(data stored in ACNUC7421 zone)

EMBL: CP000003

ID   CP000003; SV 1; circular; genomic DNA; STD; PRO; 1899877 BP.
XX
AC   CP000003;
XX
PR   Project:PRJNA12469;
XX
DT   15-OCT-2004 (Rel. 81, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Streptococcus pyogenes MGAS10394, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes MGAS10394
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-1899877
RX   DOI; 10.1086/422697.
RX   PUBMED; 15272401.
RA   Banks D.J., Porcella S.F., Barbian K.D., Beres S.B., Philips L.E.,
RA   Voyich J.M., DeLeo F.R., Martin J.M., Somerville G.A., Musser J.M.;
RT   "Progress toward characterization of the group A Streptococcus metagenome:
RT   complete genome sequence of a macrolide-resistant serotype M6 strain";
RL   J. Infect. Dis. 190(4):727-738(2004).
XX
RN   [2]
RP   1-1899877
RA   Banks D.J., Porcella S.F., Barbian K.D., Beres S.B., Philips L.E.,
RA   Voyich J.M., DeLeo F.R., Martin J.M., Somerville G.A., Musser J.M.;
RT   ;
RL   Submitted (20-JUL-2004) to the INSDC.
RL   Laboratory of Human Bacterial Pathogenesis, Rocky Mountain Laboratories,
RL   National Institute of Allergy and Infectious Disease, National Institutes
RL   of Health, 903 S. 4th Street, Hamilton, MT 59840, USA
XX
DR   MD5; 5e6a6c858c5bb0301f29dccd601bd83d.
DR   BioSample; SAMN02603497.
DR   EnsemblGenomes-Gn; EBG00001059983.
DR   EnsemblGenomes-Gn; EBG00001059984.
DR   EnsemblGenomes-Gn; EBG00001059985.
DR   EnsemblGenomes-Gn; EBG00001059986.
DR   EnsemblGenomes-Gn; EBG00001059988.
DR   EnsemblGenomes-Gn; EBG00001059990.
DR   EnsemblGenomes-Gn; EBG00001059991.
DR   EnsemblGenomes-Gn; EBG00001059992.
DR   EnsemblGenomes-Gn; EBG00001059993.
DR   EnsemblGenomes-Gn; EBG00001059994.
DR   EnsemblGenomes-Gn; EBG00001059995.
DR   EnsemblGenomes-Gn; EBG00001059996.
DR   EnsemblGenomes-Gn; EBG00001059997.
DR   EnsemblGenomes-Gn; EBG00001059998.
DR   EnsemblGenomes-Gn; EBG00001059999.
DR   EnsemblGenomes-Gn; EBG00001060000.
DR   EnsemblGenomes-Gn; EBG00001060001.
DR   EnsemblGenomes-Gn; EBG00001060002.
DR   EnsemblGenomes-Gn; EBG00001060003.
DR   EnsemblGenomes-Gn; EBG00001060004.
DR   EnsemblGenomes-Gn; EBG00001060005.
DR   EnsemblGenomes-Gn; EBG00001060006.
DR   EnsemblGenomes-Gn; EBG00001060007.
DR   EnsemblGenomes-Gn; EBG00001060008.
DR   EnsemblGenomes-Gn; EBG00001060009.
DR   EnsemblGenomes-Gn; EBG00001060010.
DR   EnsemblGenomes-Gn; EBG00001060011.
DR   EnsemblGenomes-Gn; EBG00001060012.
DR   EnsemblGenomes-Gn; EBG00001060014.
DR   EnsemblGenomes-Gn; EBG00001060015.
DR   EnsemblGenomes-Gn; EBG00001060016.
DR   EnsemblGenomes-Gn; EBG00001060017.
DR   EnsemblGenomes-Gn; EBG00001060018.
DR   EnsemblGenomes-Gn; EBG00001060020.
DR   EnsemblGenomes-Gn; EBG00001060021.
DR   EnsemblGenomes-Gn; EBG00001060022.
DR   EnsemblGenomes-Gn; EBG00001060023.
DR   EnsemblGenomes-Gn; EBG00001060024.
DR   EnsemblGenomes-Gn; EBG00001060025.
DR   EnsemblGenomes-Gn; EBG00001060026.
DR   EnsemblGenomes-Gn; EBG00001060027.
DR   EnsemblGenomes-Gn; EBG00001060028.
DR   EnsemblGenomes-Gn; EBG00001060029.
DR   EnsemblGenomes-Gn; EBG00001060030.
DR   EnsemblGenomes-Gn; EBG00001060031.
DR   EnsemblGenomes-Gn; EBG00001060032.
DR   EnsemblGenomes-Gn; EBG00001060033.
DR   EnsemblGenomes-Gn; EBG00001060034.
DR   EnsemblGenomes-Gn; EBG00001060036.
DR   EnsemblGenomes-Gn; EBG00001060038.
DR   EnsemblGenomes-Gn; EBG00001060040.
DR   EnsemblGenomes-Gn; EBG00001060042.
DR   EnsemblGenomes-Gn; EBG00001060044.
DR   EnsemblGenomes-Gn; EBG00001060045.
DR   EnsemblGenomes-Gn; EBG00001060046.
DR   EnsemblGenomes-Gn; EBG00001060047.
DR   EnsemblGenomes-Gn; EBG00001060049.
DR   EnsemblGenomes-Gn; EBG00001060051.
DR   EnsemblGenomes-Gn; EBG00001060053.
DR   EnsemblGenomes-Gn; EBG00001060054.
DR   EnsemblGenomes-Gn; EBG00001060055.
DR   EnsemblGenomes-Gn; EBG00001060056.
DR   EnsemblGenomes-Gn; EBG00001060057.
DR   EnsemblGenomes-Gn; EBG00001060058.
DR   EnsemblGenomes-Gn; EBG00001060059.
DR   EnsemblGenomes-Gn; EBG00001060060.
DR   EnsemblGenomes-Gn; EBG00001060061.
DR   EnsemblGenomes-Gn; EBG00001060062.
DR   EnsemblGenomes-Gn; EBG00001060063.
DR   EnsemblGenomes-Gn; EBG00001060064.
DR   EnsemblGenomes-Gn; EBG00001060065.
DR   EnsemblGenomes-Gn; EBG00001060066.
DR   EnsemblGenomes-Gn; EBG00001060067.
DR   EnsemblGenomes-Gn; EBG00001060068.
DR   EnsemblGenomes-Gn; EBG00001060069.
DR   EnsemblGenomes-Gn; EBG00001060070.
DR   EnsemblGenomes-Gn; EBG00001060072.
DR   EnsemblGenomes-Gn; EBG00001060074.
DR   EnsemblGenomes-Gn; EBG00001060076.
DR   EnsemblGenomes-Gn; EBG00001060078.
DR   EnsemblGenomes-Gn; EBG00001060079.
DR   EnsemblGenomes-Gn; EBG00001060080.
DR   EnsemblGenomes-Gn; EBG00001060081.
DR   EnsemblGenomes-Gn; EBG00001060084.
DR   EnsemblGenomes-Gn; EBG00001060086.
DR   EnsemblGenomes-Gn; EBG00001060088.
DR   EnsemblGenomes-Gn; EBG00001060089.
DR   EnsemblGenomes-Gn; EBG00001060090.
DR   EnsemblGenomes-Gn; EBG00001060091.
DR   EnsemblGenomes-Gn; EBG00001060092.
DR   EnsemblGenomes-Gn; EBG00001060093.
DR   EnsemblGenomes-Gn; EBG00001060094.
DR   EnsemblGenomes-Gn; EBG00001060095.
DR   EnsemblGenomes-Gn; EBG00001060097.
DR   EnsemblGenomes-Gn; EBG00001060099.
DR   EnsemblGenomes-Gn; EBG00001060100.
DR   EnsemblGenomes-Gn; EBG00001060101.
DR   EnsemblGenomes-Gn; EBG00001060102.
DR   EnsemblGenomes-Gn; EBG00001060103.
DR   EnsemblGenomes-Gn; EBG00001060104.
DR   EnsemblGenomes-Gn; EBG00001060105.
DR   EnsemblGenomes-Gn; EBG00001060106.
DR   EnsemblGenomes-Gn; EBG00001060107.
DR   EnsemblGenomes-Gn; EBG00001060108.
DR   EnsemblGenomes-Gn; EBG00001060109.
DR   EnsemblGenomes-Gn; EBG00001060110.
DR   EnsemblGenomes-Gn; EBG00001060111.
DR   EnsemblGenomes-Gn; EBG00001060112.
DR   EnsemblGenomes-Gn; M6_Spys1887.
DR   EnsemblGenomes-Gn; M6_Spys1888.
DR   EnsemblGenomes-Gn; M6_Spys1889.
DR   EnsemblGenomes-Gn; M6_Spys1890.
DR   EnsemblGenomes-Gn; M6_Spys1891.
DR   EnsemblGenomes-Gn; M6_Spys1892.
DR   EnsemblGenomes-Gn; M6_Spys1893.
DR   EnsemblGenomes-Gn; M6_Spys1894.
DR   EnsemblGenomes-Gn; M6_Spys1895.
DR   EnsemblGenomes-Gn; M6_Spys1896.
DR   EnsemblGenomes-Gn; M6_Spys1897.
DR   EnsemblGenomes-Gn; M6_Spys1898.
DR   EnsemblGenomes-Gn; M6_Spys1899.
DR   EnsemblGenomes-Gn; M6_Spys1900.
DR   EnsemblGenomes-Gn; M6_Spys1901.
DR   EnsemblGenomes-Gn; M6_Spys1902.
DR   EnsemblGenomes-Gn; M6_Spys1903.
DR   EnsemblGenomes-Gn; M6_Spys1904.
DR   EnsemblGenomes-Gn; M6_Spys1905.
DR   EnsemblGenomes-Gn; M6_Spys1906.
DR   EnsemblGenomes-Gn; M6_Spys1907.
DR   EnsemblGenomes-Gn; M6_Spys1908.
DR   EnsemblGenomes-Gn; M6_Spys1909.
DR   EnsemblGenomes-Gn; M6_Spys1910.
DR   EnsemblGenomes-Gn; M6_Spys1911.
DR   EnsemblGenomes-Gn; M6_Spys1912.
DR   EnsemblGenomes-Gn; M6_Spys1913.
DR   EnsemblGenomes-Gn; M6_Spys1914.
DR   EnsemblGenomes-Gn; M6_Spys1915.
DR   EnsemblGenomes-Gn; M6_Spys1916.
DR   EnsemblGenomes-Gn; M6_Spys1917.
DR   EnsemblGenomes-Gn; M6_Spys1918.
DR   EnsemblGenomes-Gn; M6_Spys1919.
DR   EnsemblGenomes-Gn; M6_Spys1920.
DR   EnsemblGenomes-Gn; M6_Spys1921.
DR   EnsemblGenomes-Gn; M6_Spys1922.
DR   EnsemblGenomes-Gn; M6_Spys1923.
DR   EnsemblGenomes-Gn; M6_Spys1924.
DR   EnsemblGenomes-Gn; M6_Spys1925.
DR   EnsemblGenomes-Gn; M6_Spys1926.
DR   EnsemblGenomes-Gn; M6_Spys1927.
DR   EnsemblGenomes-Gn; M6_Spys1928.
DR   EnsemblGenomes-Gn; M6_Spys1929.
DR   EnsemblGenomes-Gn; M6_Spys1930.
DR   EnsemblGenomes-Gn; M6_Spys1931.
DR   EnsemblGenomes-Gn; M6_Spys1932.
DR   EnsemblGenomes-Gn; M6_Spys1933.
DR   EnsemblGenomes-Gn; M6_Spys1934.
DR   EnsemblGenomes-Gn; M6_Spys1935.
DR   EnsemblGenomes-Gn; M6_Spys1936.
DR   EnsemblGenomes-Gn; M6_Spys1937.
DR   EnsemblGenomes-Gn; M6_Spys1938.
DR   EnsemblGenomes-Gn; M6_Spys1939.
DR   EnsemblGenomes-Gn; M6_Spys1940.
DR   EnsemblGenomes-Gn; M6_Spys1941.
DR   EnsemblGenomes-Gn; M6_Spys1942.
DR   EnsemblGenomes-Gn; M6_Spys1943.
DR   EnsemblGenomes-Gn; M6_Spys1944.
DR   EnsemblGenomes-Gn; M6_Spys1945.
DR   EnsemblGenomes-Gn; M6_Spys1946.
DR   EnsemblGenomes-Gn; M6_Spys1947.
DR   EnsemblGenomes-Gn; M6_Spys1948.
DR   EnsemblGenomes-Gn; M6_Spys1949.
DR   EnsemblGenomes-Gn; M6_Spys1950.
DR   EnsemblGenomes-Gn; M6_Spys1951.
DR   EnsemblGenomes-Gn; M6_Spys1952.
DR   EnsemblGenomes-Gn; M6_Spys1953.
DR   EnsemblGenomes-Gn; M6_Spys1954.
DR   EnsemblGenomes-Gn; M6_Spys1955.
DR   EnsemblGenomes-Gn; M6_Spys1956.
DR   EnsemblGenomes-Gn; M6_Spys1957.
DR   EnsemblGenomes-Gn; M6_Spys1958.
DR   EnsemblGenomes-Gn; M6_Spys1959.
DR   EnsemblGenomes-Gn; M6_Spys1960.
DR   EnsemblGenomes-Gn; M6_Spys1961.
DR   EnsemblGenomes-Gn; M6_Spys1962.
DR   EnsemblGenomes-Gn; M6_Spys1963.
DR   EnsemblGenomes-Gn; M6_Spys1964.
DR   EnsemblGenomes-Gn; M6_Spys1965.
DR   EnsemblGenomes-Gn; M6_Spys1966.
DR   EnsemblGenomes-Gn; M6_Spys1967.
DR   EnsemblGenomes-Gn; M6_Spys1968.
DR   EnsemblGenomes-Gn; M6_Spys1969.
DR   EnsemblGenomes-Gn; M6_Spys1970.
DR   EnsemblGenomes-Gn; M6_Spys1971.
DR   EnsemblGenomes-Tr; EBT00001662788.
DR   EnsemblGenomes-Tr; EBT00001662789.
DR   EnsemblGenomes-Tr; EBT00001662790.
DR   EnsemblGenomes-Tr; EBT00001662791.
DR   EnsemblGenomes-Tr; EBT00001662792.
DR   EnsemblGenomes-Tr; EBT00001662793.
DR   EnsemblGenomes-Tr; EBT00001662794.
DR   EnsemblGenomes-Tr; EBT00001662795.
DR   EnsemblGenomes-Tr; EBT00001662796.
DR   EnsemblGenomes-Tr; EBT00001662797.
DR   EnsemblGenomes-Tr; EBT00001662798.
DR   EnsemblGenomes-Tr; EBT00001662799.
DR   EnsemblGenomes-Tr; EBT00001662800.
DR   EnsemblGenomes-Tr; EBT00001662801.
DR   EnsemblGenomes-Tr; EBT00001662802.
DR   EnsemblGenomes-Tr; EBT00001662803.
DR   EnsemblGenomes-Tr; EBT00001662804.
DR   EnsemblGenomes-Tr; EBT00001662805.
DR   EnsemblGenomes-Tr; EBT00001662806.
DR   EnsemblGenomes-Tr; EBT00001662807.
DR   EnsemblGenomes-Tr; EBT00001662808.
DR   EnsemblGenomes-Tr; EBT00001662809.
DR   EnsemblGenomes-Tr; EBT00001662810.
DR   EnsemblGenomes-Tr; EBT00001662811.
DR   EnsemblGenomes-Tr; EBT00001662812.
DR   EnsemblGenomes-Tr; EBT00001662813.
DR   EnsemblGenomes-Tr; EBT00001662814.
DR   EnsemblGenomes-Tr; EBT00001662815.
DR   EnsemblGenomes-Tr; EBT00001662816.
DR   EnsemblGenomes-Tr; EBT00001662817.
DR   EnsemblGenomes-Tr; EBT00001662818.
DR   EnsemblGenomes-Tr; EBT00001662819.
DR   EnsemblGenomes-Tr; EBT00001662820.
DR   EnsemblGenomes-Tr; EBT00001662821.
DR   EnsemblGenomes-Tr; EBT00001662822.
DR   EnsemblGenomes-Tr; EBT00001662823.
DR   EnsemblGenomes-Tr; EBT00001662824.
DR   EnsemblGenomes-Tr; EBT00001662825.
DR   EnsemblGenomes-Tr; EBT00001662826.
DR   EnsemblGenomes-Tr; EBT00001662827.
DR   EnsemblGenomes-Tr; EBT00001662828.
DR   EnsemblGenomes-Tr; EBT00001662829.
DR   EnsemblGenomes-Tr; EBT00001662830.
DR   EnsemblGenomes-Tr; EBT00001662831.
DR   EnsemblGenomes-Tr; EBT00001662832.
DR   EnsemblGenomes-Tr; EBT00001662833.
DR   EnsemblGenomes-Tr; EBT00001662834.
DR   EnsemblGenomes-Tr; EBT00001662835.
DR   EnsemblGenomes-Tr; EBT00001662836.
DR   EnsemblGenomes-Tr; EBT00001662837.
DR   EnsemblGenomes-Tr; EBT00001662838.
DR   EnsemblGenomes-Tr; EBT00001662839.
DR   EnsemblGenomes-Tr; EBT00001662840.
DR   EnsemblGenomes-Tr; EBT00001662841.
DR   EnsemblGenomes-Tr; EBT00001662842.
DR   EnsemblGenomes-Tr; EBT00001662843.
DR   EnsemblGenomes-Tr; EBT00001662844.
DR   EnsemblGenomes-Tr; EBT00001662845.
DR   EnsemblGenomes-Tr; EBT00001662846.
DR   EnsemblGenomes-Tr; EBT00001662847.
DR   EnsemblGenomes-Tr; EBT00001662848.
DR   EnsemblGenomes-Tr; EBT00001662849.
DR   EnsemblGenomes-Tr; EBT00001662850.
DR   EnsemblGenomes-Tr; EBT00001662851.
DR   EnsemblGenomes-Tr; EBT00001662852.
DR   EnsemblGenomes-Tr; EBT00001662853.
DR   EnsemblGenomes-Tr; EBT00001662854.
