGKDMVL
FT                   PMNTGAEAVESAVKAARRWAYDVKGVPDNQAEIIACEGNFHGRTMLAVSLSSEEEYKRG
FT                   FGPMLPGIKLIPYGDLEALKQAITPNTAAFLIEPIQGEAGIVIPPEGFLKQAAEVCKER
FT                   NVLFIADEIQSGLARTGKMFASDWEDVTPDMYILGKALGGGVFPISCIAANRDVLGVFN
FT                   PGSHGSTFGGNPLACAVSIAALEVLEDERLAERSLELGEYFKEKLSQIDNPKIKEVRGR
FT                   GLFIGVELTEAARPYCERLKEEGLLCKETHETVIRFAPPLVISHEDLDWAIEKITRVLS
FT                   K"
FT   gene            422821..424266
FT                   /gene="rocE"
FT                   /locus_tag="BL01738"
FT   CDS_pept        422821..424266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocE"
FT                   /locus_tag="BL01738"
FT                   /product="amino acid permease"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01738"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22024"
FT                   /db_xref="GOA:Q65NI5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI5"
FT                   /protein_id="AAU22024.1"
FT                   /translation="MNHENREQYTLKRTMKSRHLFMISLGGVIGTGFFLGTGYTINEAG
FT                   PIGAILSYLAGGMIMYFTMLCLGELAVAMPVSGSFQTYATKFIGPATGFAVGWIYWLGW
FT                   SVTVALEFLSAGQLMKRWFPDVGVWIWCLIFGLLLFSLNALSAKAFGESEFWLSGIKII
FT                   VILLFIILGGGAMFGLIDLKDGQAAPFFSNLIGDGIFPNGFGAIFITMITVNFAFQGTE
FT                   LIGIAAGESENPEKTVPRSIKQTVWRTLVFFGLSVFVLAGLIPWEKAGVVESPFVVVFE
FT                   QIGIPYAADLMNFVILIALLSVANSGLYASTRMLYSLAKEGMAAQALSRVNKRGIPMNA
FT                   LWITLGFAGLSLISSVVAAETLYIWLLSLAGLSAQVGWITITVSQLLFRRRYVKEGGKV
FT                   EDLKFKTPLYPYLPLTGFILNSAVLVSLAFDSEQRMALYCGILFMSACYFVYHVFVKKR
FT                   QALDRQEAMIYQNKTNDEVVIDE"
FT   gene            424259..425152
FT                   /gene="rocF"
FT                   /locus_tag="BL01739"
FT   CDS_pept        424259..425152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BL01739"
FT                   /product="arginase"
FT                   /function="Molecular Function: arginase activity,
FT                   Biological Process: arginine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01739"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22025"
FT                   /db_xref="GOA:Q65NI4"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI4"
FT                   /protein_id="AAU22025.1"
FT                   /translation="MNKQVSLIGMPMDLGQARRGVDMGPSAIRYAHIVERLNELGYDID
FT                   DLGDVPINRDQPKGDEGLKNLVSVLEGNRKLADIVDNVVEQRRFPLVLGGDHSIAIGTL
FT                   AGVAKHYQQLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGVGHEKLVNLHGYAPKIK
FT                   PEHVVIIGARSLDEGERKYIRETGMKVYTMHEIDRLGMTKVMEETIEYLSANCDGIHLS
FT                   LDLDGLDPSDAPGVGTPVVGGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTG
FT                   EAAVELIESLLGKKLL"
FT   gene            complement(425221..426093)
FT                   /gene="yclA"
FT                   /locus_tag="BL01831"
FT   CDS_pept        complement(425221..426093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclA"
FT                   /locus_tag="BL01831"
FT                   /product="transcriptional regulator YclA"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01831"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22026"
FT                   /db_xref="GOA:Q65NI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI3"
FT                   /protein_id="AAU22026.1"
FT                   /translation="MDIRQLKYFVTIAREGKITTAAKRLHIAQPPLSRQLKQMEEELGV
FT                   VLFDRNKKKNLTLTYEGEVFLKRAKEILHKLEDSILEVRELREEVNGTLAVGSTIYCAA
FT                   LLLSKVSKIRDMYPNLMFNIWEGEPSRLSELLESRQIDAAVTTTPIHSKNTESKSLPEV
FT                   PCKLVLPGNQSYGLKGEAGMKEIAGLPLILLRPSHGKGIYDEVVHHFQSSGLEPRVVCE
FT                   CHDSTTLLSLVTSGFGATILPLSMLPAHFARHVQTLEIQNNPFILQPSVVWRAGSFLPK
FT                   PVREFLALF"
FT   gene            426215..426784
FT                   /gene="yclB"
FT                   /locus_tag="BL01740"
FT   CDS_pept        426215..426784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclB"
FT                   /locus_tag="BL01740"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase
FT                   YclB"
FT                   /function="Molecular Function: carboxy-lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01740"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22027"
FT                   /db_xref="GOA:Q65NI2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI2"
FT                   /protein_id="AAU22027.1"
FT                   /translation="MNIIVGITGATGAVFGVRMLEWLKKTDAETHLVISPWAAATILHE
FT                   TGYTMKDVEKLASFTYSHKDQAARISSGSFQTDGMIVAPCSMKTLAGIRTGMADNLLTR
FT                   SADVMLKERKKLVLLTRETPLNQIHLENMLELTKMGAVILPPMPAFYNHPQNLTEMVDH
FT                   IVFRTLDQFGIHLSEAKRWEGMKQEK"
FT   gene            426798..428219
FT                   /gene="yclC"
FT                   /locus_tag="BL01741"
FT   CDS_pept        426798..428219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclC"
FT                   /locus_tag="BL01741"
FT                   /product="Carboxylyase-related protein YclC"
FT                   /db_xref="EnsemblGenomes-Gn:BL01741"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22028"
FT                   /db_xref="GOA:Q65NI1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NI1"
FT                   /protein_id="AAU22028.1"
FT                   /translation="MAYQDFRDFLNTLKKEGQLLEVQEEVKPEPDLGAAARAANNLGDK
FT                   SPALLFNNIYGYNNAQIALNVIGSWPNHALMLGLPKDTPVKEQFFEFARRYNQFPVKVQ
FT                   REETAPFHENEITEDINLFDILPLFRINQGDGGFYLDKACVISRDVEDPDHFGKQNVGM
FT                   YRLQVKGKDRLGIQPVPQHDIAIHLRQAEERGENLPVTIALGCEPVIATAASTPLLYDQ
FT                   SEYEMAGALQGEPYKIVKSKLSNLDIPWGAEVVLEGEILAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVCHRNNPIFEHLYLGMPWTEVDYMVGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKSRYGGFAKAVGMRALTTPHGLGYCKMVILVDEDVDPFNLPQVMWA
FT                   ISTKMHPKHDAVIIPDLSVLALDPGSEPAGITHKMILDATTPAAPETRGHYSQPLDSPI
FT                   GTKEWEAKLMNLLNQ"
FT   gene            428239..428937
FT                   /pseudo
FT                   /gene="yclD"
FT                   /locus_tag="BL05026"
FT                   /note="frameshift or internal stop,authentic frameshift"
FT   gene            complement(428972..429418)
FT                   /locus_tag="BL01832"
FT   CDS_pept        complement(428972..429418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01832"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22030"
FT                   /db_xref="GOA:Q65NH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH8"
FT                   /protein_id="AAU22030.1"
FT                   /translation="MSNFLQKPRNKAILSVYLFFVCGSVLSAVLNPKMSIGEKLFILCF
FT                   NIFSATLFAFLIYLLLNKLMKDEDRKHPADPEKNGINQVIWKKYKKPLILFVYFGSLFA
FT                   VCAAILPMPIYTVAEKLVILSIAIIFITICCILAYKVTNKMLQK"
FT   gene            complement(429444..429785)
FT                   /locus_tag="BL01833"
FT   CDS_pept        complement(429444..429785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01833"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22031"
FT                   /db_xref="GOA:Q65NH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH7"
FT                   /protein_id="AAU22031.1"
FT                   /translation="MSPETFVEYTEYLIAGMLAAHFAYSLCFLIIASHMIIEYEKMIFL
FT                   KPEKRSHKITNTFVFLLVGTGYFVYKRLLRYNWFLRKLYFALYLVGRGILSIIIFYIFS
FT                   FLVHLIFSV"
FT   gene            complement(429843..430289)
FT                   /locus_tag="BL01834"
FT   CDS_pept        complement(429843..430289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01834"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01834"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22032"
FT                   /db_xref="GOA:Q65NH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH6"
FT                   /protein_id="AAU22032.1"
FT                   /translation="MKGRNKIIFLVYSLYATIIILAALVKPAINWKERLAVIGFMFVSI
FT                   SLFTFIIYVFINKPKKDQSAPRCNIVAKIFWKKHRKPFTLSFYFVGILIVGISVFSMSE
FT                   LSLAWKSGMFAILFAVISGNFFAVYQTANQMLNRSCLERMPDEE"
FT   gene            complement(430310..430990)
FT                   /locus_tag="BL01835"
FT   CDS_pept        complement(430310..430990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01835"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22033"
FT                   /db_xref="GOA:Q65NH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH5"
FT                   /protein_id="AAU22033.1"
FT                   /translation="MLRLKETVVYKDLPYNIQSHLKAPVSRETKWGMACFIVLVLDILC
FT                   ILPVLASKVEFFTFAVLPVAILINVWMILINTRNMTEYLHHLQYVRFMGVSFSGMSYCQ
FT                   LITAQKMMFSAIGFHLPLISLSLFIYAASIFLVIRYYLAVFPDPKRGKRETAAPTGMLL
FT                   AAVPAAGYMISHAVLRVSESAVYLLMSIVYLLMACLFSIMGVKFIHKYFFIKANQDIIR
FT                   QHRI"
FT   gene            complement(431008..431265)
FT                   /locus_tag="BL07082"
FT   CDS_pept        complement(431008..431265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07082"
FT                   /product="hypothetical protein"
FT                   /note="BLi00434, RBL05127"
FT                   /db_xref="EnsemblGenomes-Gn:BL07082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97347"
FT                   /db_xref="GOA:Q65NH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH4"
FT                   /protein_id="ABP97347.1"
FT                   /translation="MKNEKNFLYKKINEAMIIFTILFPVVGIFFVIMTIWGLLEQAPSE
FT                   IPLFVSVISLFFFVLPLLLHIFRKKVWLKKHMENYKNSEG"
FT   gene            complement(431431..432234)
FT                   /locus_tag="BL00128"
FT   CDS_pept        complement(431431..432234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22034"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH3"
FT                   /protein_id="AAU22034.1"
FT                   /translation="MKHLITCTSEELALLVGLCDYPGVAKGILESSLGKKSKKEWDAIL
FT                   EATVNQLILKQYWDEEKSSKDENPLSEEMQKFIVSYVNSEQMIRCSNLDNKNTLMLHHF
FT                   ENETWLFHMIDRDIIHEFAYVDEQEIAQLMKDYYHFSTDEEHIPLKFRLSDKCFDWLSN
FT                   KDMTEKVRKKSSFSPEEEHSFNQLIADLEANQWSLNNISHFYIPSLNDGPFLQNIVFFI
FT                   PSARGVWVAQYDEHNEKPVHISLRTLEQWNELLKGLEYTVSFQNT"
FT   gene            complement(432260..432601)
FT                   /locus_tag="BL00129"
FT   CDS_pept        complement(432260..432601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22035"
FT                   /db_xref="GOA:Q62YX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YX3"
FT                   /protein_id="AAU22035.1"
FT                   /translation="MTPKVFVEYAEYLIAAILSSQFVFGLCTLFLGYITMNYYEQGTFR
FT                   PPSNIFKKTVNFGFALIFGASYFTYKRLYRYNLFLRKFYYALYLLGSGILSIIIFYILS
FT                   FILHFIFKV"
FT   gene            complement(432614..434239)
FT                   /locus_tag="BL01838"
FT   CDS_pept        complement(432614..434239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01838"
FT                   /product="putative transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01838"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22036"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH2"
FT                   /protein_id="AAU22036.1"
FT                   /translation="MKTLDVQAFQTGLDKTLTELKNQTDEISKVKQSIKGLTSLDDALK
FT                   GAGGEAIRSFYEECHTTFLLFYESFISDYKGLLEKTKSALHSLEPNQNGFISQSFLENE
FT                   LHDGVSQAESLTGRLTSKANQTMATVSHIVDLPDLDDSAVNENAKKAQRQISETLEKLH
FT                   TFDREQTNALKAAREDLDTMKQYIQQLEKMYTGPKIEISEYKSGSILKPQNDSTISQAP
FT                   GGLQNDLQNPGETPMEKMLGRLEEKAAETLTNPDTQDKEKTNIAHEILSYFETFGEPLD
FT                   VGDKALLGYHAANATASIAWTRKLKIYYQGGKPTKWQRFKGEYKFQVMSHRSWTSQGDH
FT                   SSKVARTIKNISDSNPSNPLLKKAQKFVASYDSPSMMFKHAVGFPKNQHSFIDGKEFRK
FT                   RAALRTKAGAVDIMESTAKAKGFTALERGVPIVGTAVTFASNLTEYTDPENSDKSFAEK
FT                   TGRFAAGVGTDIFAVSTGVEIGATIGSVGGPVGVIVGGAIGGVAGAIASSSYGDAIKDA
FT                   GEKVAGSIEKGIKNSFESVKSWFK"
FT   gene            complement(434257..434535)
FT                   /gene="yxiC"
FT                   /locus_tag="BL01840"
FT   CDS_pept        complement(434257..434535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxiC"
FT                   /locus_tag="BL01840"
FT                   /product="YxiC"
FT                   /db_xref="EnsemblGenomes-Gn:BL01840"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22037"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH1"
FT                   /protein_id="AAU22037.2"
FT                   /translation="MGQEIKVKTGEVKQALSKLKHSAQAVKPNVQTDISGKNNLDVVKK
FT                   IESMNKDLKSLTKAYASALAKQIAQTEQAVNAIKDADKKLSSSIKAK"
FT   gene            complement(434549..434932)
FT                   /locus_tag="BL01841"
FT   CDS_pept        complement(434549..434932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01841"
FT                   /product="putative prefoldin"
FT                   /note="similar to YxiB in B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01841"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22038"
FT                   /db_xref="InterPro:IPR031681"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NH0"
FT                   /protein_id="AAU22038.1"
FT                   /translation="MIWEKTVLYGLQGTLLIKKQQLEQLKNCQTELEADKKEFDDSKDS
FT                   IKKPELSPTTWQGSLADSFKNVRSDMKTAYNDICGKQLNEVFKQLKEKISSLNDDIDSL
FT                   GKDISSLKTKIEKLEKEEREARR"
FT   gene            435434..436426
FT                   /locus_tag="BL01743"
FT   CDS_pept        435434..436426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01743"
FT                   /product="ribose ABC transporter (ribose-binding protein)"
FT                   /function="ribose transport"
FT                   /note="BL01743 similar to rbsB from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01743"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22039"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG9"
FT                   /protein_id="AAU22039.1"
FT                   /translation="MKKLLVVYAVMLCLFFLYVYDYSRGDKAGSAEESRRPAAAGSLSE
FT                   KYVMVTFQSGIEYWKSGLKGFEDAAQLFNVSVEYRGAAHYDVHEQTTVLEQVIAKKPAG
FT                   IAVSAINPKALNPVIDKAHEQGIPIVLFDSDAPLSKASTYIGTNNMEAGAVAARRMAEF
FT                   LNGKGETAVITQPQQYNHQERTKGFEQTIKQKYPNMKVAAVLDGKGDELTSKKEAAKIL
FT                   EENPSIKGIFTTEANGASGVARAVKEAGLEGEVCIIGFDKDKKTLDGIKNGSISATMSQ
FT                   DTWQMGYWSLHMLFFSNHHLKHERPLPAAIDTGITIITKENVAAYYAND"
FT   gene            436413..438182
FT                   /locus_tag="BL01744"
FT   CDS_pept        436413..438182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01744"
FT                   /product="putative Histidine kinase"
FT                   /function="Biological Process: signal transduction,
FT                   Molecular Function: kinase activity, Biological Process:
FT                   signal transduction, Cellular Component: membrane (GO:0016"
FT                   /db_xref="EnsemblGenomes-Gn:BL01744"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22040"
FT                   /db_xref="GOA:Q62YW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YW8"
FT                   /protein_id="AAU22040.1"
FT                   /translation="MRMIKRLINNAPIRHKLISLLLLISMLPTIGLGILSGWAVENIIE
FT                   KQVIDQTLQLIGEVNKTAEVYVSHMQNLTYLISMNEEMEAFFSHKKEDGEADYKRRTFL
FT                   QGLTSLYSEAAGILVVNDKGEMISNEMYERTPTDLTKEPWYQAALDNEGIFKMIGKPVN
FT                   RNIRSHVHYREDEVVSAVRAVIDPETQHVKGVVLIDLKLRVLAEATKNIRLGKTGYLMI
FT                   MDENGGNIYSPETSNLFLPKKWFRQERSGYFSKRIKGEEYQFIYETSSFTNWTTVGVFK
FT                   AGEPVFEVKEIHLYVLLFLLTAAFLGMSASYYLSHSMSRPILKLNAVMKTAESGNFSTL
FT                   YQEEREDEIGLLGKSFNRLMFRIRELMSVTERQERQKREAELRALQAQINPHFLYNTLD
FT                   TINWMARKKGAEEVSDLVQALSKLFRISLSKGKDIIPLSDEFEHVENYLKIQKARYRDK
FT                   LNYSIEMTGLCDDRLILKLVLQPIVENAIYHGIKEKKGPGHIAIKGMEEDGSLIIKIED
FT                   DGAGMDEETLKQITDQFKHRDDTAGYGMINVHERIALTFGEPYGITVESRKGAGTAVTI
FT                   RLPILAKGGTSLE"
FT   gene            438175..439377
FT                   /locus_tag="BL01745"
FT   CDS_pept        438175..439377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01745"
FT                   /product="transcriptional regulator"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /note="putative 2 component system"
FT                   /db_xref="EnsemblGenomes-Gn:BL01745"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22041"
FT                   /db_xref="GOA:Q65NG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG7"
FT                   /protein_id="AAU22041.2"
FT                   /translation="MSECWRVLIADDEPWIREGIRDAVSWERYQMSVSAEAENGEEAFE
FT                   LALKHGIDLLIVDLNMPIVNGIALMKKLRGALPQCRFVIVTGYDQFAYAQEAIRLNVDD
FT                   YLLKPVDPAHLEQVLKKISVSLAAEKKKLSEQKLAEQHIQQNLGLLKEHVFRSWIENRA
FT                   DEEDVYRQLECLRLPARNPETLGVIAAGHVWNKPSEADNLKEKVERFFINERDKAVFFD
FT                   GDRLIAACLWRSVTEAEQRALAEMIKAELQASAAVCFAKLAENGRSAPQCYQHCRQQVS
FT                   KAFNISPVVIRAKEYMQKHFTEREFSLKQMADALQVSSVYLSRMMKKELGVTFVQLLTE
FT                   MRMDQAVHLLETTPLSIHDIAEQTGYDTQHYFSTVFKKTMGVSPNQYRRMSGIERTGGK
FT                   L"
FT   gene            439505..440584
FT                   /locus_tag="BL01746"
FT   CDS_pept        439505..440584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01746"
FT                   /product="ribose ABC transporter (ribose-binding protein)"
FT                   /function="ribose transport"
FT                   /note="BL01746 similar to rbsB from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01746"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22042"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG6"
FT                   /protein_id="AAU22042.1"
FT                   /translation="MKKCWLLITAMLFCLIVTACSGNQASGGGDKGYVGISMPTKSSER
FT                   WVYDGKYMVKEFEKLGYKTDLQYAEDVVENQVSQIENMITKGVNVLVIASIDGEALTDV
FT                   LEKANKQDIKVISYDRLLMNSKHVDYYATFDNHKVGELQGKYIEEKLGLKDKKGPFNIE
FT                   LFAGSPDDNNAHFFFDGAMSVLKPYIDSGKLKVLSGQTSFEQGATLRWDGATAQSRMDN
FT                   LLSAHYTKAKLDAVLSPYDGISIGIISSLKGAGYGSDKKPLPVITGQDAELASVNSIIK
FT                   GEQTSTIFKDTRELAKKAVEMASSVLKGEKAEVNDTKTYDNGEKVVPSYLLEPVVVDKE
FT                   NYKKVLVDGGYYKESELGK"
FT   gene            440589..442157
FT                   /locus_tag="BL01747"
FT   CDS_pept        440589..442157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01747"
FT                   /product="sugar ABC transporter (ATP-binding protein)"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="BL01747 similar to rbsA from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01747"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22043"
FT                   /db_xref="GOA:Q65NG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG5"
FT                   /protein_id="AAU22043.1"
FT                   /translation="MSDCILEMRGITKEFPGVKALDNVHLRVKAGEIHALCGENGAGKS
FT                   TLMKVLSGVYPYGAYTGDILYKGEVCQFKNIKQSEEAGIVIIHQELALVPQLSIAENLF
FT                   LGNEQASRGVINWRKTKLETLELMKKVGLQESPDTLVSQIGVGKQQLVEIAKALAKKVQ
FT                   LLILDEPTAALNEADSENLLQLLLELKKQGISSIMISHKLNEVTKVADSITVLRDGQTI
FT                   ETLDVQSGQLTENRIIRGMVGRELQNRYPDRSAEIGDVIFEVKDWTVHHPLQQDRKVVN
FT                   MAAFSVKRGEIAGIAGLMGSGRTELAMSIFGRSYGKNISGTIEKDGRELYINHPEDAIK
FT                   NGIVYVTEDRKGNGLILKDSIKENITLSKLDKVSSRLVMDERREQHEAEDFRRKLNIKT
FT                   PDISQRTGNLSGGNQQKVMLSKWIFAEPDVLILDEPTRGIDVGAKYEIYGVINQLAEAG
FT                   KAVIMISSELPELLGMCDRIYTMCEGEITAEFSKEEADQEKLMKYMTIRMKRGGEAYAD
FT                   TGANG"
FT   gene            442132..443343
FT                   /locus_tag="BL01748"
FT   CDS_pept        442132..443343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01748"
FT                   /product="sugar ABC transporter (permease)"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="BL01748 similar to rbsC from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01748"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22044"
FT                   /db_xref="GOA:Q65NG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG4"
FT                   /protein_id="AAU22044.1"
FT                   /translation="MQTPVQTDKDRAQPGYFQLFRDMYKQNIRKYSMVIALVFIMLLFQ
FT                   ILTDGILLRPLNITNLILQNSYILILAIGMMLVIITGHIDLSVGSVAAFVGAVSAMMII
FT                   ENDMPLFAAVVLSLLLGAAIGAWQGFWIAYVKIPAFIVTLAGMLLFRGLTMIVLEGKSI
FT                   APFPVSFQKMASGFIPDWLNGGTFHLTTIVAGAGVSILYLVYQLQQRNMQKKFQFDLQG
FT                   KGLFTVKVFFIIAIINLFTYILATYEGIPLILITLFVLIAGYTFVMKKTVIGRRIYAIG
FT                   GNEKAAELSGIKTKRLTFMVFVNMGVLAALSGLIFAARLNAATPKAGNLFELDAIAACF
FT                   IGGASAYGGIGTIGGAIIGGLVMGVMNNGMSLLGLGIDWQQAIKGLVLLIAVAFDIYNK
FT                   NKTS"
FT   gene            complement(443390..444658)
FT                   /gene="ybfB"
FT                   /locus_tag="BL01842"
FT   CDS_pept        complement(443390..444658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="BL01842"
FT                   /product="Major facilitator superfamily protein YbfB"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01842"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22045"
FT                   /db_xref="GOA:Q65NG3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG3"
FT                   /protein_id="AAU22045.1"
FT                   /translation="MKRKIHYAWIIVFVTFLTLLAVQGVRLSFGAFIQPWEEEFSMDRG
FT                   TISLISMLSFIVYGVSQPVIGRLVDRFGPRIILSLSTLLVGLSIFFTYLVTSPWQLFIL
FT                   YGIIVSLGVGGASNVASTVIVTNWFNEKRGLAFGIMEAGFGAGQMLLVPGSLMMIHWFN
FT                   WKVTVIVLGLFLAVIVFPIVILLLRNHPSEKNVQPIGGAQGGEIKEEPDAQPKKIPYKA
FT                   VFLKRTFWFLVLPFFICGFTTTGLMDTHLIPFSHDHGFSTEVTSAAVSLLAGFNIIGIL
FT                   ISGVVADRWSSRKILCFLYAVRALSLVILLSSHNSMLLLCFAVLFGLVDFATVAPTQML
FT                   ATQYFRQYSVGFILGWLFLSHQIGSALGAYLPGVWYSQTGNYNLSFYLSIVILAVASIL
FT                   NILLPEPKKINPTLNQEGRSVQQ"
FT   gene            complement(444674..445591)
FT                   /gene="ybfA"
FT                   /locus_tag="BL01843"
FT   CDS_pept        complement(444674..445591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BL01843"
FT                   /product="putative DNA binding protein YbfA"
FT                   /db_xref="EnsemblGenomes-Gn:BL01843"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22046"
FT                   /db_xref="GOA:Q65NG2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG2"
FT                   /protein_id="AAU22046.1"
FT                   /translation="MAEINHSTTLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IHNTADCTAKLIQDTLGLDRGYVSRILKRFEKENMVYKKRSEEDSRNHYIYLTSFGESI
FT                   YKKLEAKANQQIENMLKHIDGRHQEKLTEAMNTIECILSEHLPPEKSAVSIRDYYISDD
FT                   IKLMIEKQRAFYAETHGWDDSFLDYLHETFDAEIEKIWIAESAGRFAGCVGLVKHPGRT
FT                   VQLRWFLVDAAFRHQGVGTRLLEHLIDYCKENQYERIFLWTVSTMAEARPLYEKFGFRL
FT                   TEVKDETLLWGQRLREERWDAELG"
FT   gene            445872..447944
FT                   /gene="lacA2"
FT                   /locus_tag="BL01749"
FT   CDS_pept        445872..447944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA2"
FT                   /locus_tag="BL01749"
FT                   /product="Glycoside Hydrolase Family 42"
FT                   /function="Molecular Function: beta-galactosidase activity,
FT                   Biological Process: carbohydrate metabolism, Cellular
FT                   Component: beta-galactosidase complex"
FT                   /note="BL01749 similar to lacA from Bacillus subtilis,
FT                   named by MDT - PiRa"
FT                   /db_xref="EnsemblGenomes-Gn:BL01749"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22047"
FT                   /db_xref="GOA:Q65NG1"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG1"
FT                   /protein_id="AAU22047.1"
FT                   /translation="MVKPYPPISRKVPRLLHGADYNPDQWLKYPDVLKEDIRLMKLSRC
FT                   NVMSVGIFSWVSLEPEEGRFTFDWFDQVLDTFKENGIYAFLATPSGARPAWMSKKYPEV
FT                   LRTERNRVRNLHGKRHNHCYTSPVYRRKTAIINGKLAERYAHHPAVIGWHISNEYGGEC
FT                   HCELCQDKFREWLLAKFKTLDRLNDAWWTSFWSHTYTDWDEIESPAPHGEDAVHGLNLD
FT                   WKRFVTDQTVDFCRHEIAHVRSFNPDLPVTTNFMGTYAGLNYWKFADLLDVISWDSYPA
FT                   WHNSRQEDSRLGADIAFVHDINRSLKGGRPFMLMESTPSMTNWQDVSKLKRPGMHELSS
FT                   LQAVAHGSDTVQYFQWRKSRGSSEKFHGAVVDHEGSEHTRVFQEVKKLGEKLEKLEDVA
FT                   GTTVEPEAAIIFDWENRWALEDAQGPRNIGKHYERTAKSFYEPFWREGVPVDVIHMEAD
FT                   FSRYKLLVAPMLYMLREGTAERIEQFVQNGGTFVATYWSGIVDENELTFLGGFPGGLRK
FT                   TLGIWSEEIDALHDGQKNTIVMDEENRLGLSGSYEASELCDLIHLEGAEALAAYEDDFY
FT                   AGRPALTVNLFGDGKAYYIASRNEAAFQEAFISRLIEECGIAKVLDTELPKGVTAQLRT
FT                   DGRHDYIFVMNFTAENRSVSLPEETNTDVLKGTRKKGALKLPPYGTSILRRSHKA"
FT   gene            complement(448186..449331)
FT                   /gene="phyL"
FT                   /locus_tag="BL01844"
FT   CDS_pept        complement(448186..449331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phyL"
FT                   /locus_tag="BL01844"
FT                   /product="phytase"
FT                   /function="hydrolysis of phytate into inorganic phosphate
FT                   and myo-inositol"
FT                   /db_xref="EnsemblGenomes-Gn:BL01844"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22048"
FT                   /db_xref="GOA:Q65NG0"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NG0"
FT                   /protein_id="AAU22048.2"
FT                   /translation="MNFYKTLALSTLAASLLSPSWSILPRAEASAYKDFSVTADAETEP
FT                   VDTPDDAADDPAIWVHPKQPEKSRLITTNKKSGLIVYDLNGKQLAAYPFGKLNNVDLRY
FT                   NFPLDGKKIDIAGASNRSDGKNTVEIYAFDGEKNKLKNIVNPQKPIQTDIEEVYGFSLY
FT                   HSQKTGKFYAMVTGKNGEFEQYELFDNGKGQVEGKKVRSFKMSSQTEGLAADDEYGKMY
FT                   IAEEDAAIWSFSAEPNGGDKGKIVDRAGGPHLTADIEGLTIYYGEDGEGYLIASSQGDN
FT                   RYAIYDRRGKNDYVADFSIDDGKEIDGTSDTDGIDVIGFGLGKKYPYGIFVAQDGENTE
FT                   NGQPANQNFKIVSWEKIADALDDKPDIDDQVNPRKLKKRAK"
FT   gene            complement(449582..451072)
FT                   /gene="yclF"
FT                   /locus_tag="BL01845"
FT   CDS_pept        complement(449582..451072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclF"
FT                   /locus_tag="BL01845"
FT                   /product="putative oligo-peptide transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: oligopeptide transport, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01845"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22049"
FT                   /db_xref="GOA:Q65NF9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF9"
FT                   /protein_id="AAU22049.1"
FT                   /translation="MSNHQKETFQNIPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAIL
FT                   IYYLYTEVTKGGLGFDQTTANSIMAVYGSLVYMSGIIGGWIADRLLGTANTVFYGGVLI
FT                   MFGHILLSFPGSVPAFFISMFLIIIGTGLLKPNVSSVVGDLYSPEDTRRDSGFSIFYMG
FT                   INLGGFLAPIIVGTVGQTYNYHLGFSLAAIGMLFGLLTYLATRKKNLGSAGRTVPNPLT
FT                   PAERKMVFGRIGIGVLVIAAIFGYSIFMGWMTIKLFTMIVSCLGILIPLIYFIVMFKSS
FT                   KTTSDERSRLTAYIPLFVASMMFWAIQEQGANILATYADKRTHLEFLGVQLHSSWFQSL
FT                   NPLFIVVLAPVFAWIWMRLGNRQPSTPTKFSLGLILAGLSFVVMIFPAYINGTESLANP
FT                   MWLVLSFLIVVLGELCLSPVGLSATSKLAPAAFSAQTMSLWFLSNASAQAINAQIVRFY
FT                   SVDTEIAYFGIIGGVSILLGIILMLLSPKIQKFMKGVN"
FT   gene            451235..451333
FT                   /locus_tag="BL07001"
FT   CDS_pept        451235..451333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07001"
FT                   /product="hypothetical protein"
FT                   /note="RBL05892"
FT                   /db_xref="EnsemblGenomes-Gn:BL07001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97348"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF8"
FT                   /protein_id="ABP97348.1"
FT                   /translation="MKDFLIKFYLFMYKRILLDWHIYNANRFTKGG"
FT   gene            451341..453098
FT                   /gene="yclG"
FT                   /locus_tag="BL01750"
FT   CDS_pept        451341..453098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BL01750"
FT                   /product="Pectin lyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01750"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22050"
FT                   /db_xref="GOA:Q65NF7"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF7"
FT                   /protein_id="AAU22050.1"
FT                   /translation="MQQQPDEMRMTVVDATKFGAVGDGKTDSTNAINECLAWTKSMGYN
FT                   TVWIPNGTYMIDGTKNGDPRAPFRGAGINVPGNIEILMDAEAVIKVKPNSSWGYAAFYI
FT                   GGTSDIKISGGSIIGERDEHTYTPAPRPTHEWGFGICIEGASNVVIEHVRIADFTGDGI
FT                   IISNGGEGYRPSERIQVTNCDIRRSRRNNLSITGCDNVLVEGCEIADAGTGNGTAPCFG
FT                   IDIEGYSEGSIVYEEPVNVIIRNNVLKGNVNHAVSNFNGTSVIIEGNVADGTISYGYGT
FT                   GTTIANNIIKKNPEFTGQSTGINGLGVGALEERSDAVIKGNLISGFTTGIDIRGKSVFA
FT                   TGNKIRDFVNAGILAYQASQVFIEGNYIENDVPEQRSGTAFSITQSDNVTCSGNHIANV
FT                   VLAVRSTGNDVQIKHNVIKQFSRGIWISQGNAVIEGNFISPNGFQTVPESYAVSVTNTA
FT                   SAVIQQNTITRFRNFPIYCSTNQHTKIIGNYIEDSPLIVTVFLTRGTHEVIGNTITLSR
FT                   PSLPAVLIYLDQSSDSAILNNTLRSNTEARVTAIQTNTSRQTLIIGNTIVKGMIHSHQT
FT                   DTVNGNIEV"
FT   gene            complement(453122..453340)
FT                   /gene="yczF"
FT                   /locus_tag="BL01847"
FT   CDS_pept        complement(453122..453340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczF"
FT                   /locus_tag="BL01847"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01847"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22051"
FT                   /db_xref="GOA:Q65NF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF6"
FT                   /protein_id="AAU22051.1"
FT                   /translation="MKLIGIGLLLLASLEAFAVMLDVFQGMTLQRAIVNSLTFAILEVG
FT                   EWIIILLFLFIIFLEASESFRKKRKRT"