DR   EnsemblGenomes-Tr; EBT00001662855.
DR   EnsemblGenomes-Tr; EBT00001662856.
DR   EnsemblGenomes-Tr; EBT00001662857.
DR   EnsemblGenomes-Tr; EBT00001662858.
DR   EnsemblGenomes-Tr; EBT00001662859.
DR   EnsemblGenomes-Tr; EBT00001662860.
DR   EnsemblGenomes-Tr; EBT00001662861.
DR   EnsemblGenomes-Tr; EBT00001662862.
DR   EnsemblGenomes-Tr; EBT00001662863.
DR   EnsemblGenomes-Tr; EBT00001662864.
DR   EnsemblGenomes-Tr; EBT00001662865.
DR   EnsemblGenomes-Tr; EBT00001662866.
DR   EnsemblGenomes-Tr; EBT00001662867.
DR   EnsemblGenomes-Tr; EBT00001662868.
DR   EnsemblGenomes-Tr; EBT00001662869.
DR   EnsemblGenomes-Tr; EBT00001662870.
DR   EnsemblGenomes-Tr; EBT00001662871.
DR   EnsemblGenomes-Tr; EBT00001662872.
DR   EnsemblGenomes-Tr; EBT00001662873.
DR   EnsemblGenomes-Tr; EBT00001662874.
DR   EnsemblGenomes-Tr; EBT00001662875.
DR   EnsemblGenomes-Tr; EBT00001662876.
DR   EnsemblGenomes-Tr; EBT00001662877.
DR   EnsemblGenomes-Tr; EBT00001662878.
DR   EnsemblGenomes-Tr; EBT00001662879.
DR   EnsemblGenomes-Tr; EBT00001662880.
DR   EnsemblGenomes-Tr; EBT00001662881.
DR   EnsemblGenomes-Tr; EBT00001662882.
DR   EnsemblGenomes-Tr; EBT00001662883.
DR   EnsemblGenomes-Tr; EBT00001662884.
DR   EnsemblGenomes-Tr; EBT00001662885.
DR   EnsemblGenomes-Tr; EBT00001662886.
DR   EnsemblGenomes-Tr; EBT00001662887.
DR   EnsemblGenomes-Tr; EBT00001662888.
DR   EnsemblGenomes-Tr; EBT00001662889.
DR   EnsemblGenomes-Tr; EBT00001662890.
DR   EnsemblGenomes-Tr; EBT00001662891.
DR   EnsemblGenomes-Tr; EBT00001662892.
DR   EnsemblGenomes-Tr; EBT00001662893.
DR   EnsemblGenomes-Tr; EBT00001662894.
DR   EnsemblGenomes-Tr; EBT00001662895.
DR   EnsemblGenomes-Tr; M6_Spys1887-1.
DR   EnsemblGenomes-Tr; M6_Spys1888-1.
DR   EnsemblGenomes-Tr; M6_Spys1889-1.
DR   EnsemblGenomes-Tr; M6_Spys1890-1.
DR   EnsemblGenomes-Tr; M6_Spys1891-1.
DR   EnsemblGenomes-Tr; M6_Spys1892-1.
DR   EnsemblGenomes-Tr; M6_Spys1893-1.
DR   EnsemblGenomes-Tr; M6_Spys1894-1.
DR   EnsemblGenomes-Tr; M6_Spys1895-1.
DR   EnsemblGenomes-Tr; M6_Spys1896-1.
DR   EnsemblGenomes-Tr; M6_Spys1897-1.
DR   EnsemblGenomes-Tr; M6_Spys1898-1.
DR   EnsemblGenomes-Tr; M6_Spys1899-1.
DR   EnsemblGenomes-Tr; M6_Spys1900-1.
DR   EnsemblGenomes-Tr; M6_Spys1901-1.
DR   EnsemblGenomes-Tr; M6_Spys1902-1.
DR   EnsemblGenomes-Tr; M6_Spys1903-1.
DR   EnsemblGenomes-Tr; M6_Spys1904-1.
DR   EnsemblGenomes-Tr; M6_Spys1905-1.
DR   EnsemblGenomes-Tr; M6_Spys1906-1.
DR   EnsemblGenomes-Tr; M6_Spys1907-1.
DR   EnsemblGenomes-Tr; M6_Spys1908-1.
DR   EnsemblGenomes-Tr; M6_Spys1909-1.
DR   EnsemblGenomes-Tr; M6_Spys1910-1.
DR   EnsemblGenomes-Tr; M6_Spys1911-1.
DR   EnsemblGenomes-Tr; M6_Spys1912-1.
DR   EnsemblGenomes-Tr; M6_Spys1913-1.
DR   EnsemblGenomes-Tr; M6_Spys1914-1.
DR   EnsemblGenomes-Tr; M6_Spys1915-1.
DR   EnsemblGenomes-Tr; M6_Spys1916-1.
DR   EnsemblGenomes-Tr; M6_Spys1917-1.
DR   EnsemblGenomes-Tr; M6_Spys1918-1.
DR   EnsemblGenomes-Tr; M6_Spys1919-1.
DR   EnsemblGenomes-Tr; M6_Spys1920-1.
DR   EnsemblGenomes-Tr; M6_Spys1921-1.
DR   EnsemblGenomes-Tr; M6_Spys1922-1.
DR   EnsemblGenomes-Tr; M6_Spys1923-1.
DR   EnsemblGenomes-Tr; M6_Spys1924-1.
DR   EnsemblGenomes-Tr; M6_Spys1925-1.
DR   EnsemblGenomes-Tr; M6_Spys1926-1.
DR   EnsemblGenomes-Tr; M6_Spys1927-1.
DR   EnsemblGenomes-Tr; M6_Spys1928-1.
DR   EnsemblGenomes-Tr; M6_Spys1929-1.
DR   EnsemblGenomes-Tr; M6_Spys1930-1.
DR   EnsemblGenomes-Tr; M6_Spys1931-1.
DR   EnsemblGenomes-Tr; M6_Spys1932-1.
DR   EnsemblGenomes-Tr; M6_Spys1933-1.
DR   EnsemblGenomes-Tr; M6_Spys1934-1.
DR   EnsemblGenomes-Tr; M6_Spys1935-1.
DR   EnsemblGenomes-Tr; M6_Spys1936-1.
DR   EnsemblGenomes-Tr; M6_Spys1937-1.
DR   EnsemblGenomes-Tr; M6_Spys1938-1.
DR   EnsemblGenomes-Tr; M6_Spys1939-1.
DR   EnsemblGenomes-Tr; M6_Spys1940-1.
DR   EnsemblGenomes-Tr; M6_Spys1941-1.
DR   EnsemblGenomes-Tr; M6_Spys1942-1.
DR   EnsemblGenomes-Tr; M6_Spys1943-1.
DR   EnsemblGenomes-Tr; M6_Spys1944-1.
DR   EnsemblGenomes-Tr; M6_Spys1945-1.
DR   EnsemblGenomes-Tr; M6_Spys1946-1.
DR   EnsemblGenomes-Tr; M6_Spys1947-1.
DR   EnsemblGenomes-Tr; M6_Spys1948-1.
DR   EnsemblGenomes-Tr; M6_Spys1949-1.
DR   EnsemblGenomes-Tr; M6_Spys1950-1.
DR   EnsemblGenomes-Tr; M6_Spys1951-1.
DR   EnsemblGenomes-Tr; M6_Spys1952-1.
DR   EnsemblGenomes-Tr; M6_Spys1953-1.
DR   EnsemblGenomes-Tr; M6_Spys1954-1.
DR   EnsemblGenomes-Tr; M6_Spys1955-1.
DR   EnsemblGenomes-Tr; M6_Spys1956-1.
DR   EnsemblGenomes-Tr; M6_Spys1957-1.
DR   EnsemblGenomes-Tr; M6_Spys1958-1.
DR   EnsemblGenomes-Tr; M6_Spys1959-1.
DR   EnsemblGenomes-Tr; M6_Spys1960-1.
DR   EnsemblGenomes-Tr; M6_Spys1961-1.
DR   EnsemblGenomes-Tr; M6_Spys1962-1.
DR   EnsemblGenomes-Tr; M6_Spys1963-1.
DR   EnsemblGenomes-Tr; M6_Spys1964-1.
DR   EnsemblGenomes-Tr; M6_Spys1965-1.
DR   EnsemblGenomes-Tr; M6_Spys1966-1.
DR   EnsemblGenomes-Tr; M6_Spys1967-1.
DR   EnsemblGenomes-Tr; M6_Spys1968-1.
DR   EnsemblGenomes-Tr; M6_Spys1969-1.
DR   EnsemblGenomes-Tr; M6_Spys1970-1.
DR   EnsemblGenomes-Tr; M6_Spys1971-1.
DR   EuropePMC; PMC1253647; 16223875.
DR   EuropePMC; PMC1459018; 16636287.
DR   EuropePMC; PMC1797290; 17085578.
DR   EuropePMC; PMC1797367; 17028269.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2636762; 19171050.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2798480; 19858262.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3028668; 21148736.
DR   EuropePMC; PMC3411356; 21115137.
DR   EuropePMC; PMC4335068; 25695510.
DR   EuropePMC; PMC5158041; 27977735.
DR   EuropePMC; PMC6373131; 30755177.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; CP000003.
DR   SILVA-SSU; CP000003.
DR   StrainInfo; 493416; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1899877
FT                   /organism="Streptococcus pyogenes MGAS10394"
FT                   /strain="MGAS10394"
FT                   /serotype="M6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:286636"
FT   gene            202..1557
FT                   /locus_tag="M6_Spy0001"
FT   CDS_pept        202..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86136"
FT                   /db_xref="GOA:Q5XEM7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEM7"
FT                   /protein_id="AAT86136.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1712..2848
FT                   /locus_tag="M6_Spy0002"
FT   CDS_pept        1712..2848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86137"
FT                   /db_xref="GOA:Q5XEM6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM6"
FT                   /protein_id="AAT86137.1"
FT                   /translation="MIQFSINRTLFIHALNATKRAISTKNAIPILSSIKIEVTPTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            2923..3120
FT                   /locus_tag="M6_Spy0003"
FT   CDS_pept        2923..3120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0003"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86138"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM5"
FT                   /protein_id="AAT86138.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFDRKLKKVLQP"
FT   gene            3450..4565
FT                   /locus_tag="M6_Spy0004"
FT   CDS_pept        3450..4565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0004"
FT                   /product="GTP-binding protein"
FT                   /note="probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86139"
FT                   /db_xref="GOA:Q5XEM4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM4"
FT                   /protein_id="AAT86139.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEEEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMIYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4590..5204
FT                   /locus_tag="M6_Spy0005"
FT   CDS_pept        4590..5204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0005"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86140"
FT                   /db_xref="GOA:Q5XEM3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEM3"
FT                   /protein_id="AAT86140.1"
FT                   /translation="MEEHSSPFGILERENMVKMIVGLGNPGSKYEKTKHNIGFMAIDNI
FT                   VKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLI
FT                   VIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHV
FT                   MGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5207..8710
FT                   /locus_tag="M6_Spy0006"
FT   CDS_pept        5207..8710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0006"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86141"
FT                   /db_xref="GOA:Q5XEM2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM2"
FT                   /protein_id="AAT86141.1"
FT                   /translation="MDILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKALAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSSLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFYPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQIGSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVQKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQIFYVYNKVDTIEKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KILTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYIADERQKIDIYKRIREIQSREDYLN
FT                   LQDELIDRFGEYPDQVAYLLEIALLKHYMDNAFAELVERKNNQVIVRFEVTSLTYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYRILEELMLFGERLSEIKIRKNNSVF
FT                   K"
FT   gene            8848..9144
FT                   /locus_tag="M6_Spy0007"
FT   CDS_pept        8848..9144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0007"
FT                   /product="Heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86142"
FT                   /db_xref="GOA:Q5XEM1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM1"
FT                   /protein_id="AAT86142.1"
FT                   /translation="MKRIVGEIMRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKS
FT                   STNVKLNDHIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9131..9502
FT                   /locus_tag="M6_Spy0008"
FT   CDS_pept        9131..9502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0008"
FT                   /product="DivIC"
FT                   /note="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86143"
FT                   /db_xref="GOA:Q5XEM0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEM0"
FT                   /protein_id="AAT86143.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKSTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9499..9624
FT                   /locus_tag="M6_Spy0009"
FT   CDS_pept        9499..9624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0009"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86144"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL9"
FT                   /protein_id="AAT86144.1"
FT                   /translation="MMMDNIIKKIEAFLAFSDKKLAELQQENQKVKEESQYIQKN"
FT   gene            9637..10923
FT                   /locus_tag="M6_Spy0010"
FT   CDS_pept        9637..10923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0010"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86145"
FT                   /db_xref="GOA:Q5XEL8"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL8"
FT                   /protein_id="AAT86145.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLLIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSFSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSNYEDITAIADDVYGILK"
FT   gene            10920..12206
FT                   /locus_tag="M6_Spy0011"
FT   CDS_pept        10920..12206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0011"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TilS"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86146"
FT                   /db_xref="GOA:Q5XEL7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEL7"
FT                   /protein_id="AAT86146.1"
FT                   /translation="MMTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKEEKMLEYDSNLCYRDYYFSFMPKSNEDQGQV
FT                   NIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIVGEQDGEIIFV
FT                   LVGDKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12211..12753
FT                   /locus_tag="M6_Spy0012"
FT   CDS_pept        12211..12753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0012"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86147"
FT                   /db_xref="GOA:Q5XEL6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEL6"
FT                   /protein_id="AAT86147.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   gene            12775..14754
FT                   /locus_tag="M6_Spy0013"
FT   CDS_pept        12775..14754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0013"
FT                   /product="Cell division protein ftsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86148"
FT                   /db_xref="GOA:Q5XEL5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL5"
FT                   /protein_id="AAT86148.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   gene            complement(14950..15957)
FT                   /locus_tag="M6_Spy0014"
FT   CDS_pept        complement(14950..15957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0014"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86149"
FT                   /db_xref="GOA:Q5XEL4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL4"
FT                   /protein_id="AAT86149.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGIFCSSIILRKH"
FT   gene            16098..17558
FT                   /locus_tag="M6_Spy0015"
FT   CDS_pept        16098..17558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0015"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86150"
FT                   /db_xref="GOA:Q5XEL3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL3"
FT                   /protein_id="AAT86150.1"
FT                   /translation="MKFTIITNYDTLSRKSFTIEGDNMTIFRKKKKYSNKTEMQRHFKV
FT                   IDLVFLGLGSMVGTGIFTVTGIGAAKYAGPALTISIIISAIAIGILALFYAEFASRMPS
FT                   NGGAYSYVYATLGEFPAWLVGWYIIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALN
FT                   GTFNLKNGTYIDILPVLVMFFVTGIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFI
FT                   DHNNWSHFAPYGVGQITGGKTGIFAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGII
FT                   LSLIIVTALYIVVTTILTGIVHYTKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITV
FT                   CISMTYALARTIYSISRDGLLPKSLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLA
FT                   EFVNICTLAYLIILSGAIIKLRRIEGEPKANEFKTPLVPFLPMLAIIICLSFMSQYKAF
FT                   TWIAFAIATIIGTLIYLAYGYTHSIENK"
FT   gene            complement(17900..18034)
FT                   /locus_tag="M6_Spy0016"
FT   CDS_pept        complement(17900..18034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0016"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86151"
FT                   /db_xref="GOA:Q5XEA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA7"
FT                   /protein_id="AAT86151.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            18125..19674
FT                   /locus_tag="M6_Spys1887"
FT   rRNA            18125..19674
FT                   /locus_tag="M6_Spys1887"
FT                   /product="16S ribosomal RNA"
FT   gene            19724..19799
FT                   /locus_tag="M6_Spys1888"
FT   tRNA            19724..19799
FT                   /locus_tag="M6_Spys1888"
FT                   /product="tRNA-Ala"
FT   gene            20095..22997
FT                   /locus_tag="M6_Spys1889"
FT   rRNA            20095..22997
FT                   /locus_tag="M6_Spys1889"
FT                   /product="23S ribosomal RNA"
FT   gene            23082..23198
FT                   /locus_tag="M6_Spys1890"
FT   rRNA            23082..23198
FT                   /locus_tag="M6_Spys1890"
FT                   /product="5S ribosomal RNA"
FT   gene            23216..23288
FT                   /locus_tag="M6_Spys1891"
FT   tRNA            23216..23288
FT                   /locus_tag="M6_Spys1891"
FT                   /product="tRNA-Val"
FT   gene            23306..23378
FT                   /locus_tag="M6_Spys1892"
FT   tRNA            23306..23378
FT                   /locus_tag="M6_Spys1892"
FT                   /product="tRNA-Asp"
FT   gene            23410..23482
FT                   /locus_tag="M6_Spys1893"
FT   tRNA            23410..23482
FT                   /locus_tag="M6_Spys1893"
FT                   /product="tRNA-Lys"
FT   gene            23488..23569
FT                   /locus_tag="M6_Spys1894"
FT   tRNA            23488..23569
FT                   /locus_tag="M6_Spys1894"
FT                   /product="tRNA-Leu"
FT   gene            23580..23652
FT                   /locus_tag="M6_Spys1895"
FT   tRNA            23580..23652
FT                   /locus_tag="M6_Spys1895"
FT                   /product="tRNA-Thr"
FT   gene            23665..23736
FT                   /locus_tag="M6_Spys1896"
FT   tRNA            23665..23736
FT                   /locus_tag="M6_Spys1896"
FT                   /product="tRNA-Gly"
FT   gene            23745..23829
FT                   /locus_tag="M6_Spys1897"
FT   tRNA            23745..23829
FT                   /locus_tag="M6_Spys1897"
FT                   /product="tRNA-Leu"
FT   gene            23846..23922
FT                   /locus_tag="M6_Spys1898"
FT   tRNA            23846..23922
FT                   /locus_tag="M6_Spys1898"
FT                   /product="tRNA-Arg"
FT   gene            23926..23999
FT                   /locus_tag="M6_Spys1899"
FT   tRNA            23926..23999
FT                   /locus_tag="M6_Spys1899"
FT                   /product="tRNA-Pro"
FT   gene            24126..25675
FT                   /locus_tag="M6_Spys1900"
FT   rRNA            24126..25675
FT                   /locus_tag="M6_Spys1900"
FT                   /product="16S ribosomal RNA"
FT   gene            25725..25800
FT                   /locus_tag="M6_Spys1901"
FT   tRNA            25725..25800
FT                   /locus_tag="M6_Spys1901"
FT                   /product="tRNA-Ala"
FT   gene            26096..28998
FT                   /locus_tag="M6_Spys1902"
FT   rRNA            26096..28998
FT                   /locus_tag="M6_Spys1902"
FT                   /product="23S ribosomal RNA"
FT   gene            29083..29199
FT                   /locus_tag="M6_Spys1903"
FT   rRNA            29083..29199
FT                   /locus_tag="M6_Spys1903"
FT                   /product="5S ribosomal RNA"
FT   gene            29217..29289
FT                   /locus_tag="M6_Spys1904"
FT   tRNA            29217..29289
FT                   /locus_tag="M6_Spys1904"
FT                   /product="tRNA-Val"
FT   gene            29307..29379
FT                   /locus_tag="M6_Spys1905"
FT   tRNA            29307..29379
FT                   /locus_tag="M6_Spys1905"
FT                   /product="tRNA-Asp"
FT   gene            29411..29483
FT                   /locus_tag="M6_Spys1906"
FT   tRNA            29411..29483
FT                   /locus_tag="M6_Spys1906"
FT                   /product="tRNA-Lys"
FT   gene            29489..29570
FT                   /locus_tag="M6_Spys1907"
FT   tRNA            29489..29570
FT                   /locus_tag="M6_Spys1907"
FT                   /product="tRNA-Leu"
FT   gene            29581..29653
FT                   /locus_tag="M6_Spys1908"
FT   tRNA            29581..29653
FT                   /locus_tag="M6_Spys1908"
FT                   /product="tRNA-Thr"
FT   gene            29666..29737
FT                   /locus_tag="M6_Spys1909"
FT   tRNA            29666..29737
FT                   /locus_tag="M6_Spys1909"
FT                   /product="tRNA-Gly"
FT   gene            29746..29830
FT                   /locus_tag="M6_Spys1910"
FT   tRNA            29746..29830
FT                   /locus_tag="M6_Spys1910"
FT                   /product="tRNA-Leu"
FT   gene            29847..29923
FT                   /locus_tag="M6_Spys1911"
FT   tRNA            29847..29923
FT                   /locus_tag="M6_Spys1911"
FT                   /product="tRNA-Arg"
FT   gene            29927..30000
FT                   /locus_tag="M6_Spys1912"
FT   tRNA            29927..30000
FT                   /locus_tag="M6_Spys1912"
FT                   /product="tRNA-Pro"
FT   gene            30006..30079
FT                   /locus_tag="M6_Spys1913"
FT   tRNA            30006..30079
FT                   /locus_tag="M6_Spys1913"
FT                   /product="tRNA-Met"
FT   gene            30100..30173
FT                   /locus_tag="M6_Spys1914"
FT   tRNA            30100..30173
FT                   /locus_tag="M6_Spys1914"
FT                   /product="tRNA-Met"
FT   gene            30199..30281
FT                   /pseudo
FT                   /locus_tag="M6_Spys1915"
FT   tRNA            30199..30281
FT                   /pseudo
FT                   /locus_tag="M6_Spys1915"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            30295..30368
FT                   /locus_tag="M6_Spys1916"
FT   tRNA            30295..30368
FT                   /locus_tag="M6_Spys1916"
FT                   /product="tRNA-Met"
FT   gene            30389..30461
FT                   /locus_tag="M6_Spys1917"
FT   tRNA            30389..30461
FT                   /locus_tag="M6_Spys1917"
FT                   /product="tRNA-Phe"
FT   gene            30474..30544
FT                   /locus_tag="M6_Spys1918"
FT   tRNA            30474..30544
FT                   /locus_tag="M6_Spys1918"
FT                   /product="tRNA-Gly"
FT   gene            30579..30652
FT                   /locus_tag="M6_Spys1919"
FT   tRNA            30579..30652
FT                   /locus_tag="M6_Spys1919"
FT                   /product="tRNA-Ile"
FT   gene            30662..30749
FT                   /locus_tag="M6_Spys1920"
FT   tRNA            30662..30749
FT                   /locus_tag="M6_Spys1920"
FT                   /product="tRNA-Ser"
FT   gene            32114..33310
FT                   /locus_tag="M6_Spy0017"
FT   CDS_pept        32114..33310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0017"
FT                   /product="Secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86152"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEL1"
FT                   /protein_id="AAT86152.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLEAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   AAPSARPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQWAYSAQAAGYRTGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADHRGWFNPTGVTFIYPH"
FT   gene            33551..34525
FT                   /locus_tag="M6_Spy0018"
FT   CDS_pept        33551..34525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0018"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86153"
FT                   /db_xref="GOA:Q5XEL0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEL0"
FT                   /protein_id="AAT86153.1"
FT                   /translation="MEEKMSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGE
FT                   IQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQD
FT                   RKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDR
FT                   HGLVGEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGK
FT                   KCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLD
FT                   TIYLPKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            34711..35466
FT                   /locus_tag="M6_Spy0019"
FT   CDS_pept        34711..35466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0019"
FT                   /product="RecO"
FT                   /note="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86154"
FT                   /db_xref="GOA:Q5XEK9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEK9"
FT                   /protein_id="AAT86154.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            complement(35599..36687)
FT                   /locus_tag="M6_Spy0020"
FT   CDS_pept        complement(35599..36687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0020"
FT                   /product="DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86155"
FT                   /db_xref="GOA:Q5XEK8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK8"
FT                   /protein_id="AAT86155.1"
FT                   /translation="MIEKYTKKDGTTAYRLRAYLGVDPMTGKQVRTTRQGFKTEREAKR
FT                   TEVKLVDDFQRQGAWKNNDKTTFDDAARLWFEQYKNTVKPSTFLVNQNYYKSTIKPHIG
FT                   KSQISKITVMACQNLINHLAQYSACASYISVINRIFKFAVHLGIIENNPMDRTIRARCT
FT                   YAHKEKMFYSKEELLIFLDIVKKEESLEMLLIYRLLAYGGLRIGEAVALYDTDFDFTNN
FT                   TISITKTLAQTKAGKVIQNPKTKKSSRTISMDQETMRLAKEYMRQSVRPLHGSFRVFNL
FT                   LTSTVRRRLKRTVERHHLKKINPHGFRHTHASLLFEAGVPAKLAQERLGHAKISITMDL
FT                   YTHLSKNQTDNVAEKLADFIAI"
FT   gene            complement(36863..37414)
FT                   /locus_tag="M6_Spy0021"
FT   CDS_pept        complement(36863..37414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0021"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK7"
FT                   /protein_id="AAT86156.1"
FT                   /translation="MDIAKLKGFAIAAAGKAKEGAIKANELRKKASQESKIILPPALNL
FT                   GLGTPTTIRKTIDGKYYIGFYSETPELYEFVNLQFDGSRIIEKTVTKGKTTQKGRSGSV
FT                   LGGAAIGTVLAPGVGTIIGGIAGGARKKKGTINTTATTTSEEIPGKATVALRNIQTGEI
FT                   KTLKTKLMQAQYVSVNNFFK"
FT   gene            complement(37425..37808)
FT                   /locus_tag="M6_Spy0022"
FT   CDS_pept        complement(37425..37808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0022"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK6"
FT                   /protein_id="AAT86157.1"
FT                   /translation="MMTPETVCQEKGIDLVYFDGRGTNTPGMFNKKHNVIAIDTYLDGI
FT                   YKHKVIYHELGHREHTASYYKLNKEKAELQADRCMIHHLLKEELSHWDNMEDFNYIQFM
FT                   EKYELTSIADEVMVKEELEFLIS"
FT   gene            complement(37822..38172)
FT                   /locus_tag="M6_Spy0023"
FT   CDS_pept        complement(37822..38172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0023"
FT                   /product="Phage transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86158"
FT                   /db_xref="GOA:Q5XEK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK5"
FT                   /protein_id="AAT86158.1"
FT                   /translation="MFSTFEKIKELAKKQGKSLGQVEEDLNYGRNTLYKIKNSTPNAER
FT                   LGEIANYFNVSTDYLLGRTDNPKIAQDGHTSVAIDLKKDAEETFFFDGHELNDEDIDLI
FT                   TSILETRIKNRK"
FT   gene            38811..39002
FT                   /locus_tag="M6_Spy0024"
FT   CDS_pept        38811..39002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0024"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK4"
FT                   /protein_id="AAT86159.1"
FT                   /translation="MSDNTVAVEKIKKYLLDNKLKQVDLAVTYNKEPQDVANILAGRKK
FT                   DPASNRFVLKVISDLKIR"
FT   gene            39053..39253
FT                   /locus_tag="M6_Spy0025"
FT   CDS_pept        39053..39253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0025"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86160"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK3"
FT                   /protein_id="AAT86160.1"
FT                   /translation="MTDAEKQNYDALFINIFERLEKLEEGYDFSSVVTTTEVQNSGGVQ
FT                   YCECEEDGTVVKTVSKRSLGN"
FT   gene            39341..39598
FT                   /locus_tag="M6_Spy0026"
FT   CDS_pept        39341..39598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0026"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86161"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK2"
FT                   /protein_id="AAT86161.1"
FT                   /translation="MQSQLTYDLLKKQIAEELFDEFKKLIQEKDLANQWVNQTTLVTEY
FT                   GYSRQTVKRMESYGLKSFKNGKDRMYCLADVNEIKHLMKQ"
FT   gene            39778..39963
FT                   /locus_tag="M6_Spy0027"
FT   CDS_pept        39778..39963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0027"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86162"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK1"
FT                   /protein_id="AAT86162.1"
FT                   /translation="MQNVMSKWELQKQLLENATDFESTVEALLDLNESGEISDLELLLS
FT                   LKDKFRSYSKEKNTYP"
FT   gene            39994..40377
FT                   /locus_tag="M6_Spy0028"
FT   CDS_pept        39994..40377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0028"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEK0"
FT                   /protein_id="AAT86163.1"
FT                   /translation="MTTFEKVISKLNRIEGELAKPESERRDSLPILSAQLSAIKQDLKL
FT                   MLWVELPSLNNVEKYEALYQGNDFKFSETFLERQATRKAFWRRLAKETFKEDQDRRNFV
FT                   KLAEKEFKGATLSWQEFLWGKKK"
FT   gene            40374..40526
FT                   /locus_tag="M6_Spy0029"
FT   CDS_pept        40374..40526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0029"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86164"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ9"
FT                   /protein_id="AAT86164.1"
FT                   /translation="MNISLKFIDETLAGLNTILRQGGGSCSQSQALADAVFILTALKQV
FT                   IEERK"
FT   gene            40523..40726
FT                   /locus_tag="M6_Spy0030"
FT   CDS_pept        40523..40726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0030"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ8"
FT                   /protein_id="AAT86165.1"
FT                   /translation="MNYLEYALAYLERELEIIDDEVIEVELPGGDWEFVPNPYYEEGLH
FT                   DSPYYRSQVAKDILDIKGLLGR"
FT   gene            40814..41113
FT                   /locus_tag="M6_Spy0031"
FT   CDS_pept        40814..41113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0031"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ7"
FT                   /protein_id="AAT86166.1"
FT                   /translation="MIEVTFKAESMAGVFDAMREALDMPKTVTKDVVEEKPAPKKKEES
FT                   VTLTLADIKKMAKAKVEEGKSKDIKEVLREMNVAKVGELEEYQFAEFVEKLEAL"
FT   gene            41113..42270
FT                   /locus_tag="M6_Spy0032"
FT   CDS_pept        41113..42270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0032"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86167"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ6"
FT                   /protein_id="AAT86167.1"
FT                   /translation="MPVENHALLSASSAHRWLYCPMLPRLEADYPSRDTVYTQEGTSAH
FT                   ELSEIKLMYKSGKITKRKFNTLTKAFKENSDFYNEEMEEMTELYTDIVMEHLNTYENAE
FT                   IELEKRVDFSDWVPGGFGTSDVVILADGVIEIIDLKYGKGMPVSANQNPQMGLYALGAY
FT                   ASYDMVYDFDRIKMTIIQPRLDSVSSVDIYVEELLYWADNVVLPMAAQADAGIGDWNLS
FT                   EKVLQWSPVAAKLVPRAQENWELIDKYDYQEPVYLSDEAVAEILDKASAIKKWVESVEA
FT                   YALKEALSGKEVPGYKIVEGRSNRVITDKDKAIDILQDNGFDDEIFKPKELLAMGALEK
FT                   LIGKTTFADLLAEVIDKPQGKPVLVPEKDKRPAINSLEQAIKDFE"
FT   gene            42263..42847
FT                   /locus_tag="M6_Spy0033"
FT   CDS_pept        42263..42847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0033"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86168"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022595"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ5"
FT                   /protein_id="AAT86168.1"
FT                   /translation="MNRRKIIMTTTPNTTKVVTGKVRLSYVALLEPKAFEGQEAKYSTV
FT                   ILIPKTDKVTIKKIKDAQKAAYEAAKDNKLKGVKWERVKTTLRDGDEEMDTEEHPEYTG
FT                   HMFMSVSSKTKPQIIDKYKNFVDSAEEVYSGVYARVSLNAYAYNTAGNKGISCGLNNVQ
FT                   IVAKGDYLGGRSSADADFDEWNEEEDEDDIL"
FT   gene            42890..44812
FT                   /locus_tag="M6_Spy0034"
FT   CDS_pept        42890..44812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0034"
FT                   /product="phage-related DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86169"
FT                   /db_xref="GOA:Q5XEJ4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ4"
FT                   /protein_id="AAT86169.1"
FT                   /translation="MRHLNIDIETYSSNDIKNGVYKYADAEDFEILLFAYSIDGGEVEC
FT                   LDLTRQSLPEDIKDMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQE
FT                   LGLPSSLEKCALYLKLAQEKDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMF
FT                   IDYCIQDVVVEMAIAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVK
FT                   MESLSGELKALTGLDNPNSRTQLLPWLKEHGYSASGLTKADVEKELKTAEGELKRVLEL
FT                   KLQTAMSSLKKYEAMERARCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLD
FT                   DAREYVKKRDIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAG
FT                   EQWRLDVFSTHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA
FT                   LNMGVKEEELQGLVDDWRRANKKIVQFWKDVQRAAIKAIKSRAPVRLGKLRFRYRKGFL
FT                   FITLPSGRNLAYARAKVEPGDYGDKIVYEGQGDKAYFTAQETYGGKLVENIVQATARDI
FT                   LAEALLRIEAAGHGVVFHVHDEAIIEGSGLTIEEVNDLMAQAPEWAEGLPLNSEGYITK
FT                   YYMKD"
FT   gene            44817..47201
FT                   /locus_tag="M6_Spy0035"
FT   CDS_pept        44817..47201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0035"
FT                   /product="virulence-associated protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86170"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ3"
FT                   /protein_id="AAT86170.1"
FT                   /translation="MKQEKLIVKSSPLQELHIATGSSRTAKTWKNITLTWQELVERLEK
FT                   PTVTQETFAEYQKMSRAEKGQAKDVGGFVGGWLKQGKRKNENVQSRSLVALDADSPSKD
FT                   FLDRLDLLADYAYVLYSTHSHSKKAAKYRLIIPTDRLMMPDEYEPVARYLANQLGMSNF
FT                   DDTTYQSVRLMFWPSHSRDAEFTFKYNDEAFLSVDEVLDTYPDWHDSSFWPESPTHAVK
FT                   RQREAKKQGDPLSKKGLIGAFCRNYDIRQAIATFLPEVYEEGATPDRYTYTEGSTANGL
FT                   VIYDDVFAYSHHGTDPVGDTLVNAYDLVRIHKFGEQDSEAKDNTPTNKLPSSKAMNAFV
FT                   SDLPEIKDYLMAEALGDFDEELPVEDDRSWLEIDERGEPEVNSYLLATQIIKEVPIYWD
FT                   GLEFLRYDAKKGIWLPNAEEYLKSYISTKKLGKITKIRHISETIVAIKAQAFSSEVFTE
FT                   SDLNKIVLANGVYDLRDNSFKTKFDPEVHARSSHPVVYDPEATCETFEGFLRETVGAEN
FT                   IDFIFEWFGYNFYREYTIQKMLFIYGSGGTGKSTLINILREMIGADNYSAVTLQYLMQE
FT                   RFAKIGLYRKTANFDTDAKPQYLADGATLKMLTGEDTIHADRKNKEPINFYNYAKLSFA
FT                   MNELPPMRDFSGGLKRRMMILEMDKVLTQEVKAKYPLDKIMSEVPGIFNRAMEGLRKAL
FT                   SKRDFSISASMRSSVEKWEKGNDVVAMFLEDECDLSEDFKVPVRDVYPAYKFYCQDSGY
FT                   KPLARNSFTQRMNELNFENKNAKMGGKTVRCWIGFRIKGEF"
FT   gene            47549..47842
FT                   /locus_tag="M6_Spy0036"
FT   CDS_pept        47549..47842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0036"
FT                   /product="Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86171"
FT                   /db_xref="GOA:Q5XEJ2"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ2"
FT                   /protein_id="AAT86171.1"
FT                   /translation="MTKGGKMRTEKDIENYLKKKTKGLCLKFASPGTIGVPDRIVVMNT
FT                   GTFFVEVKAPGKKPRPSQVAMHKKIKKAGQHVWVVDSYESVDIALKEMENWV"
FT   gene            47839..49161
FT                   /locus_tag="M6_Spy0037"
FT   CDS_pept        47839..49161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0037"
FT                   /product="Phage-related DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86172"
FT                   /db_xref="GOA:Q5XEJ1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ1"
FT                   /protein_id="AAT86172.1"
FT                   /translation="MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIF
FT                   SEDHKILIVAPKKVAEETWPTEIGKWHFDFTYSKVLGSEGKRIEALETEADIYLINREN
FT                   VTWLVEYYKTKWPFTFVVIDELSSFKSSKSKRFRALRKVRPKVQRLVGLTGTPAPNSLI
FT                   DLWPQIYLMDRGARLETSQTRFKDKYFVPDKRNGLIIYSWALRDGAEAEIYNKIEDICV
FT                   SMKAKDYLKLPPRTNNVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQM
FT                   ANGAIYDDDKATVAIHDDKLDALENVVEESQGQPILVFYQYQHDLERLKKRFPQAEELT
FT                   SVDKWNSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLDRQGQTE
FT                   PVIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQLGV"
FT   gene            49162..49332
FT                   /locus_tag="M6_Spy0038"
FT   CDS_pept        49162..49332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0038"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86173"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEJ0"
FT                   /protein_id="AAT86173.1"
FT                   /translation="MKKEYVVRIYTGREKNFEAKPQFEEKTFTRKADMLKFWNSCEATV
FT                   KEKYTREREND"
FT   gene            49325..49597
FT                   /locus_tag="M6_Spy0039"
FT   CDS_pept        49325..49597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0039"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86174"
FT                   /db_xref="GOA:Q5XEI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI9"
FT                   /protein_id="AAT86174.1"
FT                   /translation="MTEEQMIDCLLYELVKKDKAIKKKNIIITALTVMLLIVVSGLGIS
FT                   LKSYYEPQIYGLRAQLSRTQKQLKRASDDRARQTKRIAELTKNGG"
FT   gene            49730..50146
FT                   /locus_tag="M6_Spy0040"
FT   CDS_pept        49730..50146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0040"
FT                   /product="Phage transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86175"
FT                   /db_xref="InterPro:IPR006523"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI8"
FT                   /protein_id="AAT86175.1"
FT                   /translation="MSRLSNAQLKAFDEWLFDYRFIDNKIALRKLELQTDMNTAVDKNI
FT                   GGGRANFVSKVTEDVVARWDSDRELKGLSNFKEAVIATLNLLDEELTDIFNLRWGVGSS
FT                   NTWEEIAYTRHLSRKSIYRKRERILEIFSKKIGM"
FT   gene            50194..50688
FT                   /locus_tag="M6_Spy0041"
FT   CDS_pept        50194..50688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0041"
FT                   /product="Phage Terminase Small Subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86176"
FT                   /db_xref="GOA:Q5XEI7"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI7"
FT                   /protein_id="AAT86176.1"
FT                   /translation="MSLKVRQIVSCLFAMLGGDGKLSKLTLKQKRFADEYIISANATAA
FT                   AIKAGYSKKTARSIGQENLTKPDIKAYIDERLEKLESEKIATQEEVLQYLTSIMRGDQQ
FT                   EKTLISVGEFGQKIVDIDVGAKDRIKAAELLGKRYRLFTDKVEMDVSSDVTINVGEWDD
FT                   D"
FT   gene            50669..51955
FT                   /locus_tag="M6_Spy0042"
FT   CDS_pept        50669..51955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0042"
FT                   /product="Terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86177"
FT                   /db_xref="GOA:Q5XEI6"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI6"
FT                   /protein_id="AAT86177.1"
FT                   /translation="MSGMTTKQRPKINIVIKHPSKVFNKHIYDKLYNYSNFTEVHYGGA
FT                   SSGKSHGVFQKIILKALNPKFKHPRKILVLRKVGATVRDSVFADIMSNLSYFGILDKCK
FT                   INMSAFRITLPNGAEFIFKGMDNPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDK
FT                   KHLEKQIYLMFNPVSKVNWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANR
FT                   NEAYYKIYALGQFATLDKLIFPKYDKQILNKDKLSHLPSFFGLDYGFINDPSALLHVKI
FT                   DDANKKLYILEEYVRKNLTNDKIANAIKDLGYAKEEIRGDSAEKKSNQELRNLGIPRMI
FT                   DVTKGPGTVMQGIQYLLQYDWIVDERCVKTIEELENYTWKKDKKTNEYTNEPVDSYNHC
FT                   IDAIRYAVQDRIYQSADRSKRMKNAKYYF"
FT   gene            51971..53503
FT                   /locus_tag="M6_Spy0043"
FT   CDS_pept        51971..53503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0043"
FT                   /product="Portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86178"
FT                   /db_xref="InterPro:IPR006428"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI5"
FT                   /protein_id="AAT86178.1"
FT                   /translation="MEEKQFLAGTRFNENANKQFIMLQEDFEAIDYESKLWIDQLKNYI
FT                   SRFKAEQLERLKELKRYYLGDNNIKYRPAKTDKYAADNRIASDFAKYITVFEQGYMLGV
FT                   PVEYKNENKDLQAAIDLMSVRNNEDYHNVKIKTDLSIYGRAYELLTVEKIDDKKTEVKL
FT                   YQLPAEQTFVIYDDTYQRNSLMAVHFYDIDYGSGKRKQIIKAYTSDTIYTYEDYNLETK
FT                   GMRLKDYEGHFFKGVPVNEYANNEERTGAYESVLDNIDAYDLSQSELANFQQDSVNALL
FT                   VIAGNAYTGADENDYLDDGRLNPNGRLAISIGFKKAQVLILDDNPNPNGVKPQAYFLKK
FT                   EYDTAGSEAYKNRLVADILRFTFTPDTQDMKFSGVQSGESMKYKLMASDNYREKQERLF
FT                   KKGLMRRLRLAANIWAIKGNEATTYSLVNDTSIVFTPNLPQNDNEIVTAAQNLYGIVSD
FT                   QTIFEILNTVTGVDAEAELKRLKEEADKKQSLPEPRLVGDASGQEEPTAEKP"
FT   gene            53460..54911
FT                   /locus_tag="M6_Spy0044"
FT   CDS_pept        53460..54911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0044"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86179"
FT                   /db_xref="GOA:Q5XEI4"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI4"
FT                   /protein_id="AAT86179.1"
FT                   /translation="MMLVVKKNQRQKSLNYWQKRQEDILSYLDRTDLDVFSELQKLYNE
FT                   QAFELQKELFDFYTKYSEENKMTYQDVVKKLRHEDLSDYVANANKYRKQAEKDPELLKR
FT                   LNEQYVSARATRMDALNLELVYRAGILKGVLDSAFENHLKKVASYAYKKAMGGRSGTIN