FT   gene            453519..455108
FT                   /gene="gerKA"
FT                   /locus_tag="BL01751"
FT   CDS_pept        453519..455108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BL01751"
FT                   /product="GerKA"
FT                   /function="germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl, Biological
FT                   Process: spore germination, Cellular Component: integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01751"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22052"
FT                   /db_xref="GOA:Q62YV6"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YV6"
FT                   /protein_id="AAU22052.1"
FT                   /translation="MSGDKNPETVKLSGFVRPLLAENLSLIKEMTGNSSDIVIRKLKTG
FT                   AGEKIEIAVVYVGGITDEKAIHDFLLESIMNSEELAEKEYGREVLETIAGDAVALGGVE
FT                   KEKRLDKVLESLMAGNTIILAEETAEAVITTTKGGEKRSIKEPENQQAFRGSREGFIEA
FT                   LDTNISLVRRIIKNPNLWVEKTTMGSVTKTDVAIMYINGICDPKAVKEVKKRMESIEID
FT                   SILESGYIEQFIEDTVFTTFPTVYHTERPDMVAGNLLEGRIAIFVDGTPFVLLVPAVFI
FT                   QFFQSVEDYYSRFDIATFIRFLRVLIFFISLIAPAVYVGATTFHKEMIPTELLVVIAAQ
FT                   REIVPFPAVVEAMIMEISFEILREAGIRLPKAIGSAVSIVGAIVIGQAAVQAGIVSPAM
FT                   VIIVAITAISSFATPSFSMAISARLVRFFFILAAATTGFYGIILGLIIMFVHLCSLRSF
FT                   GVPYMTPFAPFILKNWGDAIVRLPWWTHEKRPELIGNDNKVRQGEYQKPEPPDSGDMKT
FT                   KQEDGDPNETNR"
FT   gene            455092..456315
FT                   /gene="gerKC"
FT                   /locus_tag="BL01752"
FT   CDS_pept        455092..456315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BL01752"
FT                   /product="GerKC"
FT                   /function="germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl"
FT                   /db_xref="EnsemblGenomes-Gn:BL01752"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22053"
FT                   /db_xref="GOA:Q65NF4"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF4"
FT                   /protein_id="AAU22053.1"
FT                   /translation="MKRIVKIVLLLAAIVLLQGCWDKRELTDLLLITAIGIDKGKDTDY
FT                   ELSYQIVNPINVTGGLQGGQGGDRPPISSYSVTGNNLTEMSRHASAKMSREIYYSHTNL
FT                   VVVDEKLAKEEGLIKILDVLDRDTDFRTTATIIISRGQKAKTFIRTLTPIDKIPSNKVN
FT                   KTLQFTEEHLGEHMKTSVQDVIKCLTSKAKHPIISSFKVTGNKEKGEKMENVQSTSPEA
FT                   IVEADGLAVIKEGKLVNWLEGKTARGVLWLRNKISRTYLTIPMNHERDAVTFDVIRQKT
FT                   KIGSHLKNGKPAISVDVAMEGDIGETTVPIHLDDPKVLSDIERKVAKELKNELQNTIDI
FT                   VKRNKTDVLQFGDVVYRTHPEVWKKMEGEWSNRYFPDTDVDITVNAYVRRTGLRNNPNI
FT                   LNHHEGRS"
FT   gene            456340..457446
FT                   /gene="gerKB"
FT                   /locus_tag="BL01753"
FT   CDS_pept        456340..457446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BL01753"
FT                   /product="GerKC"
FT                   /function="germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl, Biological
FT                   Process: spore germination, Cellular Component: integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01753"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22054"
FT                   /db_xref="GOA:Q65NF3"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF3"
FT                   /protein_id="AAU22054.1"
FT                   /translation="MEKAKISAAQLFVLIVLFELSSSLLIFPGQSAEQDAWIAILFGTV
FT                   GGLALFMMHHFFYQVNPDASPYETLMNIFGKPVGWSMTFIYIVYYCYIAARVLRDFGEM
FT                   LLTSAYPNTPIIFANGLLIAVCIFTVRKGIEVLARSGELLFGIMFWLAVTGLILIVSSG
FT                   LIKPKELLPILGNGPGPMFHAVFTQTLYFPFGEIIAFTLILPYLKEKKLAKKAGLLGIA
FT                   ISGLILAFNVALNISVLGVDLNMRSRFPLLSTIQTIQVAEFLDRLDVFFMLVLVIGGFF
FT                   KMSIFMYAVTEGVTVLFKLKNPSKVVHVIGIIILILSVSIASNISEHVKEGIEFVPLYV
FT                   HLPMQVILPAFICIVTYVKMKKNKKKAM"
FT   gene            457502..458230
FT                   /gene="mtaD"
FT                   /locus_tag="BL01754"
FT   CDS_pept        457502..458230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaD"
FT                   /locus_tag="BL01754"
FT                   /product="transcriptional regulator (MerR family)"
FT                   /function="transcriptional regulator"
FT                   /note="BL01754 similar to mta from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01754"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22055"
FT                   /db_xref="GOA:Q65NF2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF2"
FT                   /protein_id="AAU22055.1"
FT                   /translation="MLYTVKEVARLANITIKTLYHYHKIGLLCPAEVTDAGYRLYGVKE
FT                   LERLQHILFYRELEFPLKAIKQILDGKADRLTILSEQKRLFTARLDRIKQLISTIDLSI
FT                   QQAGKGEAMDQSSMFKGFSSSREWEDALAEQNRYLKEAYDVDLLKGEPVIAEEMNEKAE
FT                   EAARFMNGMAEALRDGVKHDHEQVKTAIKRHLKFLGITPDDFQSQTRFFIEDDFHRGML
FT                   ENQQTGLSYYLAAAAEAFAS"
FT   gene            complement(458263..458946)
FT                   /gene="yclH"
FT                   /locus_tag="BL01848"
FT   CDS_pept        complement(458263..458946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclH"
FT                   /locus_tag="BL01848"
FT                   /product="ABC transporter YclH"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01848"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22056"
FT                   /db_xref="GOA:Q65NF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF1"
FT                   /protein_id="AAU22056.1"
FT                   /translation="MGSILEFQNVGYWYKNQDQPLFEDISIQFSQGLLYTIVGTSGSGK
FT                   TTFLSLAGGLDAPKEGNILYKGENISKIGLTSFRNQYVSIVFQSYNLLPYMTALQNITS
FT                   AMEITGSQVKNKEQYALEMLEKVGIGEKQARQKVLTLSGGQQQRVSIIRAFCCDTDLIV
FT                   ADEPTGNLDEDTSKDIVRLFQNLAHQENKCVIMVTHDEQIAKVSDVNITLSRGGFTVKK
FT                   RISAG"
FT   gene            complement(458962..460401)
FT                   /gene="yclI"
FT                   /locus_tag="BL01849"
FT   CDS_pept        complement(458962..460401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclI"
FT                   /locus_tag="BL01849"
FT                   /product="hypothetical membrane protein YclI"
FT                   /function="Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01849"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22057"
FT                   /db_xref="GOA:Q65NF0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NF0"
FT                   /protein_id="AAU22057.1"
FT                   /translation="MNFFKRAFWSMKAKKGKTLLQLFVFTMICVLVLTGITIQSAAVKS
FT                   SELAREQLGGSVTLKVDREKMMKEQQDSGDRKRFESTPVSLKSAEKLASLYHVKSYNFI
FT                   SSTSALADNFDPIESGDEDSTDSNSDQPAGSGGNEQGGRQMMQADVSIEGVTSTALVDE
FT                   FADGTSKITEGRALTKDDVNEKVAVIEETLAEENELKVGDTIKVKASSDEDATINLKIV
FT                   GIYKTTSSGDNQAQNFAFLNPYNKIYTPYTAASALKGDDYQNAIDEAVYNMDDASNIDA
FT                   FIAAAKKTGIDLDTFTLDANDQLYQQMVGPIENVASFSKNVVYLVTVAGAVILGLIVMM
FT                   SIRERKYEMGVLMAIGEKRRKLIGQFLTEILMIAVLAIGISALTGSLIAKQIGNQLLSQ
FT                   QIEQTSASQSAGGMMGPGGGGFFGQSTAQVSAIDQLDIQVSFGNLMALGGIGLLIAMFA
FT                   TLLPSISVLRLHPKTILTKQE"
FT   gene            460619..461305
FT                   /gene="yclJ"
FT                   /locus_tag="BL01755"
FT   CDS_pept        460619..461305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclJ"
FT                   /locus_tag="BL01755"
FT                   /product="hypothetical sensory transduction protein YclJ"
FT                   /db_xref="EnsemblGenomes-Gn:BL01755"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22058"
FT                   /db_xref="GOA:Q65NE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE9"
FT                   /protein_id="AAU22058.1"
FT                   /translation="MKILMIEDNLSVCTMTEMFFAKEGFETEFVHDGLEGYNRFKSGDW
FT                   DLLIIDIMLPSMDGVTICKKVREESTVPIIMLTAKDTESDQVLGFELGADDYVTKPFSP
FT                   LALVARIKAVSRRYQNAGRQDSADSDTLETEHFKINKKTREVFLDGVQIQNLTPKEFDL
FT                   LYYLVQSPKQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLGSDSRPFLYTVWGVG
FT                   YKFDED"
FT   gene            461295..462722
FT                   /gene="yclK"
FT                   /locus_tag="BL01756"
FT   CDS_pept        461295..462722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /locus_tag="BL01756"
FT                   /product="Histidine kinase, homodimeric YclK"
FT                   /db_xref="EnsemblGenomes-Gn:BL01756"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22059"
FT                   /db_xref="GOA:Q65NE8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE8"
FT                   /protein_id="AAU22059.1"
FT                   /translation="MKIKYLYQLLASHISILVLAFLITGALFSHFAKDFAYESKVDELS
FT                   SYGYRIMGEMEMRPKGAPAIMKPFEEILRSRKISFFLFNEKKEILMTPADLRPRKLLLS
FT                   DEEWKELKDGKAVVVKTDFNRFNEEVSVVALPNIVNNEFQGGILLTAPISGTEEMISDM
FT                   NRFMLFTAAGVILVAILLSWLTSKFHVARIQKLRDATKKVAAGDYDIHIENRNKDEIGD
FT                   LGDDFNIMARKLKSSSEEIDRLEKRRRQFITDVSHELKTPLTTISGLVEGMNSQTIPED
FT                   QQDKCMKLITEETKRLIRLVNENLDYEKIRSNQITLQKLHYPLIEVFEIIKEQLALQAE
FT                   ERQNQLILDVEDHVMVNADYDRLIQILVNITKNSIQFTTNGTVWLRGREDYKETVIEVE
FT                   DTGIGIDENDIENIWDRFYKADLSRTNTPYGEYGLGLSIVRQLVSLHNGTVEIESEKNK
FT                   GTKFIIRLPLTARDDDE"
FT   gene            complement(462755..464473)
FT                   /gene="tlpA"
FT                   /locus_tag="BL01850"
FT   CDS_pept        complement(462755..464473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="BL01850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /function="Molecular Function: signal transducer activity,
FT                   Biological Process: signal transduction, Cellular
FT                   Component: membrane, Molecular Function: signal transducer
FT                   activity, Biological Process: chemotaxis (GO:00"
FT                   /db_xref="EnsemblGenomes-Gn:BL01850"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22060"
FT                   /db_xref="GOA:Q65NE7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE7"
FT                   /protein_id="AAU22060.1"
FT                   /translation="MNLLRNIKIRSKLFVIIIISALALSIVGIQGVGGLSKLSKGSEMI
FT                   YQDQLIPNQLFARLKANNLDLDTYKFELMVTKDSDRNETLQKNIKEKNEENNTLMEKID
FT                   QLKLMDNVSEKYESFKSEYKKLQDISSQMLSLAVKNENDKAYDVYLKEMEPQRETVNQL
FT                   IEDIQTLNADNAKTIYQRDSKEAGSIITLLIIVIAASLVLSISIGLLMTRLITKPIKDI
FT                   QALFAETEQGDFTVKGTYQSKDELGLLTASFNKMVAGVRSIIETVGETSHQVASSSQEL
FT                   SASADESTKASEYISTTIQELAVGSDQQVESVENSRTVIKGMTEFAGRISSSAEKAAAT
FT                   ADQTAKMSLEGTKAIDKVSAQMQSINETVVSLSEAFKHLTERSNEIGNITEVITSIAEQ
FT                   TNLLALNAAIEAARAGEQGKGFAVVADEVRKLAEQSAQSAEQITRLITIIQNDTKQTMN
FT                   SVISATGEVKEGLVVVHEAGGAFQKIENSITEVVTQINDVTNLVKNLTAGTSEIETAIS
FT                   GVKEVAETAAGSTQTVSAATQEQLASMEEIAAASQILAQNAEELQHLIQKFKIKD"
FT   gene            complement(464609..465970)
FT                   /gene="yclM"
FT                   /locus_tag="BL01851"
FT   CDS_pept        complement(464609..465970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclM"
FT                   /locus_tag="BL01851"
FT                   /product="Aspartate kinase YclM"
FT                   /function="Molecular Function: aspartate kinase activity,
FT                   Biological Process: amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01851"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22061"
FT                   /db_xref="GOA:Q65NE6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE6"
FT                   /protein_id="AAU22061.1"
FT                   /translation="MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPED
FT                   TKVTDLLIECAQQYLLSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGD
FT                   KTNPERFIDAIKASGEDNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPES
FT                   YDNLFQLRQQKGIIIFPGFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVD
FT                   AVYSVNPAIVSNPKEIRELTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPD
FT                   AEGTRVVATRDNTNGPVVGIAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEH
FT                   IPSGIDDITIILRQNQMDQAAEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVG
FT                   TTARASKALSEAGVNIEMINQGSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV"
FT   gene            466247..467200
FT                   /gene="yclN"
FT                   /locus_tag="BL01757"
FT   CDS_pept        466247..467200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclN"
FT                   /locus_tag="BL01757"
FT                   /product="putative transport system permease protein"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="probable ferrichrome transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01757"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22062"
FT                   /db_xref="GOA:Q62YU6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YU6"
FT                   /protein_id="AAU22062.1"
FT                   /translation="MKLRYLLLMLIILSFSSIFIGVKELSPLDLFRFNEDEIQTLYISR
FT                   IPRLISIVLAGMSLSICGLIMQQLTRNKFVSPTTAGTMDWARLGVIIAIVLFSSAGIVV
FT                   KILFAFVFALFGSFLFVKILDRIKFKDAIFIPLVGMMLGSVVSAISTFMAYQYNIIQNV
FT                   NAWFEGNFSLVMKGRYELLFLSIPLVIIAYLFANKFTLAGMGESFSINLGLKYKRVVNI
FT                   GLIIVSIISSVVILTIGTLPFLGLIIPNIVSIYRGDHLKNSLPHTAVLGAVFVLFCDIA
FT                   GRLVIYPYEISVGLMVGIIGSGVFLYLLLRRKAYAS"
FT   gene            467190..468134
FT                   /gene="yclO"
FT                   /locus_tag="BL01758"
FT   CDS_pept        467190..468134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclO"
FT                   /locus_tag="BL01758"
FT                   /product="putative transport system permease protein"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="probable ferrichrome transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01758"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22063"
FT                   /db_xref="GOA:Q65NE4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE4"
FT                   /protein_id="AAU22063.1"
FT                   /translation="MRHKQKMLVLIVIAAVCIGLFLFYGLPSVWEYALPRRFAKVFAII
FT                   IVGTAIAYSSMIFQTITNNRILTPSILGLDSLYVLLQTGIIFFFGAAKLADLGKNGNFL
FT                   LSTGLMVCFSFVLFFLMFRRGGRHIFLLLLVGIVFGTLFRSLSSFMQMLIDPNEFQVVQ
FT                   NKMFASFNNLNTDILVLASLVILAILVYAWRFNPYFDVISLGRDQAVNLGIDYDRTVKK
FT                   MLIVVAVLVSVSTALVGPITFLGLLVVNVAREVFKTYKHSVLIPGAVLFSIIALVGGQF
FT                   IVEKLFGLTVTLVVIIDFIGGIYFIYLLLKERK"
FT   gene            468134..468892
FT                   /gene="yclP"
FT                   /locus_tag="BL01759"
FT   CDS_pept        468134..468892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclP"
FT                   /locus_tag="BL01759"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="probable ferrichrome transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01759"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22064"
FT                   /db_xref="GOA:Q65NE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE3"
FT                   /protein_id="AAU22064.1"
FT                   /translation="MIEVRDIMKQFGEQTVVHPTTLTIQKGMITSFIGPNGAGKSTLLS
FT                   IISRLIGMDAGKVLIDGKEIGAYKSNDLAKKISILKQSNQINIRLTVRELVSFGRFPYS
FT                   QGRLSKEDWAYVDEAIDYMKLRDIEHKHLDQLSGGQCQRAFIAMVIAQDTDYILLDEPL
FT                   NNLDMKHSVEIMKLLKDLVENRGKTIVIVIHDINFASVYSDRIAALKNGRIVKEGPAED
FT                   IIQTPVLKDIYDMDIPIQQIGDQKICVYFK"
FT   gene            468907..469854
FT                   /gene="yclQ"
FT                   /locus_tag="BL01760"
FT   CDS_pept        468907..469854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclQ"
FT                   /locus_tag="BL01760"
FT                   /product="Periplasmic binding protein"
FT                   /function="Molecular Function: iron ion transporter
FT                   activity, Biological Process: high affinity iron ion
FT                   transport"
FT                   /note="probable ferrichrome transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01760"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22065"
FT                   /db_xref="GOA:Q65NE2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE2"
FT                   /protein_id="AAU22065.1"
FT                   /translation="MKKLSLLIMALITVLVVAACGNKAADTDAKSSSKKETVTIKHNSD
FT                   TTDVPKNPKKVVVFNFGMLDTLDELGLSDRVVGLPKQTLPSYLKKYKDSKFESVGGLKE
FT                   PDFEKIAELEPDLIIIEGRQSEQYDEFKKIAPTIDIELDQKNYMNSFKENTENIGKIFG
FT                   KEDAVKEALAKIDEKVEKANKLAKEKGGKGLVVLTSDKQISAYGSGSRFGLIHDVLGVE
FT                   PVDKNIEVSLHGQSVSSEYISEKNPDYLFVIDRSAAIGEKGTAKEVIENEIVKSTKAYK
FT                   NGHITYLDPGYWYLSGGGLESVSEMVKEVENGLK"
FT   gene            complement(470023..471444)
FT                   /gene="ycnB"
FT                   /locus_tag="BL01852"
FT   CDS_pept        complement(470023..471444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnB"
FT                   /locus_tag="BL01852"
FT                   /product="Drug resistance transporter YcnB"
FT                   /function="Biological Process: transport, Cellular
FT                   Component: integral to membrane"
FT                   /note="similar to drug antiporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BL01852"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22066"
FT                   /db_xref="GOA:Q65NE1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NE1"
FT                   /protein_id="AAU22066.1"
FT                   /translation="MSTGTEQQTYNRNIIVGLLIAGAFIAILNQTLLVTALPHIMADLN
FT                   IDATKAQWLTTAFMLTNGILIPITAFLIEKFSSRALVIAAMSIFAAGTVVGAVAPNFPV
FT                   LLAARIIQAAGAGIMMPLMQTIFLTIFPVEKRGAAMGMVGLVIAFAPAIGPTLSGWIVD
FT                   SFTWRYLFYIILPIALIDLVLVILLMKNVTKLRETSVDIISIILSSLGFGGLLYGFSNA
FT                   GSEGWGSNTVLISFAVGAVALFFFISRQLKIKRPILEFRVFQSWTFTITTLLGMIVFAL
FT                   MIGTETILPLYTQNVRDVTAFDSGLMLLPGAIAMGIMSPIIGRIFDKIGGKGLAIIGFA
FT                   VLLLTSIPFADLQMDTSLTFIIVIYTLRMMGTSMIMMPLTTAGINALPAHLIPHGTAMN
FT                   NTMRQIGGSIGTAVLISVMSNSAKNAATSHPLNALIHGMNSAFIVAAVLALIGFILSFT
FT                   LKKKPQADKQGQPAR"
FT   gene            complement(471456..472343)
FT                   /gene="ycnC"
FT                   /locus_tag="BL01853"
FT   CDS_pept        complement(471456..472343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnC"
FT                   /locus_tag="BL01853"
FT                   /product="probable transcriptional regulator YcnC"
FT                   /db_xref="EnsemblGenomes-Gn:BL01853"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22067"
FT                   /db_xref="GOA:A5A698"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5A698"
FT                   /protein_id="AAU22067.2"
FT                   /translation="MNEKKAAVLRAAKKLFAQKGYHNVAMQAIAEECKMSKASIYKLFQ
FT                   SKEDLLLALIKFRKHEMLNKSAVINTETSLTPKERFAKKIALEITEFRENRQFINFISN
FT                   EGSSPDTAVFKKHLKETKSMIISWHKDSIIQAYGEEVEPFIWDIVIIFHGLMREFLFLV
FT                   GTGKAQPDVKTIPPFIMSVLDLFIEKKLNEDQKSSLNEDIIASYSNFSSCWAPPKKEEL
FT                   LEDLLQKLKTKISSLPQDDVSVTELLSAADLLSEELFANEPRTYLIKALLDYLGKIEAI
FT                   QYDVSQIQTISIKE"
FT   gene            complement(472438..473280)
FT                   /locus_tag="BL01855"
FT   CDS_pept        complement(472438..473280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01855"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22068"
FT                   /db_xref="GOA:Q65ND9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND9"
FT                   /protein_id="AAU22068.1"
FT                   /translation="MKSFAKYQTFLDLHHQSDPFVLPNAWDAASAKAFQNCGFKAVGTT
FT                   SAGIAMSLGYPDGEHLPFETLLSVLKTITDAVDIPVSADLEAGYGQTPETVAENAKKAA
FT                   AAGVVGMNIEDGTKDPCRPLSDATLMEEKITAVKKLNLPVLINARTDVYWLNADAPGSR
FT                   LQAAVRRANRYSQAGADCIFIPGADDAGTIAGLRKGISGPINVLAGSHTPSLQILSELG
FT                   IERISCGSAPFRAALSLVKKIGEDIIRRGAFNRMTDGVLSYGEAADWISLHRDPKQNR"
FT   gene            complement(473391..474128)
FT                   /gene="nfrA2"
FT                   /locus_tag="BL01854"
FT   CDS_pept        complement(473391..474128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrA2"
FT                   /locus_tag="BL01854"
FT                   /product="NADPH-linked nitro/flavin reductase"
FT                   /function="Biological Process: electron transport,
FT                   Molecular Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01854"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22069"
FT                   /db_xref="GOA:Q65ND8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND8"
FT                   /protein_id="AAU22069.1"
FT                   /translation="MNEVLKTLKDHRSIRSYTDEPVSPEQLDDIIQAVQAAPNSINGQQ
FT                   VTVITVQDEERKKKIAELAGGQVWIEQAPVFLLFCADFNRAKIALEKNGETLAITDGME
FT                   SVLVGAVDAGIALGTATAAAESMGLGTVPIGAVRGRAEELIKLLNIPEYVFPVAGLVVG
FT                   HPADRSAKKPRLPEQAVRHSETYQPDLKPLIDAYDEEISEYMTKRTNGQETRNWSQGIS
FT                   AYYNKVYYPHIREMLEKQGFKLE"
FT   gene            complement(474147..474434)
FT                   /gene="ycnE"
FT                   /locus_tag="BL01856"
FT   CDS_pept        complement(474147..474434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BL01856"
FT                   /product="Dimeric alpha-beta barrel"
FT                   /note="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01856"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22070"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND7"
FT                   /protein_id="AAU22070.1"
FT                   /translation="MIVLQAYMKVKPEKRDAFLESVQPLLKHSRAEAGNAQYQLFEDTE
FT                   HANTFVMLEQWKDQDALDAHNQTEHFQAFVQAAGDLLSEPLNVVKTHTTD"
FT   gene            474612..474908
FT                   /gene="yczG"
FT                   /locus_tag="BL01761"
FT   CDS_pept        474612..474908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczG"
FT                   /locus_tag="BL01761"
FT                   /product="putative transcriptional regulator YczG"
FT                   /note="ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BL01761"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22071"
FT                   /db_xref="GOA:Q65ND6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND6"
FT                   /protein_id="AAU22071.1"
FT                   /translation="MKTNEMKLTAVLQALSDPYRLEIVKALADTAEKTCGTCTNLNIAK
FT                   STLSHHFKVLREAGLLKVRIEGKHHYYSLCKRELEEQFPGLIEAVLKVEKERW"
FT   gene            complement(474973..476403)
FT                   /gene="gabR"
FT                   /locus_tag="BL01857"
FT   CDS_pept        complement(474973..476403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BL01857"
FT                   /product="transcriptional regulator GabR"
FT                   /function="positive regulation of gabTD and negative
FT                   autoregulation"
FT                   /db_xref="EnsemblGenomes-Gn:BL01857"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22072"
FT                   /db_xref="GOA:Q65ND5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND5"
FT                   /protein_id="AAU22072.1"
FT                   /translation="MITIPIDRSKGAEYIYHQIYQRIKEEIFSRNLLPGKKLPSKRELA
FT                   ETLNVSINSVNAAYQQLLAEGYLYSRERKGFFVEQIETFHASRHPGPLQLEKELVEEPE
FT                   SKDGWISFSHMSVDTAHFPFKTWLRCEQKAVSSHVDELGEMTHPQGVYEVRQTIARFIA
FT                   LTRGVKCLPEQIVISAGTQSLIHTLQDLLPASAVYAMEEPGYSRIYRLLKNEGKEVATI
FT                   QLDHKGMRISEIHRLNPDVLFVTPSHQFPTGIIMPVSRRIQLLNWVSDGANRYIVEDDY
FT                   DSEFKYGSDTIPALQSLDRSEKVIYIGTFSKSLLPGLRISYMVLPQKLLKRYRKRHHFS
FT                   IQSSSVLTQLALQELIESGEYQKHIKKMNQIYEKKRTRLIGSLVKHFNGRVKIKGESAG
FT                   LHFVADFETDRSEEEVLLRAKERRVEVYGMSRFTLKKEQTKHEGTVSLVLGFAKIAADQ
FT                   IDEGTAKLYEAVCGDEKL"
FT   gene            476506..477819
FT                   /gene="gabT"
FT                   /locus_tag="BL01762"
FT   CDS_pept        476506..477819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BL01762"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /function="Molecular Function: 4-aminobutyrate transaminase
FT                   activity, Biological Process: aminobutyrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL01762"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22073"
FT                   /db_xref="GOA:Q65ND4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND4"
FT                   /protein_id="AAU22073.1"
FT                   /translation="MSRNTKAFTTEDWQAKRDQFVARGVSNGNRHLAAKGEGAVLYDID
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEQLIHPGFNVMMYPAYLELAEKLCRLAP
FT                   GAHEKKAIFLNSGAEAVENAVKIARKYTKRQAVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYRKPEGMTDESYDDMVIQAFDDFFVSSVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVAAFCQKHGIVFVADEIQTGFARTGKYFAIEHFDVVPDLVTVSK
FT                   SLAAGVPLSGVIGRAEMLDAADPGELGGTYAGSPLGCVAALAVLDIIESEQLNKRSEEI
FT                   GKAIEERALEWKMKYPQIGEVRRLGAMAAIEIVRDEKTREPDKAAAAKIAKYANEHGLL
FT                   LLTAGINGNIIRFLSPLVITDELLEEGFGIIEEALEQL"
FT   gene            477853..479244
FT                   /gene="yhdG"
FT                   /locus_tag="BL01764"
FT   CDS_pept        477853..479244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdG"
FT                   /locus_tag="BL01764"
FT                   /product="Amino acid/polyamine transporter I"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01764"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22074"
FT                   /db_xref="GOA:Q65ND3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND3"
FT                   /protein_id="AAU22074.1"
FT                   /translation="MGKQQMKKTMSQTDVLFLAIGAMLGWGWVVLSGDWISTAGFLGST
FT                   IAFIIGGILVILIGLTYAELSSAIPETGGGLIFVYRAFGRKTAFVAAWGVLFGYVSVIT
FT                   FEAVALPTVIDYVLPVEHQGFLWSLSGWDVYVTWVLIGSGGAVVLTALNYFGVKPAAIF
FT                   QSVFTIAIIATGFLLLGGALVNGDFEHVQPLFKDGFSGMMSVLVMIPFLFVGFDVIPQV
FT                   AAEINAPKKIIGKILIISIISAVVFYLLIVFGVTMGLSESELATTSLATADAMVNLLGN
FT                   QLFGTVLVLGGVAGIITSWNAFIIGASRILFAMSEKGMVPKWFGFIHPKYKTPTNAILF
FT                   LGALAFFAPLLGRPALVWIVNAGGTGIIVGYLIVSIAFMKLRKTEPDLHRPYKINKWKT
FT                   TGISAILLSVIFLAFYLPGMPAALTWPYEWLILAGWTLIGFLLYNSSSKRKGEEIQHDQ
FT                   HARSI"
FT   gene            479219..480613
FT                   /gene="gabD"
FT                   /locus_tag="BL01765"
FT   CDS_pept        479219..480613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BL01765"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01765"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22075"
FT                   /db_xref="GOA:Q65ND2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND2"
FT                   /protein_id="AAU22075.1"
FT                   /translation="MTSMLEVYNPATGEKIKSVPQQSAKEVEEAVVRSHEAFQKWSKTS
FT                   AAERAGLLKKWFDLIVEQKDELAKLITLENGKPYAEAQGEVLYSAGYIEWYAEEAKRIY
FT                   GRTVPASVTNKRIIVTRQGVGPVAAITPWNFPAAMITRKAGPALAAGCTFIIKPAPDTP
FT                   LTALELVRLGHEAGIPKDVLQCVIGDGQEIGSIFTSHPLIRKITFTGSTPVGKHLMKNS
FT                   AETVKHVSMELGGHAPLIVDEDANIDLAVKQTMLSKYRNAGQTCVCANRLIVHESVKDE
FT                   FAEKLRAEVAKLKVGNGLEEGVSIGPIINKNGFQKIVDQINDAVNKGAKVLIGAEYESD
FT                   DEKSCYFVHPTVLTDVDPSMTIMHEETFGPVAPITSFKTLDEAVKLANDTPYGLAAYFF
FT                   TENYRRGIYLSENLDYGILGWNDGGPSTVQAPFGGMKESGIGREGGLEGIEPYLETKYL
FT                   SIGLDE"
FT   gene            complement(480660..481544)
FT                   /gene="ywfM"
FT                   /locus_tag="BL01858"
FT   CDS_pept        complement(480660..481544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywfM"
FT                   /locus_tag="BL01858"
FT                   /product="conserved membrane protein YwfM"
FT                   /function="Cellular Component: membrane, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01858"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22076"
FT                   /db_xref="GOA:Q65ND1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND1"
FT                   /protein_id="AAU22076.2"
FT                   /translation="MKVSVLFVLLAAILWGTTGTTQAFAPKEAAPLVFGAVRMAVGGIT
FT                   LLLFAAFRGQLKRSGWPVKTLIIAALSMAFYQPFFFSAVSLSGIAVGTVVAIGSAPIIA
FT                   GCLEWLVFKKVPQTKWWIATAAAIAGVALLFIPSASSGGSFLGILLALGAGLSFAVYTL
FT                   TSKKLLQKQKPEAVTGTVFFLSAVLLAPLLFLYDLGWISSVQGMAVSLYIGVIATGAAY
FT                   LLFTTGLAKVPASTAVTLSLAEPLTASLLGTVLVRESLPLVSWAGIALLLLGIFYISYQ
FT                   PKKDKINAEQMKA"
FT   gene            481709..482200
FT                   /locus_tag="BL01766"
FT   CDS_pept        481709..482200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01766"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22077"
FT                   /db_xref="UniProtKB/TrEMBL:Q65ND0"
FT                   /protein_id="AAU22077.1"
FT                   /translation="MKKRTVLFFLLIWLAGCASAQEAEEQTKWVNSEQKAIENGIRYES
FT                   ITKDDIIDKIDLNGEQVVVFRFGDSEGEGIGLAHIKRENGNYQWYRDLNYAIVKSDHPK
FT                   TENAEASAPFTTPKGRKYTLYTGDADRLNGTFETDDGLHLEPVVDQKTGMYYQIVQDSD
FT                   "
FT   gene            complement(482248..482892)
FT                   /gene="ycnI"
FT                   /locus_tag="BL01859"
FT   CDS_pept        complement(482248..482892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnI"
FT                   /locus_tag="BL01859"
FT                   /product="conserved membrane protein"
FT                   /function="Cellular Component: cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:BL01859"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22078"
FT                   /db_xref="GOA:Q65NC9"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC9"
FT                   /protein_id="AAU22078.1"