FT                   GPVLEELVRTPFDGYNYSEQLWGNTDNLVKNLQKRLKQGFVRGEHPRAMARDLAKRFNV
FT                   ANHRAETLIRTDGTMVINNATARRYLNAGLKYYRDLVRLDDRTTEICRTIAKENKRKLL
FT                   SELKPGINVAPYHFNCRTTIIPDEDELSIEVEPIDDKSTKYFKDVTSDWIDGNEHKPQL
FT                   SLLNEYVKNGTPYKVDGHSVVLDHSNYEYRVANWLSKKTGLQVDMVPRVNSPEHIKTPD
FT                   YLVDVAPFDLKEITGSGKNVIDGNLRKAKKQATNIIFDITKTPLSFEEIMGQLEHIYMI
FT                   DRRGLDISIIKNKDEVLAVLEKEGG"
FT   gene            54939..55127
FT                   /locus_tag="M6_Spy0045"
FT   CDS_pept        54939..55127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0045"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86180"
FT                   /db_xref="GOA:Q5XEI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI3"
FT                   /protein_id="AAT86180.1"
FT                   /translation="MGVRPSSFFISIIHHPIKTIKEENMFIWQMVLVALGVLVLILIVG
FT                   IAAIAVKSIIAELKKEG"
FT   gene            55132..55398
FT                   /locus_tag="M6_Spy0046"
FT   CDS_pept        55132..55398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0046"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI2"
FT                   /protein_id="AAT86181.1"
FT                   /translation="MNKRIKKKRKLETAVVMLVAENAMQAEAIKNQNKQIMELKSIVQR
FT                   NALATNEELAAVKAATLDNQSVIKAIGDTVDYIKKNYKRKWGK"
FT   gene            55566..56135
FT                   /locus_tag="M6_Spy0047"
FT   CDS_pept        55566..56135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0047"
FT                   /product="Phage scaffold protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86182"
FT                   /db_xref="InterPro:IPR025580"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI1"
FT                   /protein_id="AAT86182.1"
FT                   /translation="MAEENVTTETTEQVDTQKEAVEYPKHEYERTFTRADISKMMAAER
FT                   TKWESEQSAAIEKARTEGERLAKLSKDERAKEEEQKRLDAIAEREKAVAEREMRIETHS
FT                   LLVEKGLPLDFIDIVLATTAEEVKANIDNLQTIFDKAVEKRVNDRLTQKPPRTGNGSVG
FT                   MTKADIMAIEDDDERMRLIAENRNLF"
FT   gene            56148..57035
FT                   /locus_tag="M6_Spy0048"
FT   CDS_pept        56148..57035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0048"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86183"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEI0"
FT                   /protein_id="AAT86183.1"
FT                   /translation="MAEKNLNTMADLGDIKSIDFVNKFSKNINDLLKLLGVTRRETLTN
FT                   DLKIQTYKWEVTLDQTDPGEGETIPLSKVTRTKDKDYTVKWFKKRRATTAEAIARHGAA
FT                   RAITEADKRIMRELQNGIKDAFFTFLKTKPTKVKGVGLQKALSASWAKLATFNEFEGSP
FT                   LVSFVSPLDVANYLGDTKVGADASNVFGMTLLKNFLGMQNVIVMPSVPEGKIYSTAVEN
FT                   LVFASLNVKGGDLGGLFADFTDETGLIAAARNRQLSNLTYESVFFGANVLFAEIPEGVV
FT                   EATIEAAAVPGIGG"
FT   gene            57047..57403
FT                   /locus_tag="M6_Spy0049"
FT   CDS_pept        57047..57403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0049"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86184"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH9"
FT                   /protein_id="AAT86184.1"
FT                   /translation="MGDKQLIDDIKLFIGISKGDGAQDELITLAIYESKERVLAKLNEY
FT                   SETEITKIPDRLRFIVRDVAIKRFNRINSEGAVEDSEEGKTFKWDSYLKEYESTLRSAA
FT                   IGKVYSGKGVARFI"
FT   gene            57414..57692
FT                   /locus_tag="M6_Spy0050"
FT   CDS_pept        57414..57692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0050"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH8"
FT                   /protein_id="AAT86185.1"
FT                   /translation="MIYKDRVILVYVDEQDDFLDKRTVEKPSGKIPCMENTFTKSEQMG
FT                   LFGKYDLNAFKLHLQGHYDGFSKIIYKGKSRLIKGLAHHKNSTVIYV"
FT   gene            57707..58033
FT                   /locus_tag="M6_Spy0051"
FT   CDS_pept        57707..58033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0051"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86186"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH7"
FT                   /protein_id="AAT86186.1"
FT                   /translation="MRGLDRFLRSVERKQKSVRIAVDKELSKSAARIERQAKILAPVDT
FT                   GWLRAQIYSEQQRLLHYRVVSPALYSIYLELGTRKMEAQSFLDPALRKEWPVLMANIKK
FT                   MFKR"
FT   gene            58037..58396
FT                   /locus_tag="M6_Spy0052"
FT   CDS_pept        58037..58396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0052"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86187"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH6"
FT                   /protein_id="AAT86187.1"
FT                   /translation="MDYSLETLYLKKVKNRLGVLDIPIYFKLPKSDVLEPFIVVGTNIS
FT                   DLSKTAQTGAVIDDFSLNIDAFLPGDSRLDAEEIKSRMLRLLGRNNQIKAQILVDNSIG
FT                   REVYRVAINITETLF"
FT   gene            58408..59007
FT                   /locus_tag="M6_Spy0053"
FT   CDS_pept        58408..59007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0053"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86188"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH5"
FT                   /protein_id="AAT86188.1"
FT                   /translation="MANTKKGTTIEITTGKPIVGKKIFYFIQSVDAPKKSQALLPAYRT
FT                   DGTTTMGGEYIDEQTQQGRVIEKATDEHSIDLTTYFVPTDPSVAVIEEAKKTGKSIKIW
FT                   EVIADESVKEQIQIPESTGPKKDVYPAKFGYAKIDEIERGTGISDLVEMSYTANIVGAL
FT                   QDGKFPLTKEEIEMLENVYGYQNPGDTTGDYDNITK"
FT   gene            59061..59516
FT                   /locus_tag="M6_Spy0054"
FT   CDS_pept        59061..59516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0054"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86189"
FT                   /db_xref="InterPro:IPR024410"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH4"
FT                   /protein_id="AAT86189.1"
FT                   /translation="MEFTAAKRNIDIKFDFKTMFKINNKLGTINPETGERNADGVGALF
FT                   FNILERNESAIVDLVRLSAGSGKKALTEDEILDAIAESVDEEGTTEGLFAEIEKEMVDS
FT                   GFFRAKILKYIENMEKSARYLKAKDDMDATQIQIIEDVIGRMSNAVS"
FT   gene            59591..59824
FT                   /locus_tag="M6_Spy0055"
FT   CDS_pept        59591..59824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0055"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86190"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH3"
FT                   /protein_id="AAT86190.1"
FT                   /translation="MEGLEYKQLAERESLSELSLKLRYTLNAKKVDVGKLKYDKHRLTI
FT                   KRSYQKASRSQADSDSSIVERIQMLNNHFQNR"
FT   gene            59839..64221
FT                   /locus_tag="M6_Spy0056"
FT   CDS_pept        59839..64221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0056"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86191"
FT                   /db_xref="GOA:Q5XEH2"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH2"
FT                   /protein_id="AAT86191.1"
FT                   /translation="MPGTFDGSIFADVGANTKDYEQAMARIVSTTQNAFRKAQDTAVNS
FT                   SNKMVQIIGQIMAQLANNGESLGKRLGSAYATGLKLSIGEIQRIAASIGEKIPEPIKNG
FT                   FQKIIIPVASVIDKIRGNLTGFINQTKMQLQNLVGIGKIRSAFAKAATGVDILTQRASS
FT                   KLNNLSAIFETVAGKLPRPFGTAFRKIASSVSTLNSSIQSVGGKISSSLGQQVLNPALQ
FT                   SWNNFFSSVSAKASAFANKVSTSLFGRLTSSLANLSSKIGSSLSNGFSRMSSSAATSLN
FT                   GISQKFANTSSAGERLKSTVMSIVQAFSLMAVAQKAMHAITGAIDGAVSRVDTMNRFPK
FT                   TMALFGYSAEQSKASIDKLSKGIEGLPTPLDSAVKSAQQLAITTGSLDKGTSLALAFNN
FT                   AMIGYGATTEGAEQALRQFSQSLGSGKIQAEEFNSVSEAAPGLISKMAEAFGFGKNGVQ
FT                   DLKSALSDGKITAQEFADKMIELNDAQGGFAEMAQSSAGGIRTAWKNVHTAVVKGVAGM
FT                   ISAFDEAAKANGMKTIAETLLSLKPAITSVFDTINSLIPNAVAAFARLKQSINIDFSPL
FT                   GASVKEVFALINIVFGDFAHTGELSEQAFDNLKAKITSLAPKVIALWAVMNPASAISTI
FT                   MPLLSLFGKVGLALGSLGTSVGAFGGIISSGIASASGVVGAFAATLSGLPGVFATAAGR
FT                   GLSVLGTMTSAMSSLVSLALAAIGPAAILGLVVAGLGLINSQFGAQIEQLLNTAVTKGP
FT                   GIIQGLVKGITSKIPVLIASGTQLIAKFANAIAVLLPVIIQAGVQLITSLVQGIGQNAT
FT                   NLISSAIKIIGSFVSSIASALPQLISVGMELLLNVVNGIVQNIPLIIQQAQQIIDSFGN
FT                   SLQANLPSIISNGIAILVNLVQGITQMLPTVLQIATQVITSFVSGIVQFLPQLLQGGIQ
FT                   IIISLVQGIIQNLPQIAQSAVQIIQSLASGLTQALPQIIAAGIQLVAQLAVALIKGLPQ
FT                   IISAGIQLIMGLGKAMLGAIPNALSGVWEGIKSGFSSMWDQITGKSSTSTAKVSADATV
FT                   MAMNVGMQTTAIANQANTDTTSMLNSISQNTELANINATSNATQMANNVNAQTGTMSLR
FT                   GLNDSMSLASGISANMSVANINATTQAREMASGVNGATSSMNLDAINHTLSLASGVGAN
FT                   MGAASTGATSQAQAMSSGVSNSLASMQSNSTKAASGLSNSVTSEMSSAATSATSSVNRL
FT                   SSAVESGFNKAKTSATTSMNGIANAVKTGFSSINSTAKQSMANLVSSVTSGMSRATAVS
FT                   NNACQKILSIFRALAGQMSSAGAYAGQGFANGLASSAGTIYAIANSIAANVAATIRRAL
FT                   DIHSPSRVTKTLGAFTGEGFALGMAEWIGEINSLGKAYATAVTDQNWGVNSTVSTSAKV
FT                   NNSGINTSLDNLSEEVRQSQLSEPIFEVHNEIVGDKIYTAVKEKESREQSKDSYFVFD"
FT   gene            64233..65075
FT                   /locus_tag="M6_Spy0057"
FT   CDS_pept        64233..65075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0057"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86192"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH1"
FT                   /protein_id="AAT86192.1"
FT                   /translation="MDLLIEKESQATRLSDFGIYNIAIEDSAPLLSVSHRAVKGRSGYI
FT                   YDGATFTTKTLKVKGRVTVSNVERLLDKQDELNALLVVDEPFYVTKMYPENSDLFNFEL
FT                   PGESTGDLQLIGSPHKPWKYRFKVILDDTIAYEFIGKTSQGLKYNLSFALRTAELPFGE
FT                   TKPKDITLSGGSFAYAGTAKASQLEWPFIIELTPSGGQTNFYIEIDGRRFEFKQNSQLQ
FT                   NSDKLLLTGIATTLNGNYVNAKTNYEYFIFNPNPNKRITYKTDFLGTIRILNFVELYK"
FT   gene            65085..67064
FT                   /locus_tag="M6_Spy0058"
FT   CDS_pept        65085..67064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0058"
FT                   /product="Phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86193"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEH0"
FT                   /protein_id="AAT86193.1"
FT                   /translation="MITFLDHRDIEYGVISVIRHTNAVNGERSVSGEIYTNSDVLNNID
FT                   RGWRLRFEDEYYVVIYAKPVDVGQKTQVSFDAIHQFFWDFSKSSIYEGLGDGSHTIDTY
FT                   LETVFKGSGYRYKLEVGVNAFRKQSFNYKSRLDLFNEIIKATGLEFSVSGKVVRLLKNI
FT                   GTDLSTVVRKNFNMNDLTIEKNIDSFITYQKGFGAWTDPEDHSKGRLEAEYESPLAKEY
FT                   GRLEGAPLTDERFTVADNLKEALKSNVENSYKISVKIDMEDLTRAGYRCERPVAGDYIM
FT                   AINETLGFQERIRIVSFTSYYDATGALVKHEVTCNDIGSVKKQSVGSLSINSRINQIDA
FT                   DIASAIEVATQALVSADGKNTVYGGTEMPKDEPKGTLKKGDILFLKAGDTTRMYFWNGA
FT                   EWEEPEVVNDPERWREDLEKQISEAIEKAKKAQEEINQRTDKELEEFRAALKNLALPEE
FT                   AIKKITETIKVDDIPYIKQSFDDLKNKVSETSETSRLNAEILGNNGKTRYNKNLLVGDP
FT                   NRVKKIDEDYIEVEANDGGFKRGETYTISFSQTCELLKKVAVTLTQPHNKGIKLVLTPT
FT                   KAKMDAQTFEVTKDKQSIEVYPLSYTAVLTGDWYKSKQIDLNALEGRELALDMSYKDVV
FT                   DGNNAAITGQWSDSPQIILDGGNQ"
FT   gene            67061..68068
FT                   /locus_tag="M6_Spy0059"
FT   CDS_pept        67061..68068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0059"
FT                   /product="Hyaluronoglucosaminidase"
FT                   /EC_number="3.2.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86194"
FT                   /db_xref="GOA:Q5XEG9"
FT                   /db_xref="InterPro:IPR009860"
FT                   /db_xref="InterPro:IPR041352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG9"
FT                   /protein_id="AAT86194.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWARSTVILLEGEIGLETDTGYAKFGDG
FT                   KNRFSKLKYLNKPDLDAFAQKKETDNKIAKLESIKADKDTVYLKAESKIELDKKLSLAG
FT                   GIVTGQLRLKPNSGIEKSSSTGGAINIDMSKSKGAAMVMYTNKDTTDGPLMILRSNKDT
FT                   FDQSVQFVDYRGKTNAVNIVMRQPPTPNFSSALNITSANEGGSAMQIRGVEKALGTLKI
FT                   THENPSVDKEYDKNAAALSIDIVKKKKGGGDGTAAQGIFINSSSGTTGKLLRIRNKNED
FT                   KFYVNPDGGFHSYADSIVDGNLTVKNPTSGKHAATKDYVDKKFDELKKLIQKTD"
FT   gene            68078..69985
FT                   /locus_tag="M6_Spy0060"
FT   CDS_pept        68078..69985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0060"
FT                   /product="Phage infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86195"
FT                   /db_xref="InterPro:IPR012892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG8"
FT                   /protein_id="AAT86195.1"
FT                   /translation="MSRDPTLTLDESNLVIGKDGRVHYTFTAENDNPKVRLASKCLGTA
FT                   HFNQLMIERGDQATSYVAPVVVEGSGESTGVFKSLEEMLSGLQSINLELTDTKNSKLWS
FT                   KIKLTNRGMLQEYYDGTIKTEIINSAKGIATRISEETGQKLALINDTIDGIRREYQDAD
FT                   RRLSASYQAGIEGLKATMRDDKLDLQAEIQASAHGLSQKYDDKLKQLSAKITTTSSGTT
FT                   EAYENKLKGLRAEFTRSNQGMRTELESKISGLQSTQQATASQISQEIRDREGAVSRVQQ
FT                   SLESYQRRMQDAEENYSSLTHTVRGLQSDVGSPTGKIQSRLTQLAGQIEQRVTRDGVMS
FT                   IISGAGDSIKLAIQKAGGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTFT
FT                   TKIAEAIKIRADQIIAGTIDAARIRVINLNASSIVGLDANFIKAKIGYAITDLLEGKVI
FT                   KARNGAMLIDLNTAKMDFNSDATINFNSKNNALVRKDGTHTAFVHFSNATPKGYTGSAL
FT                   YASIGITSSGDGVNSASSGRFAGLRSFRYATGYNHTAAVDQTEIYGDNVLVVDDFNITR
FT                   GFKFRPDKMQKMLDMNDLYAAVVALGRCWGHLANVGWNTVHGNFVSAVNGELNNYITKI
FT                   "
FT   gene            69997..70434
FT                   /locus_tag="M6_Spy0061"
FT   CDS_pept        69997..70434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0061"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86196"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG7"
FT                   /protein_id="AAT86196.1"
FT                   /translation="MQLTIKNKDLNTLYCVLDKIKVTNMRANRGRAKLLAKVVDKFKEY
FT                   AKDEGDLIDLYAQKDKDGKFVIDEHKNIKLADPAKLDEFNGLLNELADEEIVIKGGEYS
FT                   KRFIDFLNFLEECEDEFTSSEIILIDNILEQFEESKKGEKP"
FT   gene            70431..71048
FT                   /locus_tag="M6_Spy0062"
FT   CDS_pept        70431..71048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0062"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86197"
FT                   /db_xref="InterPro:IPR009796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XA81"
FT                   /protein_id="AAT86197.1"
FT                   /translation="MRNWKVTGKYPQFDSTVAVASTHIIITAEDGSVISQLVKQDLIST
FT                   NDTEIIKATLEEFKKSEYVEIAMGEAVQKVDDLEKISQETAKTAKTAQTAAGLAKVSAE
FT                   RTQRMINLQTIHMLTSGGKIDSDIYKGMLELIEPAKKGEYQAYDVFTVVDSTKEEDGEA
FT                   GEGNLVFVHVNEPFTYEAQTLEELESEAKVTVIKYADLVKQD"
FT   gene            71058..71330
FT                   /locus_tag="M6_Spy0063"
FT   CDS_pept        71058..71330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0063"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86198"
FT                   /db_xref="GOA:Q5XEG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG5"
FT                   /protein_id="AAT86198.1"
FT                   /translation="MATELIFGVGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHDEQNKTLITMTEQIKNLNREVRELKDIMKGEA"
FT   gene            71327..71554
FT                   /locus_tag="M6_Spy0064"
FT   CDS_pept        71327..71554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0064"
FT                   /product="Holin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86199"
FT                   /db_xref="GOA:Q5XEG4"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG4"
FT                   /protein_id="AAT86199.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTKGLSDSEQALTYHEPKQ"
FT   gene            71670..72872
FT                   /locus_tag="M6_Spy0065"
FT   CDS_pept        71670..72872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0065"
FT                   /product="Phage-associated cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86200"
FT                   /db_xref="GOA:Q5XEG3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG3"
FT                   /protein_id="AAT86200.1"
FT                   /translation="MTFLDKIKQGCLDGWTKYKILPSLTAAQAILESGWGKHAPHNALF
FT                   GIKADASWTGKSFDTKTQEEYQPGIVTDIVDRFRAYDSWTDSIIDHGKFLNDNPRYKAV
FT                   IGETDYKKACYAIKAAGYATASSYVELLIQLIEENDLQSWDREALKNNKEETMTTANEI
FT                   VQYCVNLANSGMGVDKDGAHGTQCCDLPCFVAKNWFGVDLWGNAIDLLDSASAQGWEVH
FT                   RMPTEANPKAGATFVQSVPYHQFGHTGIVIEDSDGYTMRTVEQNIDGNADALYVGAPAR
FT                   FNTRDFTGVVGWFYPPYQGDTVTQPVSTEPQTSDTIVETAKTGTFTLDVAEINIRRWPS
FT                   LASEVVGIYKQGDTVSFDSEGYANGYYWISYVGGLGMRDYLAIGQTDKDGNRISIWGKL
FT                   N"
FT   gene            73086..73709
FT                   /locus_tag="M6_Spy0066"
FT   CDS_pept        73086..73709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0066"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86201"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG2"
FT                   /protein_id="AAT86201.1"
FT                   /translation="MAMRGRRDALVNRSIPLAMRPTNTQLVGFFIFRRQIMKSKKLVFG
FT                   QIDLNMCRDFDLVQALDYDFKEKKLYNKGRGFAIVLVSIQNLTFAIPLRSNIPKKYQLK
FT                   YKLRDSKKYGCVEGLDIGKALVVEDPKYILNRTFKLREQVDYFKIVDNDILIVNKLIKA
FT                   IIDYNQAVANSDQHKLTDPKRFKFSTFPNYTDRLKSITDADYLR"
FT   gene            complement(73823..74809)
FT                   /locus_tag="M6_Spy0067"
FT   CDS_pept        complement(73823..74809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0067"
FT                   /product="Sdn"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86202"
FT                   /db_xref="GOA:Q5XEG1"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG1"
FT                   /protein_id="AAT86202.1"
FT                   /translation="MDMSKKLRNSLARIVVAAFASFAVMAIPTYHHSTVLAKTVSVNQT
FT                   YGEYKDYYTVIGESNIDQSAFPKIYKTTERVYKGQGTSEKRVTVSDVVYNPLDGYKRST
FT                   GAYGVVTKDMIDMSKGYREKWETNPEPSGWFRFYNRADNEEISEKEYDSRRTKSYKVTN
FT                   NVPVVLTTLKGKQYNSHLFVRSHLLADSLGGKSIRKNAITGTQMQNVGTRKGGMQYIEK
FT                   KVLSHITKNPDVYVFYSAIPEYQGTELLARSVLVSALSSDGVINETVRVFNTADGFNIN
FT                   YEKGGLLTESPVSEIDNIEDSTTDEIENSVDDSEEIVYNDTTTEEEN"
FT   gene            75042..75224
FT                   /locus_tag="M6_Spy0068"
FT   CDS_pept        75042..75224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0068"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86203"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEG0"
FT                   /protein_id="AAT86203.1"
FT                   /translation="MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEV
FT                   VTYENVEEVLRELDK"
FT   gene            75364..76470
FT                   /locus_tag="M6_Spy0069"
FT   CDS_pept        75364..76470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0069"
FT                   /product="Fatty acid/phospholipid synthesis protein plsX"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86204"
FT                   /db_xref="GOA:Q5XEF9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEF9"
FT                   /protein_id="AAT86204.1"
FT                   /translation="MIAIEFKRSGIYAIIKILLIDCVRTQDIIKGVEMKRIAIDAMGGD
FT                   NAPKAIVEGVNQVIEAFSDIEIQLYGDQTKINSYLIQSDRVAIIHTDEKIMSDDEPAKA
FT                   VRRKKKASMVLAAKAVKEGKADAIISAGNTGALLAVGLFVVGRIKGVDRPGLLSTIPTV
FT                   TGLGFDMLDLGANAENTVKHLHQYAILGSFYAKNVRGIANPRVGLLNNGTEETKGDPLR
FT                   KATYELLTADNTISFVGNVEARELMSGVADVIVSDGFTGNAVLKSIEGTGISIMGQLKQ
FT                   IINSGGIKTKIGASLLKSSLYEMKKTLDYSSAGGAVLFGLKAPVVKSHGSSDVKAIFST
FT                   IKQVRTMLDTNVVGQLVEEFAKETQVND"
FT   gene            76463..76705
FT                   /locus_tag="M6_Spy0070"
FT   CDS_pept        76463..76705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0070"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86205"
FT                   /db_xref="GOA:Q5XEF8"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEF8"
FT                   /protein_id="AAT86205.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDVEDMVFMEDVLDYLVQRLT"
FT   gene            76827..77561
FT                   /locus_tag="M6_Spy0071"
FT   CDS_pept        76827..77561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0071"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86206"
FT                   /db_xref="GOA:Q5XEF7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEF7"
FT                   /protein_id="AAT86206.1"
FT                   /translation="MKTERKANNQVTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLN
FT                   GARKEAIDGKGALNNQISSLIFEKLNKAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRN
FT                   VTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGE
FT                   TRRINELLKGWFAQIGLNLIDFKLEFGFDQEGTIILADELSPDNCRLWDKNGNHMDKDV
FT                   FRRDLGNLTDVYQVVLEKLIAL"
FT   gene            77637..81410
FT                   /locus_tag="M6_Spy0072"
FT   CDS_pept        77637..81410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0072"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86207"
FT                   /db_xref="GOA:Q5XEF6"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEF6"
FT                   /protein_id="AAT86207.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKDLRIVQVYDVFNLAEDLLARAEKHIFSEQVTDRLLTEAEITAELDKVAFFAIEA
FT                   LPGQFDQRAASSQEALLLFGSDSQVKVNTAELYLINKDIAEAELEAVKNYLLNPVDSRF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFENYKADDFAAYKAEQGLAMEVDDLLFIQDYFKSI
FT                   GRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRTGKLPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDGEVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPSD
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNGETIVDLERRFLDTNGVRVVVDVKFVD
FT                   KDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTRTASVMAQGYNPYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPT
FT                   LVAFGVTTADIRKVLSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFEAIQAQHKI
FT                   TAASAAKYGSVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQADALEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEVAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGSLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSPWLAGVEVGDIHAIPVSHGEG
FT                   KFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   gene            81644..83098
FT                   /locus_tag="M6_Spy0073"
FT   CDS_pept        81644..83098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0073"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86208"
FT                   /db_xref="GOA:Q5XEF5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEF5"
FT                   /protein_id="AAT86208.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNSSFMGKVKEALN
FT                   TVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDRGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQE
FT                   FKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            83126..84148
FT                   /locus_tag="M6_Spy0074"
FT   CDS_pept        83126..84148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0074"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86209"
FT                   /db_xref="GOA:Q5XEF4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEF4"
FT                   /protein_id="AAT86209.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGVLGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNNPVKLEEVVSGVAEGCVQAGVALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKRLKDVLL
FT                   EPTRIYVKAALPLIKEELVNGIGHITGGGFIENVPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKDLLDEPVYEIGRIIKKADDSVVIK
FT                   "
FT   gene            84316..84870
FT                   /locus_tag="M6_Spy0075"
FT   CDS_pept        84316..84870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0075"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86210"
FT                   /db_xref="GOA:Q5XEF3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEF3"
FT                   /protein_id="AAT86210.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            85054..86601
FT                   /locus_tag="M6_Spy0076"
FT   CDS_pept        85054..86601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0076"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86211"
FT                   /db_xref="GOA:Q5XEF2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEF2"
FT                   /protein_id="AAT86211.1"
FT                   /translation="MTKRALISVSDKSGIIDFAKELKNLGWDIISTGGTKVALDNAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDNNIELIDLVVVNLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADAGQT
FT                   TFETRQRLAAKVFRHIAAYDALIAEYFTAQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDVDAAIRIIRDFKDRPTVVALKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAKKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEVAAAGVKAIIQPGGSVRDQDSIDAANKHGLTMIFTGVRHFRH"
FT   gene            complement(86660..87784)
FT                   /locus_tag="M6_Spy0077"
FT   CDS_pept        complement(86660..87784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0077"
FT                   /product="Autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86212"
FT                   /db_xref="GOA:Q5XEF1"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEF1"
FT                   /protein_id="AAT86212.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQASFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKVVAAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIEVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYFTVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            87890..89302
FT                   /locus_tag="M6_Spy0078"
FT   CDS_pept        87890..89302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0078"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86213"
FT                   /db_xref="GOA:Q5XEF0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEF0"
FT                   /protein_id="AAT86213.1"
FT                   /translation="MANRVFLISRIVVYYHIFTMFQLLIINTLYQKANVYDIISNYNTK
FT                   EVGVLKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLDLVNIVVSEHSRL
FT                   IAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKY
FT                   NVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQAVEAAQEMLLD
FT                   NKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAY
FT                   APVPHLPQSVVDTAVETIVRPVLEGMVAEGRPYLGVLYVGLILTADGPKVIEFNSRFGD
FT                   PETQIILPRLTSDFAQNIDDIMMGIEPYITWQNDGVTLGVVVASEGYPLDYEKGVPLPE
FT                   KTDGDIITYYAGAKFAENSELLLSNGGRVYMLVTTEDSVKAGQDKIYTQLAQQDTTGLF
FT                   YRNDIGNKAIKE"
FT   gene            89460..90071
FT                   /locus_tag="M6_Spy0079"
FT   CDS_pept        89460..90071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0079"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   carboxyltransferase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86214"
FT                   /db_xref="GOA:Q5XEE9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE9"
FT                   /protein_id="AAT86214.1"
FT                   /translation="MLKHLVALTWVRLRNQRFRTYRIFFYGKFRQVETPLYILIMKTPI
FT                   ISIIMGSKSDWATMQKTAEILDNFGIAYEKKVVSAHRTPDLMFKHAEEARGRGIKIIIA
FT                   GAGGAAHLPGMVAAKTTLPVIGVPVKSRVLSGLDSLYSIVQMPGGVPVATMAIGEAGAT
FT                   NAALTALRILSIEDQNLADALAHFHEEQGKIAEESSNELI"
FT   gene            90022..91131
FT                   /locus_tag="M6_Spy0080"
FT   CDS_pept        90022..91131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0080"
FT                   /product="Phosphoribosylaminoimidazole carboxylase NCAIR
FT                   mutase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86215"
FT                   /db_xref="GOA:Q5XEE8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE8"
FT                   /protein_id="AAT86215.1"
FT                   /translation="MRNKEKSQRSQAMNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITL
FT                   DPTNDCPASRVSEVIVAPYDDVEALGQLAACCDVLTYEFENVNADGLDAVVSACQLPQG
FT                   TDLLRISQNRIFEKDFLANKAGVTVAPYKVVTSSLDLEGLDFTKTYVLKTATGGYDGHG
FT                   QKVIRSAEDLPEAQQLANSAQCVLEEFVNFDLEISVIVSGNGEDVTVFPVQENIHCNNI
FT                   LSKTIVPARISDQLADKAKKMAVQIAKKLQLSGTLCVEMFATADDIIINEIAPRPHNSG
FT                   HYSIEACDFSQFDTHILGVLGQPLPPIKLHAPAVMLNVLGQHVQQAIDYVAQNPSAHLH
FT                   MYGKLEAKHNRKMGHVTLFAEDADEVEEF"
FT   gene            91152..92492
FT                   /locus_tag="M6_Spy0081"
FT   CDS_pept        91152..92492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0081"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86216"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE7"
FT                   /protein_id="AAT86216.1"
FT                   /translation="MELREFKAWLLKNHFEEDELYKESIKCYQVEAYKAAYIFSYLANH
FT                   KFIAKLAIDYSGVSSNFMSKCPDDEVRKSSWQKRVNSLKNEDEWEQTVNEKLIQAWEDD
FT                   NVFKLPFKIKEKYSLMRVLRNNAAHAKDCRISESTVLELWNEIEYIYPYFVINGTIDAW
FT                   MEDLEKLVRYSNSSIESQNQLQNKFGDFSTENKTLIVKKIIQKYLVDSEWDETYPDIVM
FT                   NFLLYIFQESNYINQIGKDLTEKEELYLSIGTGIYHFQAEAIDIYSQFEESLSDYTFRY
FT                   FCEEFSDNFWKFIDSMDSEVNKENLTATSLEILKKNSAILVNAEFNESRFLSDNSLFFK
FT                   SVLDKIKHLYYYTMHHTGQRHHNTNTFDYSKFNSYIPYINYIFYRISSNPGLKEDEKVI
FT                   DFVKRCNNLISSDYSAESWYSERQMQDVIKKINEKYTILEDSGRESD"
FT   gene            92708..94000
FT                   /locus_tag="M6_Spy0082"
FT   CDS_pept        92708..94000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0082"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86217"
FT                   /db_xref="GOA:Q5XEE6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE6"
FT                   /protein_id="AAT86217.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSVERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFNRLGI"
FT   gene            94131..95042
FT                   /locus_tag="M6_Spy0083"
FT   CDS_pept        94131..95042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0083"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86218"
FT                   /db_xref="GOA:Q5XEE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE5"
FT                   /protein_id="AAT86218.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLIL
FT                   LELYLAYLDIEGMDGQYSDKIFYDSLLDNLSEQFEQFELDELFIVNKIIIDISSLSLKN
FT                   NRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKQKDIIKAEQSFMKACLFAQ
FT                   MTADQYLENKLIQEWEKDVKSY"
FT   gene            95196..96266
FT                   /locus_tag="M6_Spy0084"
FT   CDS_pept        95196..96266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0084"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86219"
FT                   /db_xref="GOA:Q5XEE4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEE4"
FT                   /protein_id="AAT86219.1"
FT                   /translation="MLLTGGDYNKSRPLLSFTLCYNSPMARILDNNVMGNEEFSDRTLR
FT                   PQYLHEYIGQDKVKEQFAIFIEAAKRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNL
FT                   KQTSGPAVEKAGDLVAILNELEPGDILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAG
FT                   DTSRSIHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYQEKDLTEIVERTATIFE
FT                   IKIDHEAARKLACRSRGTPRIANRLLKRVRDYAQIIGDGIITAQITDRALTMLDVDREG
FT                   LDYIDQKILRTMIEMYQGGPVGLGTLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRV
FT                   ATQKAYRHLGYPYQNT"
FT   gene            96404..96841
FT                   /locus_tag="M6_Spy0085"
FT   CDS_pept        96404..96841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0085"
FT                   /product="Protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86220"
FT                   /db_xref="GOA:Q5XEE3"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE3"
FT                   /protein_id="AAT86220.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGN
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEY"
FT   gene            96864..97265
FT                   /locus_tag="M6_Spy0086"
FT   CDS_pept        96864..97265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0086"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86221"
FT                   /db_xref="GOA:Q5XEE2"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE2"
FT                   /protein_id="AAT86221.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRMHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            97262..99037
FT                   /locus_tag="M6_Spy0087"
FT   CDS_pept        97262..99037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0087"
FT                   /product="Acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86222"
FT                   /db_xref="GOA:Q5XEE1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE1"
FT                   /protein_id="AAT86222.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLLWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMFIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLMVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGALALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPKGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYAS
FT                   TIQTAVEKSAKKPAK"
FT   gene            99346..101988
FT                   /locus_tag="M6_Spy0088"
FT   CDS_pept        99346..101988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0088"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="Acetaldehyde dehydrogenase [acetylating]"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86223"
FT                   /db_xref="GOA:Q5XEE0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEE0"
FT                   /protein_id="AAT86223.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAEC
FT                   KEVSENEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   gene            complement(101958..102065)
FT                   /locus_tag="M6_Spy0089"
FT   CDS_pept        complement(101958..102065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0089"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86224"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XED9"
FT                   /protein_id="AAT86224.1"
FT                   /translation="MIYLENKMISYDFNHKKSFPGINIKNHLRRPGRSA"
FT   gene            102240..103256
FT                   /locus_tag="M6_Spy0090"
FT   CDS_pept        102240..103256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0090"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86225"
FT                   /db_xref="GOA:Q5XED8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XED8"
FT                   /protein_id="AAT86225.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPG
FT                   YIQEKIGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS"
FT   gene            103644..104933
FT                   /locus_tag="M6_Spy0091"
FT   CDS_pept        103644..104933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0091"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86226"
FT                   /db_xref="GOA:Q5XED7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XED7"
FT                   /protein_id="AAT86226.1"
FT                   /translation="MIYNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEASVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPATAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   gene            105132..105440
FT                   /locus_tag="M6_Spy0092"
FT   CDS_pept        105132..105440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0092"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86227"
FT                   /db_xref="GOA:Q5XED6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED6"
FT                   /protein_id="AAT86227.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            105688..106314
FT                   /locus_tag="M6_Spy0093"
FT   CDS_pept        105688..106314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0093"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86228"
FT                   /db_xref="GOA:Q5XED5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED5"
FT                   /protein_id="AAT86228.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVILEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   gene            106338..106961
FT                   /locus_tag="M6_Spy0094"
FT   CDS_pept        106338..106961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0094"
FT                   /product="LSU ribosomal protein L1E"
FT                   /note="L4P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86229"
FT                   /db_xref="GOA:Q5XED4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED4"
FT                   /protein_id="AAT86229.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   gene            106961..107257
FT                   /locus_tag="M6_Spy0095"
FT   CDS_pept        106961..107257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0095"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86230"
FT                   /db_xref="GOA:Q5XED3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED3"
FT                   /protein_id="AAT86230.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            107275..108108
FT                   /locus_tag="M6_Spy0096"
FT   CDS_pept        107275..108108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0096"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86231"
FT                   /db_xref="GOA:Q5XED2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED2"
FT                   /protein_id="AAT86231.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            108193..108525
FT                   /locus_tag="M6_Spy0097"
FT   CDS_pept        108193..108525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0097"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86232"
FT                   /db_xref="GOA:Q5XED1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED1"
FT                   /protein_id="AAT86232.1"
FT                   /translation="MLLNSSRCGTLFKGENYKMGRSLKKGPFVDEHLMKKVEAQANDEK
FT                   KKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAAD
FT                   DKKTRR"
FT   gene            108541..108885
FT                   /locus_tag="M6_Spy0098"
FT   CDS_pept        108541..108885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0098"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86233"
FT                   /db_xref="GOA:Q5XED0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XED0"
FT                   /protein_id="AAT86233.1"
FT                   /translation="MAEISSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            108898..109551
FT                   /locus_tag="M6_Spy0099"
FT   CDS_pept        108898..109551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0099"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86234"
FT                   /db_xref="GOA:Q5XEC9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC9"
FT                   /protein_id="AAT86234.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            109555..109968
FT                   /locus_tag="M6_Spy0100"
FT   CDS_pept        109555..109968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0100"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86235"
FT                   /db_xref="GOA:Q5XEC8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC8"
FT                   /protein_id="AAT86235.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            110022..110183
FT                   /locus_tag="M6_Spy0101"
FT   CDS_pept        110022..110183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0101"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86236"
FT                   /db_xref="GOA:Q5XEC7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC7"
FT                   /protein_id="AAT86236.1"
FT                   /translation="MSQEELAKKENELKKELFDLRFQAAAGQLEKTARLDEVKKQIARV
FT                   KTVQSEMK"
FT   gene            110209..110469
FT                   /locus_tag="M6_Spy0102"
FT   CDS_pept        110209..110469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0102"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86237"
FT                   /db_xref="GOA:Q5XEC6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC6"
FT                   /protein_id="AAT86237.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            110494..110862
FT                   /locus_tag="M6_Spy0103"
FT   CDS_pept        110494..110862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0103"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86238"
FT                   /db_xref="GOA:Q5XEC5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC5"
FT                   /protein_id="AAT86238.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            110941..111246
FT                   /locus_tag="M6_Spy0104"
FT   CDS_pept        110941..111246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0104"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86239"
FT                   /db_xref="GOA:Q5XEC4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC4"
FT                   /protein_id="AAT86239.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   gene            111270..111812