FT                   /translation="MLKKTLWMGAILASFLLFSVPVSAHVTVKPTESAAGSWETYTVKV
FT                   PVEKDNATIKVVLSMPDGVEFQQYEPVPGWKTSTETGKNEKVTRVTWEAENGGIQPGEF
FT                   QQFTFTAKNPDKEQKAAWNAYQYYKDGTIVEWTGDDDADTPHAITSIVDAAKLGHETVD
FT                   AHGASTKQNAAAENEDSQGGQGIQTASLILSILAVLLGGAALLLTVRKKKS"
FT   gene            complement(482895..484532)
FT                   /gene="ycnJ"
FT                   /locus_tag="BL01860"
FT   CDS_pept        complement(482895..484532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnJ"
FT                   /locus_tag="BL01860"
FT                   /product="putative copper export protein YcnJ"
FT                   /function="Molecular Function: copper ion binding, Cellular
FT                   Component: periplasmic space, Biological Process: response
FT                   to copper ion"
FT                   /db_xref="EnsemblGenomes-Gn:BL01860"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22079"
FT                   /db_xref="GOA:A5A697"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A5A697"
FT                   /protein_id="AAU22079.2"
FT                   /translation="MKRATLWAVLAVLCTILLPKAAFAHAYIVQSTPAENQELKKAPEE
FT                   IKIEFNEAIQNGFHSITVRNSSGERVDSGKTEIDPQNAKIMTVKLKPKLKDDIYSAEWR
FT                   AVSADGHPVSGTIPFSIGNIQGGLPKDQQNQASGLPAADIVIERVLLYTGFSLFMGAAL
FT                   FQLVWHRPENGWPGDKKRRLKRITNVALLLTGAAIIIQLPLQTKTNAGVSWIGAFQPSL
FT                   LKETLLNTTGGTLWLINIAIIALLVFSSNRKGLKSAILSLFLFAGLLFVKSLDGHAAST
FT                   SAGYMTIAMNFIHLNAASIWTGGLAMFVLFFGKDWLKPDKSLIWETIRRFSPWALASAG
FT                   LLIFSGLFNSFFIVHTLDNLFGTAYGKALLVKSALVLLMIGLGAFHYFRFRKAPKQQGG
FT                   RSMKAEWAVGLLILLTTAVFTNIPSPPAPLPQPFSETKQLTEGNTLSLRISPNMPGSNT
FT                   FEVTVRNRKGDVVKDIQKIELTVEKTGLFGDDKESTFSLSKNKDGVFQTKNLNLSEDGI
FT                   WKIRVHGLTASFEEIRTVFNAKINKKEF"
FT   gene            complement(484561..485133)
FT                   /gene="ycnK"
FT                   /locus_tag="BL01861"
FT   CDS_pept        complement(484561..485133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnK"
FT                   /locus_tag="BL01861"
FT                   /product="probable transcriptional regulator YcnK"
FT                   /note="probable transcriptional regulator (DeoR family)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01861"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22080"
FT                   /db_xref="GOA:Q65NC7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC7"
FT                   /protein_id="AAU22080.1"
FT                   /translation="MLPIKRREQILAWIKEEESLRISEISKRLNVSEMTVYRDIKPLVE
FT                   NGQVIKTAGGITLNKPKQQLGQLCVVCGKGAGSRLAVQIVKNDSQIEQFCCVHCAMLRY
FT                   EKVKDDVSQIICRDFLLDTTISAKAAVFLLDTDLHLNCCEPHALPFASEAEARKFKKGF
FT                   GGQLLSFDDAALLVQKTMKNSCCSLKT"
FT   gene            485394..487688
FT                   /gene="nasB"
FT                   /locus_tag="BL01767"
FT   CDS_pept        485394..487688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BL01767"
FT                   /product="assimilatory nitrate reductase (electron transfer
FT                   subunit)"
FT                   /function="Biological Process: electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BL01767"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22081"
FT                   /db_xref="GOA:Q65NC6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC6"
FT                   /protein_id="AAU22081.1"
FT                   /translation="MGKQRLVLIGNGMAGVRTAEEISLHGGSRFEIVIIGSEPHPGYNR
FT                   ILLSSVLQGETDWNDVMTKSRSWYEENGITLYTGETAVAIDTVNQTVATDQNREIAYDK
FT                   LIIATGSSPFILPVHGADKEGVYGFRTIDDCRAFINASKRFKKAAVIGGGILGLEAARG
FT                   LANLGMKVDVVHHSSSIMQTQLDPPASAMLQKELERQGIHFLLEKDTEAILGTSRAEGV
FT                   RFKDGTKISADLVVMAAGVRPNIELAKASGISTNRAIIVSDYMETNVPNVYAVGECAEH
FT                   NGTVYGLVKPLYEQGKVLAKHICGLECSGYQGSVQSAALKMSGIDVFSAGKITEDDSTT
FT                   AIKLLDEAAGVYKKAVFQGDKMAGVILYGDTSGSQRLLESIIKQRDITVVKKELFQSEE
FT                   DSSVASMAVRETICQCNAVSKGMIMEAIQTHGLKTAEEVKRCTKASGSCGGCRPLVEEL
FT                   LLHTAEHDGHISAAEQPMCACTSFTEDEVVNEIQMRNLSSVHEVISALGWKNSSGCRIC
FT                   VPALHYYLKMIRPDIAYEEHEEETDAIIPQMYGGRTNAEELKRIAGVIEKYQIQEVYMT
FT                   HHQRLKLAGIKPEHIERVKEELGMPYCLPQQQRIAAVKTCPCGSPQIQTLAADLEKAAE
FT                   SLLIPAKVSIGVSGCLDDCVYASVHDIGLLKVNGGWEIYAGGQGGQHASPGELLSVADS
FT                   AEEAGELMKGLLQYYRETANYLEKIGHWIERAGIIHIREVLFDNGLRGQLFERLEKEKR
FT                   LAQQEMIKGLM"
FT   gene            487690..489849
FT                   /gene="nasC"
FT                   /locus_tag="BL01768"
FT   CDS_pept        487690..489849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /locus_tag="BL01768"
FT                   /product="assimilatory nitrate reductase (catalytic
FT                   subunit)"
FT                   /function="Biological Process: electron transport,
FT                   Molecular Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01768"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22082"
FT                   /db_xref="GOA:Q65NC5"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC5"
FT                   /protein_id="AAU22082.1"
FT                   /translation="MTERLLKYFRTKQKEVQSEKTYDTQCPFCSMQCKMQLIEQTIVTR
FT                   KKYTAVGKDNPTTKGRLCMKGMNAHQHAFHSERITHPLIKKNGEFVRVSWEEALQYIKE
FT                   QVTAIQHEDGRDALSVYGSASITNEEAYLLGKFARVALKTKHIDYNGRLCMSAAATAAN
FT                   QTFGMDRGLTNALSEIPHARVIILAGTNIAECQPTIMPYFEEAKQNRAYIIVIDPRETA
FT                   TAKIADLHLKIKPGTDAALANGMLKIIIEEQLTDGAFIRDRAEGFEEVKRHVASLSLED
FT                   ISAKTGIQIEQIKKAAVKFAREETGMLFTARGVEQQTDGTAAVRNLLNILISTGKIGKY
FT                   ACGYGAVTGQGNGQGAREHGQKADQLPGYRSIENEADRAYIADVWGIKAEDLPGKGVSA
FT                   YEMMKKVHEGEITGMFLMCSNPVVSSPTAGFVKSALGKLKFFAAVDLFLSETAILADVV
FT                   LPASSYLEDEGTMTNLEGRVTLREASKPCPGEARHDWQIICDIAKALGKGRYFSYRSAE
FT                   DVFNELRKASRGGIADYSGITYERLRKEGGILWPCPEEGHPGTQRLFESSFSHPDKKAR
FT                   MCVVPNEPKVKKDVPTEEYPLILTTGRVMSHYLTGVQTRRSAALKARHFESFMEIHPKT
FT                   AEKYNIGDRVLVRVESKRGSIIVRSKWSEAIRPDTVFVPIHWADSQNVNDLIAETLDPS
FT                   CSMPGFKVCSVKIRPSVDNFVNKLS"
FT   gene            489963..492383
FT                   /gene="nasD"
FT                   /locus_tag="BL01769"
FT   CDS_pept        489963..492383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BL01769"
FT                   /product="assimilatory nitrite reductase (subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:BL01769"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22083"
FT                   /db_xref="GOA:Q65NC4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC4"
FT                   /protein_id="AAU22083.1"
FT                   /translation="MKKKQLVLVGNGMAGVRAIEEILKISNEEFQITIFGSEPHPNYNR
FT                   ILLSKVLQGDTDVKDITLNDWDWYEENGIQLYTGEEVVKVDPESKTVITDTGRVQPYDE
FT                   LILATGSLPFILPLPGADKEGVTAFRDIKDTDIMLEASKTYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVTVVHLAPYLMERQLDAAAGRLLQKELEKQGMKFLLEKQTEEIYGETRVEGL
FT                   KFKDGSTLEADLVVMAVGIKPNVQLGKDCGLPVNRGIVVNDYMETEVPNIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKKICGVETAPYEGSVLSTQLKVSGVEVFSAGDFNEDDGED
FT                   KKALKVFDEQDGIYKKIVLRGNQVIGAVLFGDSSEGNRLFSMIQKGADISDTSKISILQ
FT                   PLNQEEGMSLTAAMSDDEIVCGCNGVSKGMIIQAIKEQGCTSTDEIKACTGASRSCGGC
FT                   KPLVAEILQHTLGSEFDASAQKEAICGCTDLSRDELVAEIREKGLTHTKEVMNVLGWKT
FT                   AEGCSKCRPALNYYLGMINPKEYEDERESRFVNERMHANIQKDGTYSVVPRMYGGVTNS
FT                   NDLRRIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWADLDMPSGFAYGKTLRTVK
FT                   TCVGEQFCRFGTQDSMALGIDLEKKFEGLYTPHKIKMAVSACPRNCAESGIKDIGVVGI
FT                   DGGWEIYVGGNGGTHLRAGDLLMKVKTAEEVIEITGAYLQYYRETANYLERTSAWIERV
FT                   GLSHVQSVLNDKEKRKELNDRINQALSVHKDPWKDFLEDGKTTRQLFENVVTS"
FT   gene            492414..492734
FT                   /gene="nasE"
FT                   /locus_tag="BL01770"
FT   CDS_pept        492414..492734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BL01770"
FT                   /product="assimilatory nitrite reductase (subunit)"
FT                   /function="Biological Process: electron transport,
FT                   Molecular Function: oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01770"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22084"
FT                   /db_xref="GOA:Q65NC3"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC3"
FT                   /protein_id="AAU22084.1"
FT                   /translation="MVNKNLTKVFVSKIGDLPNQLGKTVFIKDKEIAVFKLSNGSVRAI
FT                   ENRCPHKGGVLAEGMVSGEFVFCPMHDWKISLEDGKVQEPDTGCVQTYETVVEGEDLYI
FT                   VY"
FT   gene            492852..494312
FT                   /gene="nasF"
FT                   /locus_tag="BL01771"
FT   CDS_pept        492852..494312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BL01771"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /function="Biological Process: porphyrin biosynthesis,
FT                   Molecular Function: methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01771"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22085"
FT                   /db_xref="GOA:Q65NC2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC2"
FT                   /protein_id="AAU22085.1"
FT                   /translation="MGNGKVYFVGAGPGDSGLITLKGRTLIEAADVILYDRLVNSRLLE
FT                   HAKASCEFVYCGKLPDRHYMRQSEINALLIEKGLKGLKVVRLKGGDPSVFGRVGEEAAA
FT                   VSEHGIPYEMVPGITSGIAAPLYAGLPVTHRDFASSFAVVTAHDKSGKPEMNWEGLAKG
FT                   VQTLVFYMGIKNLGYICEQLMKHGKSPLVPAMAIQWGTWGRQRSVKGTLQNIREKITEH
FT                   QIKNPAIIVIGDIVSFRQNSWFEEKPLIGLNIMAVKSCEEEQIPVEALREQGAEVVEWP
FT                   KWKSAETVPDDALLGRIACFDSLLFTSSASLRRFFSRLAALKIDVREMRGRLYASDQHV
FT                   KAALEERGFEAFLQTEMPVSGSCLLIGSREAVQNYPHSGCEVLITHDRVIDSRFTSIIK
FT                   REIDEFPIDIVLFSNRTCVELFVNEAETVGLHPEKTAARLQAFCLTEEAGERAAAVGFQ
FT                   RVHAVNDRDRLPDVIKEINRTAEFVCQS"
FT   gene            complement(494338..495018)
FT                   /gene="ydhC"
FT                   /locus_tag="BL01862"
FT   CDS_pept        complement(494338..495018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhC"
FT                   /locus_tag="BL01862"
FT                   /product="putative regulatory protein"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01862"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22086"
FT                   /db_xref="GOA:Q65NC1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC1"
FT                   /protein_id="AAU22086.1"
FT                   /translation="MKFSIQRAVSYHDQVHHYLKDMIIKGGYQPGERIYESKIAKELQV
FT                   SRSPVREAIRTLEQEGLLLIDDKSKITVYEPTIKDLEEIYQCRQALESLAVSLATRLAS
FT                   NETLELISETLSEAHKHQKSQGPESANALLRLNTQFHDAIIEASENERLQKQLLDLRSL
FT                   TFFYRSKNLEKPERTLEIINQHEEILRHMQDRNDAKAAESMRKHIEADLCYLKEVLFRS
FT                   SAAR"
FT   gene            495248..496888
FT                   /locus_tag="BL01772"
FT   CDS_pept        495248..496888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01772"
FT                   /product="Sodium/sulphate symporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: sodium ion transport, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL01772"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22087"
FT                   /db_xref="GOA:Q65NC0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NC0"
FT                   /protein_id="AAU22087.1"
FT                   /translation="MKSSVVSAWDMLWRSHREAKRLLLFAMPVRAGKDAGLKINSEQTM
FT                   KEEKPPSYKTPQKIGLLLGPALFFAVLLFFFPEGLSYEGRMVLATTLWVAVWWITEAVP
FT                   IPAASLLPIVLLPLTGALEGAAVTSSYGDPIVFLFLGGFLIALAMERWNLHKRIALNII
FT                   SVVGTSTSRIVLGFMAATGFLSMWVSNTAAVMMMLPIGTAIIHQVSAVIKSERKDLAAE
FT                   EAKFSKALIFSIGYAGTIGGLGTLIGTPPNIILAANIKKLYGVEVSFGGWMAFAVPVVV
FT                   ILLVAVWLYLTKVAHPIKMKELPGGKELILEEKRKLGKMSFEETMVLLVFGFAAFMWVT
FT                   RTFLWDDKIPGIDDTMIAIFAASLLFLIPSLNKGGRVLDWSVSKDLPWGILLLFGGGLA
FT                   LATGFKETGLAEWIGGRLTVLDGFNFVVIVIISTALVLFLTEITSNTATATMILPVLAS
FT                   LALALNVHPYALMVPAAMAANCAFMLPVGTPPNAIIFASGKLKISEMVRTGFVINIFTL
FT                   ILIVGAVFYILPHLWGVDLTVFPDNLKSN"
FT   gene            497007..497419
FT                   /pseudo
FT                   /gene="ycsD"
FT                   /locus_tag="BL05027"
FT                   /note="frameshift or internal stop,authentic frameshift"
FT   gene            497416..497883
FT                   /locus_tag="BL01773"
FT   CDS_pept        497416..497883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01773"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01773"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22089"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB7"
FT                   /protein_id="AAU22089.1"
FT                   /translation="MIEIKPVAFVENLRTFPKDDHWGDVISEIKLAEGIHPDALKGIEE
FT                   FSHLDIIFYFHQVKEEHIQYKARRPRNNKNYPETGIFAQRGKNRPNRLGATVVTLLEKS
FT                   GSKLVVKGLDAIDGTPVIDIKPVMKEFLPKGQIIQPKWSEDLMKVYWHAAD"
FT   gene            498049..500100
FT                   /locus_tag="BL01774"
FT   CDS_pept        498049..500100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01774"
FT                   /product="transcriptional regulator"
FT                   /function="positive regulation of the mannitol operon
FT                   (mtlAD)"
FT                   /note="BL01774 similar to mtlR from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01774"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22090"
FT                   /db_xref="GOA:Q65NB6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB6"
FT                   /protein_id="AAU22090.1"
FT                   /translation="MINEKRPAQLLQYLLRVREATMHQLIDHFQLSKRQICYDLDKINH
FT                   WLTGKQLPEIEYKRKNRLAVPETLLELRFSEACSDIGRSFIFTQEERIKALYMFLFVRR
FT                   EPISSAHLTQLLQVSKNTVMNDVKKANEALTPFLVAIKYTRQRGYHLIGSEFDKRVPVM
FT                   HHLSSFLQKPYGKEILHYILKISGSRDHKQQEFKRAVELVSKEYGLQLVEERLNEFIYF
FT                   LMMYSIRVAEGKIVRFHQEEGELLKQSPLKNAAVRLVNELRIPVHETELCYILIQLLGL
FT                   SFGQQPAHDPLYQLCEKLVFEFESRACITFPRRREVAESLYRHLKPAYFRMKYRIPIHN
FT                   PLLSKIKKEHKELFTIVQKLMRHLEALLNKPVPEEEIGFITIHFGALLEQPVQSGSSKK
FT                   TAVVVCPSGVSSSLMVRRQLESLFSEIVVEKAMSLQEFTPDVFDHYDAVFSTVELKTKK
FT                   RYYMVRPLMTPAEKSRLVNEVYQEMFGVKQRELLTDEFLHILKKHASIIDEKGLRESLK
FT                   NIAFVQKVTETRGKRPVLKDLLTDETIQMADQIKGWEEAIQTAAKPLLDKEVILKEYTD
FT                   AMIDNVKTMGPYMIIGPEIAIPHARPEKGVQKVGMSLLKLKEPVYFLDDEQYPVRLLFC
FT                   IAAVDHTTHLKALSQLTRLLSNKENQDSLKETESLEHIKRLIEAYSSN"
FT   gene            500117..500398
FT                   /locus_tag="BL01775"
FT   CDS_pept        500117..500398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01775"
FT                   /product="putative sugar phosphotransferase"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system"
FT                   /db_xref="EnsemblGenomes-Gn:BL01775"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22091"
FT                   /db_xref="GOA:Q65NB5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB5"
FT                   /protein_id="AAU22091.1"
FT                   /translation="MKILAVCGSGLGSSFMLEMNIKDILQEMGLMEIEVDHSDLSSASP
FT                   DQADLFIVAKDIAEGAAHLRDIVVLESIIDMDELKTKLVKTLQEKGVL"
FT   gene            500422..501795
FT                   /locus_tag="BL01776"
FT   CDS_pept        500422..501795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01776"
FT                   /product="putative sugar phosphotransferase system protein"
FT                   /function="Molecular Function: cysteine-type endopeptidase
FT                   activity, Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01776"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22092"
FT                   /db_xref="GOA:Q65NB4"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB4"
FT                   /protein_id="AAU22092.1"
FT                   /translation="MGERALKLMMDVLSQPAVLIAAISLIGLLLQKKPANEIVKGTTKS
FT                   FLGFIVISAGAGILVGSLEPFGKMFQAAFHVNGVVPNNEAIVAMALNEYGTATALIMFF
FT                   GMLSNILIARFTRLKYIFLTGHHTLYMACLIAVILAVAGLKGPFLIGVGAVSLGLTMSL
FT                   FPAMVQPFMKKITGNDKVAFGHFSSIGYAVSGLIGKAAGKGSRSTEKIRFPNGLGFLRD
FT                   SSVSIALTMTILYVLIALFAGAGYVERELSGGTHYLVFSVIQAVTFAAGVFIILSGVRL
FT                   VLAEIVPAFKGISDKLVPDSKPALDCPIIFPYAPNAVLIGFFCSFIGGITGMLILGAAG
FT                   AVIVLPGVVPHFFTGASAGVFGNAAGGIRGAVLGSFVNGLIITFFPVFLLPVMGDLGFA
FT                   NTTFSDTDFAATGIVLGHAVKLLGSGGVVIGIAAVVVGAVLFGFKRGKAEKPDQKVEA"
FT   gene            501810..502652
FT                   /locus_tag="BL01777"
FT   CDS_pept        501810..502652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01777"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01777"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22093"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YR5"
FT                   /protein_id="AAU22093.1"
FT                   /translation="MSVREIDMERFRDQIRLLTLKQLHHLGFGHYGGSLSIADVLAVLY
FT                   GKVMKIDPANPSWEDRDFFILSKGHGGPALYAALHLSGYFEEDVLYTLNQNGTALPSHP
FT                   DRNLTPGVDMTTGSLGQGISAAAGVALSHKLSGRANRTFVIVGDGELNEGQCWEAIQFA
FT                   AHHKLRNLYVFVDDNKQQLDGPTKEIIDPLDFVSKFRAFGFYSERVNGHEPEAIYRAVK
FT                   RGEAQRERPVAVILDTVKGKGIPYFEKMENSHHIRANEEQNRMIERIILTLEEKEVRA"
FT   gene            502649..503599
FT                   /locus_tag="BL05028"
FT   CDS_pept        502649..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05028"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /note="BL05028 similar to dxs from Bacillus subtilis,
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BL05028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22094"
FT                   /db_xref="GOA:Q65NB2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB2"
FT                   /protein_id="AAU22094.1"
FT                   /translation="MNEAANVELDAVEMRQAYSSAVYELAQENTDIVALEADLMSSISM
FT                   DKVKRRIPEQVINCGVMEANMIGIAAGLSLTGRIPFVHTFAQFATRRCFDQLFVSGAYA
FT                   KTNIKILGSDSGITAEHNGGTHMAFEDLGLARLIPNAFVYEASDAAMLKFLIKKAAAEY
FT                   GIHYIRTIRKKAVRLYDEHETFADGKAKVLKDGSDAALFASGIMVAEALQAAELLKEKG
FT                   IDAAVIDMYCIKPIDQETVVRYAQKTNAIVTAENHNVIGGLGSAVAEVLSEHYPAPLKR
FT                   IGVHEAFGQVGTIDYLKKSYRLTAEHIALAAEQLV"
FT   gene            503674..504429
FT                   /gene="ycsE"
FT                   /locus_tag="BL05029"
FT   CDS_pept        503674..504429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsE"
FT                   /locus_tag="BL05029"
FT                   /product="putative hydrolase YcsE"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism, Biological Process:
FT                   metabolism, Molecular Function: hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL05029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22095"
FT                   /db_xref="GOA:Q65NB1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NB1"
FT                   /protein_id="AAU22095.1"
FT                   /translation="MSVSQRNRIDVKLVALDMDGTLLNDEQTISDENRKAIKEAEEKGV
FT                   YVVLSTGRTLMTCRELAESLELSSFLITANGSEIWDSSFNLVERQLLHPDHVQMMWDLR
FT                   NLHNTDFWAASVDKVWRGEFPEDIQAYEWLKFGFDIPDDDVRNRVLEELKKNKELEVTN
FT                   SSPTNIEVNAIGINKAAALAKVCERLGFTMEHVMAVGDSLNDIAMIKEAGLGVAMGNAQ
FT                   EIVKETADWITDSNIEHGVAKAIRHWVLS"
FT   gene            504716..505477
FT                   /gene="ycsF"
FT                   /locus_tag="BL02806"
FT   CDS_pept        504716..505477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsF"
FT                   /locus_tag="BL02806"
FT                   /product="putative lactam utilization protein YcsF"
FT                   /db_xref="EnsemblGenomes-Gn:BL02806"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22096"
FT                   /db_xref="GOA:Q65NB0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NB0"
FT                   /protein_id="AAU22096.1"
FT                   /translation="MNQVDLNCDLGESFGAYKIGLDEEILEFVTSANIACGFHAGDPGV
FT                   MRKTVKMAAEKGVKIGAHPGLPDLAGFGRRNMAITPEEAYDLVVYQIGALSGFLKAEGV
FT                   TMQHVKPHGALYNMAAQSRELSDAIARAVYQTDPELILFGLAGSELVLAGERAGLKTAH
FT                   EVFADRTYQEDGTLTSRRQNDALIQDDDEAVGQVIRMVKEGKVRSLQGTDVSLKADTVC
FT                   IHGDGAHALHFAKKIRRELRAADIKVQAFST"
FT   gene            505502..506713
FT                   /gene="ycsG"
FT                   /locus_tag="BL02807"
FT   CDS_pept        505502..506713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsG"
FT                   /locus_tag="BL02807"
FT                   /product="putative branched chain amino acids transporter
FT                   YcsG"
FT                   /db_xref="EnsemblGenomes-Gn:BL02807"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22097"
FT                   /db_xref="GOA:Q65NA9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NA9"
FT                   /protein_id="AAU22097.1"
FT                   /translation="MKQNKKTKAPAGNWTLLLGAAFLMATSAIGPGFLTQTTVFTQSLA
FT                   ASFGFVILVSIILDIFAQTNVWRIIAVSEKRGQEIANLVLPGLGYFIAFLVVLGGLAFN
FT                   IGNIGGAGLGMQVLFGISPQMGAIISAVIAILIFVIKEAGKAMDRFTLIAGFVMILLTV
FT                   YVAVTTGPPVGEAITKTVMPDNIDYLAIITLVGGTVGGYITFAGGHRLLDAGVKGKDAI
FT                   PEVTKSSVSGILITSVMRIALFLAVLGVVSKGMQINPDNPPASVFQHAAGNVGYKIFGL
FT                   VMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIVFIIVSTLCFVTIGKPVNLLVL
FT                   AGALNGLILPIALGSLLIGAHKKNVIGDYRHPIWLTIPGILVVIVMAIMGGYTLINEIP
FT                   KLWG"
FT   gene            506719..507507
FT                   /gene="ycsI"
FT                   /locus_tag="BL02808"
FT   CDS_pept        506719..507507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsI"
FT                   /locus_tag="BL02808"
FT                   /product="conserved protein YcsI"
FT                   /db_xref="EnsemblGenomes-Gn:BL02808"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22098"
FT                   /db_xref="GOA:Q65NA8"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA8"
FT                   /protein_id="AAU22098.1"
FT                   /translation="MHVNEMRPDEVRALIRKGEITGPTAGMAGGFTQANLVILKKELAF
FT                   EFLLFCQRNQKPCPILDVTDPGSPVPSITAPDADIRTDFPKYRVYKRGELADEVTDISS
FT                   LWEDDMVGFLIGCSFTFEQALMNNGIPVRHIEEKRNVPMYQTNIPCVPAGRFQGPMVVS
FT                   MRPVPEEQAVRAVQVTSRLPAVHGGPVHIGSPEAIGITDIAKPDFGDAVTIKKGEVPVF
FT                   WACGVTPQAVAMHARPELMITHSPGHMLVTDVRDEQFGVL"
FT   gene            507585..508319
FT                   /gene="kipI"
FT                   /locus_tag="BL02809"
FT   CDS_pept        507585..508319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipI"
FT                   /locus_tag="BL02809"
FT                   /product="kinase inhibitor KipI"
FT                   /function="inhibition of the autophosphorylation reaction
FT                   of KinA"
FT                   /db_xref="EnsemblGenomes-Gn:BL02809"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22099"
FT                   /db_xref="GOA:Q65NA7"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NA7"
FT                   /protein_id="AAU22099.1"
FT                   /translation="MKNLSNATMSPLGDSAVIIQLGEGISEQTHRVVSALTKRIENDPF
FT                   PGFIECVPAFTSVTVFYQPFEVYRKMESGKAVDSPYEKVKALLDHHLQELTMEEETDQR
FT                   TVEIPVCYGGRFGPDLEEVADINGLTAQEVIDIHTSGEYLVYMIGFAPGFPYLGGMSEK
FT                   IAAPRRSSPRTSIPAGSVGIAGMQTGVYPLSTPGGWQLIGNTPLELFKPYEQPPSLLRA
FT                   GDIVKFVSVTEEEYHALKEGKS"
FT   gene            508316..509329
FT                   /gene="kipA"
FT                   /locus_tag="BL02810"
FT   CDS_pept        508316..509329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipA"
FT                   /locus_tag="BL02810"
FT                   /product="KipA"
FT                   /function="antagonist of KipI"
FT                   /db_xref="EnsemblGenomes-Gn:BL02810"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22100"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q65NA6"
FT                   /protein_id="AAU22100.1"
FT                   /translation="MSIEVLKPGLMTTVQDLGRTGFQKYGVLVSGAMDADSLRIANLLA
FT                   GNSQNEAALEVTLMGPGPSLRFQKPALIAVTGADFSLMVNDEEVPLWRPVFIKEGSVLT
FT                   FGMCKRGSRAYMAVAGGIDVPPVMESKSTYVRAGLGGFQGRALQKGDVLSLGSPTPLSE
FT                   ALHRKLADEGKERGFAAPKWAVDRKYFLPLKKNPVIRVIKGDQFACFTSSSQERFFAGP
FT                   FRVTAKSDRMGYRLQGEALELTQPLEMISEAVSFGTIQVPPDGNPIVLLADRQTAGGYP
FT                   RIAHIASADFSQVTQMMPGEQVQFQLVSLQEAERVYIERETKISELSARLKLEYML"
FT   gene            509361..510110
FT                   /gene="kipR"
FT                   /locus_tag="BL02811"
FT   CDS_pept        509361..510110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipR"
FT                   /locus_tag="BL02811"
FT                   /product="transcriptional regulator KipR"
FT                   /function="regulator of the kip operon"
FT                   /db_xref="EnsemblGenomes-Gn:BL02811"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22101"
FT                   /db_xref="GOA:Q62YQ7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YQ7"
FT                   /protein_id="AAU22101.1"
FT                   /translation="MEHKNKTVVKAMTLLNLFLTRERLSLGDMIELTGMPKTSVYRMVC
FT                   SLEEMGFLDRDENGMYSLGLLFLQYGHLVSERLDIRKIALPIMEELRDDVDEAVHLIVR
FT                   QGNEAMYIEKIEGTQTVRLYTAIGRRSPLYAGACARSILTFLPEEERDAYIEQTELVPI
FT                   ASGTIRDKAELIRIVDESYRSGCTVSHSELEDYTSAIAAPIFNHKREVAAGISIAGFEA
FT                   RFQKDRLPYLTERVKKAALDISRKLGF"
FT   gene            510199..510837
FT                   /gene="ycsK"
FT                   /locus_tag="BL02812"
FT   CDS_pept        510199..510837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsK"
FT                   /locus_tag="BL02812"
FT                   /product="Lipolytic enzyme, G-D-S-L"
FT                   /function="Molecular Function: catalytic activity"
FT                   /note="Lipase/Acylhydrolase with GDSL-like motif"
FT                   /db_xref="EnsemblGenomes-Gn:BL02812"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22102"
FT                   /db_xref="GOA:Q65NA4"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA4"
FT                   /protein_id="AAU22102.1"
FT                   /translation="MTLQYTALGDSLTVGVGAGLFEPGFVQRYKRKMEEDLNEEVSLIV
FT                   FAKSGLETSEILAMLNEPFIMEQVKKADVITITGCGNDLLQSLEIYEKEKDEHVFLEAS
FT                   SHCQKNYSGMLEKIREIKGEKDTRYLVRLLNLYNPFPSIELADKWISGFNRHLKQLESA
FT                   PQIKVIDTYAVFKGREKEYLSIDRVHPSSRGYEAMSEKLRAAGYGRLEG"
FT   gene            511082..513013
FT                   /pseudo
FT                   /gene="mtlA"
FT                   /locus_tag="BL02813"
FT                   /note="frameshift or internal stop,authentic frameshift"
FT   gene            513010..514149
FT                   /gene="mtlD"
FT                   /locus_tag="BL02815"
FT   CDS_pept        513010..514149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BL02815"
FT                   /product="mannitol-1-phosphate dehydrogenase"
FT                   /function="Molecular Function: catalytic activity,
FT                   Biological Process: metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02815"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22103"
FT                   /db_xref="GOA:Q65NA1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA1"
FT                   /protein_id="AAU22103.1"
FT                   /translation="MIALHFGAGNIGRGFIGALLCKSGYDVVFADVNDAVINELNDKGR
FT                   YTVEMADAGRKQETIGPVRAINSATQLDELYDLIAKADLVTTAVGPAVLKLIAEPIAEG
FT                   LKRRMKINKQPLNIIACENMIGGSAHLREEIFARLTETERAAISDSVGFPNSAVDRIVP
FT                   IQHHDDPLKVTVEPFFEWAVDQTEFAGKVPDIEGVTYVADLAPFIERKLFTVNTGHAMA
FT                   AYAGYKKGLKTIKDAIHHPEVRQTVAGALEETGRYLVQTYDFTQEEHRAYMTKIIGRFE
FT                   NECLSDDVTRVARSPLRKLGRDDRLVGPARKLCDLGFEPVRLAEGIALALQFDCADDPE
FT                   AVQLQSMIAEKGYAGVLRDVCGLEEDHSLFKLVISHLKA"
FT   gene            514460..516508
FT                   /gene="mtlR"
FT                   /locus_tag="BL02816"
FT   CDS_pept        514460..516508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="BL02816"
FT                   /product="transcriptional regulator MtlR"
FT                   /function="positive regulation of the mannitol operon
FT                   (mtlAD)"
FT                   /note="BL02816 similar to mtlR from Bacillus subtilis, name
FT                   change PiRa"
FT                   /db_xref="EnsemblGenomes-Gn:BL02816"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22104"
FT                   /db_xref="GOA:Q62YQ4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YQ4"
FT                   /protein_id="AAU22104.1"
FT                   /translation="MKYLLHQNRYVKVNEIAGYIEVSTRTVHRELKAVKSVLDKYRLQL
FT                   DKQPGKGLKLVGAYRDKQRLLEDLSRDSHVEYSADERKLLILCAMLETGEPIKLYTIAH
FT                   DLQVTAATISNDLDELEKWIAPFGLSLIRKRGYGIELRGPEDAKRKIVGNLMADKLDVQ
FT                   QFLETIEMNIKGKNEAPEKIFGVVSRGKLLKAEKVLFQMKEKYGLSLSDSAYIALVVHL
FT                   TFAIERIQLGEMINMNEEELTDLKRTKEFELALALAKALEDAFHVKIPEAEAGYITMHL
FT                   RSANKSFKIDYRAEDIELDTALRTKKLIDFISQKTGMNLTGNHSLYEGLIAHLEPAIIR
FT                   IKEKMSVHNPLTEQVKKDYFLLYMAIEEGVEIFFPEIRFPDEEIAFIVLHFGSALEMSK
FT                   QKVDINALVICSSGIGSSKMLASRLKKELPEIASFEISSLMELKTKNTDAFDIIVSTVP
FT                   IPYENIDCVTVSPLLDTEDVKQIKHQLTRKIPLILRKKRMAPKKPEPFPDMLQIARKIG
FT                   HYAAGIQHILSHFTVETMEAESSLEHTVKRICGTLEDQGLVKDAGQMADGLMKREAQGG
FT                   LGIPGTTFALFHLKSEAAAVPLFKAYDLSKPFEIKGMDGSAMKMMRMLIMLAPADLSPE
FT                   GSEILSFISSSMIESDESIKAYQTGDREQLYGMLNVLFHRFIQDKEW"
FT   gene            516621..517490
FT                   /gene="ydaD"
FT                   /locus_tag="BL02817"
FT   CDS_pept        516621..517490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BL02817"
FT                   /product="putative Short-chain dehydrogenase/reductase
FT                   YdaD"
FT                   /function="Biological Process: metabolism, Molecular
FT                   Function: oxidoreductase activity"
FT                   /note="similar to alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02817"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22105"
FT                   /db_xref="GOA:Q65N99"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N99"
FT                   /protein_id="AAU22105.1"
FT                   /translation="MDLRNQQTNGQPAQTQDRQPGIESVMNPRPIYEDENYKGTDKLKG
FT                   KVALITGGDSGIGRAVAVAYAKEGADISIVYLNEHEDAQETKARVEKEGVKCLLLPGDV
FT                   RDEAFCNDAVEQTVKELGRLDILVNNAAEQHPKDSIKEISSEQLEKTFKTNFFSYFYFT
FT                   KKAIDYLEPGSAIINTTSINPYRGNPQLIDYTATKGAINAFTRSMSQALVKDGIRVNAV
FT                   APGPIWTPLIPSTFSGEEVAKFGTDTPMGRPGQPVDHVGCYVLLASDDSSYMTGQTLHV
FT                   NGGDFITT"
FT   gene            517506..518009
FT                   /gene="ydaE"
FT                   /locus_tag="BL02818"
FT   CDS_pept        517506..518009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaE"
FT                   /locus_tag="BL02818"
FT                   /product="YdaE"
FT                   /db_xref="EnsemblGenomes-Gn:BL02818"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22106"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N98"
FT                   /protein_id="AAU22106.1"
FT                   /translation="MKVTKEDVIEYYEKAGIVLNDDDKENIQIMDYGLNKLDKLGLQLF
FT                   VYVNTDRYCAKELVLFPEQTCPEHRHPPVDKQKGKEETFRCRYGKVYLYVEGEKTEAPA
FT                   VMPPDEDIEHFTVWHEIQLTPGEQFTIPPDTKHWFKAGSEGAVVTEFSSTSTDDHDVFT
FT                   DPRI"
FT   gene            complement(518026..518409)
FT                   /locus_tag="BL02824"
FT   CDS_pept        complement(518026..518409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02824"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02824"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22107"
FT                   /db_xref="InterPro:IPR016789"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N97"
FT                   /protein_id="AAU22107.1"
FT                   /translation="MNIFISFDAEADMGYIALTERRAGSVSATDDIGDTALSADFDRHQ
FT                   RIIGVEFPGDEAPEIARLGTLTGRKYKLEPAYLNGTHVRRFRPTAQEAVKTLCVNGVQF
FT                   YFADHDGRHFIGFDVMERAKKSE"
FT   gene            518495..518917
FT                   /gene="ydaG"
FT                   /locus_tag="BL02819"
FT   CDS_pept        518495..518917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="BL02819"
FT                   /product="FMN-binding split barrel domain protein YdaG"
FT                   /db_xref="EnsemblGenomes-Gn:BL02819"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22108"
FT                   /db_xref="GOA:Q65N96"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N96"
FT                   /protein_id="AAU22108.1"
FT                   /translation="MDQQQLKNKVLDILDHHKIGSLATVESGKPHSRYMTFFHDGLTLY
FT                   TPTSDETHKAEEIDNNPNVHVLLGYNGEGLGDAYLEITGTAKLNHSKDLKDKIWDERLE
FT                   QWFDGKDDPNLTVLEIEPSEIRLMNEGESTPVTLDM"
FT   gene            519370..520179
FT                   /gene="ydaH"
FT                   /locus_tag="BL02820"
FT   CDS_pept        519370..520179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaH"
FT                   /locus_tag="BL02820"
FT                   /product="conserved membrane protein YdaH"
FT                   /db_xref="EnsemblGenomes-Gn:BL02820"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22109"
FT                   /db_xref="GOA:Q65N95"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N95"
FT                   /protein_id="AAU22109.1"
FT                   /translation="MDFLTSKVLLIFCFLLLIHSIETLAYAARLSGARVGFIASALSLF
FT                   NVMVIVSRMSNMVQQPVTGKLVDVAGADALSLVGSQFRFLIFGSTVGTIFGMLLLPTFV
FT                   AVFSRAIVHLAGENGSVLQVFRKAFSKNSFKHAKHYAKRPSLEYVKDFRFRYIPKRLFV
FT                   LNMVITAIYTIGVLAALYAGVLVPERHTTAVMASGLVNGVATMLLALFVDPKVSVLADD
FT                   VAKGKRSYTYLKWASITMAASRVAGTIFAQVLFIPASYYIAWMTKWM"
FT   gene            520344..521285
FT                   /locus_tag="BL02821"
FT   CDS_pept        520344..521285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02821"
FT                   /product="Cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:BL02821"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22110"
FT                   /db_xref="GOA:Q65N94"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N94"
FT                   /protein_id="AAU22110.1"
FT                   /translation="MERVRVRVRKPKRKRRKIIKRLFTLTLLVIIAAAGYTYFEYKKGL
FT                   SESDGDFKEDGQFEFNGEGSDLDEVNILVLGIDSRGEDHSRSDSMMVIHYNKKQKQPKL
FT                   ISIMRDSYVDIPGYDKQKVNAAYAYGGPELVRKTLKESFDLDINYYAVIDFKGFAKIVD
FT                   AVAPDGIEVDVPKKMSYGIGMTLQPGKQVLHGERLLGYVRFRHDRESDFGRVRRQQEVF
FT                   SKLQKEAVSIGNIAQLPKLWGLVDPYIETNIPNGVILSVGKDFLLGSVKETKSFRLPVD
FT                   GSFTNKDDPKYGAVLDLDLEQNKEELKRFLNE"
FT   gene            complement(521317..521610)
FT                   /gene="ydzA"
FT                   /locus_tag="BL02825"
FT   CDS_pept        complement(521317..521610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzA"
FT                   /locus_tag="BL02825"
FT                   /product="conserved membrane protein YdzA"
FT                   /db_xref="EnsemblGenomes-Gn:BL02825"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22111"
FT                   /db_xref="GOA:Q65N93"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N93"
FT                   /protein_id="AAU22111.1"
FT                   /translation="MLQTPIGRLRLMGFIEGMSLLILLFIAMPLKYWADYPMAVTIVGS
FT                   VHGGLFILYLFVLLYATFVLRWSVKWPAAGLVAAFVPFGNFLYDRGLKKYDQ"
FT   gene            complement(521694..522104)
FT                   /locus_tag="BL02826"
FT   CDS_pept        complement(521694..522104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02826"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22112"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N92"
FT                   /protein_id="AAU22112.1"
FT                   /translation="MTRINFSDRGETPFQRLLGHSESLMSSWTALAEELSGDGFLSKEL
FT                   KEQVRRVLAQGNGCEYCKAKGKPEIPNQQKTSFAMGFAEVFLAQRERVSDRQFDVLKEV
FT                   FSEEEITELTAFICFTTAQQYFGALMKLPADA"
FT   gene            522222..522650
FT                   /gene="lrpC"
FT                   /locus_tag="BL02822"
FT   CDS_pept        522222..522650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrpC"
FT                   /locus_tag="BL02822"
FT                   /product="transcriptional regulator (Lrp/AsnC family)"
FT                   /db_xref="EnsemblGenomes-Gn:BL02822"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22113"
FT                   /db_xref="GOA:Q65N91"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N91"
FT                   /protein_id="AAU22113.1"
FT                   /translation="MKIDDLDFKIIAELKKDSRLSMRELGRKISLSAPSVTERVRRLES
FT                   FGVIKKYTLDIDYQKVGLPVSCIIEATVKNGEYERFKAYIERLPNIEFCYRIAGAACYM
FT                   LKINAESLAKIEAFINETSPYAQTVTHVIFSEIETKES"
FT   gene            522718..524907
FT                   /gene="topB"
FT                   /locus_tag="BL02823"
FT   CDS_pept        522718..524907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BL02823"
FT                   /product="DNA topoisomerase III"
FT                   /function="Molecular Function: DNA binding, Molecular
FT                   Function: DNA topoisomerase activity, Cellular Component:
FT                   chromosome, Biological Process: DNA topological change,
FT                   Biological Process: DNA unwinding"
FT                   /db_xref="EnsemblGenomes-Gn:BL02823"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22114"
FT                   /db_xref="GOA:Q65N90"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N90"
FT                   /protein_id="AAU22114.2"
FT                   /translation="MDVSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDRYIVTWALG
FT                   HLVTLADPEGYGKEYQSWRLEDLPIIPEPLKLVVIKKTGKQFQAVKSQLIRKDVKDIVI
FT                   ATDAGREGELVARWIIEKAKVTKPLKRLWISSVTDKAIKDGFKNLKNGKDFENLYHSAV
FT                   ARAEADWIVGINATRALTTKFNAQLSCGRVQTPTLAMIAKREEDIKNFKPVPYFGLRAA
FT                   VDGMTLTWQDKKTSQTRTFNASVTSQLAGALQGKPAVIVDLKKTAKKSFAPGLYDLTEL
FT                   QRDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSNDIVPTLKDRLEGMQVKPY
FT                   AQHVARILKRGVKANKSFVNDAKVSDHHAIIPTEEPLALGALSEKERKLYDLIAKRFLA
FT                   VLMPPFEYEETKVFAEIGGETFTAKGKTVQSQGWKAVYDFADEDDDEEEKDQTLPKLAK
FT                   GDTLSVRSLTETKGETKPPARFNEGTLLSAMENPAAFMQGEEKNLVKTLGETGGLGTVA
FT                   TRADIIEKLFNTFLIEKKGKDIYITSKGKQLLELVPSDLKSPALTAEWEQKLSGIAKGK
FT                   LKSSAFIKEMKEYAKQTIREIKSSNQKFKHDNITGTHCPDCGKLMLKVNGKRGTMLVCQ
FT                   DRECGHRKTVAKQTNARCPVCHKRMELRGHGEGQTFACVCGHREKLSVFEKRRAKDKNS
FT                   KASKRDVHSYMKKQNKDEPINNALAEQLKKLKLDQ"
FT   gene            complement(524997..525083)
FT                   /locus_tag="BL05030"
FT   CDS_pept        complement(524997..525083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22115"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YP3"
FT                   /protein_id="AAU22115.2"
FT                   /translation="MIGIQNILMFQSDFPGRGYMNFPVFSAQ"
FT   gene            525131..525265
FT                   /locus_tag="BL05031"
FT   CDS_pept        525131..525265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22116"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YP2"
FT                   /protein_id="AAU22116.2"
FT                   /translation="MENRPALLWQGNFSEVEHSRKTKHDISIFSFALSGLRKELMYNQ"
FT   gene            complement(525461..525592)
FT                   /locus_tag="BL05032"
FT   CDS_pept        complement(525461..525592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22117"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YP1"
FT                   /protein_id="AAU22117.2"
FT                   /translation="MSSPSLLFFQYFFAQKSAEAKAPAESDFYSQVISLSLNAYEVS"
FT   gene            525595..527415
FT                   /gene="ydaO"
FT                   /locus_tag="BL00148"
FT   CDS_pept        525595..527415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="BL00148"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BL00148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22118"
FT                   /db_xref="GOA:Q62YP0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YP0"
FT                   /protein_id="AAU22118.2"
FT                   /translation="MYSAIKRFLIGKPLKSKELREQKITKTKALALLSSDALSSVAYGT
FT                   EQILIVLAAVSSAALWYSLPIAAGVMILLTALILSYRQIIFSYPHGGGAYVVSRENLGV
FT                   NPGLVAGGSLLVDYILTVAVSVSAGTDAITSAVPMLHPYHLLIAIVLVLLIMVLNLRGL
FT                   TESASILAYPVYLFVAALLILIAAGSYKLLTGQIEPAEHAAVGTPVAGLSLFLLLKAFS
FT                   SGCSALTGVEAISNAIPAFKDPAPKNAANTLAMMGILLAVLFSGITMLAFGYGITPKSE
FT                   ETVVSQIASETFGRSFLYFFIQGTTSMILVLAANTGFSAFPQLAFNLARDKYMPRMFTV
FT                   RGDRLGYSNGIIFLGIASIVLIVLFNGQTEHLIPLYAVGVFIPFTLSQTGMCLKWMREK
FT                   PDGWIAKMIINAAGAAISAVVLLILFITKFALVWPIVIFMPIVIWAFYVVKKHYTAVSE
FT                   QLRITGKPLEPIKGNIVIVPVAGVTSVVEKSVQYAKTLSDQVIAVHVSFDKEEEKKIEK
FT                   KWEALQNGVRLVTLYSSYRSLIHPLEKFLETVEAKAASYNYSVMVLVPQFIPKKSWHNI
FT                   LHNQSALLLRLRLLWKKDIVVATLPYHFKK"
FT   gene            527523..529244
FT                   /gene="ydaP"
FT                   /locus_tag="BL00146"
FT   CDS_pept        527523..529244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaP"
FT                   /locus_tag="BL00146"
FT                   /product="Pyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22120"
FT                   /db_xref="GOA:Q65N88"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N88"
FT                   /protein_id="AAU22120.1"
FT                   /translation="MANKTAGKIAAELLKEWNIDHVYGMPGDSVNEFIDELRHEENSLR
FT                   FIQVRHEETAALAAAADAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAITGQV
FT                   SSDEIGRDYFQEIGLERMFEDVALFNQQVHSAEALPDLLNQAIRTAYSQKGAAVLSVSD
FT                   DLFAEKIKRKPVYTSALYIEGDLEPKKSQLMQCAQLINQAKKPVILAGRGMKSARDELL
FT                   EFADKAAAPIIVTLPAKGVVPDRHPHMLGNLGHIGTKPAYEAMEESDLLIMLGTSFPYR
FT                   DYLPEDAPAIQLDNNPAKIGKRYPVTAGLVCDAKKGLFELTKTIERKSNRAFLESCIQH
FT                   MRKWRYEVEKDEQVATEPLKPQQVIARLEDAVADDAVLSVDVGNVTVWTARHFNMTNQD
FT                   FLISSWLGTMGCGLPGAISAKLSHPERQVVAVCGDGGFSMSMHDFPTAVKYELPIVVVI
FT                   LNNQNLGMIQYEQQEKGHVNYATALENVDYAKFAEACGGKGFSVTKHEELIPALKSAFH
FT                   SQKPSIIDVAIEDEPPLPGKISYTQAVNYSKYMIKKLVEKKELDLPPLKKSLKRIF"
FT   gene            529385..529996
FT                   /gene="chbB"
FT                   /locus_tag="BL00145"
FT   CDS_pept        529385..529996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chbB"
FT                   /locus_tag="BL00145"
FT                   /product="putative chitin binding protein"
FT                   /note="Paha thinks this maybe a GH61"
FT                   /db_xref="EnsemblGenomes-Gn:BL00145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22121"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="PDB:5LW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YN7"
FT                   /protein_id="AAU22121.1"
FT                   /translation="MYRLPKTTFSTVFILAAGLLWMSIVPQQAFAHGFIEKPGSRAALC
FT                   SEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQIASAGGLFGGILDQQSENRWFKH
FT                   IMTGGEHTFTWTYTAPHNTSQWHYYITKKGWDPDKPLKRADFELIGAVPHDGSPASRNL
FT                   SHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVDLVNK"
FT   mobile_element  complement(530099..531383)
FT                   /mobile_element_type="insertion sequence:IS3Bli1 Insertion
FT                   Element 1"
FT                   /note="2 CDS may encode single transposase due to ribosomal
FT                   slippage"
FT   gene            complement(530136..530996)
FT                   /locus_tag="BL00144"
FT   CDS_pept        complement(530136..530996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00144"
FT                   /product="putative transposase, part of IS element"
FT                   /function="Molecular Function: DNA binding, Biological
FT                   Process: DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:BL00144"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22122"
FT                   /db_xref="GOA:Q62YN6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YN6"
FT                   /protein_id="AAU22122.1"
FT                   /translation="MEPRVIVQVVEELSATFKIIDILGVLGIPKSTYYRWKKKYKKVEL
FT                   TSLEELVIKLCKKNFYHYGHRKIKSILNRKYGINVNRKTVQKIMQKFEIQCQVKKKRQK
FT                   YICGESNIIVPNTLNRNFKASRLNEKWVTDITYLPYGSTMLYLSTIMDLYNNEIVAYKI
FT                   GTSQDINLVLDTLREAVELRKPVGLLLHSDQGSVYTSHAYQNLAKEKGITTSMSRKGNC
FT                   HDNAVIESFHSSLKSEGFNAQSRASISNSKVVQIVNQYMYRYNHVRIQAKLNYLSPLEY
FT                   RGQAA"
FT   gene            complement(530966..531298)
FT                   /locus_tag="BL00143"
FT   CDS_pept        complement(530966..531298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00143"
FT                   /product="putative transposase, part of IS element"
FT                   /db_xref="EnsemblGenomes-Gn:BL00143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22123"
FT                   /db_xref="GOA:Q65K39"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q65K39"
FT                   /protein_id="AAU22123.1"
FT                   /translation="MGTRVHYAEEVKWEVIKMKQAGMTNKEIMEQLGIKNKTQIKTWMR
FT                   WYKTGQTYRFSQQVGKQYSYGKESEEMSELEELKLKNKQLEAQLAIIKKYQEIERSWSH
FT                   ESLSKL"
FT   gene            complement(531411..531662)
FT                   /locus_tag="BL00142"
FT   CDS_pept        complement(531411..531662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22124"
FT                   /db_xref="GOA:Q65N84"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N84"
FT                   /protein_id="AAU22124.2"
FT                   /translation="MKVFILFYLWIVPLVIGLIFFRVTQRTSFKKRFYPGYIMIVLAAA
FT                   VFAVCYLIGQPYLGNFFGGTMLFGTLLPFMAAAMKKKK"
FT   gene            complement(531734..532285)
FT                   /gene="ydaF"
FT                   /locus_tag="BL00141"
FT   CDS_pept        complement(531734..532285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BL00141"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /function="Molecular Function: N-acetyltransferase
FT                   activity"
FT                   /note="acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:BL00141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22125"
FT                   /db_xref="GOA:Q65N83"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N83"
FT                   /protein_id="AAU22125.1"
FT                   /translation="MFKLMVRDDLYLKMLEPKDARAVYMQIQQSKDVLRKWLFWVDGTK
FT                   QLEDTEAFIEESMKQAAANNGFQAGIWHQGQFAGIIGLHYINWINRTTSIGYWLGEPFQ
FT                   GKGMMTDACRALIDTLFSEYDLNRIEIRAAVQNVKSQAIPERLGFTKEGCLRQCEWLHD
FT                   HFADHFVYGLLKEEYEARSK"
FT   gene            complement(532340..533620)
FT                   /gene="mntH"
FT                   /locus_tag="BL00140"
FT   CDS_pept        complement(532340..533620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BL00140"
FT                   /product="manganese transporter"
FT                   /function="manganese uptake, Molecular Function:
FT                   transporter activity, Biological Process: transport,
FT                   Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22126"
FT                   /db_xref="GOA:Q65N82"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N82"
FT                   /protein_id="AAU22126.1"
FT                   /translation="MVSHDLSKHSQISKEAQDALDGKSKGFKRLLPFLGPAFIAAIAYI
FT                   DPGNFATNIAAGSKYGYLLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP
FT                   VSIGLWIQGELVVIATDLAEFIGAALGLYLLFGIPMLEASIIAAAGSFAILELQRRGVR
FT                   PLEAAITGMLFIVVIAFAFQTFFAKPDIGSVLEGMFVPRFDGADSILLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGKTEAEKKKIFRFEFIDILIAMLIAGAINASMLIVAAALFYKNG
FT                   IFVEDLDVAFSHFSSMVSPLSAVLFGVGLLTAGLSSSSVGTLSGDIIMQGFINFRIPLY
FT                   LRRFITILPPIAIIASGVNPTTALVLSQVVLSFGIAFALIPLILFTSNKRIMGSLKNAK
FT                   WITAVSWLIAALIVALNIFLIYDTFSG"
FT   gene            complement(533803..534051)
FT                   /gene="ydaS"
FT                   /locus_tag="BL05035"
FT   CDS_pept        complement(533803..534051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BL05035"
FT                   /product="Transglycosylase-associated protein"
FT                   /function="Cellular Component: integral to membrane"
FT                   /note="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22127"
FT                   /db_xref="GOA:Q65N81"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N81"
FT                   /protein_id="AAU22127.2"
FT                   /translation="MLGFLVSLIVAIVIGLIGGAIGGHGAPGSMVIGFIGAWIGHGLFG
FT                   TWGPDIAGFAIFPAIIGAAILVFILNLIFRGRMGSQA"
FT   gene            complement(534147..535568)
FT                   /gene="ansB"
FT                   /locus_tag="BL02922"
FT   CDS_pept        complement(534147..535568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="BL02922"
FT                   /product="L-aspartase AnsB"
FT                   /function="Biological Process: aspartate metabolism,
FT                   Molecular Function: aspartate ammonia-lyase activity"
FT                   /note="BL02922 similar to ansB from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02922"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22128"
FT                   /db_xref="GOA:Q65N80"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N80"
FT                   /protein_id="AAU22128.1"
FT                   /translation="MDTKATRIEKDFLGEKEVPVDAYYGVQTMRAVENFPITGYQIDEE
FT                   LIKALAMVKKAAALANMDIKRLYKELGEVIVKAAGEIAEGLWHEHFIVDPIQGGAGTSM
FT                   NMNTNEVIANRGLELLGKEKGDYFHLSPNTHVNMAQSTNDVFPTAIHLATLNHLKRLLS
FT                   TMEHMLDAFRKKAAEFDSVIKMGRTHLQDAVPIRLGQEFEAYSRVIERDIQRIRQSQHH
FT                   LYEVNMGATAVGTGLNADPRYIQNVVAHLSDISGYQLTGADHLVDATQNTDAYTEVSAA
FT                   LKVGMMNMSKIANDLRLMASGPRAGLAEIRLPPRQPGSSIMPGKVNPVMPELMNQIAFQ
FT                   VIGNDNTICLASEAGQLELNVMEPVLVFNLLQSIKIMNNGFRVFTDYCITGIEANEIRL
FT                   KEFVEKSVGTITAVNPHLGYEAAARIAKEAIATGRSVRELCLLHDVLTEEELDLILDPY
FT                   EMTHPGIAGASLLEE"
FT   gene            535877..537061
FT                   /gene="yojK"
FT                   /locus_tag="BL02924"
FT   CDS_pept        535877..537061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojK"
FT                   /locus_tag="BL02924"
FT                   /product="Glycosyl Transferase Family 1"
FT                   /function="Molecular Function: transferase activity,
FT                   transferring hexosyl groups, Biological Process: antibiotic
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BL02924"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22129"
FT                   /db_xref="GOA:Q62YM9"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YM9"
FT                   /protein_id="AAU22129.2"
FT                   /translation="MGHVLMINFPGEGHINPSIGVTKELQRRGESIVYYAVEEYAEKIK
FT                   KTGAEVRLYPDFREVLSPGKKKEKMDFAEVVYNMSSKVNEIVQFIYREVKSESYDYVIY
FT                   DHHFLAGKIIAEMLELPSVSLCTTFAMDEQFAKTFTPQGDLESSPYFEKLKGSLGELSE
FT                   RYPVSLDKPFDVFSCPGDITIVFTSRAFQPHAERFGSDYLFVGPSIASRQDPGSFPFAE
FT                   LEGETVIVISMGTIFNQQKELYHMCIEALKDFDGKVVMSVGKSTDPRDLGSIPDHFIVR
FT                   PYIPQLEVLKQADVFVTHGGMNSTNEGLYFDTPLIVIPMGADQFFVADQVERTGAGIKL
FT                   DKNELSPAVLQKTIKDMLENRSYKDDAAKIGRSLRNAGGYQKAADAVLELAGRK"
FT   gene            complement(537087..537533)
FT                   /gene="ydaT"
FT                   /locus_tag="BL02921"
FT   CDS_pept        complement(537087..537533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /locus_tag="BL02921"
FT                   /product="conserved protein YdaT"
FT                   /db_xref="EnsemblGenomes-Gn:BL02921"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22130"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N78"
FT                   /protein_id="AAU22130.1"
FT                   /translation="MPWSMEDYPASLKHLDKPVKKKAIEIANAMVDEGYDESRAIPIAT
FT                   SQAKEWADNRSKSELKSYAEKADETKRGDSGSSSRPELAEKCEHVIKHEKGWAVKAEDA
FT                   KRASEVKDTKAEAVERAKEIAENKGTAVVVHKKDGSVERKIRMN"
FT   gene            537652..538476
FT                   /gene="ydbA"
FT                   /locus_tag="BL02923"
FT   CDS_pept        537652..538476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BL02923"
FT                   /product="YdbA"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL02923"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22131"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N77"
FT                   /protein_id="AAU22131.1"
FT                   /translation="MRYDKTDLENELKKIEKWEKEQQKAWFWERIGRLPFKVLDKLTPA
FT                   FIQDKIGLLLDEIGGFIQNGGQYLTSEKHLIRQFQKKLPDETIETIEDIQWAPLEVMDQ
FT                   ICENLGKNRANTAAVQGATTGVGGLFTLAVDIPAILGLSLKTLQDIAVSYGYDPKEKTE
FT                   RMFIIKCLQLSAADIVGKRAIIQELSRYHQPSGSRENMISQIQGWREVVYTYRDSFGWK
FT                   KLFQMVPVAGILFGAISNRSMVNGVAETGMMMYKKRRIMERLAELDATETEG"
FT   gene            complement(538516..539805)
FT                   /locus_tag="BL05036"
FT   CDS_pept        complement(538516..539805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05036"
FT                   /product="Na+/H+ antiporter"
FT                   /function="Biological Process: sodium ion transport,
FT                   Biological Process: regulation of pH, Molecular Function:
FT                   sodium:hydrogen antiporter activity, Cellular Component:
FT                   integral to membrane"
FT                   /note="BL05036 similar to nhaC from Bacillus subtilis,
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BL05036"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22132"
FT                   /db_xref="GOA:Q65N76"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N76"
FT                   /protein_id="AAU22132.1"
FT                   /translation="MQNQNGKASGLLPLFLFVCLFVGSGLITGDFYSLPIVAAALAASV
FT                   VSLAMNRKEKLSQKTEWFAKGAGHPDIMIMVMIFILAGAFSSAAKAMGAVESTVNLALS
FT                   FVPGQFMVAGLFIIAAFISVSMGTSTGTIAALAPIAAGISAEIGVPAAYSVAAVVGGAM
FT                   FGDNLSFISDTTIAAVRTQKTKMSDKFKTNFLIVLPAAVATVILLMVFSAGGHPGAQAG
FT                   TYSWVKVLPYLGVLIFALLGFNVMAVIFGGIVLAGVIGISDGSLTLHTYLTAITEGIGG
FT                   MSELIILSLLIGGMAEMMKRNGGIAFLLQFVSRRIRSKKGAEAGIAGLVSAANLATANN
FT                   TIAIITAGPLAKDLSDRYGIDNRKSASILDIFSCAVQGLIPYGAQMLSAAQIAKISPIS
FT                   ILPYSFYPILIGVCGICAIIFRLPRFTEKA"
FT   gene            539934..540650
FT                   /gene="ydbB"
FT                   /locus_tag="BL05037"
FT   CDS_pept        539934..540650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BL05037"
FT                   /product="conserved protein YdbB"
FT                   /note="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22133"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N75"
FT                   /protein_id="AAU22133.1"
FT                   /translation="MDRKTNLLELTKEVAEKHANFLVSEVNDHCMRIAVLEGEYVWHIH
FT                   PGSDELFIVLEGELLIDFQDRPTEVLKANDSLLIPKGVIHRTRADVRSVNLCIEKTNAE
FT                   TVPFAEGNVLKLIRCKSAEQKLQAFSEAQAKWAPLQNVSGFIRQWGGWMETEDGPEAVV
FT                   LALWKSKHDYLNFMAEHHDEIYERTHQKGTFESINITLFEDPAEISETLQNNTPAPVPE
FT                   WTVMGSGRLRDPHSLS"
FT   gene            540725..541165
FT                   /gene="gsiB"
FT                   /locus_tag="BL05038"
FT   CDS_pept        540725..541165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BL05038"
FT                   /product="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22134"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N74"
FT                   /protein_id="AAU22134.1"
FT                   /translation="MANNNDDNKMSREEAGRKGGEKTSQNHDKEFYQEIGQKGGEATSQ
FT                   NHDKEFYQEIGEKGGEATSRNHDKEFYQEIGEKGGEATSRNHDKEFYQEIGEKGGEATS
FT                   KNHDKEFYQEIGKKGGEATSRNHDKEFYQENGEKGGRQRRSG"
FT   gene            541387..542427
FT                   /gene="ydbI"
FT                   /locus_tag="BL05039"
FT   CDS_pept        541387..542427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /locus_tag="BL05039"
FT                   /product="conserved membrane protein YdbI"
FT                   /db_xref="EnsemblGenomes-Gn:BL05039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22135"
FT                   /db_xref="GOA:Q65N73"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N73"
FT                   /protein_id="AAU22135.1"
FT                   /translation="MAALIKFFQHPGVRRFSVFVVLAGVLYLFRSMMNLILLTFIFTFL
FT                   MNRLENVIRGFLNRFIKVSQRLIISCLYAALAIALSIGGVVYYPVIVTQIQQLIKQGKH
FT                   IASHPDSIPFLDMITGMFGDINLTSYLEKGLNFIYTYITDISTFGLQVVMSLVLSMFLL
FT                   IEKDKVMSLMDKFKTSKIAIFYEEIAYFGKKFTRTFGKVLEAQFIIATINCALTTIALA
FT                   IMGFPQLFGLAVMVFFLGLVPVAGVVLSLIPLSIIAYSIGGIAYIVSLVLVIMIVHAIE
FT                   AYFLNPKLMSAKTELPIFFTFIVLIFSEHFIGIWGLIIGIPIFVFLLDILDVTNQEKNR
FT                   TAGTRK"
FT   gene            542715..543959
FT                   /locus_tag="BL02188"
FT   CDS_pept        542715..543959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02188"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /note="BL02188 similar to gltT from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22136"
FT                   /db_xref="GOA:Q65N72"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N72"
FT                   /protein_id="AAU22136.2"
FT                   /translation="MKLATKIIIALLLGAVVGIILNVTSPDLFSKLNTFLFGPLGTIFL
FT                   NLIKMLVVPIVFFSLTLGVAGLGDPKKLGRIGAKTISFFLITTAIAIIIGLVLALVIKP
FT                   GTIGTYDTSAAEYSAQKAPSISDTLLNIIPTNPVQAMAEGNMLQIIAFSILVGLGITML
FT                   GKKADALLKVVEQGNDLMMYLVNLVMKFAPYGTFGLIAGAIGSQGWDAIKAMGLYMIVV
FT                   ILALFIHTIVTYGAAIALLAKRNPLTFFKDFSEVMLVAFSTSSSNATLPVSMDVAQRKL
FT                   KVPEPISSFVQPLGATINMDGTAIMQGVATVFIAQVYGNDLSLTQLLMVVLTAVLASIG
FT                   TAGVPGVGLIMLAMVLQTVGLPVEGIALILGIDRLLDMIRTAVNTTGDAACAVIVTETE
FT                   KKHGKIEAPHSEVSV"
FT   gene            544029..544955
FT                   /gene="ydbJ"
FT                   /locus_tag="BL02189"
FT   CDS_pept        544029..544955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BL02189"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="probable ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22137"
FT                   /db_xref="GOA:Q65N71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N71"
FT                   /protein_id="AAU22137.1"
FT                   /translation="MTKQPVLHIENVDKIIDGKTILKDIRLTADEGEIIGLLGPNGSGK
FT                   TTLIKLITGLIKMKSGSIVINGFPIDRQFEKAIQSVGAIVENPEFYPYLTGYENLKHYA
FT                   NMHAGIGRERLEEVISRVGLEDAAEDKVKTYSLGMKQRLGIAQAILHRPKLLILDEPTN
FT                   GLDPAGMKDFREHLRELAEEEGTAILFATHLLKEVEDLCDRVVILQKGKIKSTVVLNQA
FT                   DEKQEKAMLEVQPHDKALQWLKDQGYEARTEKGLLAVKVEKAQIPALNQQLVANDIDVY
FT                   SIAPFKQSLEDEYMARTNGIEERNADV"
FT   gene            544948..545715
FT                   /gene="ydbK"
FT                   /locus_tag="BL02190"
FT   CDS_pept        544948..545715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbK"
FT                   /locus_tag="BL02190"
FT                   /product="probable ABC transport system permease protein