FT                   /locus_tag="M6_Spy0105"
FT   CDS_pept        111270..111812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0105"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86240"
FT                   /db_xref="GOA:Q5XEC3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC3"
FT                   /protein_id="AAT86240.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            111828..112013
FT                   /locus_tag="M6_Spy0106"
FT   CDS_pept        111828..112013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0106"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86241"
FT                   /db_xref="GOA:Q5XEC2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC2"
FT                   /protein_id="AAT86241.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            112164..112562
FT                   /locus_tag="M6_Spy0107"
FT   CDS_pept        112164..112562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0107"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86242"
FT                   /db_xref="GOA:Q5XEC1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC1"
FT                   /protein_id="AAT86242.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            112764..113300
FT                   /locus_tag="M6_Spy0108"
FT   CDS_pept        112764..113300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0108"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86243"
FT                   /db_xref="GOA:Q5XEC0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEC0"
FT                   /protein_id="AAT86243.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            113396..113761
FT                   /locus_tag="M6_Spy0109"
FT   CDS_pept        113396..113761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0109"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86244"
FT                   /db_xref="GOA:Q5XEB9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB9"
FT                   /protein_id="AAT86244.1"
FT                   /translation="MKIVISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYA
FT                   QVIDDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYH
FT                   GRVKALADAARENGLKF"
FT   gene            113780..114274
FT                   /locus_tag="M6_Spy0110"
FT   CDS_pept        113780..114274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0110"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86245"
FT                   /db_xref="GOA:Q5XEB8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB8"
FT                   /protein_id="AAT86245.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            114289..114471
FT                   /locus_tag="M6_Spy0111"
FT   CDS_pept        114289..114471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0111"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86246"
FT                   /db_xref="GOA:Q5XEB7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB7"
FT                   /protein_id="AAT86246.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            114686..115126
FT                   /locus_tag="M6_Spy0112"
FT   CDS_pept        114686..115126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0112"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86247"
FT                   /db_xref="GOA:Q5XEB6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB6"
FT                   /protein_id="AAT86247.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            115095..116447
FT                   /locus_tag="M6_Spy0113"
FT   CDS_pept        115095..116447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0113"
FT                   /product="Protein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86248"
FT                   /db_xref="GOA:Q5XEB5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEB5"
FT                   /protein_id="AAT86248.1"
FT                   /translation="MLKVVQSKSSNEGILIMFLKILKDALKIKTVRNKIFFTIFIILVF
FT                   RIGTHITVPGVNAKSLEQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLL
FT                   QMDILPKFVEWGKQGEVGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDI
FT                   KTYLLIGALLTTGSVIVTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVN
FT                   VKASDLHSSYLIVGILIIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVN
FT                   PAGVIPVIFASSITTIPSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFS
FT                   FFYTFVQVNPEKTAENLQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAP
FT                   IAAQQALNLSSSIALGGTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            116597..117235
FT                   /locus_tag="M6_Spy0114"
FT   CDS_pept        116597..117235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0114"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86249"
FT                   /db_xref="GOA:Q5XEB4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB4"
FT                   /protein_id="AAT86249.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQEEPILEHYRKLDLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            117353..117496
FT                   /locus_tag="M6_Spy0115"
FT   CDS_pept        117353..117496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0115"
FT                   /product="Translation Initiation Factor 1"
FT                   /note="IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86250"
FT                   /db_xref="GOA:Q5XEB3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB3"
FT                   /protein_id="AAT86250.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKITF
FT                   VF"
FT   gene            117596..117712
FT                   /locus_tag="M6_Spy0116"
FT   CDS_pept        117596..117712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0116"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86251"
FT                   /db_xref="GOA:Q5XEB2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB2"
FT                   /protein_id="AAT86251.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            117730..118095
FT                   /locus_tag="M6_Spy0117"
FT   CDS_pept        117730..118095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0117"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86252"
FT                   /db_xref="GOA:Q5XEB1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB1"
FT                   /protein_id="AAT86252.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            118113..118496
FT                   /locus_tag="M6_Spy0118"
FT   CDS_pept        118113..118496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0118"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86253"
FT                   /db_xref="GOA:Q5XEB0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEB0"
FT                   /protein_id="AAT86253.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            118542..119480
FT                   /locus_tag="M6_Spy0119"
FT   CDS_pept        118542..119480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0119"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86254"
FT                   /db_xref="GOA:Q5XEA9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEA9"
FT                   /protein_id="AAT86254.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            119495..119881
FT                   /locus_tag="M6_Spy0120"
FT   CDS_pept        119495..119881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0120"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86255"
FT                   /db_xref="GOA:Q5XEA8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEA8"
FT                   /protein_id="AAT86255.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            complement(120476..120610)
FT                   /locus_tag="M6_Spy0121"
FT   CDS_pept        complement(120476..120610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86256"
FT                   /db_xref="GOA:Q5XEA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA7"
FT                   /protein_id="AAT86256.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            120701..122250
FT                   /locus_tag="M6_Spys1921"
FT   rRNA            120701..122250
FT                   /locus_tag="M6_Spys1921"
FT                   /product="16S ribosomal RNA"
FT   gene            122300..122375
FT                   /locus_tag="M6_Spys1922"
FT   tRNA            122300..122375
FT                   /locus_tag="M6_Spys1922"
FT                   /product="tRNA-Ala"
FT   gene            122671..125573
FT                   /locus_tag="M6_Spys1923"
FT   rRNA            122671..125573
FT                   /locus_tag="M6_Spys1923"
FT                   /product="23S ribosomal RNA"
FT   gene            125658..125774
FT                   /locus_tag="M6_Spys1924"
FT   rRNA            125658..125774
FT                   /locus_tag="M6_Spys1924"
FT                   /product="5S ribosomal RNA"
FT   gene            125792..125864
FT                   /locus_tag="M6_Spys1925"
FT   tRNA            125792..125864
FT                   /locus_tag="M6_Spys1925"
FT                   /product="tRNA-Val"
FT   gene            125870..125940
FT                   /locus_tag="M6_Spys1926"
FT   tRNA            125870..125940
FT                   /locus_tag="M6_Spys1926"
FT                   /product="tRNA-Gly"
FT   gene            125975..126048
FT                   /locus_tag="M6_Spys1927"
FT   tRNA            125975..126048
FT                   /locus_tag="M6_Spys1927"
FT                   /product="tRNA-Ile"
FT   gene            126071..126142
FT                   /locus_tag="M6_Spys1928"
FT   tRNA            126071..126142
FT                   /locus_tag="M6_Spys1928"
FT                   /product="tRNA-Glu"
FT   gene            126156..126238
FT                   /pseudo
FT                   /locus_tag="M6_Spys1929"
FT   tRNA            126156..126238
FT                   /pseudo
FT                   /locus_tag="M6_Spys1929"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            126252..126325
FT                   /locus_tag="M6_Spys1930"
FT   tRNA            126252..126325
FT                   /locus_tag="M6_Spys1930"
FT                   /product="tRNA-Met"
FT   gene            126346..126418
FT                   /locus_tag="M6_Spys1931"
FT   tRNA            126346..126418
FT                   /locus_tag="M6_Spys1931"
FT                   /product="tRNA-Phe"
FT   gene            126438..126518
FT                   /locus_tag="M6_Spys1932"
FT   tRNA            126438..126518
FT                   /locus_tag="M6_Spys1932"
FT                   /product="tRNA-Tyr"
FT   gene            126525..126595
FT                   /locus_tag="M6_Spys1933"
FT   tRNA            126525..126595
FT                   /locus_tag="M6_Spys1933"
FT                   /product="tRNA-Trp"
FT   gene            126607..126679
FT                   /locus_tag="M6_Spys1934"
FT   tRNA            126607..126679
FT                   /locus_tag="M6_Spys1934"
FT                   /product="tRNA-His"
FT   gene            126688..126759
FT                   /locus_tag="M6_Spys1935"
FT   tRNA            126688..126759
FT                   /locus_tag="M6_Spys1935"
FT                   /product="tRNA-Gln"
FT   gene            126779..126862
FT                   /locus_tag="M6_Spys1936"
FT   tRNA            126779..126862
FT                   /locus_tag="M6_Spys1936"
FT                   /product="tRNA-Leu"
FT   gene            127122..127307
FT                   /locus_tag="M6_Spy0122"
FT   CDS_pept        127122..127307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0122"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA6"
FT                   /protein_id="AAT86257.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVRDE
FT                   MLSQQGHEDKADWLEP"
FT   gene            127945..128253
FT                   /locus_tag="M6_Spy0123"
FT   CDS_pept        127945..128253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0123"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86258"
FT                   /db_xref="GOA:Q5XEA5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA5"
FT                   /protein_id="AAT86258.1"
FT                   /translation="MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLT
FT                   LSRKDMMDIGIPIGSDVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST"
FT   gene            128293..128520
FT                   /locus_tag="M6_Spy0124"
FT   CDS_pept        128293..128520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0124"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86259"
FT                   /db_xref="GOA:Q5XEA4"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA4"
FT                   /protein_id="AAT86259.1"
FT                   /translation="MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKT
FT                   LQAGAATVLMTGSGPTVFALCQTEKQTIIV"
FT   gene            128630..129073
FT                   /locus_tag="M6_Spy0125"
FT   CDS_pept        128630..129073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0125"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86260"
FT                   /db_xref="GOA:Q5XEA3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEA3"
FT                   /protein_id="AAT86260.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            129077..129796
FT                   /locus_tag="M6_Spy0126"
FT   CDS_pept        129077..129796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0126"
FT                   /product="High-affinity zinc uptake system ATP-binding
FT                   protein"
FT                   /note="ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86261"
FT                   /db_xref="GOA:Q5XEA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA2"
FT                   /protein_id="AAT86261.1"
FT                   /translation="MRYISVENLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEAETDDEKGGHGHA"
FT   gene            129750..130604
FT                   /locus_tag="M6_Spy0127"
FT   CDS_pept        129750..130604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0127"
FT                   /product="High-affinity zinc uptake system membrane
FT                   protein"
FT                   /note="ZnuB"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86262"
FT                   /db_xref="GOA:Q5XEA1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA1"
FT                   /protein_id="AAT86262.1"
FT                   /translation="MKLKQMTKKEVMVMLDILSYDFMQRAVMAVVAISIFAPILGIFLI
FT                   LRRQSLMSDTLSHVSLAGVALGVVIGISPTITTIIVVVLAAILLEYLRVVYKHYMEIST
FT                   AILMSLGLALSLIIMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLF
FT                   IRPMYILTFDEDTAFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIA
FT                   MRLGKNFKTVILLGIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKK
FT                   RLF"
FT   gene            complement(130644..131018)
FT                   /locus_tag="M6_Spy0128"
FT   CDS_pept        complement(130644..131018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0128"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86263"
FT                   /db_xref="GOA:Q5XEA0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA0"
FT                   /protein_id="AAT86263.1"
FT                   /translation="MYFCHQLKANQLLTQSQYFKVVFDIDPIQKGHLLLISKDHYTSLT
FT                   QLPKEVRYDLIDLQAALVAKLEQHLPISGVTSVSNDKELMEEGTQFHLHLIPRLTNDSF
FT                   WEGITINQENWDLAPFLKHL"
FT   gene            complement(131077..132333)
FT                   /locus_tag="M6_Spy0129"
FT   CDS_pept        complement(131077..132333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0129"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86264"
FT                   /db_xref="GOA:Q5XE99"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE99"
FT                   /protein_id="AAT86264.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSAFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   TQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSEDSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGDRVQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            132425..134737
FT                   /locus_tag="M6_Spy0130"
FT   CDS_pept        132425..134737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0130"
FT                   /product="Multimodular transpeptidase-transglycosylase"
FT                   /note="PBP 1B"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86265"
FT                   /db_xref="GOA:Q5XE98"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE98"
FT                   /protein_id="AAT86265.1"
FT                   /translation="MRYFMVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIF
FT                   LFGMMGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLR
FT                   TPVANDAISENIKKAIVSTEDEHFQEHKGVVPKAVFRATLASVLGFGEASGGSTLTQQL
FT                   VKQQVLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNM
FT                   YRTGVLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKV
FT                   SSRDLKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTV
FT                   QMGNVLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENY
FT                   MTKMGYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVV
FT                   YKHENKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTE
FT                   NYTDVWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVG
FT                   QRFNLDPGVIKANVLKSTGLQPGTVNVNGRTFSVGGEMTTSLWSQKGPGAMTYRFAIGG
FT                   TDADYQKAWGNFGFRKN"
FT   gene            135001..138567
FT                   /locus_tag="M6_Spy0131"
FT   CDS_pept        135001..138567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0131"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86266"
FT                   /db_xref="GOA:Q5XE97"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE97"
FT                   /protein_id="AAT86266.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   gene            138658..142299
FT                   /locus_tag="M6_Spy0132"
FT   CDS_pept        138658..142299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0132"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86267"
FT                   /db_xref="GOA:Q5XE96"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE96"
FT                   /protein_id="AAT86267.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQALLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQNPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAVFTAEAE"
FT   gene            142451..142816
FT                   /locus_tag="M6_Spy0133"
FT   CDS_pept        142451..142816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0133"
FT                   /product="Putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86268"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE95"
FT                   /protein_id="AAT86268.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   gene            142909..143847
FT                   /locus_tag="M6_Spy0134"
FT   CDS_pept        142909..143847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0134"
FT                   /product="ComG operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86269"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE94"
FT                   /protein_id="AAT86269.1"
FT                   /translation="MVQVLAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISNYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGVTKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            143783..144817
FT                   /locus_tag="M6_Spy0135"
FT   CDS_pept        143783..144817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0135"
FT                   /product="ComG operon protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86270"
FT                   /db_xref="GOA:Q5XE93"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE93"
FT                   /protein_id="AAT86270.1"
FT                   /translation="MISFLRQDISIPSKLSLKKLSSKHQHKFIQLLANLLSTGFSFAEV
FT                   IAFLKRSQLLQLDYVLKMEESLLKGQGLADMLSGLGFSDAILTQISLADRHGNIETTLV
FT                   AIQHYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRYLVPQLETQNQITYFLNHFP
FT                   AFFIGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLGRLLKQYLTSYYAREWGTLI
FT                   GQGLDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHIKVATYPFFKKELSLMIEYG
FT                   EIKSKLGAELEIYAQESWEQFFSQLYQVTQLIQPAIFLVVAVTIVMIYAAILLPIYQNM
FT                   GGIF"
FT   gene            144819..145145
FT                   /locus_tag="M6_Spy0136"
FT   CDS_pept        144819..145145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0136"
FT                   /product="ComG operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86271"
FT                   /db_xref="GOA:Q5XE92"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE92"
FT                   /protein_id="AAT86271.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            145120..145548
FT                   /locus_tag="M6_Spy0137"
FT   CDS_pept        145120..145548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0137"
FT                   /product="ComG operon protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86272"
FT                   /db_xref="GOA:Q5XE91"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE91"
FT                   /protein_id="AAT86272.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNNLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            145553..145789
FT                   /locus_tag="M6_Spy0138"
FT   CDS_pept        145553..145789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0138"
FT                   /product="ComG operon protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86273"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE90"
FT                   /protein_id="AAT86273.1"
FT                   /translation="MIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTR
FT                   TKEMTLNGCHITILRTDTYISIHDDEGEVMKIE"
FT   gene            145782..146216
FT                   /locus_tag="M6_Spy0139"
FT   CDS_pept        145782..146216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0139"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86274"
FT                   /db_xref="GOA:Q5XE89"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE89"
FT                   /protein_id="AAT86274.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIGQSQICITLKWKSGLERTFYYAFQD"
FT   gene            146200..146526
FT                   /locus_tag="M6_Spy0140"
FT   CDS_pept        146200..146526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0140"
FT                   /product="ComG operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86275"
FT                   /db_xref="GOA:Q5XE88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE88"
FT                   /protein_id="AAT86275.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVSFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            146579..147577
FT                   /locus_tag="M6_Spy0141"
FT   CDS_pept        146579..147577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0141"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86276"
FT                   /db_xref="GOA:Q5XE87"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE87"
FT                   /protein_id="AAT86276.1"
FT                   /translation="MTLLFISSVIWYDKVMTFEKIEEAYQLLLENCQLIENDLKTHIYD
FT                   AIVEQNSFYLGAEGASPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQF
FT                   TPDAIGFILLYLLEQLSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLID
FT                   LSASIAEIMDSSAHFVQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHT
FT                   YAHHLLMEQSLKYLKKDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVALITLPDSIFG
FT                   HPSNAKSIIVLQKQTDHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            147636..148832
FT                   /locus_tag="M6_Spy0142"
FT   CDS_pept        147636..148832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0142"
FT                   /product="Acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86277"
FT                   /db_xref="GOA:Q5XE86"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE86"
FT                   /protein_id="AAT86277.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEEVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEHIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            149019..149327
FT                   /locus_tag="M6_Spy0143"
FT   CDS_pept        149019..149327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0143"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86278"
FT                   /db_xref="GOA:Q5XE85"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE85"
FT                   /protein_id="AAT86278.1"
FT                   /translation="MYVFIEPNDLKDYLITIYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKIATNSQKPPFDTSQVLC"
FT   gene            complement(149410..150180)
FT                   /locus_tag="M6_Spy0144"
FT   CDS_pept        complement(149410..150180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0144"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86279"
FT                   /db_xref="GOA:Q5XE84"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE84"
FT                   /protein_id="AAT86279.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   MLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   gene            complement(150228..151295)
FT                   /locus_tag="M6_Spy0145"
FT   CDS_pept        complement(150228..151295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0145"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86280"
FT                   /db_xref="GOA:Q5XE83"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE83"
FT                   /protein_id="AAT86280.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKVEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNSGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEA
FT                   GVNIQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKCY"
FT   gene            complement(151405..151569)
FT                   /locus_tag="M6_Spy0146"
FT   CDS_pept        complement(151405..151569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0146"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86281"
FT                   /db_xref="GOA:Q5XE82"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE82"
FT                   /protein_id="AAT86281.1"
FT                   /translation="MTPLSLLFASEESFRILSALLFLLTSLCFIILMISLLPKKTGYRQ
FT                   KTNTSSRDL"
FT   gene            151831..152832
FT                   /locus_tag="M6_Spy0147"
FT   CDS_pept        151831..152832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0147"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86282"
FT                   /db_xref="GOA:Q5XE81"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE81"
FT                   /protein_id="AAT86282.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGFRSSNLIFL"
FT   gene            152837..153130
FT                   /locus_tag="M6_Spy0148"
FT   CDS_pept        152837..153130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0148"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86283"
FT                   /db_xref="GOA:Q5XE80"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE80"
FT                   /protein_id="AAT86283.1"
FT                   /translation="MRDMSKKKIGMISGIFGFSLAIGLGVVIKDYCQDRQRRQMTRDLR
FT                   TFFSPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG"
FT   gene            153127..153444
FT                   /locus_tag="M6_Spy0149"
FT   CDS_pept        153127..153444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0149"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86284"
FT                   /db_xref="GOA:Q5XE79"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE79"
FT                   /protein_id="AAT86284.1"
FT                   /translation="MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAE
FT                   LTDMTFVCVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   Q"
FT   gene            153462..154088
FT                   /locus_tag="M6_Spy0150"
FT   CDS_pept        153462..154088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0150"
FT                   /product="tRNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86285"
FT                   /db_xref="GOA:Q5XE78"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE78"
FT                   /protein_id="AAT86285.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPTVGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   gene            154240..154635
FT                   /locus_tag="M6_Spy0151"
FT   CDS_pept        154240..154635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0151"
FT                   /product="Single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86286"
FT                   /db_xref="GOA:Q5XE77"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE77"
FT                   /protein_id="AAT86286.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   gene            complement(154895..155584)
FT                   /locus_tag="M6_Spy0152"
FT   CDS_pept        complement(154895..155584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0152"
FT                   /product="Deoxyadenosine kinase"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.113"
FT                   /note="Deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86287"
FT                   /db_xref="GOA:Q5XE76"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE76"
FT                   /protein_id="AAT86287.1"
FT                   /translation="MKPSSKQYANDIRRRRMLIVLAGTIGAGKSSLAAALGEHLGTDVF
FT                   YEAVDNNPVLDLYYQDPKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLK
FT                   LNYKNGNVTKTELDIYQELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSF
FT                   EQVDGNPSLEQYYHQVHGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTK
FT                   LKELHLL"
FT   gene            complement(155556..156533)
FT                   /locus_tag="M6_Spy0153"
FT   CDS_pept        complement(155556..156533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0153"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86288"
FT                   /db_xref="GOA:Q5XE75"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE75"
FT                   /protein_id="AAT86288.1"
FT                   /translation="MIKLNSSFRIGDVEIPHRTVLAPMAGVTNSVFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHDTLARVSKAITKIPFIGNGDVRSVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPDLPFAKKLDIAKDHLKRLINLKGET
FT                   IAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR"
FT   gene            complement(156520..157392)
FT                   /locus_tag="M6_Spy0154"
FT   CDS_pept        complement(156520..157392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0154"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86289"
FT                   /db_xref="GOA:Q5XE74"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE74"
FT                   /protein_id="AAT86289.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAICGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEAIINDKA"
FT   gene            complement(157539..157766)
FT                   /locus_tag="M6_Spy0155"
FT   CDS_pept        complement(157539..157766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0155"
FT                   /product="Transcriptional regulator"
FT                   /note="RofA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86290"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE73"
FT                   /protein_id="AAT86290.1"
FT                   /translation="MIFIPILQDNVYQIPDLKPDLVITHSQLIPFVHHELTKGIAVAEI
FT                   SFDESILSIQELMYRVKEEKFQADLTKQLT"
FT   gene            complement(157738..159027)
FT                   /locus_tag="M6_Spy0156"
FT   CDS_pept        complement(157738..159027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0156"
FT                   /product="Transcriptional regulator"
FT                   /note="RofA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86291"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE72"
FT                   /protein_id="AAT86291.1"
FT                   /translation="MIEKYLESSIESKCQLVVLFFKTSYLPITEVAEKTGLTFLQLNHY
FT                   CEELNAFFPDSLSMTIQKRMISCQFTHPFKETYLYQLYASSNVLQLLAFLIKNGSHSRP
FT                   LTDFARSHFLSNSSAYRMREALIPLLRNFELKLSKNKIVGEEYRIRYLIALLYSKFGIK
FT                   VYDLTQQDKNTIHSFLSHSSTHLKTSPWLSESFSFYDILLALSWKRHQFSVTIPQTRIF
FT                   QQLKKLFIYDSLKKSSRDIIETYCQLNFSAGDLDYLYLIYITANNSFASLQWTPEHIRQ
FT                   CCQLFEENDTFRLLLKPIITLLPNLKEQKPSLVKALMFFSKSFLFNLQHFIPETNLFVS
FT                   PYYKGNQKLYTSLKLIVEEWLAKLPGKRYLNHKHFHLFCHYVEQILRNIQPPLVVVFVA
FT                   SNFINAHLLTDSFPRYFSDKSIDFHSYIAR"
FT   gene            159255..161138
FT                   /locus_tag="M6_Spy0157"
FT   CDS_pept        159255..161138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0157"
FT                   /product="Fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86292"
FT                   /db_xref="GOA:Q5XE71"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE71"
FT                   /protein_id="AAT86292.1"
FT                   /translation="MVSSYMFVRGEKMNNKIFLNKEASFLAHTKRKRRFAVTLVGVFFM
FT                   LLACAGAIGFGQVAYAADEKTVPSHSSPNPEFPWYGYDAYGKEYPGYNIWTRYHDLRVN
FT                   LNGSRSYQVYCFNIQSNYPSQKNSFIKNWFKKIEGNGKSFVDYAHTTKLGKEELEQRLL
FT                   SLLYNAYPNDANGYMKGLEHLNAITVTQYAVWHYSDNSQYQFETLWESEAKEGKISRSQ
FT                   VTLMREALKKLIDPNLEATAVNKIPSGYRLNIFESENEAYQNLLSAEYVPDDPPKPGET
FT                   SEHNPKTPELDGTPIPEDPKHPDDNLEPTLPPVMLDGEEVPEVPSESLEPALPPLMPEL
FT                   DGQEVPEKPSIDLPIEVPRYEFNNKDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPN
FT                   ETGFSGNMVETEDTKEPEVLMGGQSESVEFTKDTQTGMSGQTTPQVETEDTKEPEVLMG
FT                   GQSESVEFTKDTQTGMSGQTTPQIETEDTKEPEVLMGGQSESVEFTKDTQTGMSGQTTP
FT                   QIETEDTKEPEVLMGGQSESVEFTKDTQTGMSGFSETATVVEDTRPKLVFHFDNNEPKV
FT                   EENREKPTKNITPILPATGDIENVLAFLGILILSVLSIFSLLKNKQSNKKV"
FT   gene            161874..162077
FT                   /locus_tag="M6_Spy0158"
FT   CDS_pept        161874..162077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0158"
FT                   /product="Reverse transcriptase"
FT                   /EC_number="2.7.7.49"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86293"
FT                   /db_xref="GOA:Q5XE70"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE70"
FT                   /protein_id="AAT86293.1"
FT                   /translation="MSLRHQNKKGIRKEGWKSRPQSRWSDHCQLVAQKSVLKQAISKTV
FT                   LAERGLFSCLDDYLERHALKVN"
FT   gene            162348..165458
FT                   /locus_tag="M6_Spy0159"
FT   CDS_pept        162348..165458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0159"
FT                   /product="Collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86294"
FT                   /db_xref="GOA:Q5XE69"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE69"
FT                   /protein_id="AAT86294.1"
FT                   /translation="MYSRLKRELVIVINRKKKYKLIRLMVTVGLIFSQLVLPIRRLGLQ
FT                   MISTQTKVIPQEIVTQTETQGTQVVATKQKLESENSSLKVALKRESGFEHNATIDASLD
FT                   TESQGDNSQRSVTQAIVTMALELRKQGLSIVDTKIVRIQSSTNQRNDITTTLTFKNGLS
FT                   LEGASTEANDPNVRVGIVNPNDTVQTITPTIKQDADGKVKNLVFTGRLGKQVIIVSTTR
FT                   LKEEQTISLDSYGELVIDGAVGLSQKDRPPYSKPITVNILKPKLSSIESSLDSKDFEIV
FT                   KTIDNLYTWDDQFYLLDFISKQYEVLKTDYQSAKDSTPQTRDILFGEYTVEPLVMNKGH
FT                   NNTINIYIRSTRPLGLKPIGAAPALIQPRSFRSLTPRSTRMKRSAPVEKFEGELEHHKR
FT                   IDYLGDNQNNPDTTIDDKEDEHDTSDLYRLYLDMTGKKNPLDILVVVDKSGSMQEGIGS
FT                   VQRYRYYAQRWDDYYSQWVYHGTFDYSSYQGESFNRGQIHYRYRGIVSVSDGIRRDDAV
FT                   KNSLLGVNGLLQRFVNINPENKLSVIGFQGSADYHAGKWYPDQSPRGGFYQPNLNNSRD
FT                   AELLKGWSTNSLLDPNTLTALHNNGTNYHAALLKAKEILNEVKDDGRRKIMIFISDGVP
FT                   TFYFGEDGYRSGNGSSNDRNNVTRSQEGSKLAIDEFKARYPNLSIYSLGVSKDINSDTA
FT                   SSSPVVLKYLSGEEHYYGITDTAELEKTLNKIVEDSKLSQLGISDSLSQYVDYYDKQPD
FT                   VLVTRKSKVNDETEILYQKDQVQEAGKDIIDKVVFTPKTTSQPKGKVTLTFKSDYKVDD
FT                   EYTYTLSFNVKASDEAYEKYKDNEGRYSEMGDSDTDYGTNQTSSGKGGLPSNSDASVNY
FT                   MADGREQKLPYKHPVIQVKTVPITFTKVDADNNQKKLAGVEFELRKEDKKIVWEKGTTG
FT                   SNGQLNFKYLQKGKTYYLYETKAKLGYTLPENPWEVAVANNGDIKVKHPIEGELKSKDG
FT                   SYMIKNYKIYQLPSSGGRGSQIFIIVGSMTATVALLFYRRQHRKKQY"
FT   gene            165476..167146
FT                   /locus_tag="M6_Spy0160"
FT   CDS_pept        165476..167146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0160"
FT                   /product="Fimbrial structural subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86295"
FT                   /db_xref="GOA:P18481"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041184"
FT                   /db_xref="PDB:4P0D"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18481"
FT                   /protein_id="AAT86295.1"
FT                   /translation="MTNRRETVREKILITAKKLMLACLAILAVVGLGMTRVSALSKDDT
FT                   AQLKITNIEGGPTVTLYKIGEGVYNTNGDSFINFKYAEGVSLTETGPTSQEITTIANGI
FT                   NTGKIKPFSTENVSISNGTATYNARGASVYIALLTGATDGRTYNPILLAASYNGEGNLV
FT                   TKNIDSKSNYLYGQTSVAKSSLPSITKKVTGTIDDVNKKTTSLGSVLSYSLTFELPSYT
FT                   KEAVNKTVYVSDNMSEGLTFNFNSLTVEWKGKMANITEDGSVMVENTKIGIAKEVNNGF
FT                   NLSFIYDSLESISPNISYKAVVNNKAIVGEEGNPNKAEFFYSNNPTKGNTYDNLDKKPD
FT                   KGNGITSKEDSKIVYTYQIAFRKVDSVSKTPLIGAIFGVYDTSNKLIDIVTTNKNGYAI
FT                   STQVSSGKYKIKELKAPKGYSLNTETYEITANWVTATVKTSANSKSTTYTSDKNKATDN
FT                   SEQVGWLKNGIFYSIDSRPTGNDVKEAYIESTKALTDGTTFSKSNEGSGTVLLETDIPN
FT                   TKLGELPSTGSIGTYLFKAIGSAAMIGAIGIYIVKRRKA"
FT   gene            167217..168059
FT                   /locus_tag="M6_Spy0161"
FT   CDS_pept        167217..168059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0161"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86296"
FT                   /db_xref="GOA:Q5XE67"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE67"
FT                   /protein_id="AAT86296.1"
FT                   /translation="MTERLKNLGILLLFLLGTAIFLYPTLSSQWNAYRDRQLLSTYHKQ
FT                   VIQKKPSEMEEVWQKAKAYNARLGIQPVPDAFSFRDGIHDKNYESLLQIENNDIMGYVE
FT                   VPSIKVTLPIYHYTTDEVLTKGAGHLFGSALPVGGDGTHTVISAHRGLPSAEMFTNLNL
FT                   VKKGDTFYFRVLNKVLAYKVDQILIVEPDQATSLSGVMGKDYATLVTCTPYGVNTKRLL
FT                   VRGHRIAYHYKKYQQAKKAMKLVDKSRMWAEVVCAAFGVVIAIILVFMYSRVSAKKSK"
FT   gene            complement(168254..168919)
FT                   /locus_tag="M6_Spy0162"
FT   CDS_pept        complement(168254..168919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0162"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86297"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE66"
FT                   /protein_id="AAT86297.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEEGKVHLYWQGNY
FT                   YVDNYVDYTKKLVDNDKNIEWTVTFNSTKEQWVYPDFSVFLPKGVKAPKEITYEHHYGN
FT                   GTVHSETRSNTQWHYNWENQQTNFNQEFDKFPGYTGWSTSLDKFYKLKNDGKFSHVLVD
FT                   TYGRQSHTYFSHKMVWKFKTELEDNYKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            169239..170678
FT                   /locus_tag="M6_Spy0163"
FT   CDS_pept        169239..170678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0163"
FT                   /product="Short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86298"
FT                   /db_xref="GOA:Q5XE65"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE65"
FT                   /protein_id="AAT86298.1"
FT                   /translation="MLVDNVKGIDNMNNIKTKKRFMDRYIDGFMKWMPESLFICFILTF
FT                   LVVTMSVLMTDSPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHK
FT                   MFKSLAKLPQTRTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTP
FT                   LFVATLFFTFLPATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFI
FT                   SLLVVCMLVPLCFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRL
FT                   VMYLVGGAIVSYSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVM
FT                   SSWGLVLQFPFYAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSG
FT                   GSKFVIEAPYIVPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIV
FT                   AYTIPCVLVVTGIAIIYLFVF"
FT   gene            complement(170746..171264)
FT                   /locus_tag="M6_Spy0164"
FT   CDS_pept        complement(170746..171264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0164"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86299"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE64"
FT                   /protein_id="AAT86299.1"
FT                   /translation="MNCKKKLFLKEVDFAILLTPTTLDATIADIDILLRDQLCLYMSHK