FT                   YdbK"
FT                   /db_xref="EnsemblGenomes-Gn:BL02190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22138"
FT                   /db_xref="GOA:Q65N70"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N70"
FT                   /protein_id="AAU22138.2"
FT                   /translation="MFKLIQNEHVKLLKRKVTFVSLALIVVFQFLLALITKRILMGAGA
FT                   EDHFIGYFSFTPNLNILLQGLSIVVAASIISFEYDKKTIKFLLIRPVRREKILVSKYVT
FT                   SVLASIWLFIIYYGFSILFGLLFFGVKLDEKAEPLFINTVKMIGTQWFEVWMMVSFAFL
FT                   CSALFKSSALSIMVSIVVLYGAKMLVTIMAYLEKPLGKFLLFANTDLTQYAGEAKPLFA
FT                   GMTPLFSLFIVFIHLVFFLGTAWWGFCKRDMKV"
FT   gene            545833..546171
FT                   /gene="ydbL"
FT                   /locus_tag="BL02191"
FT   CDS_pept        545833..546171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbL"
FT                   /locus_tag="BL02191"
FT                   /product="YdbL"
FT                   /db_xref="EnsemblGenomes-Gn:BL02191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22139"
FT                   /db_xref="GOA:Q65N69"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N69"
FT                   /protein_id="AAU22139.1"
FT                   /translation="MKKFITALPIVLLLSFSFVSFAFNFDHLVYFRLALGLFSLAGLFL
FT                   LYKLKNGVRLFMAYLYGSWIVLAGIAAYEEPLFSDFFFGGLTITMGYLTYMLIYLGMKV
FT                   DRRGGQAV"
FT   gene            546296..547444
FT                   /gene="ydbM"
FT                   /locus_tag="BL02192"
FT   CDS_pept        546296..547444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbM"
FT                   /locus_tag="BL02192"
FT                   /product="putative Acyl-CoA dehydrogenase YdbM"
FT                   /note="similar to butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BL02192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22140"
FT                   /db_xref="GOA:Q65N68"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N68"
FT                   /protein_id="AAU22140.1"
FT                   /translation="MCSIFVKTERQQEWLDKIGKLADEFEKTAAYYDEHAQFPAEHIQK
FT                   LRDSGYTALTVGKDYGGEGISLYDMLLFQERLAKGDGPTALSIGWHLSVMGELAEGNSW
FT                   DRDVFSSLSHEALKGALINRAASEAQTGSPTRGGRPGTHAVKKNGGWIVNGRKTFTTMS
FT                   PVLDYFLVTAWIEEKQMIGVFLIHKDAEGLAIEETWDMAAMRGTGSHDLVLTDVRLDES
FT                   MLVELLAGKRTDKINGWLLHIPAVYLGIAQAARDYAVQFAKDYQPNSLKGPIKEVPAVQ
FT                   RHIGEIDLELMKARHFMYHVAELYDDPERRALLTGELGAVKHTVTNTAIDVVDKAMRVV
FT                   GAKSLARTNPLQRFYRDVRAGLHNPPMDDATIAKLAGIAFSE"
FT   gene            complement(547518..547673)
FT                   /gene="ydbN"
FT                   /locus_tag="BL02212"
FT   CDS_pept        complement(547518..547673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbN"
FT                   /locus_tag="BL02212"
FT                   /product="small antisense RNA YdbN"
FT                   /note="similar to B.subtilis ydbN;induced under low iron
FT                   conditions;inhibits translation of sdh -succinate
FT                   dehydrogenase-RamB"
FT                   /db_xref="EnsemblGenomes-Gn:BL02212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22141"
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N67"
FT                   /protein_id="AAU22141.1"
FT                   /translation="MSKRKIKTFHQLVEEYKKEIAKNPKEMEVIYDKIDRRHENRLLAI
FT                   SKAKQT"
FT   gene            complement(547676..547834)
FT                   /locus_tag="BL05040"
FT   CDS_pept        complement(547676..547834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22142"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YL6"
FT                   /protein_id="AAU22142.2"
FT                   /translation="MAPQLKKAVEMRKKQLIQRLIQLGIYKKEERHLYELSLSELESEY
FT                   QSIKKGG"
FT   gene            complement(548250..548570)
FT                   /gene="ydbP"
FT                   /locus_tag="BL02213"
FT   CDS_pept        complement(548250..548570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbP"
FT                   /locus_tag="BL02213"
FT                   /product="putative thiredoxin protein YdpP"
FT                   /function="Molecular Function: electron transporter
FT                   activity, Biological Process: electron transport"
FT                   /note="similar to thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BL02213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22143"
FT                   /db_xref="GOA:Q65N66"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N66"
FT                   /protein_id="AAU22143.1"
FT                   /translation="MKKITTEAQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEA
FT                   YQENDWYELNKDDLPELADKYQVMGIPSLLIFKNGEKTGHLHSANAKTPEEVNEFLAEH
FT                   IS"
FT   gene            548731..549816
FT                   /gene="ddl"
FT                   /locus_tag="BL02193"
FT   CDS_pept        548731..549816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BL02193"
FT                   /product="D-alanyl-D-alanine ligase A"
FT                   /function="Cellular Component: cytoplasm, Molecular
FT                   Function: D-alanine-D-alanine ligase activity, Biological
FT                   Process: peptidoglycan biosynthesis"
FT                   /note="RBL03284"
FT                   /db_xref="EnsemblGenomes-Gn:BL02193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22144"
FT                   /db_xref="GOA:Q65N65"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N65"
FT                   /protein_id="AAU22144.1"
FT                   /translation="MKTRLGLVYGGKSAEHNVSLQTALAVTKALDTEKFDIHPIYITEK
FT                   GEWVRGPQLTEPVSNVKMLQFEQTGQTFSPAVLNRDMFPGEADAKEDSIDVVFPLLHGP
FT                   NGEDGTIQGMLELLNVPYVGNGVLASSAGMDKVVMKHLFAQAGLDQAKYVSFLKKTWSQ
FT                   SKEECYAQVEGELGYPCFVKPANLGSSVGISKCRSREELDQAFELAFQYDRKIVVEEGV
FT                   IGREIELGVLGNDEPVCSVAGEIAPKKDFYDYKAKYEDGDTDLIIPASLTEDEYETMRS
FT                   MAVKAFQAIDGSGLVRADFFLTNEGRVLINEVNTMPGFTPFSMFPLLWKQSGVEYAELI
FT                   EKLVALAIERHEEKQQIKHTF"
FT   gene            549954..551324
FT                   /gene="murF"
FT                   /locus_tag="BL02194"
FT   CDS_pept        549954..551324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BL02194"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanine ligase"
FT                   /function="Cellular Component: cytoplasm, Molecular
FT                   Function: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanine ligase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22145"
FT                   /db_xref="GOA:Q62YL3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YL3"
FT                   /protein_id="AAU22145.1"
FT                   /translation="MITRTVKEIAEMSEGVLTNEAFEGRLIKGVSTDSRKLAKGQLFIP
FT                   LAGERFNGHVFAEQAFQEGVAAVLWNRSEPNPPEGKPVILVDDTLEALQKLAKAYRNQL
FT                   DVKVVGVTGSNGKTTTKDMIHAVLGTEYKVHKTEGNYNNHIGLPLTILAMPEDTEVAIL
FT                   EMGMSAKGEIDFLTRLARPDIAVITNIGESHLLELGSREGIAEAKLEIVNGLSKEGTLI
FT                   YVGDEPLLTERLNQPPYDTKTFGEDPAFDYQLEDMTQTEEGTAFRVRGIENGFFIPVLG
FT                   KHNVKNALAAIAAGDLLNVSRAHIAEGLTKLKVTGMRLELVKTPDGVAIINDAYNASPT
FT                   SMKAAIELVEQMKGYGKKILVLGDMLELGEGEKAFHEEIGQAVNPDSIDFLFTYGELGA
FT                   YIAKGALKHFPEHRVLHFNPEEKDSLKKTLKEKANTGDLILVKASRGMRLEDVIKDL"
FT   gene            551390..552100
FT                   /locus_tag="BL02196"
FT   CDS_pept        551390..552100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02196"
FT                   /product="Esterase/lipase/thioesterase"
FT                   /function="Molecular Function: catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02196"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22146"
FT                   /db_xref="GOA:Q65N63"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N63"
FT                   /protein_id="AAU22146.1"
FT                   /translation="MIGCLCIHGFTGAPYELEPLASHLKQTADWQVEMITLPGHGEMPV
FT                   LKGVCFQEWIACAEVELIRLLKTCDTVFLIGFSMGGMIAGYLAGKYPVSRLVLLSAAAQ
FT                   YISPGQLIQDLKNVIKDSLQGKLEDNLLYKRYKQKLTSTPVSSAFQFRKLVKMTKPALK
FT                   NLRIPVLIVQGECDAIVPVSSAYYLYETIPSEEKELCLLPESKHHVCLEENSSILFQTV
FT                   EAFLKKTPIESIKK"
FT   gene            552451..553914
FT                   /gene="ydbR"
FT                   /locus_tag="BL02197"
FT   CDS_pept        552451..553914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbR"
FT                   /locus_tag="BL02197"
FT                   /product="probable ATP-dependent RNA helicase YdbR"
FT                   /function="Molecular Function: nucleic acid binding,
FT                   Molecular Function: ATP binding, Molecular Function:
FT                   ATP-dependent helicase activity"
FT                   /note="DEAD (asp-Glu-Ala-Asp) protein with RNA dependent
FT                   ATPase activity, unwinds dsRNA, similar to B.subtils
FT                   ydbR-B.subtilis mutants show reduced growth rates-RamB"
FT                   /db_xref="EnsemblGenomes-Gn:BL02197"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22147"
FT                   /db_xref="GOA:Q65N62"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N62"
FT                   /protein_id="AAU22147.1"
FT                   /translation="MTITFQDFQLSSDLTKAIKRMGFEEATPIQAQTIPLGLANKDVIG
FT                   QAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRARVLP
FT                   IYGGQDIGRQIRALKKNPHIIVGTPGRLLDHINRRTMRLQTVNTVVLDEADEMLNMGFI
FT                   EDIESILSNVPAEHQTLLFSATMPAPIKRIAERFMTNPEHVKVKAKEMTVSNIQQFYLE
FT                   VHERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELTEALNLRGYTAEGIHGDLTQAKRM
FT                   VALRKFKQGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGM
FT                   AMTFITPREKDMLRAIEQTTKRKMDRMKAPTLDEAIEGQQQVTVDRIRTIIEENNLNFY
FT                   MTAAAELLEDHDSVTVVAAAIKMMTKEPDNTPVRLTEEAPLRTKRNKNHHHRSSKRRDG
FT                   GGYRGKNNRSSYDKKRSSNDRRQKKSYNS"
FT   gene            554028..554507
FT                   /gene="ydbS"
FT                   /locus_tag="BL02198"
FT   CDS_pept        554028..554507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbS"
FT                   /locus_tag="BL02198"
FT                   /product="conserved membrane protein YdbS"
FT                   /db_xref="EnsemblGenomes-Gn:BL02198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22148"
FT                   /db_xref="GOA:Q65N61"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N61"
FT                   /protein_id="AAU22148.1"
FT                   /translation="MRSEPKNQISRDGVKVWRITACITSFVLMLAAAGLIAAGVIFKWP
FT                   VWIGILSAAVWLGISFVIIIMIPNIRHRVWRYEVHENEIDIQHGIFVVTRVIVPMVRVQ
FT                   HVDTSQGPILRKYNLASVQISTAATTHSIPALDVEEADQLRDSISRLARVTEDDV"
FT   gene            554497..555978
FT                   /gene="ydbT"
FT                   /locus_tag="BL02199"
FT   CDS_pept        554497..555978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbT"
FT                   /locus_tag="BL02199"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22149"
FT                   /db_xref="GOA:Q65N60"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N60"
FT                   /protein_id="AAU22149.2"
FT                   /translation="MMSEPRRMHPAAVILNFIKGLVETVKNFIIPFGVVIFLNQSQTVK
FT                   MIAIAAAVLFFIALVVTSIIKWSKFTYRIEEDELRIEEGLINKKKRYIPIERIQTINTS
FT                   AGLIQQMFKLVKLQVETASGGTEAEVSLVAITQAEAERIQQALFERKKAAEDTGTDVPV
FT                   PLEETAEEAEEAEEPVMMYKMTGQELLTAASTSSGIGVIISGVFAFFTQVDDFFDLDWL
FT                   YDRFAFLNSAGAAVIALAAFVALFIAWLLSIVGMLLKYANFTVVRKEKEIVISRGLIEK
FT                   QQITIPLQRIQAIKIKESLIRQPFGLAAVTIVSAGGNVLEEDKSAILFPIISKKIINQR
FT                   LGEFIPDYAPEDDLNRLPKRALRRYILRASWPVLAVVPLSILFPPWGYLSAVLIPFYWI
FT                   IGYFSYRDAGWKISGSKIIMSSRFIGRTTAVIQRRRMQVFEVSRSYFQRRKQLVSIHTS
FT                   TKSSVLMEKFSVADVEEKDSDDIIAWYSYEKRVNG"
FT   gene            complement(555975..556574)
FT                   /gene="ydcA"
FT                   /locus_tag="BL02214"
FT   CDS_pept        complement(555975..556574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcA"
FT                   /locus_tag="BL02214"
FT                   /product="conserved membrane protein YdcA"
FT                   /db_xref="EnsemblGenomes-Gn:BL02214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22150"
FT                   /db_xref="GOA:Q65N59"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N59"
FT                   /protein_id="AAU22150.1"
FT                   /translation="MFIRTENFQTFIRLYPVTSAILALQLAIWILFLFPFTAVQMWSDL
FT                   LIGFNWGIANGEWWRFVTPIFIHAGFGHLLFNSMSIFLFAPGLERMLGKLKFLIVYIGA
FT                   GVIGNIGTYFIEPLEYMHVGASGAIFGLFGVYLYIVLFRKELMGSANSQIIVTILAISV
FT                   LMTFVNQNINMMAHIFGLLGGLALAPPLLNKRVNGF"
FT   gene            556869..557876
FT                   /gene="ydcC"
FT                   /locus_tag="BL02200"
FT   CDS_pept        556869..557876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="BL02200"
FT                   /product="conserved membrane protein YdcC"
FT                   /db_xref="EnsemblGenomes-Gn:BL02200"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22151"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N58"
FT                   /protein_id="AAU22151.2"
FT                   /translation="MRKSFVLLLTGLLVILMLSACGQKSQEDVVTGLDKKAKEYTSYKA
FT                   KAKMTIETGNEPQEYNVEIWHKKPSLYRVYLENPKKDQSQVILRNENGVFVLTPSLNKS
FT                   FRFHSDWPNNSSQVYLFESLVKDVKNDGEASFSAKDSKYIFETKTNYQHNQMLPTQEIV
FT                   FHKKTMAPSSVKVMDTDRKPMVKVEFTSFEFDKPLDKDSFDEKKNMTLSQIDVATSADV
FT                   SDSFAVKTPLDVPQGVKKLEEKEMATEDGKRIVITYGGEKSFTLIQEKARVAKTSTSVS
FT                   MNGEPVDLGFTVGALTDKSLSWTYDGVDYFISSEDLSQDELLMVAKSMQGQSSK"
FT   gene            558101..559270
FT                   /gene="alr"
FT                   /locus_tag="BL02201"
FT   CDS_pept        558101..559270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BL02201"
FT                   /product="D-alanine racemase"
FT                   /function="Biological Process: alanine metabolism,
FT                   Molecular Function: alanine racemase activity, Biological
FT                   Process: alanine metabolism, Molecular Function: alanine
FT                   racemase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22152"
FT                   /db_xref="GOA:Q62YK6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YK6"
FT                   /protein_id="AAU22152.2"
FT                   /translation="MSLKPFYRKTWAEIDLTALKENVRNMKRHIGEHVRLMAVVKANAY
FT                   GHGDAQVAKAALAEGASILAVALLDEALSLRAQGIEEPILVLGAVPTEYASIAAEKRII
FT                   VTGYSVGWLKDVLGFLNEAEAPLEYHLKIDTGMGRLGCKTEEEIKEMMEMTESNDKLNC
FT                   TGVFTHFATADEKDTDYFNMQLDRFKELISPLPLDRLMVHSSNSAAGLRFREQLFNAVR
FT                   FGIGMYGLAPSTEIKDELPFRLREVFSLHTELTHVKKIKKGESVSYGATYTAQRDEWIG
FT                   TVPVGYADGWLRRLAGTEVLIDGKRQKIAGRICMDQFMISLAEEYPVGTKVTLIGKQKD
FT                   EWISVDEIAQNLQTINYEITCMISSRVPRMFLENGSIMEIRNPILPDQS"
FT   gene            559382..559663
FT                   /gene="endoAI"
FT                   /locus_tag="BL02805"
FT   CDS_pept        559382..559663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endoAI"
FT                   /locus_tag="BL02805"
FT                   /product="transcriptional inhibitor endoAI"
FT                   /function="coexpression of ydcD with endoA reverses
FT                   toxicity caused by overexpression of endoA"
FT                   /db_xref="EnsemblGenomes-Gn:BL02805"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22153"
FT                   /db_xref="GOA:Q62YK5"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YK5"
FT                   /protein_id="AAU22153.2"
FT                   /translation="MSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKMYL
FT                   RERKNRQIRESMRRGYMEMAKINLNISSEAQFAEYEAENTVERLVSGG"
FT   gene            559668..560018
FT                   /gene="endoA"
FT                   /locus_tag="BL05041"
FT   CDS_pept        559668..560018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endoA"
FT                   /locus_tag="BL05041"
FT                   /product="putative RNase"
FT                   /note="ortholog to endoA in B.subtilis, Overexpression of
FT                   EndoA is toxic for bacterial cell growth and this toxicity
FT                   is reversed by coexpression of the gene immediately
FT                   upstream, ydcD in B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL05041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22154"
FT                   /db_xref="GOA:Q65N55"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N55"
FT                   /protein_id="AAU22154.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMEKVN
FT                   EALQISLALIDF"
FT   gene            560136..560963
FT                   /gene="rsbR"
FT                   /locus_tag="BL02202"
FT   CDS_pept        560136..560963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /locus_tag="BL02202"
FT                   /product="RbsR"
FT                   /function="positive regulation of sigma-B activity in
FT                   response to salt and heat stress"
FT                   /db_xref="EnsemblGenomes-Gn:BL02202"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22155"
FT                   /db_xref="GOA:Q65N54"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N54"
FT                   /protein_id="AAU22155.1"
FT                   /translation="MSNQAVLKFISEHQNVLAGNLADILKDLNSNMTNVKLTEHMYETI
FT                   SNEYIHILMNESGDGNEKSIDTIYQFSSKAVQLGVPLKLLSSGLSAFWKHLYYEMNKDV
FT                   PEDQQCYDLIWEIDKFIEPINSEILNQYAISWEKTVALQKVALQELSAPLIPVFENITV
FT                   MPLVGTIDTERAKKIMENLLSGVVKHRSEVVLIDITGVPVVDTMVAHHIMQASEAVRLV
FT                   GAKCLLVGIRPEIAQTIVNLGIDLTQVITKNTLQKGIQTALEMTDRKIVSLEE"
FT   gene            560967..561332
FT                   /gene="rsbS"
FT                   /locus_tag="BL02203"
FT   CDS_pept        560967..561332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="BL02203"
FT                   /product="antagonist of RsbT"
FT                   /function="negative regulation of sigma-B activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22156"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N53"
FT                   /protein_id="AAU22156.1"
FT                   /translation="MRVPNIPILKLYNCLLVSIQVELDDQTALKFQEDLLNKIYETGSN
FT                   GVVIDLTSVDIIDSFIAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGISLDEIET
FT                   ALDLEKGLETLQRELGE"
FT   gene            561335..561736
FT                   /gene="rsbT"
FT                   /locus_tag="BL02204"
FT   CDS_pept        561335..561736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="BL02204"
FT                   /product="switch protein/serine-threonine kinase"
FT                   /function="positive regulation of sigma-B activity,
FT                   Molecular Function: ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL02204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22157"
FT                   /db_xref="GOA:Q65N52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N52"
FT                   /protein_id="AAU22157.1"
FT                   /translation="MADQSCVKILTEWDIVAARQLGRNVAKELGFGTVDQARITTAISE
FT                   LARNIYLYAGKGRICIEQVQEEGKKGLKIVAEDEGPGIADIKKVMEDGFSTSGGLGAGL
FT                   PGVKRLMDQFELHSDAENGTDIQAVKWLR"
FT   gene            561747..562754
FT                   /gene="rsbU"
FT                   /locus_tag="BL02205"
FT   CDS_pept        561747..562754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="BL02205"
FT                   /product="serine phosphatase"
FT                   /function="indirect positive regulation necessary for the
FT                   RsbX-dependent regulation of sigma-B activity, Molecular
FT                   Function: catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22158"
FT                   /db_xref="GOA:Q65N51"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N51"
FT                   /protein_id="AAU22158.1"
FT                   /translation="MDFREVIEQRYRQLLSRYISELTETSLYQGQKFSRKTIEHQVPPE
FT                   EIISIHRKVLSELYPDLPDHVFHSLDFLIEVMIGYGLAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLETTVPKVEALEIGAVSIPAKQMSGDYYHFVRDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPDSGTSPSQVLKNLNRVVEQNVDPSMFITMFYGNYHLQKHLFTFSS
FT                   AGHEPGFYYSCRENKFYDLNAKGLVLGISSNYDYEQYEQKLDIGDMIVLFSDGVTECRT
FT                   DSGFLERSDLQNLITVHMEKPAQQMVDNIYEHLLKLQDFQLHDDFTLIVLKRKV"
FT   gene            562813..563139
FT                   /gene="rsbV"
FT                   /locus_tag="BL02206"
FT   CDS_pept        562813..563139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="BL02206"
FT                   /product="anti-anti-sigma factor (antagonist of RsbW)"
FT                   /function="positive regulation of sigma-B-dependent gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:BL02206"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22159"
FT                   /db_xref="GOA:Q65N50"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N50"
FT                   /protein_id="AAU22159.2"
FT                   /translation="MNLAVDTNKNDHVIEVKVAGEIDVHTAPTLRDELMPLAEEGKDLK
FT                   VSLKDVSYMDSTGLGVFVGIYKAVNRTGGSLVLENLSERLIRLFDITGLKDIIDISGKS
FT                   EGGL"
FT   gene            563139..563624
FT                   /gene="rsbW"
FT                   /locus_tag="BL02207"
FT   CDS_pept        563139..563624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="BL02207"
FT                   /product="switch protein/serine kinase and anti-sigma
FT                   factor (inhibitory sigma-B binding protein)"
FT                   /function="negative regulation of sigma-B-dependent gene
FT                   expression phosphorylation of RsbV"
FT                   /db_xref="EnsemblGenomes-Gn:BL02207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22160"
FT                   /db_xref="GOA:Q65N49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N49"
FT                   /protein_id="AAU22160.1"
FT                   /translation="MKRAADYIEMKSPAKPEYVGIIRLTLSGIASKMGYSYDDIEDLKI
FT                   AVSEACTNAVQHAYKADNNTGEVSVRFGVFEDRLEIVVADQGDSFDIQDKQKELGPYSP
FT                   EHTVDQLSEGGLGLYLMETLMDEVHVQIDSGVTVSMTKFLNRERVDDGTTVQNYETN"
FT   gene            563590..564381
FT                   /gene="sigB"
FT                   /locus_tag="BL02208"
FT   CDS_pept        563590..564381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="BL02208"
FT                   /product="RNA polymerase sigma-37 factor (sigma-B)"
FT                   /function="general stress sigma factor (class II genes),
FT                   Molecular Function: DNA binding, Molecular Function:
FT                   transcription factor activity, Biological Process:
FT                   transcription initiation, Biological Process: regulation of
FT                   transcription, DNA-dependent, Molecular"
FT                   /db_xref="EnsemblGenomes-Gn:BL02208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22161"
FT                   /db_xref="GOA:Q62YJ7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YJ7"
FT                   /protein_id="AAU22161.1"
FT                   /translation="MAQPSKTTKLTKTEVDTLIKKYQENQDEDAQLTLVQTYKNLVETL
FT                   AKKYSKGKSFHEDLCQVGMLGLLGAIKRYDPDVGKSFEAFAIPTIIGEIKRFLRDKTWS
FT                   VHVPRRIKELGPRIKMAVDHLTTETQRSPRVDEIAEFLDVTEEEVLETMEMGKSYQALS
FT                   VDHSIEADADGSTVTILDIVGSQEEGYEKVNQKLMLESVLHVLSDREKQIIELTYIQNK
FT                   SQKETGEMLGISQMHVSRLQRKAVKRLREALAEDPYMELKP"
FT   gene            564378..564977
FT                   /gene="rsbX"
FT                   /locus_tag="BL02209"
FT   CDS_pept        564378..564977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /locus_tag="BL02209"
FT                   /product="serine phosphatase"
FT                   /function="indirect negative regulation of
FT                   sigma-B-dependent gene expression, Molecular Function:
FT                   catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22162"
FT                   /db_xref="GOA:Q65N47"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N47"
FT                   /protein_id="AAU22162.1"
FT                   /translation="MIWTESNEHMQALVYQLPKEGKAVCGDSFYFHATDETMVCALADG
FT                   LGSGALARESSSVISEVVEEHGHEDVESLMERCNQALKHKRGATVSILKVDFRTRTIAY
FT                   SSVGNIRFILYAPSDKYIHPLPVTGYMSGKPQTYKTFTYTYEKGSRFIIYSDGLEVPAL
FT                   RTYLKQHHTPGDISNQLESYTRMGKDDLTYIIGQLF"
FT   gene            565055..567217
FT                   /gene="ydcI"
FT                   /locus_tag="BL02210"
FT   CDS_pept        565055..567217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcI"
FT                   /locus_tag="BL02210"
FT                   /product="putative RNA binding protein containing S1 RNA
FT                   binding domain,YdcI"
FT                   /function="Molecular Function: nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:BL02210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22163"
FT                   /db_xref="GOA:Q65N46"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N46"
FT                   /protein_id="AAU22163.2"
FT                   /translation="MDTLASIVKQIAKETGLAPKHVESVIQLLEDGNTVPFIARYRKEQ
FT                   TGSMDEVQIQTISERWGYIQHLNQRKDEVIRLIDEQGKLTGQLKLDIEKADKLQEVEDL
FT                   YRPFKQKRKTKATIAKSKGLEPLADFIISLPRNEDVAAEARKYINEEKEVMSAEEALEG
FT                   AKNILAERISDEPEYRKWIRQETFKRGTLKSAAKDAEADEKKIYEMYYEYEEPIQKIVP
FT                   HRVLAVNRGEKEEILRASVEPPADRIQAYLEKRILQQKQTSAQDVLKSAIEDGYKRLIQ
FT                   PSIEREIRKELTEKAEDQAIHIFAENLRKLLLQPPMKGKLVLGVDPAFRTGCKLAVVDE
FT                   TGKMLKIDVIYPHPPVNKKSAAIEKVKRIIEDFQIEVIAIGNGTASRETEQFIADLLKD
FT                   IDRKVYYLIVNEAGASVYSASELAREEFPDLQVEERSAVSIARRLQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKKLNDSLRFVVETVVNQVGVNVNTASAALLQYVAGLSKTVAANIVKK
FT                   RDEIGKFTSRKELKDIPRLGAKTYEQCIGFLRVPDGDEPLDRTGIHPESYKETRELLKK
FT                   LGLSTAQIGTKELQDKINELNISEAAEQLGIGEITLKDICAQLTRPERDPRDEVPKPLL
FT                   KTDVLQLEDLKEGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSHSFVKHPLDVVSV
FT                   GDIVTVWVEDVDAAKGRVSLSMVKDR"
FT   gene            complement(567267..567824)
FT                   /locus_tag="BL02215"
FT   CDS_pept        complement(567267..567824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02215"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22164"
FT                   /db_xref="GOA:Q65N45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N45"
FT                   /protein_id="AAU22164.1"
FT                   /translation="MEDRRSIKTKRAIKEAFLKLLHEKEINKITVSDLSRRADLGRGTF
FT                   YLHYRDVFDLYEQIENELFDQLGKFYDDYFPSEDPHHLLTFIEKTTEYIYQNAAIFTLL
FT                   TKPKGNILTINKFKDFFKQKIFEELSMMQQSGNEMACDEMEITFLVSGAVGIFEEWING
FT                   GMVQTPAHIAGVVHRILLKIAM"
FT   gene            568181..571300
FT                   /gene="ydgH"
FT                   /locus_tag="BL02211"
FT   CDS_pept        568181..571300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /locus_tag="BL02211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02211"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22165"
FT                   /db_xref="GOA:Q65N44"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N44"
FT                   /protein_id="AAU22165.1"
FT                   /translation="MRTIIKARWIIAALWIAMAAVLFITAPDMGQLTKEKGQIAVPEGY
FT                   PSSYANKLLEQMSKDGDTNKSVVVVFQDKHLLPNREAALKKAITTLEKDSSLHVSDITS
FT                   YFNADEDIQKQLLSKDRTTLLVPVTFDANKISAAEFKAKVNEKLKTLKLDYEMTGQPLI
FT                   DDDVMTSSQEGLKKTEYITVGFILIVLILVFRSAVAPFVPLLAVALSYLVSQSVVAYLV
FT                   KYADFPLSTFTQIFMVAIMFGIGTDYCILLLSRFKEEIARGKDKIEAILTTYKTAGRTV
FT                   LFSGIAVLIGFTCIGFAEFQLYKSAVAVAVGVAVLILALLSIVPFFMAVLGKVLFWPVR
FT                   GNIGHPQSKLWETAGRFAFSKPLISLLIVAAVAVPPILMYKGTLSYNSLDEIGDQYESV
FT                   SAFNTISDKFGPGESLPVTVVLKTSDALDTNDGLIAIEKISRAIEQTNGVSKVRSATRP
FT                   VGKGLSDLYVKTQANELNKGLESGNKGLKKIKDGLAEASKSIADQKPQIEASGKGINQL
FT                   IKGTESIQAGISDVEANMRKLKEGTDQSKQGVAQAKKEIQTAKKQLTAQVDQLNGQIET
FT                   YKEISKILKAALSQAENAQGITADVQKMIEQTNQNFKNLESEIPEVKENPSYLAIKGSY
FT                   TELASAIKQGSQKAAVYTKQAANAKKQLEAADAFIAKAQEEQKVYTSKIDALINGLGQI
FT                   EKGLEETSKGQGQLADSLPKLESGAGEVAEGQKQMKEKVGEFAGQLDQLTKGLNSSVDG
FT                   LEKISSGLMGAGDYLDQLKNASDQEMSGWFVPKEVLKNKQFQQVFNSYMSDDRHITTID
FT                   VILEDNPYGNGAIAKVKDIEASVKRALPDTHLHDASFGVGGVSSINADLKQLSDQDFSN
FT                   TVIYMMIGIFLILVLLFRSIVMPVYLVGSLVLTYFASIGVTEFIFTAFFGYPGLNWAVP
FT                   FFGFVILMALGVDYSIFLMERFNEYRGTDIMTAMTESMKNMGSVIISAAVILAGTFAAM
FT                   LPSGVLSLLQIATLVLTGLLLYAFVMLPLFVPVMVRIFGSANWFPFKRKE"
FT   gene            complement(571468..571578)
FT                   /locus_tag="BL05042"
FT   CDS_pept        complement(571468..571578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22166"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YJ2"
FT                   /protein_id="AAU22166.1"
FT                   /translation="MPNWLKNQMQRAFYEKDHYQIKLLNQCWYFYRKKHC"
FT   gene            571690..572151
FT                   /gene="ydcK"
FT                   /locus_tag="BL05043"
FT   CDS_pept        571690..572151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcK"
FT                   /locus_tag="BL05043"
FT                   /product="conserved protein YdcK"
FT                   /db_xref="EnsemblGenomes-Gn:BL05043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22167"
FT                   /db_xref="GOA:Q65N43"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N43"
FT                   /protein_id="AAU22167.1"
FT                   /translation="MDEQQLQQLTEQLSLTYFKKPFRHRAYFNSRLKTTGGRYLLNSHN
FT                   IELNKKYLTEHGQKELEGIIKHELCHYHLHLEGKGYKHRDKDFRTLLKEVGAPRFCTPL
FT                   EKEKKPQRKVRTYKCEACGQTFLRKRKMDTSRYVCGKCGGKIKEIIKKG"
FT   gene            572268..572342
FT                   /locus_tag="BL_trna_0015"
FT   tRNA            572268..572342
FT                   /locus_tag="BL_trna_0015"
FT                   /product="tRNA-Asn"
FT   gene            572345..572435
FT                   /locus_tag="BL_trna_0016"
FT   tRNA            572345..572435
FT                   /locus_tag="BL_trna_0016"
FT                   /product="tRNA-Ser"
FT   gene            572464..572535
FT                   /locus_tag="BL_trna_0017"
FT   tRNA            572464..572535
FT                   /locus_tag="BL_trna_0017"
FT                   /product="tRNA-Glu"
FT   gene            572548..572622
FT                   /locus_tag="BL_trna_0018"
FT   tRNA            572548..572622
FT                   /locus_tag="BL_trna_0018"
FT                   /product="tRNA-Gln"
FT   gene            572631..572706
FT                   /locus_tag="BL_trna_0019"
FT   tRNA            572631..572706
FT                   /locus_tag="BL_trna_0019"
FT                   /product="tRNA-Lys"
FT   gene            572719..572801
FT                   /locus_tag="BL_trna_0020"
FT   tRNA            572719..572801
FT                   /locus_tag="BL_trna_0020"
FT                   /product="tRNA-Leu"
FT   gene            572822..572905
FT                   /locus_tag="BL_trna_0021"
FT   tRNA            572822..572905
FT                   /locus_tag="BL_trna_0021"
FT                   /product="tRNA-Leu"
FT   gene            complement(573195..574079)
FT                   /locus_tag="BL05044"
FT   CDS_pept        complement(573195..574079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05044"
FT                   /product="putative membrane protein"
FT                   /function="Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22168"
FT                   /db_xref="GOA:Q65N42"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N42"
FT                   /protein_id="AAU22168.2"
FT                   /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPIELVWIRYVIA
FT                   ILTLLIVGLIKRQSWKIHKRDLLLIVVIGIVGNTISIVTQEYGTMLSSAQMGAIITSST
FT                   PAFMVIFARLLLKEPLNIKKGTSIILATIGVLFIVGNGHIDTSNQIGGISLLAAALTWA
FT                   LMSVLIKLVPNSYSSLLVTTYSTFVAIVALTPFVKPTAIFTSQLLDPKILGGLLYLGIV
FT                   STACAFLLWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGEKIGGTFWIGSFLILIGV
FT                   LLVIKEKEKDVNS"
FT   gene            complement(574945..575295)
FT                   /locus_tag="BL02690"
FT   CDS_pept        complement(574945..575295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02690"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22169"
FT                   /db_xref="GOA:Q65N41"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N41"
FT                   /protein_id="AAU22169.2"
FT                   /translation="MISKFFSGIHNTIFSPLRSWAEQSPGNWNILIVVGFLLVYGSGIL
FT                   VYVFYKKLGKDDERTNKIYLKSSSYMLLVIILCDMIFPKDDMWTIFFLYKYALAFLAAG
FT                   IYLSVQYKKDFS"
FT   gene            complement(575285..575524)
FT                   /locus_tag="BL02691"
FT   CDS_pept        complement(575285..575524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02691"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22170"
FT                   /db_xref="GOA:Q62YI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YI8"
FT                   /protein_id="AAU22170.2"
FT                   /translation="MKKDFGDSISNKVYEYRVLARMSQQELAEKVGVSKQTIFVMEKGN
FT                   YVPTLLLAFRIAEFFNVDVNEIFTYVKGNDQNDK"
FT   gene            complement(576162..577190)
FT                   /locus_tag="BL02692"
FT   CDS_pept        complement(576162..577190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02692"
FT                   /product="fatty acid desaturase"
FT                   /function="involved in the formation of unsaturated fatty
FT                   acids from saturated phospholipid precursors, Molecular
FT                   Function: oxidoreductase activity"
FT                   /note="BL02692 similar to des from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02692"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22171"
FT                   /db_xref="GOA:Q65N39"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N39"
FT                   /protein_id="AAU22171.1"
FT                   /translation="MNDQNLKTLRKLVTPYEKSDLQKSIYQIINTLIPFFLLWCLAYKS
FT                   LSISYFLTLAISIVAAGFLVRTFIIFHDCCHYSFFKNKKANRILGTITGILTLHPFDHW
FT                   GRDHSIHHATSSNLDKRGTGDIWLLTVEEYKEASTKTKIMYRLYRNPFVMFMIGPIYVF
FT                   GITNRFNRKGAKRKERMNTYVTNLGIAALTALLCWAIGWQNFLLVQAPIFMISGSLGIW
FT                   MFYIQHTFEDSYFEEDEHWEYVKAAVEGSSFYKLPKVMQWLTGNIGFHHVHHLSPRVPN
FT                   YKLEEVHNNIEPLQNVPTITLATSLKSLKFRLWDEESKKFVGFSHLKKASKSQVSAQLR
FT                   TD"
FT   gene            577619..577729
FT                   /locus_tag="BL07002"
FT   CDS_pept        577619..577729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL07002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97349"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N38"
FT                   /protein_id="ABP97349.1"
FT                   /translation="MNKTIIGIAIISVSCYDKGELFLFGVKDSMNIDFSS"
FT   gene            577789..577992
FT                   /gene="cspC"
FT                   /locus_tag="BL02685"
FT   CDS_pept        577789..577992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="BL02685"
FT                   /product="cold-shock protein"
FT                   /function="Molecular Function: DNA binding, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL02685"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22172"
FT                   /db_xref="GOA:Q65N37"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N37"
FT                   /protein_id="AAU22172.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQ
FT                   KVTFDVEQGPRGAQAANVQKTA"
FT   gene            complement(578248..579234)
FT                   /locus_tag="BL02693"
FT   CDS_pept        complement(578248..579234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02693"
FT                   /product="hypothetical protein"
FT                   /note="GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:BL02693"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22173"
FT                   /db_xref="GOA:Q62YI5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YI5"
FT                   /protein_id="AAU22173.1"
FT                   /translation="MNNVSLIYKEFGDPLQKLQLHAGEKLPLQPNEILVKMIASPINPS
FT                   DLLPIRGAYSHRIKLPAVAGYDGVGIVIDQGKDVSPSLIGKRVLPVRGEGTWQQYVTTK
FT                   ADYAIELPPSISDNDASQLYINPLTAWLICTESLRVQPNEIVLMNGGGTSIAGLFAQIS
FT                   KILGFRLIVMTRNSRKIEKLQKLGAWRAIDASKGSIYEKISDGCDIGVDHAIDSVGGES
FT                   GELLARALKPEGTFVSYGLLSGIPNDWRKLHDVYHVSPQLFALRLWNERHSVSEYRNRF
FT                   SEVIKLVESGRMVINAPEKIYDFEDFYDALKHYEQPGLNGKILLNFA"
FT   gene            complement(579602..580207)
FT                   /gene="yyaS"
FT                   /locus_tag="BL02694"
FT   CDS_pept        complement(579602..580207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yyaS"
FT                   /locus_tag="BL02694"
FT                   /product="conserved membrane protein YyaS"
FT                   /db_xref="EnsemblGenomes-Gn:BL02694"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22174"
FT                   /db_xref="GOA:Q65N35"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N35"
FT                   /protein_id="AAU22174.1"
FT                   /translation="MKYLFYVIGILILTLGIAFTIQSDLGASPFDALLVVLAVHAGLTV
FT                   GSWEVIIALLLIGCNSVLKRQRPEVSGLLTAFITGIGIDMWLFLLHFFVTPEQWYSKAV
FT                   CFGIGLVVTGLGTATYLYTNFASMPIDRLTFIIKELTGTNIFFSRTIIYLVFLTAAVML
FT                   KGPIGIGTLLTVCLGGLALHLFMPFAGKVLGRFTDART"
FT   gene            580318..580770
FT                   /gene="yybA"
FT                   /locus_tag="BL02686"
FT   CDS_pept        580318..580770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybA"
FT                   /locus_tag="BL02686"
FT                   /product="negative regulator of yyaTS-YybA"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL02686"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22175"
FT                   /db_xref="GOA:Q65N34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N34"
FT                   /protein_id="AAU22175.1"
FT                   /translation="MKDILREIGMIARALDSISNIEFKEHDLTKGQYLYLVRICENPGI
FT                   IQEKLAEMIKVDRTTAARAIKKLEMKGFIERRDDEHNKKIKKLFPTEKGNEVFPFIKRE
FT                   NDHSNRVALEGFSEGEAEIIFNLLQRVRKNVEKDWEFVKKGNKRNY"
FT   gene            580795..581313
FT                   /gene="paiA"
FT                   /locus_tag="BL02687"
FT   CDS_pept        580795..581313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paiA"
FT                   /locus_tag="BL02687"
FT                   /product="transcriptional regulator PaiA"
FT                   /function="negative regulation of sporulation, septation
FT                   and degradative enzyme genes (aprE, nprE, phoA, sacB),
FT                   Molecular Function: N-acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02687"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22176"
FT                   /db_xref="GOA:Q65N33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N33"
FT                   /protein_id="AAU22176.1"
FT                   /translation="MTVNIKRCTLEDLHKLQEIGYETFNETFKHQNSPENMKAYLDKAF
FT                   NLKQLEKELSNSSSQFFFVYFNNEIAGYLKVNTDEAQSEKMGDESLEIERIYIKNNFQK
FT                   HGLGKYLFNKAVEIAKELNKKKIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQT
FT                   DFIMAKTIL"
FT   gene            581335..581952
FT                   /gene="paiB"
FT                   /locus_tag="BL02688"
FT   CDS_pept        581335..581952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paiB"
FT                   /locus_tag="BL02688"
FT                   /product="transcriptional regulator"
FT                   /function="negative regulation of sporulation and
FT                   degradative enzyme genes"
FT                   /db_xref="EnsemblGenomes-Gn:BL02688"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22177"
FT                   /db_xref="GOA:Q65N32"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N32"
FT                   /protein_id="AAU22177.1"
FT                   /translation="MYIPKYFKVENADEILDFVQKNSFGTIVTTEQGKPIATHLPLGLN
FT                   KKGDDYYITGHIAYGNPQVGTLETCKDVLVMFQGPHAYISSSWYGHEDVPTWNYQAVHI
FT                   YGKASILERDELIEELTIMMEKYEKHRENPILWDNLSPQLLERQLKAIVGFKIKVEDIQ
FT                   AAYKLSQNRNDTDYMNIIDQLQNEGDPDSEQLAAAMKKRLEN"
FT   gene            complement(582347..583261)
FT                   /locus_tag="BL02695"
FT   CDS_pept        complement(582347..583261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02695"
FT                   /product="arginase"
FT                   /function="Molecular Function: catalytic activity"
FT                   /note="BL02695 similar to rocF from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL02695"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22178"
FT                   /db_xref="GOA:Q65N31"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N31"
FT                   /protein_id="AAU22178.1"
FT                   /translation="MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQ
FT                   PYDGTPLENENGINGRKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERY
FT                   GGDLGLIWIDAHSDLVRYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLA
FT                   APTEEETKVISNELQRQGIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIK
FT                   YLAIHLDLDVLDPKAFRSLLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGI
FT                   TEHLPWDSIHLKKLLSEIPILTQ"
FT   gene            583367..583702
FT                   /gene="ydzF"
FT                   /locus_tag="BL02689"
FT   CDS_pept        583367..583702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzF"
FT                   /locus_tag="BL02689"
FT                   /product="putative carboxy-lyase"
FT                   /function="Biological Process: amino acid metabolism,
FT                   Molecular Function: carboxy-lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL02689"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22179"
FT                   /db_xref="GOA:Q65N30"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N30"
FT                   /protein_id="AAU22179.2"
FT                   /translation="MSMAEYKGKVKNIQDTPFGYTLSVIGGKWKMVIIYLLAENQPIRF
FT                   NELKRQIGAITYKTLSSQLKELEADGLVKRKEYPQVPPKVEYSLTDKAESLLPVLEGLC
FT                   EWGLKNQ"
FT   gene            584041..584913
FT                   /gene="ydeO"
FT                   /locus_tag="BL02008"
FT   CDS_pept        584041..584913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeO"
FT                   /locus_tag="BL02008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22180"
FT                   /db_xref="GOA:Q65N29"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N29"
FT                   /protein_id="AAU22180.1"
FT                   /translation="MNKIEKHRKFRAKMIFKVIMVMIGGIIAAYGLETVLIPNSVSDGG
FT                   VTGLSIVGSQLFDLPLGILIAVLNIPFVWLGYKQIGKSFALLSIIGIASLAAGTSFMHH
FT                   TPAIIEGDTLLVTVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFF
FT                   NLFVFIFVSAVFGLQGALLSVIAYYIASKVIHVVEEGLSGSKTFQIITSEPELMVETIR
FT                   DQLGRSATYKEAYGGFSHEKFKEITCVINRLEDTKLKEIINEVDKNAFVTVYDVAEVKG
FT                   SNFRKPNIH"
FT   gene            complement(585012..585590)
FT                   /gene="lysE"
FT                   /locus_tag="BL02014"
FT   CDS_pept        complement(585012..585590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysE"
FT                   /locus_tag="BL02014"
FT                   /product="Lysine exporter protein"
FT                   /function="Molecular Function: lysine permease activity,
FT                   Biological Process: amino acid transport, Cellular
FT                   Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22181"
FT                   /db_xref="GOA:Q65N28"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N28"
FT                   /protein_id="AAU22181.1"
FT                   /translation="MSIIAFLSYVIMTSITPGPSNILMMNEAQRFGFTGSWRFSSGILA
FT                   GFAVLGILSGAFTISLYNWIPVVEPYFKLAGACYLIYLALQVGFTKNKKQDSTEARSSF
FT                   ISGFIFQLINIKSILFFLTVMSAFVLPFNHSLKSTIYYLALAIVLGWLALLLWSGFGSV
FT                   FKRVFAKHDRVFRVLMCLLLMYSAVSIFR"
FT   gene            585722..586603
FT                   /locus_tag="BL02009"
FT   CDS_pept        585722..586603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02009"
FT                   /product="putative regulatory protein"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL02009"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22182"
FT                   /db_xref="GOA:Q65N27"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N27"
FT                   /protein_id="AAU22182.1"
FT                   /translation="MEIRHLITFQTIVEMGSYTGAASKLGYTQSTITTHIQALEHEIGG
FT                   ALFTYEKRNLKLTQLGRELMPLAEELLSTHNQIKNLQSAHEVKGVLKVAAPESLTISRL
FT                   GPIIREYSLKYPHVKLKLSNGTCGQNQVDLLSGNVDVALMVYPEIELDKCIRYTLAEEK
FT                   IVLVGSSEGPEDLEEYQKHFFITNEEDCSYRTMFEKYLLKNDIHYFPTMELWSIEAIKQ
FT                   TVMSGLGFSVLPYITVKDEVESGKLKILPHSQYLDPLYSQMLIKKKKWQLPAVDAFADL
FT                   VLHSFREPRLIG"
FT   gene            586685..586906
FT                   /locus_tag="BL02010"
FT   CDS_pept        586685..586906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22183"
FT                   /db_xref="GOA:Q65N26"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N26"
FT                   /protein_id="AAU22183.1"
FT                   /translation="MREFAPKVFQTTGIIGFILAFVQIPIGWFIGFFFSGLFFMMLKSN
FT                   NEKSGTFNMMAGIACLLYSFYCLFTQVL"
FT   gene            587216..588313
FT                   /locus_tag="BL02011"
FT   CDS_pept        587216..588313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02011"
FT                   /product="Major facilitator superfamily, transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22184"
FT                   /db_xref="GOA:A5A696"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5A696"
FT                   /protein_id="AAU22184.2"
FT                   /translation="MATMILVFFASPYLGSLVDRYSRKAIFLYMEITGIVVLGVFSVLC
FT                   NVSAVLDITLVVMLIFYHTAYDSIKYPALAALTQEMFKKEDYSKVNSSLEVQGQAALMI
FT                   SSGLAAMMIGKMDAAVILVMNISTFIAASILIYQLPYQRNAEAEEHSNTMKNESYWKNF
FT                   RSSLQYLCYRKVLFVLLLTSFIPSIVIIVANYLDPVFIYDYLNEGPSVIGIANIVYAIG
FT                   AMGAGFVAYQISKKWSDMQGVILFMAVFALATIAIFLVPNAVTFIVASLFWGHSNAAIR
FT                   VFRKSYMFHHVDNAYMGRVNSLFNAVKLLGQVALIGILTITVVPAGQTVYGYFVLFIIV
FT                   IAALLTTTYLFNRTYNKDKEKRVSL"
FT   gene            complement(588409..589191)
FT                   /locus_tag="BL02015"
FT   CDS_pept        complement(588409..589191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22185"
FT                   /db_xref="GOA:Q65N24"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N24"
FT                   /protein_id="AAU22185.1"
FT                   /translation="MKINQIVDLSVSLRGDIPSDPPGFIPEIEYADHKQGAKQMVQSFP
FT                   GLSSQDLPGGEGWSLEKVKMSTHAGTHIDAPYHYRSVTDDGKRMMTIDEVPLDWFHGPG
FT                   VKLDFRHLKDGHIVTPEEIEQELHRINHKLAPGDIVLVNTSAGAKYGQSDYLDSGCGMG
FT                   REATLFLTERGVRLVGTDAWSWDAPFSMTAKRFEQEKDPSIIWEGHYSGSTIPYCQIEK
FT                   LANLDQLPSTGFYVMAFPVKVEKASAGWARPVAILSGE"
FT   gene            complement(589317..590699)
FT                   /gene="aapA"
FT                   /locus_tag="BL02016"
FT   CDS_pept        complement(589317..590699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapA"
FT                   /locus_tag="BL02016"
FT                   /product="Amino acid permease"
FT                   /function="Molecular Function: amino acid-polyamine
FT                   transporter activity, Biological Process: amino acid
FT                   transport, Cellular Component: membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL02016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22186"
FT                   /db_xref="GOA:Q65N23"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N23"
FT                   /protein_id="AAU22186.1"
FT                   /translation="MTEDVTDNDIHEQKLSRGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYLITGIICFFIMRSLGELLLSNLEYHSFVDFVRDYLGDMAAFITGWTYW
FT                   FCWISLAMADLTAVGLYTQYWLPDVPQWLPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIAIGLFMIFKGFSTHSGTAAFHNLWSHGGMFPNGLHGFLLSFQMVVFAFVG
FT                   IELVGLTAGETKDPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWNVINPNESPFVQV
FT                   FAAVGIIAAASIINFVVLTSAASASNSAVFSTSRMIYSLAKEHNAPGAMTKLTSRKVPG
FT                   NALFFSAVVILIGIMLNYIMPEQVFTLITSISTICFIFIWGITVICHLKYRRTRPDLAK
FT                   RNKFKMPLYPFSNYVVLGFLAFILIVLALAQDTRVSLFVTPVWFIMLIAIYKLRKPKSR
FT                   QV"
FT   gene            591137..591736
FT                   /locus_tag="BL02012"
FT   CDS_pept        591137..591736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22187"
FT                   /db_xref="GOA:Q62YH1"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YH1"
FT                   /protein_id="AAU22187.2"
FT                   /translation="MFENLILDPQSTSFLSHKSHLRDSFHLPIWLKVMYVHVIAACLAM
FT                   VSGAVNFSSGLLAKSRKIHRLNGFIYVVSVMVVTLSSGYMAPHSTGGRAVSIAFNMVNM
FT                   YWPAATVISVIKARRNQFTKHRNWMIRSYLFCFTNLFIHFITFVCRSGFGLPYDISYTI
FT                   GVYGAIALNVAAAEFVIHFTRRKAVDILHTAGFDKV"
FT   gene            591929..592564
FT                   /locus_tag="BL02013"
FT   CDS_pept        591929..592564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL02013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL02013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22188"
FT                   /db_xref="GOA:Q65N21"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N21"
FT                   /protein_id="AAU22188.1"
FT                   /translation="MDDRIETKEPMPSLIGLITNPALQFERMKRRPAVALPMFIVFVLS
FT                   VLSAYLYISKDFPDTYTYFGMIIFLWEFLKTGIYLFVSALILWLIATIGGGKTNFVTMF
FT                   SLASFVGFAKIIGDVINNTVYRFANVPEGTSFTSLHDVFSAVEPYKSILGVFDIFMVWA
FT                   LVLAAEGLQKAGGASKRASWIAVAVLFILKFLFACFFGLFAALFEDIF"
FT   gene            592906..593403
FT                   /gene="sigV"
FT                   /locus_tag="BL05045"
FT   CDS_pept        592906..593403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigV"
FT                   /locus_tag="BL05045"
FT                   /product="RNA polymerase ECF(extracytoplasmic
FT                   function)-type sigma factor (sigma-V)"
FT                   /function="Molecular Function: DNA binding, Molecular
FT                   Function: transcription factor activity, Biological
FT                   Process: transcription initiation, Biological Process:
FT                   regulation of transcription, DNA-dependent, Molecular"
FT                   /db_xref="EnsemblGenomes-Gn:BL05045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22189"
FT                   /db_xref="GOA:Q65N20"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N20"
FT                   /protein_id="AAU22189.1"
FT                   /translation="MKKQAARASLVACITDRKEDFYRLAYSYVKNQEDALDIVQESIKK
FT                   ALDSVDSVRNPDTIKSWFYKILVRTAIDFLRKQKKLKVMDDQTIEFLSQGKEDTYRDTD
FT                   LHEALDELPQPYHTIIVLRFFEDLKLEEIAEITGENLNTIKTRLYRGLKLMRIQLTKED
FT                   LS"
FT   gene            593403..594263
FT                   /gene="yrhM"
FT                   /locus_tag="BL05046"
FT   CDS_pept        593403..594263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhM"
FT                   /locus_tag="BL05046"
FT                   /product="YrhM"
FT                   /note="similar to anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BL05046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22190"
FT                   /db_xref="GOA:Q65N19"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N19"
FT                   /protein_id="AAU22190.1"
FT                   /translation="MDKKLEQLRKAYQNVPIPKELDQVVETALQHKPKKKRRIVVWPAS
FT                   TLVAAAVLLAAVVNINPGAAQAMSQIPVIGKVVKAITFTEIKQKDGESSIDVKTPALSG
FT                   LNNRELENGINEKYVKESHQLYREFMKETSRNKKGHLSIYSDYETVTDTKDLISIRRSV
FT                   ERTEASSYTERRYITIDKKNEVLLTLKSLFKDDRYITAISENIKEQMKQQMKDDPDKIY
FT                   WIGDEEVEPFKRIKADQNFYITENHKLVISFDDYEVAPGYMGAVEFEIPTKAISNLLIG
FT                   DRYIR"
FT   gene            594493..596373
FT                   /gene="yrhL"
FT                   /locus_tag="BL00125"
FT   CDS_pept        594493..596373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhL"
FT                   /locus_tag="BL00125"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22191"
FT                   /db_xref="GOA:Q65N18"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N18"
FT                   /protein_id="AAU22191.1"
FT                   /translation="MRDQTQQHRYIPGLDGLRAFAVLAVIAYHLNMSWADGGFIGVDIF
FT                   FVLSGYLITSIILPAYGNDISLTFRDFWVRRIRRLLPAATLMIFATVIWVALFNRELMH
FT                   TVRGDAISSLLYVSNWWFIFHDLSYFDSFGSPSPLKNLWSLAIEEQFYFIWPIILLLGI
FT                   YIFKKRERFAAAVVLCALCSAIWMSILYVPGGDPSRVYYGTDTRAFELLIGCALALVWP
FT                   MKRLSGNRLPNSLKHALHGTELAAFALLMMCIYFVDEFSPFLYHGGMLIISIIAAILIA
FT                   CVSHPSSFLGFALSVKPLRWIGKRSYGIYLWHYPVIVLSTPVQEIGNPVYWHVAMKVAV
FT                   TFILAELSYRFIEKPIRKDGFKPFVSRVFLDKITEWKTASVPSKISIGLMFAALLVFAG
FT                   GLSGLADEKKQPQQAYSKSYEETSASADQPADKSEERQDDKKAQTESGNESKTGNGEES
FT                   SDTKDEQSAEKEPDRIEKEVLAVGDSVMLDIASSLRRKIPGITIDGQVGRQVREALQLT
FT                   STYASFNHPDKAVVIELGTNGYFTDGQLDALLDAFSKADVYLVNTRVPRQWESKVNESL
FT                   RKHADSRQNVTLVDWHAEALQHPEYFTADGVHLMPKGAEALASLIVKAMK"
FT   gene            596562..597767
FT                   /gene="ydgK"
FT                   /locus_tag="BL00124"
FT   CDS_pept        596562..597767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK"
FT                   /locus_tag="BL00124"
FT                   /product="putative Drug resistance transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component: integral
FT                   to membrane"
FT                   /note="Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BL00124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22192"
FT                   /db_xref="GOA:Q65N17"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N17"
FT                   /protein_id="AAU22192.2"
FT                   /translation="MLHNPVGKERLALAFLLGMLAILGPLNIDMYLPSFPEIADDLGAG
FT                   ASLVQLSLTACLIGLTIGQLVIGPVSDAKGRRKPLLISISLFALSSLFCALSPNIATLV
FT                   LARFLQGFTASAGIVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFYTLALIGLLLVLVISMKLTETLPPEKRIPSSIGSSLKTMGSLLKDRSFIGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSVLFGINGLAIISGSFIIGRFGGIIH
FT                   ERKLLRIAVITAVIATSVLLTMTILKGPLAAIVISIFIYMITIGMTLTSTFTLAMENQG
FT                   HRAGSASAMLGMLPLLLGSIVSPLVGMNETTAVPMGAIMFITAVIGSFAFFALTRENQG
FT                   ER"
FT   gene            complement(597807..600899)
FT                   /gene="ywpD"
FT                   /locus_tag="BL00118"
FT   CDS_pept        complement(597807..600899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywpD"
FT                   /locus_tag="BL00118"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22193"
FT                   /db_xref="GOA:Q62YG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YG5"
FT                   /protein_id="AAU22193.1"
FT                   /translation="MKKLFVFISIILGYAGFFFIFLFINNQLSEQNYPEAKQGIINLET
FT                   WDFQKDGNIALTGEWALYRNQLLSPKDIHAGKGKAPIYSDVPNNVKLTDSGKNVDYGTY
FT                   RLMIRSKQDNEMFGISTSFINSANRVYFNGKLIGQSGTPSNKANFTAQNRPYTSFFEVR
FT                   RGDNELIVQFSNFKKTPSWGIEKPIAFGMQQHILHQSKISFLNETSMITAFFITGLYFL
FT                   GFFLHRRKDKHLFFFSTMCLLFSVIVLLIGRERMIFLLFPSISFSALSVVRATTMVLVS
FT                   MAVFLYLYFAYKEIVSKKWIIAATAFSVLVLMIDFITWGYTDRLAYILHSVLAVTTLIY
FT                   ITYVFAISAVRKMKGSLYLTIAAISMSAFVILTTVSAYSGKRGFSFNSLYAVPSIIALL
FT                   AAVLMMAQQFAGAFRENEILSLKLLRMNRLKDEFIAKTSHEFKTPLNSMINICQTLLAR
FT                   KRKRTLEEEKENLQLVIRMGYRLSSLVNDILDLEKMKQGMLQIQAVPVDAHSAISTEMD
FT                   FYRLLSKNKNVRIVNRVPSGLPLVLADENRFRQIMTNLVDNAIKYTPEGQITLSAERLD
FT                   QEKVKITVADTGVGIPKAVRQLIFEAFQQAKNHKDDGAGLGLSIVRQLVQLQNGEIWVE
FT                   SEEGKGSAFHFTLPVAKNDPLPDAKKENMPQQQAVRDLPDVSISTPYYSKKMDASTVLI
FT                   VDDNIESLKILADMLEGVPYQVIAAKSGHEALEVVSRSKLDLVILDLMMPDMTGFEVCM
FT                   KIRERFTMVELPVLIITAAIIDHDKYKAFHAGANDILQKPYNYTEFAARVKNLIMMKDT
FT                   AAQATNMEMAFLQSQIKPHFLFNVLNTIIALSHLDIEKAREVTADFTNYLRMSFDFQNT
FT                   SGMSSFKHELSIVNSYLSIEKTRFGDRLDVIYDIEEDIDFTLPPLMIQPLVENAVHHGI
FT                   SKKRGGGWIKLTAKKESENRYYIKIEDNGIGMPPEKQQDIFSSHFTHSVGMKNINRRLK
FT                   HFCGSELNIESTPDSGTAVSMVISINESADVSDSAIQRAPL"
FT   gene            601077..602153
FT                   /locus_tag="BL00122"
FT   CDS_pept        601077..602153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00122"
FT                   /product="two-component response regulator"
FT                   /note="BL00122 similar to lytT from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00122"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22194"
FT                   /db_xref="GOA:Q65N15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N15"
FT                   /protein_id="AAU22194.2"
FT                   /translation="MKALIVDDEELALLHFKNMLERTNCFRFIEMFQDPADVLEYPDIR
FT                   DIDTVFLDIEMPGINGIELAEAIQSMNENIQVVFITAYNDFAIKAFELNAVDYLLKPVD
FT                   YVRLVKTIERIRENSLLKASAVNAGGDYFIQCFGNLQFYKAEKGVKTYIPVKWRTSKAR
FT                   EIYAYLLHHHGHVISKDVLIDLFWQDHDVSKASTQLYSAIYQIRKLIDRLPFGQSIEKT
FT                   DTGYVLRISGVKVDADEWEKSLKEAPPIHMATINRHMELLLAYENHYFMEHGYLWAEPE
FT                   KTRLARIWLGKAYELVDFLIHEKDYRRGLDICLLVEKIEPCDHKIIQYKMQLFNKTGNV
FT                   EEAIKEYERYKLMKDKMN"
FT   gene            602451..608378
FT                   /locus_tag="BL00121"
FT   CDS_pept        602451..608378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00121"
FT                   /product="LPXTG-motif containing, cell wall anchor domain
FT                   protein"
FT                   /function="Cellular Component: cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:BL00121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22195"
FT                   /db_xref="GOA:Q65N14"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N14"
FT                   /protein_id="AAU22195.1"
FT                   /translation="MRSKKYSFSLSKKRGLKSFLVTCLALYLIFSQVVGFTLTAVAAGT
FT                   STGGSVFFDSVTIKNSEDQTVDGSKGDEPALKPGDKVTLTYEWSLKNDEEAGAENSFTV
FT                   EVPKSFEFAQDAEGEVKSADQQIIGSYQVKADSNIFTVTLKSPAEGSAGAKGAIALSAK
FT                   FAADMKSDTKTVTALFQLGAGKTQQVIIPVNTGSESETAKNDPPSSEDDQSDDQSKSSG
FT                   GQDQEETKKKAADAENSDSKPAASSRLAAAGSLASGGNQITQNILTGVTLTDEHGKPYD
FT                   KSNRADTNSPAKISITWDIPNELGKTINDGDRYEFDLPEAFIMYNDITNQPLSSDGITY
FT                   GYFSIDTKGHVVMTFNGEVKEDSNVKGTLFVNTQFNAQKIKGSTTQKIPFPVKSDTPEV
FT                   TVYFKPKVSKTIDKSGTFDKGINPGQVTWTVDLNKKLDQVKNAKLQNFPEGLTYRSVKV
FT                   YQLDVNIDGSVSRGDEVLSGYTVDADGNVTFDGEIDSAYRLIYVTDIDDSAKPNEGGNA
FT                   AFRNKATFGGDNLEPASAEASVTAKYGKMIEKSSTGYKSDSQTFSWTILYNYGEKKIDE
FT                   SKASITDSFGSADLHLVSDSLKVIPITFNQNGSEQAGTPLTEGKDYTLSDNGSGFEIKF
FT                   NQDVTGAYKITYQTEVNSGVIIDKSTTYTNTAVTGTGESKKASGTAVQQNLIKGYSNID
FT                   YKKKTVDWTIAINKNNYTMNNWKLDDNFESGGLTLLDGSFRLQDVTNNKTLEEGKDYTL
FT                   IIKPDHEGFLLELIGDYATTNSQLKITYTTNMNADFSNENVKNTAESTWTDHSSTERKN
FT                   KEASSFTPNRQTSHNGFKHGLYNAVSKEITWKIGINYNGEPSKNPYIKDSLADDQQFEK
FT                   GSVVVKSYSVNKDGSITEGDILPASQYDVEEPSAANKQTLTVHLKTDDSVPYLIEFKTS
FT                   LKGQVIKHDPYTNKATYHNAGYSERELTASVSVADGGSLVFKGGKQNGGYVDWSINVNA
FT                   SQSVLEDVKVTDTPDTNQILAEDSFKVYQAKYDEKGAVKDSSGNLVPDDVQLKKGEDYT
FT                   LDIKTDNATGEQSFVLKFTGDYKKIDRAYVIQYQSLINIAGTSGHVNNKVSISGTNVQE
FT                   QTQENNSSVFVAVSSGGGSGSGERGSLTILKTGEDGTPLSGADFQLRTKDNEQLLRTGT
FT                   TDDNGKLTFGNIRYGTYILKEIKAPDGYTISDAYADGVSVEINSSSSSAGALYKVVNEK
FT                   NKVTLIKQDEQKNPLEGAVFKLEKKSGDGAFTTIRTNIKSDKNGKVEINGLPPGDYRLL
FT                   ETKAPEGYLLNTKELGFSVKTNDKNQVPDVDLGTLINYKGRAHLTKEDAEGRQLEGAEF
FT                   KLIDHEGKTIHEKLTSDQDGKTAVSDLAPGRYAFVETKAPEGYVINSKAIEFTISESAK
FT                   EKPESVDAGKAVNYKGSVYLTKEDAEGRTLKGAEFKIVDHEGKTVHEKLTSDEDGKIAV
FT                   SGLAPGRYAFVETKAPEGFMLNNDQIEFTIPGSAEGKPEPVDAGAAVNYKGSVHLTKED
FT                   AKGHKLEGAVFKIADQIGNTVQEELVSDRNGTVTASGLAPGRYAFVETKAPDGFVLNSG
FT                   KIEFVIPDSAKGKPEHVDAGTFVNYKGSVYLEKKDEDGNGLEGAVFKIIDSEGKTVKDD
FT                   LISKEGGKIEAGDLAPGSYQFVEKHAPDGYLLSTDPIPFSITGKHEGEPKQVKLTALNK
FT                   KNSVVLTKVGQDDKSAGLQGAQFDLTDETGKVLKTGLATDADGRITVYGLKPGNYQFVE
FT                   TKAPKHYQLDKTPISFTVKNTDTKQIELTAENQLTPGDVKLTKVDSNNKKAVLKGAEFK
FT                   LLDADGKPVKAGGNSKKLPAVWTTDQNGQFTAEGLAPGRYQFVETKAPDGYKLDETPIP
FT                   FEIKKGQTKPVEVIASNEKLKTPAVDKGAPDPNSGDPKTDNKGTPDRNSKGDPKTNDNG
FT                   HLKDTLPKTGDTDSIIPIMIGILLILSGGAFAFFTRKKQRKA"
FT   gene            608445..609077
FT                   /gene="ywpE"
FT                   /locus_tag="BL00120"
FT   CDS_pept        608445..609077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywpE"
FT                   /locus_tag="BL00120"
FT                   /product="conserved protein YwpE"
FT                   /function="Biological Process: biosynthesis, Molecular
FT                   Function: transferase activity"
FT                   /note="Sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22196"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N13"
FT                   /protein_id="AAU22196.1"
FT                   /translation="MYKKMIVAVLVISGILFVLSPFIKESIIINLNKNKNFDLTAEQAE
FT                   QNNAQKASFDFEAIQPPSILETIKASLDRESKAVIGRITISSVNLKLPILKGTTNQNLL
FT                   YGATTMRPDQKMGEGNYPLAGHHMKRESLLFGPLLNIEKGDTVKITDFKKDYIYAVTSK
FT                   QFISEMDTDVIQETKKKEITLITCDKAVRTEGRLAVKGKLIHVAVHR"
FT   gene            complement(609183..609293)
FT                   /locus_tag="BL05047"
FT   CDS_pept        complement(609183..609293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22197"
FT                   /db_xref="GOA:Q62YG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YG1"
FT                   /protein_id="AAU22197.1"
FT                   /translation="MSKIAANPGMKEKYPIRIVSFSFFVISHYFFTLVIS"
FT   gene            609653..611074
FT                   /gene="iolT"
FT                   /locus_tag="BL00119"
FT   CDS_pept        609653..611074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolT"
FT                   /locus_tag="BL00119"
FT                   /product="major inositol transport protein IolT"
FT                   /function="Molecular Function: sugar porter activity,
FT                   Biological Process: carbohydrate transport, Cellular
FT                   Component: membrane"
FT                   /note="major inositol transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22198"
FT                   /db_xref="GOA:Q65N12"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N12"
FT                   /protein_id="AAU22198.1"
FT                   /translation="MNEQGNQKSFLRTIILVSTFGGLLFGYDTGVINGALPYMSEGDQL
FT                   NLTAFTEGLVASSLLLGAALGAVFGGRLSDYIGRRKNIIFLAVLFFFSTLGCTLAPDVT
FT                   VMVISRFLLGVAVGGASVTVPTYLAEMSPSEKRGRMVTQNELMIVSGQLLAFTFNAILG
FT                   TTMGDSSHVWRYMLAIAAVPAVFLFFGMLRMPESPRWLVSKGKNEAALGVLKRIRKEKR
FT                   AHSEVAEIEAAVMKESEMKKANYKDLAVPWVRRIVFLGIGIAVVQQITGVNSIMYYGTE
FT                   ILKNAGFETKAALIGNIANGVISVLATFVGIWLLGKVGRRPMLLTGLIGTTSALLLIGI
FT                   FSNVLQGSAALPYVVLTLTVTFLAFQQGAISPVTWLMLSEIFPLRVRGLGMGVTVFCLW
FT                   IANFFVGFSFPILLESIGLSSTFYIFVGLGLLSIAFVKKFLPETKGLTLEQLEHNFRNY
FT                   KSETAQSGASAKISG"
FT   gene            611672..611748
FT                   /locus_tag="BL_trna_0022"
FT   tRNA            611672..611748
FT                   /locus_tag="BL_trna_0022"
FT                   /product="tRNA-Arg"
FT   gene            611761..611834
FT                   /locus_tag="BL_trna_0023"
FT   tRNA            611761..611834
FT                   /locus_tag="BL_trna_0023"
FT                   /product="tRNA-Gly"
FT   gene            611999..613543
FT                   /locus_tag="BL_rrna_0013"
FT   rRNA            611999..613543
FT                   /locus_tag="BL_rrna_0013"
FT                   /product="16S ribosomal RNA"
FT   gene            613716..616646
FT                   /locus_tag="BL_rrna_0014"
FT   rRNA            613716..616646
FT                   /locus_tag="BL_rrna_0014"
FT                   /product="23S ribosomal RNA"
FT   gene            616779..616894
FT                   /locus_tag="BL_rrna_0015"
FT   rRNA            616779..616894
FT                   /locus_tag="BL_rrna_0015"
FT                   /product="5S ribosomal RNA"
FT   gene            616907..616983
FT                   /locus_tag="BL_trna_0024"
FT   tRNA            616907..616983
FT                   /locus_tag="BL_trna_0024"
FT                   /product="tRNA-Met"
FT   gene            617025..617101
FT                   /locus_tag="BL_trna_0025"
FT   tRNA            617025..617101
FT                   /locus_tag="BL_trna_0025"
FT                   /product="tRNA-Asp"
FT   gene            617296..618279
FT                   /gene="thiL"
FT                   /locus_tag="BL00841"
FT   CDS_pept        617296..618279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BL00841"
FT                   /product="thiamine-monophosphate kinase"
FT                   /function="Molecular Function: thiamin-phosphate kinase
FT                   activity, Biological Process: thiamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00841"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22199"
FT                   /db_xref="GOA:Q65N11"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N11"
FT                   /protein_id="AAU22199.1"
FT                   /translation="MDEFELIQRITPRSLSHREIEIGIGDDAAVYHTKNNYQEIVAVDT
FT                   MVDGIHFLSSHSSPADIGYKALAVNISDIAAMGGRPKYYLVSIAVPSGWGATDIEAMYE
FT                   EMNKLATLYEMDLIGGDTVSANGPLVLTVTAIGEIEKGRSCLRSHAEPGDVVFVTGELG
FT                   SSAAGLSFILGQTSARDETQSQYFIERHKRPEPRVEAGLICSRYHHVALNDISDGLASE
FT                   LNEIAEASRVSIDIYKELIPVHSDLHILHTKWEEWVLFGGEDFELVGTISNDQWERFSQ
FT                   ECSEHDVRVHQIGRVTKQGQAEVFYHDGQDRVLLEKKGYNHFKQDR"
FT   gene            618288..618764
FT                   /gene="ydiB"
FT                   /locus_tag="BL00842"
FT   CDS_pept        618288..618764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="BL00842"
FT                   /product="hypothetical conserved protein YdiB"
FT                   /db_xref="EnsemblGenomes-Gn:BL00842"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22200"
FT                   /db_xref="GOA:Q65N10"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N10"
FT                   /protein_id="AAU22200.1"
FT                   /translation="MKTLEWKTTEPEETKNIARLAAKYVQPGDVITLEGDLGAGKTTFT
FT                   KGFAEGIGIKRVVSSPTFTIIKEYRDGSLPLFHMDVYRMEDETEDLGLDEYFEGDGVCL
FT                   VEWAHLIEEQLPKERLEVVIKRLGDDKRKLTFTPKGRRYENLCEEISKHDDTCD"
FT   gene            618745..619434
FT                   /gene="ydiC"
FT                   /locus_tag="BL00843"
FT   CDS_pept        618745..619434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="BL00843"
FT                   /product="Peptidase M22, glycoprotease YdiC"
FT                   /function="Biological Process: proteolysis and
FT                   peptidolysis, Molecular Function: O-sialoglycoprotein
FT                   endopeptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00843"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22201"
FT                   /db_xref="GOA:Q65N09"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N09"
FT                   /protein_id="AAU22201.1"
FT                   /translation="MTILAIDTSNLTLGVALIKDGKVIAEHISHLKKNHSVRAMPAIDE
FT                   LLKECGLKPSDLTQIAVAKGPGSYTGVRIGVTIAKTLAWSLNIPVKTVSSLEVLAANGR
FT                   FFQGLICPLFDARRGQVYTGLYQYRDGKLHGLEEDQNILLEDWLKKLKAMDQQVLFIGS
FT                   DTGIHREMIERILDEQAVIADPALQLPRPSELALIGELKEDEPVHSIVPNYIRLAEAEA
FT                   VWLEKQK"
FT   gene            619447..619905
FT                   /gene="ydiD"
FT                   /locus_tag="BL00844"
FT   CDS_pept        619447..619905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiD"
FT                   /locus_tag="BL00844"
FT                   /product="Ribosomal-protein-alanine acetyltransferase YdiD"
FT                   /function="Biological Process: N-terminal protein amino
FT                   acid acetylation, Molecular Function: acetyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00844"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22202"
FT                   /db_xref="GOA:Q65N08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N08"
FT                   /protein_id="AAU22202.1"
FT                   /translation="MNTQMVIRDMNPKDLDQVFEIEKSSFSSPWKKESFHHELFHNMYA
FT                   HYLVLEVEEQVVGYCGIWIVMDDAQITNIAVSPAYRGRRFGEALLKAAMKLCRMKRAVQ
FT                   LSLEVRVSNHIAQSLYKKLGFEPGGIRKNYYTDNGEDALLMWVRLNES"
FT   gene            619895..620920
FT                   /gene="gcp"
FT                   /locus_tag="BL00845"
FT   CDS_pept        619895..620920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BL00845"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="Biological Process: proteolysis and
FT                   peptidolysis, Molecular Function: O-sialoglycoprotein
FT                   endopeptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL00845"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22203"
FT                   /db_xref="GOA:Q65N07"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N07"
FT                   /protein_id="AAU22203.1"
FT                   /translation="MNHKKDLYVLGIETSCDETAAAIVKNGTDIISNVVASQIESHKRF
FT                   GGVVPEIASRHHVEQITIVLEEAFAQADMTFDDIDAIAVTEGPGLVGALLIGVNAAKAL
FT                   SFARGIPLVGVHHIAGHIYANRLVQDIQFPAIALVVSGGHTELVYMKEHGSFEVIGETL
FT                   DDAAGEAYDKVARTMGLPYPGGPHIDKLAQKGEANVPLPRAWLEEGSYHFSFSGLKSAV
FT                   INTLHNASQKGETIAPEDLSASFQESVIDVLVTKTERAAEAYGVKQVLLAGGVAANKGL
FT                   RAALEKTFSSRPEIELLIPPLSLCTDNAAMIAAAGTVAFEKGIRGKYDMNGQPGLDLTS
FT                   Y"
FT   gene            complement(621160..623085)
FT                   /gene="ydiF"
FT                   /locus_tag="BL00849"
FT   CDS_pept        complement(621160..623085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiF"
FT                   /locus_tag="BL00849"
FT                   /product="ABC transporter"
FT                   /function="Molecular Function: ATP-binding cassette (ABC)
FT                   transporter activity, Molecular Function: ATP binding,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00849"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22205"
FT                   /db_xref="GOA:Q65N06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N06"
FT                   /protein_id="AAU22205.2"
FT                   /translation="MMILQVNQLSKSFGADTILTNIKLEVRSRDRIAVVGRNGAGKSTL
FT                   LKIIAGKLSYEKGDIIKPKDLTMGYLDQHSGLDSKLTLKEELLSVFDFLKKMEKEMRAI
FT                   EEKMAQAGPDKLESLMKTYDRLQQEFKDKGGYQYEAEVRSVMHGLGFAGFDDSVRVQDL
FT                   SGGQKTRLALGKMLLTKPDLLILDEPTNHLDIDTLTWLEQYLQSYSGAILIVSHDRYFL
FT                   DKVVTQVYEITRSQSKKYIGNYSSYLQLKAEQLERETKLYEKQQDEIAKLQDFVDRNLA
FT                   RASTTKRAQSRRKQLERMEIMDKPLGDEKSASFRFEITRQSGNDVLRVEDLTVSYQDQP
FT                   PLLRSLDFRITRGESVALVGPNGIGKSTLLKALIQKLQPVSGTIATGSHVSIGYYDQEQ
FT                   AELTSSKRVLDELWDDYPEMNEKDIRTCLGNFLFSGEDVLKPVHALSGGEKARLALAKL
FT                   MLQKANFLILDEPTNHLDLDSKEVLENALIDYPGTILFVSHDRYFINRIATKVLELSRD
FT                   KAEEYLGDYDYYTEKKAQQLELKELEKQTEERQKAASEKPGAKKSYEEEKELKRKERQR
FT                   QRRIEDIETRITAIEEQIEKNEELLCNPDVFQDHEKVQEIHSENEQLNEELEQLLSEWE
FT                   TLSTNE"
FT   gene            623232..623738
FT                   /gene="moaC"
FT                   /locus_tag="BL00846"
FT   CDS_pept        623232..623738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="BL00846"
FT                   /product="Molybdopterin cofactor biosynthesis protein MoaC"
FT                   /function="Biological Process: Mo-molybdopterin cofactor
FT                   biosynthesis"
FT                   /note="probable molybdopterin precursor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00846"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22206"
FT                   /db_xref="GOA:Q65N05"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N05"
FT                   /protein_id="AAU22206.1"
FT                   /translation="MNEFTHFNEQGRAKMVDISEKEASVRTAAAVSSVSMNREVHEKIK
FT                   NREIGKGDVLAVAQVAGIMAAKQTSAIIPMCHPIALKGVDIAFCWEKKEQKSILHIQSN
FT                   VKTKGSTGVEMEALTSASVCALTVYDMCKAADKGMVIGPTFLLEKTGGKNGDYKREKAD
FT                   VDMED"
FT   gene            623742..624389
FT                   /gene="rex"
FT                   /locus_tag="BL00847"
FT   CDS_pept        623742..624389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="BL00847"
FT                   /product="redox regulator Rex"
FT                   /function="Redox-sensing transcriptional repressor"
FT                   /note="similar to YdiH/Rex in B.subtilis. In B.subtilis has
FT                   motif that binds to promoters of cyd, ldh and ywcJ genes.
FT                   Deletion of this gene leads to induction of the general
FT                   stress(sigB) response"
FT                   /db_xref="EnsemblGenomes-Gn:BL00847"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22207"
FT                   /db_xref="GOA:Q65N04"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N04"
FT                   /protein_id="AAU22207.1"
FT                   /translation="MNMDHSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLSFFRKTLDQDETTNVTLIGVGNLGTAFLHYN
FT                   FIKNNNTKIAMAFDINEEKIGTEVGGVPVYDLNKLEEHMTDDDIPVAILTVPAQAAQSI
FT                   TDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYSMQEK"
FT   gene            624432..624611
FT                   /gene="tatAY"
FT                   /locus_tag="BL00848"
FT   CDS_pept        624432..624611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAY"
FT                   /locus_tag="BL00848"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="Biological Process: protein transport, Cellular
FT                   Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00848"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22208"
FT                   /db_xref="GOA:Q65N03"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q65N03"
FT                   /protein_id="AAU22208.1"
FT                   /translation="MPTIGPGSFILIVVVALLIFGPKKLPELGRAAGNTLREFKNATKG
FT                   LADDDSDNKKKEDQ"
FT   gene            624627..625394
FT                   /gene="tatCY"
FT                   /locus_tag="BL05049"
FT   CDS_pept        624627..625394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCY"
FT                   /locus_tag="BL05049"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BL05049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22209"
FT                   /db_xref="GOA:Q62YE9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE9"
FT                   /protein_id="AAU22209.2"
FT                   /translation="MKGKEMSLLEHITELRRRLVITFFFFVLFVAAGFFLAKPLIIYLQ
FT                   QTDEAKLLTLNAFKLTDPLFVYVQFAFIIGAVLTSPLVLYQLWAFISPGLYEKERKVTL
FT                   SYIPISIILFLGGIAFSYFILFPFVVDFMTRVSDDLNVNQVIGIHEYFQFLLQLTLPFG
FT                   LLFQMPVVIMFITRLGLVTPMFLAKIRKYAYFVLFVIAALITPPELLSHLMVSVPLLIL
FT                   YEISIVISRISYRQAQKTMIQEENQSFLNDHTK"
FT   gene            complement(625440..625631)
FT                   /gene="ydiK"
FT                   /locus_tag="BL05050"
FT   CDS_pept        complement(625440..625631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiK"
FT                   /locus_tag="BL05050"
FT                   /product="YdiK"
FT                   /db_xref="EnsemblGenomes-Gn:BL05050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22210"
FT                   /db_xref="GOA:Q62YE8"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE8"
FT                   /protein_id="AAU22210.1"
FT                   /translation="MRSPKFWGVIYLLTGVLFTYLAATSPGSMWSFYTILLMLFAAYNI
FT                   SISFKMFALAGRMKRKDQ"
FT   gene            complement(625631..626365)
FT                   /gene="ydiL"
FT                   /locus_tag="BL05051"
FT   CDS_pept        complement(625631..626365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiL"
FT                   /locus_tag="BL05051"
FT                   /product="Aldo/keto reductase"
FT                   /note="putative membrane-bound metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BL05051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22211"
FT                   /db_xref="GOA:Q62YE7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE7"
FT                   /protein_id="AAU22211.2"
FT                   /translation="MRKQYWFIILAYVLMQLSAVVGLPLLYFLGVGRGQPKAEAQLTLT
FT                   GVWSVIAFTLCLVIVLLILRTVPKTTLRNRPKASVAASIGWAVAGVFLALFAQSIAASI
FT                   EMNLFGVNPESENMQRIMKIITALPLMVFVSSVFGPILEEIIFRKIIFGAIYEKTNFFV
FT                   AALFSSVLFSVVHLDFSHLLIYTAMGFTFAFLYVRTNRIIVPIFAHVAMNTLVVLLQTF
FT                   REPIEEYLKNVEKMQMIIGGFL"
FT   gene            626591..626875
FT                   /gene="groES"
FT                   /locus_tag="BL03284"
FT   CDS_pept        626591..626875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BL03284"
FT                   /product="class I heat-shock protein (chaperonin)"
FT                   /function="Molecular Function: chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL03284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22212"
FT                   /db_xref="GOA:Q65MZ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MZ9"
FT                   /protein_id="AAU22212.1"
FT                   /translation="MLKPLGDRVVIELVESEEKTASGIVLPDSAKEKPQEGKVVAAGSG
FT                   RVLESGERVALEVKTGDRIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            626920..628554
FT                   /gene="groEL"
FT                   /locus_tag="BL03283"
FT   CDS_pept        626920..628554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BL03283"
FT                   /product="class I heat-shock protein (chaperonin)"
FT                   /db_xref="EnsemblGenomes-Gn:BL03283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22213"
FT                   /db_xref="GOA:Q65MZ8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MZ8"
FT                   /protein_id="AAU22213.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDALADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPVGVRKGIEQAVAVAVESLKEISKPIEGKESIAQVASISAADEEVGSLIAEA
FT                   MERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILVTD
FT                   KKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDISILTGAEVITEDLGLDLKSTQINQLGRASKVVVTKENTTIVEGAGDTEQI
FT                   AARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALVNVYNKVAALEAEGDELTGINIVLRALEEPIRQIAHNAGLE
FT                   GSVIVERLKNEEIGVGYNAATGEWVNMIDKGIVDPTKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEENKGGAGMPDMGGMGGMGGMM"
FT   gene            complement(629441..629533)
FT                   /locus_tag="BL03281"
FT   CDS_pept        complement(629441..629533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL03281"
FT                   /product="putative transporter"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL03281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22214"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE4"
FT                   /protein_id="AAU22214.2"
FT                   /translation="MIQDEHEGHGVRIRFTGLGYAAVPTGVFPQ"
FT   gene            complement(629655..629996)
FT                   /locus_tag="BL03280"
FT   CDS_pept        complement(629655..629996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL03280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22215"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE3"
FT                   /protein_id="AAU22215.2"
FT                   /translation="MNDVKKLEAYLKLNADGTLTLDPSYTKLDISRSVTNEVQDWIKYL
FT                   NDLVKQKEAVINSDFSVKILDKDGSVLTLENGNNHKMKVAKKGCGRSGHDLYWWGYNLY
FT                   FDCNETRTI"
FT   gene            complement(630431..630625)
FT                   /locus_tag="BL05052"
FT   CDS_pept        complement(630431..630625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22216"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE2"
FT                   /protein_id="AAU22216.2"
FT                   /translation="MEFNLTVLFSVFKPLPFLNRAESGETINIEGKIHYINHIRKVFHI
FT                   VEGDTNFIKFEDAVFREIK"
FT   gene            complement(631349..631480)
FT                   /locus_tag="BL05053"
FT   CDS_pept        complement(631349..631480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22217"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE1"
FT                   /protein_id="AAU22217.2"
FT                   /translation="MNPFTIFLTIFLKSPIFHKESNLGLAVLMPFADALAVERDYGQ"
FT   gene            631452..631661
FT                   /locus_tag="BL05054"
FT   CDS_pept        631452..631661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22218"
FT                   /db_xref="GOA:Q62YE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YE0"
FT                   /protein_id="AAU22218.1"
FT                   /translation="MVKKIVNGFNSFSLLGTIFFIGSYFTYKFNGVELVGFLYLGIIFL
FT                   TALIATTVMLIRLKRKGINKDKQA"
FT   gene            631804..632721
FT                   /gene="yoaR"
FT                   /locus_tag="BL03282"
FT   CDS_pept        631804..632721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaR"
FT                   /locus_tag="BL03282"
FT                   /product="conserved protein YoaR"
FT                   /note="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL03282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22219"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ6"
FT                   /protein_id="AAU22219.1"
FT                   /translation="MLKIWMTGLLLLAQPAGHSDSLTITQQGKKVAVVNREDFTMPLPG
FT                   TPMIDDKKYNEFVDRLERKVHKDPVNAVINDQGRIVPGKVGYSLSRKGFKEQFYAYFYG
FT                   DGPSTIEVPELNVYPKVDSELLSHIRTQRIGQYVTYFNSGNKSRTHNISLAAKAIDNHV
FT                   VFPNETFSFNKVVGMRTPDKGYMKAPVIVRGELSEGVGGGICQVSSTLFNAVDRAGLEI
FT                   VQRYSHSRRVPYVPPGRDATVSWGGPDLRFQNKYNQPVLIRAKRHGGTMVVTLYSSDVV
FT                   NHQLRKVPKAPAQIPKEEHQSGDH"
FT   gene            632839..633288
FT                   /gene="yfmQ"
FT                   /locus_tag="BL05055"
FT   CDS_pept        632839..633288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmQ"
FT                   /locus_tag="BL05055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22220"
FT                   /db_xref="InterPro:IPR019723"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ5"
FT                   /protein_id="AAU22220.1"
FT                   /translation="MTWLFVTFLVIFSLFKILVTCLPSGVVEWLTGKFQVHVKLEESNV
FT                   QVTFGGKRLEGSDKSRFIQNFNEAVFMERYYIYPGDEPLYVNPKNAGTPFVIETTKGKN
FT                   AVKLFVYRYDDHIDVVKQYKKKTAAYCLRSDSLQTCGGMKTADLI"
FT   gene            633512..633973
FT                   /locus_tag="BL01067"
FT   CDS_pept        633512..633973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01067"
FT                   /product="hypothetical protein"
FT                   /function="Molecular Function: N-acetyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22221"
FT                   /db_xref="GOA:Q65MZ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ4"
FT                   /protein_id="AAU22221.1"
FT                   /translation="MTIHIQQLEAPLNREFVDELINLWNDNTLETADCALDDQDREMIH
FT                   QQLEQYVQSAYGAVFAVVNEKQEAVGYGLASIKKDLVSDCLSGQIDEVYIAPDYRRNKL
FT                   GKLVADRMMDWFEQHQVSHVQVSVDIDNQSALHFWEGIGFSSDFYLLTN"
FT   gene            complement(634038..634712)
FT                   /gene="yoqW"
FT                   /locus_tag="BL01064"
FT   CDS_pept        complement(634038..634712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoqW"
FT                   /locus_tag="BL01064"
FT                   /product="YoqW"
FT                   /db_xref="EnsemblGenomes-Gn:BL01064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22222"
FT                   /db_xref="GOA:Q65MZ3"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ3"
FT                   /protein_id="AAU22222.1"
FT                   /translation="MCGRFTLFSEFDEIIDRFEIDQMAIEDYSPSYNIAPSQYILAVIN
FT                   DGSHNRLGRLRWGLIPPWSKDEKIGYKMINARAETLAEKPSFRKPLIRQRCLIPADSFY
FT                   EWKRTDAKTKRPMRIKLKTNRLFSFAGLWEKWQPAGGKPVYTCTIITTTPNDLMKDIHD
FT                   RMPVILDRQAEKEWLNPKNQNLAYLESLLKPYASKEMEAYEVAPLVNSPHHNSPELIKK
FT                   AP"
FT   gene            635144..635758
FT                   /locus_tag="BL01066"
FT   CDS_pept        635144..635758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01066"
FT                   /product="putative regulatory protein"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Biological Process: regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BL01066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22223"
FT                   /db_xref="GOA:Q65MZ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ2"
FT                   /protein_id="AAU22223.1"
FT                   /translation="MPLQLYEKEQILDACLEVFARHGYAKTSTGMLAEAAGISKALIFH
FT                   HFKSKKDLYLTVLDYCIEKVKSRLSLDDLASYDDFFEAKEKISMAKLEFFADYSNVYKL
FT                   TKDAFYSPPSELKKEIAAKYGEQFAVRNRILKQLFAKVPLREGVDREEAFELIMVMMGH
FT                   FEQKFLAEVTAEDDFDPAWSRRLLEERKRFLDMIRFGIEGE"
FT   gene            635774..638395
FT                   /locus_tag="BL01065"
FT   CDS_pept        635774..638395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01065"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /function="Biological Process: phosphorylation, Molecular
FT                   Function: transferase activity, transferring
FT                   phosphorus-containing groups"
FT                   /note="BL01065 similar to pps from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22224"
FT                   /db_xref="GOA:Q65MZ1"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ1"
FT                   /protein_id="AAU22224.1"
FT                   /translation="MGHYVLGFHEIDRTDLPLIGGKGLNLGELSKMDGIQVPPGFCITT
FT                   KAYEKMIGENDKVSEQIDQLSLLKVKDRKQINDLALQIRNGIERAEIAEEIKEAVKSAH
FT                   SNAGGDAYAVRSSATAEDLPHASFAGQQDTYLNIKGIEAILKHISKCWASLFTERAVIY
FT                   RIQNGFDHRKVQLSVVVQQMVFPDASGILFTADPITSNRKVTSIDASFALGEALVSGTV
FT                   SADNYKVREGAIIQKTISEKKTAVYSLESGGTEAREVEAGCRKEQTLTDEQIIRLEKLG
FT                   RRIEAHFGFPQDIEWCLADGEFFFVQSRPITTLFPLPKQSDDKLRVYMSVGHQQMMTEP
FT                   INPLGISFFGLISDYELTCAGGRLFIDLSHDLASFAGRKVVLSTAGKNDPFMHSALVNF
FT                   LKRKELVKTLPKGKRMFRLGAEGLSWSLPGDALKIYRKNDTDVVKRLMSKAEASIQEAE
FT                   QRLKNASGETLFAQIEEDQKSLKKVLYDSESMAVIMVGLYAVYWLNRKMEKWLGEKNVA
FT                   DTLSQSVLYNVTSEMGLALLDVSDAARGYPEVQKYLAYANNETFFEDLKQLDGGPAFIG
FT                   ALRAFLEKYGMRCTGEIDITKTRWSERPSILAPIILSNIKNFEPGARTAKFEQGRLEAE
FT                   KKERDLLSRLQQLKGGRQKAKRTKKMISVLRNFIGYREYPKYALIKRYFIYKEALMKEA
FT                   AVLQQKKLIQAKEDIYYLSFDELKEAVCTNRLDVKKIEERKAEYRHYEKLTPPRIMTSE
FT                   GEVITGEALGDHIPAGALAGVPVSSGIIEGRARVILKLEEADIEEGDILVTPFTDPSWT
FT                   PLFVSIKGLVTEVGGLMTHGAVIAREYGLPAVVGVEHATKEIKDGQKIRINGSEGYVEI
FT                   LE"
FT   gene            complement(638423..638707)
FT                   /gene="yoaF"
FT                   /locus_tag="BL01063"
FT   CDS_pept        complement(638423..638707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaF"
FT                   /locus_tag="BL01063"
FT                   /product="YoaF"
FT                   /db_xref="EnsemblGenomes-Gn:BL01063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22225"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MZ0"
FT                   /protein_id="AAU22225.1"
FT                   /translation="MEMNLFWIGLGLAALGYFIGDGLKNFKNPKGIYSGYPYLIKEDDL
FT                   HYYLGLSKVETKEMLRKYPDIPKIELNGTTYYPYQQLMDWMLSADLYKN"
FT   gene            complement(638773..639135)
FT                   /locus_tag="BL01062"
FT   CDS_pept        complement(638773..639135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL01062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22226"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY9"
FT                   /protein_id="AAU22226.1"
FT                   /translation="MPFILQRIYQENQQTEGRRILIDRVWPRGISKEKANPDCWMKEIA
FT                   PSPELRKWFGHDPKKFESFKEAYQNEIKQNAEKQKSFRELKKMAADETVILLYGAKDER
FT                   HNHAVVLYEMLNRQSL"
FT   gene            complement(639219..639983)
FT                   /gene="dltE"
FT                   /locus_tag="BL01061"
FT   CDS_pept        complement(639219..639983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltE"
FT                   /locus_tag="BL01061"
FT                   /product="DltE"
FT                   /function="involved in lipoteichoic acid biosynthesis,
FT                   Biological Process: metabolism, Molecular Function:
FT                   oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BL01061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22227"
FT                   /db_xref="GOA:Q65MY8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY8"
FT                   /protein_id="AAU22227.1"
FT                   /translation="MELSGNTVLITGGASGIGFAFAERFIKAGNTVIVCGRRESKLKEA
FT                   KEKHPELITCVCDVAVETERLALFEWIKEHHPGVNVLVNNAGIQQRYHILKADVIDNWA
FT                   DYNKEITVNMEAPIHLAMLFSRYFAEKAGKTAIINVSSGLAFTPMAVAPIYSSTKAALH
FT                   SFTMSLRHQLSEAGVEVIEVAPPAVNTDLGGVGLHDSGAPLDEFADAIFKGLEEGRLEI
FT                   GYAVSEKALRMSRDEIDESVSQLYSSLKHSIE"
FT   gene            640135..641607
FT                   /gene="pnbA"
FT                   /locus_tag="BL01300"
FT   CDS_pept        640135..641607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnbA"
FT                   /locus_tag="BL01300"
FT                   /product="para-nitrobenzyl esterase (intracellular esterase
FT                   B)"
FT                   /note="BL01300 similar to pnbA from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22228"
FT                   /db_xref="GOA:Q65MY7"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY7"
FT                   /protein_id="AAU22228.1"
FT                   /translation="MYDTTVETRFGKLKGRAENGVRIFKGVPYAKPPVGDLRFREPQRM
FT                   EAWEGELDAFQFGPVCPQPDGVLPESAGVQKSEDCLYLNVYAPEEADGDLPVMVWIHGG
FT                   AFYRGAGSEPLYDGTQLAKQGKVIVVTINYRLGPFGFLHLSSIDDSYSSNLGLLDQIAA
FT                   LEWVKDNIAFFGGDRHHITVFGESAGSMSIASLLAMPKAKGLFQQAIMESGASATMSDK
FT                   LAKAAAERFLRILDIDHHHLERLHDVSDQELLEAADQLRTLMGENIFELIFLPALDEKT
FT                   LPLKPEVAVAKGAAKEINLLIGTNRDEGVLFFPSDSDLLPESKINEILEEYMGKEAAEA
FT                   ASSLYPRSLEGHVDMMTDLIFWHPSVVFASAQSRYASVFMYRFDWHADSEQPPFNKAAH
FT                   GLEIPFVFGNMDILEQLTGTKAGEEAQLLAEQIQAAWVSFARSGNPSTDDVSWPDYDED
FT                   SRKTLIFDQEVAVESDPYSDKRKMLTAPNPQI"
FT   gene            complement(641632..642909)
FT                   /locus_tag="BL01294"
FT   CDS_pept        complement(641632..642909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01294"
FT                   /product="inositol transport protein"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="BL01294 similar to iolF from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22229"
FT                   /db_xref="GOA:Q65MY6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY6"
FT                   /protein_id="AAU22229.1"
FT                   /translation="MPGRKKGSLKSTITVAMSNYLEAGSIVAGAGGLSLWVEYLGLDDA
FT                   RVGLLGALSANGFGAAIGAFLGGFLVDRYGRKFIYKYDLLVYMLGVLLIAASFNFPMLL
FT                   TGYIVTGIAVGAAIPAAWTYIAEEAPDHERAGRVGWGQLAWSVGPALTLLLSVALAPLG
FT                   LMGSRLIFAQLFVVAVITWILQQQIHESSIWEEQKRKEAEDKAKGVEEKASIKELLTNK
FT                   ANLRAMILLIGIYAFWNLVAGTMGYFMPYIYETVGGLTAAQANLLQAFLWILTVASTYF
FT                   VFIRLGDKVNRKLLFGIGAAMATAAWVILTFGTMNITELLLFVCLWGISAGFGAQAFYG
FT                   LWAAELFHTKYRALAQGFMFFIVRIGVGLISLVVPAMITGLGFKTAGAVMIAFLVIHMI
FT                   IGLRMAPETRGKSLEAIQSERYHQSG"
FT   gene            643279..643959
FT                   /gene="pspA"
FT                   /locus_tag="BL01299"
FT   CDS_pept        643279..643959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="BL01299"
FT                   /product="phage shock protein A homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BL01299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22230"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY5"
FT                   /protein_id="AAU22230.1"
FT                   /translation="MSILSRFKDIMASNINALLDKAENTEKMVDQYVRNLNSDLNKVKA
FT                   ETASVMAAEQRAKRELADCRAEIDKLERYAMKALEAGSEADARTFLEKKAVLETKASEL
FT                   ETAFQTASSNANQMKKMHDKLVSDIGELEARRAAIKAKWTAAKTQERMNKLGASAANAN
FT                   HSMSAFGRMEEKANRALDEANAMAELNAAPQDDIEDLKAKYDSPSNVDDALAALKAKMA
FT                   GQKS"
FT   gene            643994..645019
FT                   /gene="ydjG"
FT                   /locus_tag="BL01298"
FT   CDS_pept        643994..645019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjG"
FT                   /locus_tag="BL01298"
FT                   /product="conserved protein YdjG"
FT                   /db_xref="EnsemblGenomes-Gn:BL01298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22231"
FT                   /db_xref="GOA:Q65MY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY4"
FT                   /protein_id="AAU22231.1"
FT                   /translation="MVISYKCPGCGDDMAFDAESGTLACRSCGRQDKIENIPEELKTAR
FT                   FTEDEATEYHCQNCGAILITEKETTATSCSFCGGAAVIADRLSGSLAPAKVIPFTISKE
FT                   EAADAFRKWCRKGLLTPKGFMSADRIKSITGMYVPFWMYDLNSKVQVSARCTKVHRYIQ
FT                   GDYIYTETEHYDAFRDINLDYIKVPVDASEKMNDQLMDKLEPYPYDQLKDFKTAYLAGY
FT                   IAEKYNYDDEELFPRAKSKISGYIESYIDSTLSGYSSVDVKTKHVDTQKVKSLYVLLPV
FT                   WMVNYNYKQKDYIFAMNGQTGKVVGKPPISSFKEKMWFSGLAVSIFALWKIIAAVMGGG
FT                   A"
FT   gene            645019..645786
FT                   /gene="ydjH"
FT                   /locus_tag="BL01297"
FT   CDS_pept        645019..645786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjH"
FT                   /locus_tag="BL01297"
FT                   /product="conserved membrane protein YdjH"
FT                   /db_xref="EnsemblGenomes-Gn:BL01297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22232"
FT                   /db_xref="GOA:Q65MY3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY3"
FT                   /protein_id="AAU22232.1"
FT                   /translation="MRSLLRSAMILCMIFLVFIPIASGAAASEQKRFVYDEAGLLTKQE
FT                   IEKLETLAAKLGAERETDFIIVTTNDTNGRDVKKYAEDFYDEKAPGYQKKHGNAAVLTV
FT                   DMEHREVYLAGFKKAEEYLNDARLDKIREKITPDISDKHYEAAFEMFMKAAHDDMEKKP
FT                   WADSIFFKTWFQLLVSAVIAGIAVAIMKYNSGGKVTVSASTYMNGDTSGVIRNNDEYIR
FT                   TTVTKQRKPSNNKSSGGGTTSGGHSHSGSRGSF"
FT   gene            645808..646782
FT                   /gene="ydjI"
FT                   /locus_tag="BL01296"
FT   CDS_pept        645808..646782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjI"
FT                   /locus_tag="BL01296"
FT                   /product="conserved protein YdjI"
FT                   /db_xref="EnsemblGenomes-Gn:BL01296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22233"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY2"
FT                   /protein_id="AAU22233.1"
FT                   /translation="MVFFRNQFANVVEWDEFRDDMIFYKWNNREIKKGSRLIIRPGQDA
FT                   VFLNNGKIEGIFQDEGDYDIESEIIPFLSTLKGFKFGFNSGMRAEVLFVNTKEFTVKWG
FT                   TKNAINIPAAGLPGGMPIRANGRFNFKVNDYVALIDKIAGVKDQYVVEDIKIRITSILD
FT                   QLLMKWITKEGKDMFNLQANAFDIAKGIKEDLDMEIVGDGMTITGFNIMSFNYPKEVQD
FT                   MITKNASHGMVGDLNRYQQISMTDGMASGKMTGGGAASDMAGMMMGMNVANQMMNQMNQ
FT                   NQQAQTQTPPSAPQPAAKPNFCPNCGTKTGEANFCPNCGQKLV"
FT   gene            647042..648097
FT                   /locus_tag="BL01295"
FT   CDS_pept        647042..648097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01295"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BL01295"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22234"
FT                   /db_xref="GOA:Q65MY1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY1"
FT                   /protein_id="AAU22234.1"
FT                   /translation="MELGISTFVETTPDIKTGKVISHAERLREVVEEIVLADQVGLDVF
FT                   GVGEHHRQDYAASSPAVVLAAAASQTKRIRLTSAVTVLSSADPVRVFQDFATLDGISNG
FT                   RAEIMAGRGSFIESFPLFGYDLDDYDELFEEKLDLLLELQKSERVTWSGKHRPAIHNTG
FT                   VYPRPVQKPLPVWIGSGGNQESVVRAGLLGLPLVLAIIGGSPQHFAPLVELYYKAAEHA
FT                   GHDASKLIVASHSHGFIAEDTETAADRFFPSTQQAMNTLARERGWGPYSRSSFDAARSF
FT                   EGALYVGDPETVAEKIIHLRKNVGITRFLLHVPVGSMPHEDVMKAIELFGTKTAPLVRE
FT                   EVSRWEASERS"
FT   gene            complement(648130..648957)
FT                   /gene="yrhO"
FT                   /locus_tag="BL01292"
FT   CDS_pept        complement(648130..648957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhO"
FT                   /locus_tag="BL01292"
FT                   /product="putative cyclodextrin metabolism protein YrhO"
FT                   /db_xref="EnsemblGenomes-Gn:BL01292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22235"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MY0"
FT                   /protein_id="AAU22235.1"
FT                   /translation="MKENILDVLKNLNFTEYESKAYLALLEESPLTGYAVAKKSGVPRS
FT                   KIYEVLESLVIRGDIFVSYGNTPQYIPVPAKDLIKNRRMKAEETFEQAEKYFEKFERTA
FT                   NDRENIWNITGRSEILDKVKACISSAGKRILLEIWKEDFPELEPELKRAAKKGVIVTII
FT                   AYGDIEADFANVYLHDNSRQITEEYDGRWLVFSVDDSEVVAGIVSHGKDSRAAWTMHVG
FT                   LVMPITEVMIHDLYLMEIMEKHREVLEESFGENLIHLRRKFSIHPDFKKHYMK"
FT   gene            649104..649736
FT                   /gene="yrhP"
FT                   /locus_tag="BL00683"
FT   CDS_pept        649104..649736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhP"
FT                   /locus_tag="BL00683"
FT                   /product="Lysine exporter protein YrhP"
FT                   /function="Molecular Function: lysine permease activity,
FT                   Biological Process: amino acid transport, Cellular
FT                   Component: membrane"
FT                   /note="RhtB subfamily of amino-acid-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00683"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22236"
FT                   /db_xref="GOA:Q65MX9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX9"
FT                   /protein_id="AAU22236.2"
FT                   /translation="MDSLLSYISIAAMMVVIPGADTMLVVKNTLRYGPNAGRCNVLGLA
FT                   TGLSFWTLIAVLGLAVVIAKSVILFNTIKYLGAAYLIYLGIKSFFAKKMFSLEEIQAEK
FT                   NKNENASSRHYKDSFMQGLFSNILNPKTVLVYITIMPQFINLRESVNQQLIILALILTF
FT                   LAVFWFLILVYLIDFAKKWLRSVKFQKIFQKAAGLVLVGFGVKTGLD"
FT   gene            649931..650575
FT                   /locus_tag="BL00684"
FT   CDS_pept        649931..650575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00684"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL00684"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22237"
FT                   /db_xref="GOA:Q65MX8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX8"
FT                   /protein_id="AAU22237.1"
FT                   /translation="MDEQKKNQLGVLLKEQLRKRSLSLRELSERTQIDKATISRIINGK
FT                   RKANLNHLQRFSESFGVSFDELMTAAGYAMEKTQESERPDIHSSVAEIEDVLQTSNVYD
FT                   RPFTMEELKNKLNECEQYSQTEEGKRTILAEFESKIEKVAGIGPFLTRLHDMYSRFTSG
FT                   RGTPRELLLMGGALLYFIVSVDVIPDYIFPIGYIDDAAAVHFVFNQLSYKS"
FT   gene            650591..651748
FT                   /locus_tag="BL00685"
FT   CDS_pept        650591..651748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00685"
FT                   /product="sporulation related protein Stage V"
FT                   /function="Biological Process: cell cycle, Cellular
FT                   Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00685"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22238"
FT                   /db_xref="GOA:Q65MX7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX7"
FT                   /protein_id="AAU22238.1"
FT                   /translation="MKRKHINIDISLLLILFCLFIISLLAVYSGSGQYETQDPFYFAKR
FT                   QVFWYLVGFGVMAGTAYIDYELLERLALRLFVGAVFLLILVHFFGTYKNGSQRWISFGV
FT                   IEIQPSEFMKIILILLLASILNQFQHKRFSFAESIIPTGKIMMYTVIPFFFILVQPDLG
FT                   SALVILSIAFTLMLVSGISGRMIVSLSLGFMALVAFLTYLHNHYFEIFSKIIKPHQLDR
FT                   IYGWLSPHEHASTYGYQLTQALLGIGSGQLSGSGFTQGIQVQGGKIPEAHTDFIFAVIG
FT                   EEFGFLGAVTLVCLYFLMIYRIIRIALSSNSLFGLYICAGVAGLIVFQVFQNIGMTIGL
FT                   MPITGLALPFISYGGSALLTNMIALGLVFSVNIRSKHYMFGNDWG"
FT   gene            651745..652893
FT                   /locus_tag="BL05056"
FT   CDS_pept        651745..652893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05056"
FT                   /product="cell-division protein"
FT                   /function="Biological Process: cell cycle, Cellular
FT                   Component: integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL05056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22239"
FT                   /db_xref="GOA:Q65MX6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX6"
FT                   /protein_id="AAU22239.1"
FT                   /translation="MKLLKMILSHLKKLDYVLIAAVLFLSAFGLLMVYSAGYPLGYMKY
FT                   HDGSYFFMKQLQWLLIGLAFFSAAAIFPYKAYSKLIRFLVKLSFLMLILVLLPGIGMEK
FT                   NNSQRWIQFGSLMIQPSEAVKLVMVIYFAYVYAKKQKYIADFGKGVMPPLLILAAVFFL
FT                   ILKQPDLGTAVSILLSCGAVLLCAGLRMRHLLLLGTMAGAGIAYFAITAPYRLKRLTSF
FT                   SDPFQNENGDGYQLINSYLAIDSGGLWGNGLGNSVQKLGFLPEAHTDFIMAVITEELGG
FT                   IGLAVIIWAYLLIMFRGVRIAVQIDDPFGKLLAVGLTFQIMIQALFNLGAVFGLLPITG
FT                   IPLPFVSYGGSSLLFMLTTAGILVNLSSHVKRGVKKDVAFLL"
FT   gene            complement(653347..653508)
FT                   /locus_tag="BL05057"
FT   CDS_pept        complement(653347..653508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22240"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YB8"
FT                   /protein_id="AAU22240.1"
FT                   /translation="MSRVPAKKKQHLLSLTAERFKKTAVFQICMSTDIYGNNSAFWYNK
FT                   GWQQFGSI"
FT   gene            complement(653582..654007)
FT                   /locus_tag="BL01194"
FT   CDS_pept        complement(653582..654007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL01194"
FT                   /product="conserved hypothetical protein"
FT                   /function="Molecular Function: cysteine-type endopeptidase
FT                   activity, Biological Process: proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BL01194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22241"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX5"
FT                   /protein_id="AAU22241.1"
FT                   /translation="MKTRFTPYILMNGRAKEAIDYYRDVLDAEVKFSQTIGEGPADEAA
FT                   NFKEDELDFIAHAVLTIGDAVLMIADIIPELPFQSGNQLSICVTAADVSSAKRLFGKLS
FT                   ERGEVKLELKETYFSPAYGIVTDPFGVAFQIFAARPA"
FT   gene            654102..655049
FT                   /locus_tag="BL05058"
FT   CDS_pept        654102..655049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL05058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BL05058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22242"
FT                   /db_xref="GOA:Q65MX4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX4"
FT                   /protein_id="AAU22242.2"
FT                   /translation="MSKAKRLNEMIMMVNRKKRFTVGELAREFGVSKRTVLRDLQELSE
FT                   MGVPLYSETGPHGGYQVLNERILPPIAFSENEAISIFFAIDALKHYISLPFDAQYASIK
FT                   KKFYLNLSGDIRDAIDSMKDRVAFYTPYEQTDDIPVLKVLLEAAVQQKVLIIEYEANGA
FT                   SSKRSIQPIGIYANQGKWYCPAYCFLRKDYRIFRCDRIKRAELDEHKAPIDLSGLNLKN
FT                   RFSALSRPRETLELSAELTKKGVERHGSLKWPHLELHVREDGSGVLKGEIAPKDIDFFA
FT                   DYFISFGREAVIQKPSKLIERMKRTLSDMLKQYG"
FT   gene            655266..655394
FT                   /locus_tag="BL07003"
FT   CDS_pept        655266..655394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL07003"
FT                   /product="hypothetical protein"
FT                   /note="BLi00653, RBL05904"
FT                   /db_xref="EnsemblGenomes-Gn:BL07003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP97350"
FT                   /db_xref="UniProtKB/TrEMBL:A4VF80"
FT                   /protein_id="ABP97350.1"
FT                   /translation="MLQKKMICYEFKRRLTKEHAYEKSDGYFRIPCTHSIAAIYHQ"
FT   gene            655327..656004
FT                   /locus_tag="BL00500"
FT   CDS_pept        655327..656004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BL00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22243"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX2"
FT                   /protein_id="AAU22243.1"
FT                   /translation="MKKAMAILGFLVLTASLLFIINKGTSQINASQNRKAAVHTEYYKD
FT                   ISSLSFPVFSDLKEEDAKLANDAVKLHLKNSYKEFQKIVNDAEKKDKDEENVYETSYKV
FT                   KYNEEGKLSFLIYDYQFSGGAHGMYTVTSYNFDFDKHKQVVLTDVLNNQAKIEKAKNYI
FT                   FSYINEHPEQFYSDLKKSDIRLDEHTAFYYTSSGISIVFQQYDIAPYAAGNQEIKLPST
FT                   LLY"
FT   gene            656076..657455
FT                   /gene="yjeA"
FT                   /locus_tag="BL00501"
FT   CDS_pept        656076..657455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="BL00501"
FT                   /product="Putative Carbohydrate Esterase Family 4 protein"
FT                   /function="Biological Process: carbohydrate metabolism,
FT                   Molecular Function: hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds"
FT                   /note="similar to endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00501"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22244"
FT                   /db_xref="GOA:Q62YB4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017219"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YB4"
FT                   /protein_id="AAU22244.2"
FT                   /translation="MSGKPSFRWVKMLIFLTILIGLAGYSYNKVSSNSQEPPQPKKDRG
FT                   QSGLGVESMVNDSKQERYAIHYPVFHIKEIDEQIKDYVNQELAGFKEDNAKAQAQDEDG
FT                   PFELNIKYKVVYYTKDTASVVLNQYIEAGGVSGTTSVKTFNADLKQKKLLSLQDLFEEN
FT                   SDFLNRISSIAYQELKNRNPSADMALLKEGTSPQEEHFSRFALLENEVEFYFEKKQTGL
FT                   EQSVKIKKEWVKDILKDRYQDMKKNRLQAKPDQEPVPLPKQAKINPDEKVIALTFDDGP
FT                   NPATTNKILNALQKHEGHATFFVLGSRAQYYPETIKRMLKEGNEVGNHSWDHPLLTRLS
FT                   NEKAYQEINDTQEMIEKISGHLPVHLRPPYGGINDSVRSLSNLKVSLWDVDPEDWKYKN
FT                   KQKIVNHVMSHAGDGKIVLMHDIYATSADAAEEIIKKLKAKGYQLVTVSQLEEVKKQRG
FT                   Y"
FT   gene            657584..659122
FT                   /gene="amyL"
FT                   /locus_tag="BL00499"
FT   CDS_pept        657584..659122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyL"
FT                   /locus_tag="BL00499"
FT                   /product="alpha amylase, Glycoside Hydrolase Family 13"
FT                   /function="Molecular Function: alpha-amylase activity,
FT                   Biological Process: carbohydrate metabolism"
FT                   /note="BL00499 similar to treA from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BL00499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22245"
FT                   /db_xref="GOA:Q65MX0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015237"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MX0"
FT                   /protein_id="AAU22245.1"
FT                   /translation="MKQQKRLYARLLPLLFALIFLLPHSAAAAANLKGTLMQYFEWYMP
FT                   NDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRT
FT                   KYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHR
FT                   IKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKAWDWEVSNENGNY
FT                   DYLMYADIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIKFSFLRDWVNHVREKT
FT                   GKEMFTVAEYWQNDLGALENYLNKTNFNHSVFDVPLHYQFHAASTQGGGYDMRKLLNGT
FT                   VVSKHPLKAVTFVDNHDTQPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTK
FT                   GDSQREIPALKHKIEPILKARKQYAYGAQHDYFDHHDIVGWTREGDSSVANSGLAALIT
FT                   DGPGGAKRMYVGRQNAGETWHDITGNRSEPVVINSEGWGEFHVNGGSVSIYVQR"
FT   gene            659285..660235
FT                   /gene="yvdE"
FT                   /locus_tag="BL00498"
FT   CDS_pept        659285..660235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdE"
FT                   /locus_tag="BL00498"
FT                   /product="probable transcriptional regulator YvdE"
FT                   /function="Molecular Function: transcription factor
FT                   activity, Cellular Component: intracellular, Biological
FT                   Process: regulation of transcription, DNA-dependent"
FT                   /note="probable transcriptional regulator (LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:BL00498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22246"
FT                   /db_xref="GOA:Q65MW9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW9"
FT                   /protein_id="AAU22246.1"
FT                   /translation="MATLSDVAKKANVSKMTVSRVINHPETVTDELKKLVHSAMKELNY
FT                   IPNYAARALVQNRTQVVKLLILEEMDTTEPYYMNLLTGISRELDRHHYALQLVTRKSLN
FT                   IGQCDGIIATGLRKADFEGLIKVFEKPVVVFGQNEMGYDFIDVNNEKGTYMATRHVIGL
FT                   GVRNVVFFGIDLDEPFERSREKGYLQAMEGSLKKAAIFRMENSSKKSEARAREVLASFD
FT                   APAAVVCASDRIALGVIRAVQSLGKRIPEDVAVTGYDGVFLDRIASPRLTTVRQPVVEM
FT                   GEACARILLKKINEDGAPQGNQFFEPELIVRESTL"
FT   gene            660354..662114
FT                   /gene="yvdF"
FT                   /locus_tag="BL00497"
FT   CDS_pept        660354..662114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdF"
FT                   /locus_tag="BL00497"
FT                   /product="Glycoside Hydrolase Family 13 YvdF"
FT                   /function="Molecular Function: alpha-amylase activity,
FT                   Biological Process: carbohydrate metabolism"
FT                   /note="putative neopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22247"
FT                   /db_xref="GOA:Q62YB1"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q62YB1"
FT                   /protein_id="AAU22247.1"
FT                   /translation="MEYAAIHHQPFSSDAYSYNGRTLHIKIRTKKDDAEHVRLVWGDPY
FT                   EYTGGTWKANELAMAKIAATSTHDYWFAEVAPPFRRLQYGFILTGADDRDTFYGSNGAC
FT                   PFAGKAADIGKHCFKFPFVHEADTFDAPDWVKSTVWYQIFPERFASGREDLSPENALPW
FT                   GSKDPEAHDFFGGDLQGIMDKLDYLEDLGVGGIYLTPIFAAPSNHKYDTLDYCSIDPHF
FT                   GDEELFRTLVSRIHERGMKIMLDAVFNHIGSASQEWQDVVKNGETSRYKDWFHIHSFPV
FT                   KEGSYDTFAFTPEMPKLNTANPEVQAYLLDIALYWIREFDIDGWRLDVANEVDHAFWKK
FT                   FRQAVTAEKPDIFILGEIWHQADPWLRGDEFHSVMNYPFTEPMIDYFADGSISASQMAS
FT                   RINSHLMSGMKQVNEVMFNLLDSHDTKRILTRCGGDDKKVRSLLAFMFAQTGSPCIYYG
FT                   TEVGLDGGDDPLCRKCMVWEEEKQNQEMLAFMKRLIALRKQENDVLTYGALEWKLVDDQ
FT                   NDFVSFSRTHEGKELIYFFHQGSEVRRVRLRDLKIASDKRIYDAWTEEALQHDDVVDIQ
FT                   PGGFFILGAV"
FT   gene            662209..663462
FT                   /gene="mdxE"
FT                   /locus_tag="BL00496"
FT   CDS_pept        662209..663462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxE"
FT                   /locus_tag="BL00496"
FT                   /product="maltodextrin transport system substrate-binding
FT                   protein MdxE"
FT                   /function="maltodextrin binding and transport Molecular
FT                   Function: transporter activity, Biological Process:
FT                   transport"
FT                   /note="MdxE is substrate binding part of the maltodextrin
FT                   ABC transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BL00496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22248"
FT                   /db_xref="GOA:Q65MW7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW7"
FT                   /protein_id="AAU22248.1"
FT                   /translation="MQHLKKGILVLLASVLLFGLAACSSSKETGGSGGKKVLTVSVEEV
FT                   YKPYVESIKEGFEKENDVTVKIVEKPMFDQLEALPLDGPAGNAPDVMLAAYDRIGGLGQ
FT                   QGHLLEVKPSDTKSFGDKEMQQVTVGGKVYGIPLVIETLVLYYNKDLLKTPPKTFNELE
FT                   DLTKDKRFAFSSEKGKSTAFLAKWTDFYMSYGLMAGYGGYVFGADGTDSGDIGLNNKGA
FT                   VEAVEYAEKWFSEYWPKGMQDNTSADDFIQQTFMDGKAAAVIGGPWSASNYKEAGLNYG
FT                   AAKIPTLPNGKEYAPFAGGKGWVASKYTKEPELAEKWLQYAANDENAYRFYEDTNEVPA
FT                   NLAARKKAGEQKSELTSAVITQYETATPTPNIPEMAEVWTGAESLIFDAAAGKKSAQQS
FT                   ADDAVRVIKENIKEKYVK"
FT   gene            663504..664811
FT                   /gene="mdxF"
FT                   /locus_tag="BL00495"
FT   CDS_pept        663504..664811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxF"
FT                   /locus_tag="BL00495"
FT                   /product="maltodextrin transport system permease protein
FT                   MdxF"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BL00495"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22249"
FT                   /db_xref="GOA:Q65MW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW6"
FT                   /protein_id="AAU22249.1"
FT                   /translation="MNKDQTLANRSRKAALLSIIPGAGQIANRQFSKGILFLVITGLFI
FT                   CELAIFGYQALIGLVTLGTVPGEDHSLFLLIEGTLQLILTLVFLMFYIFNLYDARKTAA
FT                   MKAAGLKISETAGDMIRNAGDKGFPYLFTLPAYLMMVFVIIFPVLVTLFIAFTNYDFYH
FT                   IPPNSLIDWVGFKNFMNIFFLGSYRQTFADVLGWTIIWTICATTLQIVLGIVTALIVNQ
FT                   NFIKGKRMFRIIFLLPWAVPAFITIMSFANIFNDSAGAMNVQVIPLLNQLPFVDIPAVA
FT                   WKTDPFWTKTALIMIQTWLGFPYIYVMVTGVLQAIPGELYEAAKIDGATFIQRFKHITL
FT                   PMILFATAPVMITQYTFNFNNFSIIYLFNEGGPGSAGAGAGSTDILISWIYKLTTGTSP
FT                   QYSVAAAVTLLISFIVIGVSLIAFKKSNAFGNEEVM"
FT   gene            664812..665663
FT                   /gene="mdxG"
FT                   /locus_tag="BL00494"
FT   CDS_pept        664812..665663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxG"
FT                   /locus_tag="BL00494"
FT                   /product="maltodextrin transport system permease protein
FT                   MdxG"
FT                   /function="Molecular Function: transporter activity,
FT                   Biological Process: transport, Cellular Component:
FT                   membrane"
FT                   /note="MdxG - part of ABC transport system for
FT                   maltodextrins, membrane spanning component"
FT                   /db_xref="EnsemblGenomes-Gn:BL00494"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22250"
FT                   /db_xref="GOA:Q65MW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW5"
FT                   /protein_id="AAU22250.1"
FT                   /translation="MRGLFKNTRFTGMLNKVLTYIFLAFLSIVIIYPLLITASSAFRVG
FT                   NVAAFTLDFSGAWTLDHFKRLFEETLYLNWYGNTLVIALSVMVFQVTIVTLAGYTYSRY
FT                   RFAGRKKSLIFFLIIQMVPTMAALTAFYVLAMLIGALDQYWFLTAIYIGGGIPMNTWLM
FT                   KGYFDTVPREIDEAARIDGAGHLRIFASVVLPLVKPMLAVQALWAFMGPFGDYLLAKFL
FT                   LRSPESLTIAVGLQTFISNPQQQKVALFAAGAILAALPICILFFFLQKNFVSGLTSGGT
FT                   KG"
FT   gene            665668..666549
FT                   /gene="yvdJ"
FT                   /locus_tag="BL00493"
FT   CDS_pept        665668..666549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdJ"
FT                   /locus_tag="BL00493"
FT                   /product="conserved membrane protein YvdJ"
FT                   /db_xref="EnsemblGenomes-Gn:BL00493"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22251"
FT                   /db_xref="GOA:Q65MW4"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW4"
FT                   /protein_id="AAU22251.1"
FT                   /translation="MNDMRNEKLIVRFLKAAASPAGVMRCKHAFSWLEISFLFMFLTAC
FT                   LMAPMTLAFMKMDRFNAGYLIPNVAQEADAAFIKQLKGYQLTNGRLKGEDELYRVEKGR
FT                   TLLAVDLKDELKTSGENGRIKAEGYQNALIFQSDHLIISDQSGAGFSVRYPAKAGLNDL
FT                   DAGHLGDFIGAMWFAQYKPLIIMLACSAVFIISLFLTAVLAGGIWISKKSNMTGIRSFK
FT                   EAAAAAVCGSALPAGAAMAFGMISFDFIAMLLIHSCGSALMVSFIFRHIFKNRHHNENL
FT                   QSGGNHGKSAAI"
FT   gene            666527..668809
FT                   /gene="yvdK"
FT                   /locus_tag="BL00492"
FT   CDS_pept        666527..668809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdK"
FT                   /locus_tag="BL00492"
FT                   /product="Glycoside Hydrolase Family 65, YvdK"
FT                   /note="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BL00492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22252"
FT                   /db_xref="GOA:Q65MW3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q65MW3"
FT                   /protein_id="AAU22252.1"
FT                   /translation="MANQRLFEIDQWKIKTNKFEKEHKRLQESLTSLANGYMGIRGNFE
FT                   ESYSGESLKGTYIAGVWFPDKTRVGWWKNGYPEYFGKVINAMNFIGIDVYVDDEKVDLS
FT                   QNDIESFELELNMKEGILRRSAVVRVNQKAVKISSERFLSLDVPQLCAIHYEAECLSDE
FT                   AVITLVPYLDGNVANEDANFEERFWQEEAKGAESHRGHLVTKTIENPFGTPRFTVAASM
FT                   CNVTEGYVSEHFQTDAMYAENRYCYEVGPGTKASLKKLIIVTTSRDFEEAELLVQGRAL
FT                   LADVLRQGYEEAKRRHTEHWMERWAKADIEIKGDDELQQGIRYNLFQLFSTYYGADSRL
FT                   NIGPKGFTGEKYGGAAYWDTEAYAVPMYLATAEPEVTKNLLLYRYHHLEAAKRNAAKLG
FT                   LKGALYPMVTFTGDECHNEWEITFEEIHRNGAICYAIYNYVNYTGDRDYMKEYGIDVLV
FT                   EISRFWADRVHFSKRNNKYMIHGVTGPNEYENNVNNNWYTNLIASWTLEYTLENLAILP
FT                   EEKRRRLDVREAEIEKWKDIIERMYYPYSEELNVFIQHDTFLDKELQAADELEPGDRPL
FT                   YQNWSWDKILRSSFIKQADVLQGIYFFNHRFTMEEKRRNFEFYEPMTVHESSLSPSVHA
FT                   VLAAELKMEKKALELYKRTARLDLDNYNHDTEEGLHITSMTGSWLAIVQGFAGMRTQDE
FT                   KLSFAPFLPKEWDGYSFNINYRDRLINVQVEENSVVFSLLKGEPLSMTVYGEQIALNGR
FT                   YERRMAR"
FT   gene            668806..670512
FT                   /gene="malL"
FT                   /locus_tag="BL00491"
FT   CDS_pept        668806..670512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL"
FT                   /locus_tag="BL00491"
FT                   /product="Glycoside Hydrolase Family 13, MalL"
FT                   /function="maltodextrin utilization, Molecular Function:
FT                   alpha-amylase activity, Biological Process: carbohydrate
FT                   metabolism"
FT                   /note="similar to oligo-1,4-1,6-alpha-glucosidase
FT                   (sucrase-maltase-isomaltase)"
FT                   /db_xref="EnsemblGenomes-Gn:BL00491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU22253"
FT                   /db_xref="GOA:Q65MW2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="Inter