FT                   TFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLPVVKCYSASWDFLL
FT                   NCTRYSSYLTILPRPITHFAHIDSLVEVQLTEHPKWEVVLASLKHNKTSHLKHYIKHTI
FT                   LDYFTNQRF"
FT   gene            complement(171179..171658)
FT                   /locus_tag="M6_Spy0165"
FT   CDS_pept        complement(171179..171658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0165"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86300"
FT                   /db_xref="GOA:Q5XE63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE63"
FT                   /protein_id="AAT86300.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   VVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKTVSKRSRFCDFINTHYTRCYYC"
FT   gene            171779..172963
FT                   /locus_tag="M6_Spy0166"
FT   CDS_pept        171779..172963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0166"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86301"
FT                   /db_xref="GOA:Q5XE62"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE62"
FT                   /protein_id="AAT86301.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLIDQDEYPK
FT                   FGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            172918..173634
FT                   /locus_tag="M6_Spy0167"
FT   CDS_pept        172918..173634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0167"
FT                   /product="Acetate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86302"
FT                   /db_xref="GOA:Q5XE61"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE61"
FT                   /protein_id="AAT86302.1"
FT                   /translation="MYWWWPRSKYHRNKIEGNRMKENKRIAIAEAISHIKDGDTIMVGG
FT                   FMANGTPEALIDALVDKGTKDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEA
FT                   GRQMTAGETTIELIPQGTFAEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLL
FT                   EYPFEADVALIFANKADEMGNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPEC
FT                   VHTPHIFVDYIVKEGV"
FT   gene            173637..174287
FT                   /locus_tag="M6_Spy0168"
FT   CDS_pept        173637..174287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0168"
FT                   /product="Acetate CoA-transferase beta subunit"
FT                   /EC_number="2.8.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86303"
FT                   /db_xref="GOA:Q5XE60"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE60"
FT                   /protein_id="AAT86303.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKEKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEGE"
FT   gene            complement(174405..175085)
FT                   /locus_tag="M6_Spy0169"
FT   CDS_pept        complement(174405..175085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0169"
FT                   /product="Putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86304"
FT                   /db_xref="GOA:Q5XE59"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE59"
FT                   /protein_id="AAT86304.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            175259..175624
FT                   /locus_tag="M6_Spy0170"
FT   CDS_pept        175259..175624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0170"
FT                   /product="Translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86305"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE58"
FT                   /protein_id="AAT86305.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            175661..176680
FT                   /locus_tag="M6_Spy0171"
FT   CDS_pept        175661..176680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0171"
FT                   /product="Transcriptional regulator pfoR"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86306"
FT                   /db_xref="GOA:Q5XE57"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE57"
FT                   /protein_id="AAT86306.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            177131..177454
FT                   /locus_tag="M6_Spy0172"
FT   CDS_pept        177131..177454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0172"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86307"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE56"
FT                   /protein_id="AAT86307.1"
FT                   /translation="MMNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEY
FT                   EQETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVET
FT                   YGH"
FT   gene            177444..179444
FT                   /locus_tag="M6_Spy0173"
FT   CDS_pept        177444..179444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0173"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86308"
FT                   /db_xref="GOA:Q5XE55"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE55"
FT                   /protein_id="AAT86308.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEERHRQQAAQTALKMMSQKIERLEQLQNKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANDHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   gene            179404..179925
FT                   /locus_tag="M6_Spy0174"
FT   CDS_pept        179404..179925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0174"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86309"
FT                   /db_xref="GOA:Q5XE54"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE54"
FT                   /protein_id="AAT86309.1"
FT                   /translation="MSMSMKKQIWRTINMEHLAHYFTAHGGVFFAALGIVLAVALSGMG
FT                   SAYGVGKGGQAAAALLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQ
FT                   GLAYFLVSLPIAIVGYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFV
FT                   VSFILLNKIG"
FT   gene            179994..180578
FT                   /locus_tag="M6_Spy0175"
FT   CDS_pept        179994..180578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0175"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86310"
FT                   /db_xref="GOA:Q5XE53"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE53"
FT                   /protein_id="AAT86310.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDGIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   gene            180594..181592
FT                   /locus_tag="M6_Spy0176"
FT   CDS_pept        180594..181592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0176"
FT                   /product="V-type sodium ATP synthase subunit C"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86311"
FT                   /db_xref="GOA:Q5XE52"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE52"
FT                   /protein_id="AAT86311.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLAALEHLIRTMTSDEFPKEVVTEIQSIWVEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKECVIERMRPIA"
FT   gene            181559..181909
FT                   /locus_tag="M6_Spy0177"
FT   CDS_pept        181559..181909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0177"
FT                   /product="V-type sodium ATP synthase subunit F"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86312"
FT                   /db_xref="GOA:Q5XE51"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE51"
FT                   /protein_id="AAT86312.1"
FT                   /translation="MCHRKDETNSMTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQD
FT                   AINQLRQLAMEDFGIIYITEDIAAAIPEALTHYDNQVLPAVLPLPTHQGAQGIGLSRIQ
FT                   AMVEKAVGQNIL"
FT   gene            182152..183885
FT                   /locus_tag="M6_Spy0178"
FT   CDS_pept        182152..183885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0178"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86313"
FT                   /db_xref="GOA:Q5XE50"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE50"
FT                   /protein_id="AAT86313.1"
FT                   /translation="MASGMQEANIQDICRVGHLGLVGEIIEMRRDQASIQVYEETSGIG
FT                   PGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLIRGVAIPSLDRKAKW
FT                   AFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIHAGDFTVTDTVYEIK
FT                   QEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFPVTKGGAAAVPGPFG
FT                   AGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPNTGQSIMERTVLIAN
FT                   TSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALREMSGRLQEMPGDEG
FT                   YPAYLGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDISEPVTQNTLRIVKVF
FT                   WGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQQSNWSNKVTRAMAILQREASLE
FT                   EIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFPKQEAMLTNILTFNE
FT                   EASKALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQKVTKEIHHVLAKGG
FT                   I"
FT   gene            183886..185301
FT                   /locus_tag="M6_Spy0179"
FT   CDS_pept        183886..185301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0179"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86314"
FT                   /db_xref="GOA:Q5XE49"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE49"
FT                   /protein_id="AAT86314.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            185325..185972
FT                   /locus_tag="M6_Spy0180"
FT   CDS_pept        185325..185972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0180"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86315"
FT                   /db_xref="GOA:Q5XE48"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE48"
FT                   /protein_id="AAT86315.1"
FT                   /translation="MTKGVISMARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELM
FT                   RRFVDLIRENNELRQTLEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIEN
FT                   IMSVNVPKFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTC
FT                   QLMADDIEKTRRRVNGLEYSIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(186092..187354)
FT                   /locus_tag="M6_Spy0181"
FT   CDS_pept        complement(186092..187354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0181"
FT                   /product="Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86316"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE47"
FT                   /protein_id="AAT86316.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEEVNATVDHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   TTPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIVNANNAALQMLAETSKEAIPALEQSAQ
FT                   SPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   gene            complement(187367..188245)
FT                   /locus_tag="M6_Spy0182"
FT   CDS_pept        complement(187367..188245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0182"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86317"
FT                   /db_xref="GOA:Q5XE46"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE46"
FT                   /protein_id="AAT86317.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRQLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            188683..189975
FT                   /locus_tag="M6_Spy0183"
FT   CDS_pept        188683..189975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0183"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86318"
FT                   /db_xref="GOA:Q5XE45"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE45"
FT                   /protein_id="AAT86318.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDAV
FT                   KICVAYDLDGERIDYYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   IGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            190302..191345
FT                   /locus_tag="M6_Spy0184"
FT   CDS_pept        190302..191345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0184"
FT                   /product="Nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86319"
FT                   /db_xref="GOA:Q5XE44"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE44"
FT                   /protein_id="AAT86319.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSSKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEGQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEG
FT                   TITVPEN"
FT   gene            191503..192057
FT                   /locus_tag="M6_Spy0185"
FT   CDS_pept        191503..192057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0185"
FT                   /product="Transcription antitermination protein"
FT                   /note="NusG"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86320"
FT                   /db_xref="GOA:Q5XE43"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE43"
FT                   /protein_id="AAT86320.1"
FT                   /translation="MKGNIMLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNIL
FT                   RVEIPTQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNR
FT                   SKPTPLLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKL
FT                   MLNMFGSETVAEVELYQIAEL"
FT   gene            192420..193784
FT                   /locus_tag="M6_Spy0186"
FT   CDS_pept        192420..193784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0186"
FT                   /product="NAD glycohydrolase"
FT                   /EC_number="3.2.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86321"
FT                   /db_xref="GOA:Q5XE42"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="InterPro:IPR041934"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE42"
FT                   /protein_id="AAT86321.1"
FT                   /translation="MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKE
FT                   NKKSDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASP
FT                   MRIGRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEI
FT                   DKKLDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADE
FT                   FIETADKYADKAVQMSAVASRAEYYRMYVSRKYQYKKEFVEKLKQVYKESGASHVTSKK
FT                   DLMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYS
FT                   DGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPS
FT                   ISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   gene            193789..194274
FT                   /locus_tag="M6_Spy0187"
FT   CDS_pept        193789..194274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0187"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86322"
FT                   /db_xref="InterPro:IPR032002"
FT                   /db_xref="InterPro:IPR038509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE41"
FT                   /protein_id="AAT86322.1"
FT                   /translation="MYKVPKGLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMG
FT                   DISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALDIYQAVQTLNAENMLLN
FT                   YYESLPFYLNRQSILANITKALKDAHIREAMAHYKLGEFAHYQDTMLDMVERTIETF"
FT   gene            194289..196013
FT                   /locus_tag="M6_Spy0188"
FT   CDS_pept        194289..196013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0188"
FT                   /product="Streptolysin O"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86323"
FT                   /db_xref="GOA:Q5XE40"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE40"
FT                   /protein_id="AAT86323.1"
FT                   /translation="MKDMSNKKTFKKYSRVAGLLTVALIIGNLVTANAESNKQNTASTE
FT                   TTTTNEQPKPESSELTIEKAGQKMDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKS
FT                   EEDHTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTP
FT                   VDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVND
FT                   PTYANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTL
FT                   GIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKDLQRKGVSNEAPPL
FT                   FVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGG
FT                   DAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVET
FT                   TSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVI
FT                   PLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            complement(196152..196394)
FT                   /locus_tag="M6_Spy0189"
FT   CDS_pept        complement(196152..196394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0189"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86324"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE39"
FT                   /protein_id="AAT86324.1"
FT                   /translation="MKKKLSLFMIATAAVVGLSLATPKNQTVSANEAVATQACADGTNC
FT                   CGYNFYGYCRPISWLFYKTKHLLMGDQPTTDIVTK"
FT   gene            complement(196777..196932)
FT                   /locus_tag="M6_Spy0190"
FT   CDS_pept        complement(196777..196932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0190"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86325"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE38"
FT                   /protein_id="AAT86325.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGNHQTVSANDASFYGQNAPDSW
FT                   LLYTVW"
FT   gene            complement(197117..197383)
FT                   /locus_tag="M6_Spy0191"
FT   CDS_pept        complement(197117..197383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86326"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE37"
FT                   /protein_id="AAT86326.1"
FT                   /translation="MKNKLFLVALATVTVLGPSLANPHHGTVHTTEYCTYVTGKPEVGG
FT                   CYERKDGMPIEENIIKKSNDFSLLNWFWEIITNWWSKITGYFS"
FT   gene            197616..199007
FT                   /locus_tag="M6_Spy0192"
FT   CDS_pept        197616..199007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0192"
FT                   /product="Cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86327"
FT                   /db_xref="GOA:Q5XE36"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE36"
FT                   /protein_id="AAT86327.1"
FT                   /translation="MLAAWSKMIKGLANLAKGCIINVIDLKMILLEKFIIHLKGAHYFS
FT                   YRLADHAFLKSFLVCATIGVGPLSKREFIGVNAIAEVHEMRENTTLLHGYTVIDEFTGA
FT                   ASVPIYQTSTFHNSELYCPSQKHLYTRFSNPTTEALEDGLACLEKATYAVAYASGMAAI
FT                   STVLMLLKAGDHVIFPLEVYGGTCQFATAILPNYQIETSFVDMADLATVKASIRPNTRM
FT                   IYLETPSNPLLKICDISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKF
FT                   INGHSDVVAGLAATNNEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKN
FT                   AQQLANYLAKHPKVLKVHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMTFTHRI
FT                   QLPILAVSLGGVESILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLADFE
FT                   QALAF"
FT   gene            199218..201719
FT                   /locus_tag="M6_Spy0193"
FT   CDS_pept        199218..201719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0193"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86328"
FT                   /db_xref="GOA:Q5XE35"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE35"
FT                   /protein_id="AAT86328.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGNEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSGFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDKSKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   TGKDIIKVIAVPNKLVNIVIK"
FT   gene            202026..203459
FT                   /locus_tag="M6_Spy0194"
FT   CDS_pept        202026..203459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0194"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86329"
FT                   /db_xref="GOA:Q5XE34"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE34"
FT                   /protein_id="AAT86329.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSDVDLIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QLQFAKAKDKEAYYRGEAQ"
FT   gene            203530..203808
FT                   /locus_tag="M6_Spy0195"
FT   CDS_pept        203530..203808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0195"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86330"
FT                   /db_xref="GOA:Q5XE33"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE33"
FT                   /protein_id="AAT86330.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            203931..204416
FT                   /locus_tag="M6_Spy0196"
FT   CDS_pept        203931..204416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0196"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86331"
FT                   /db_xref="GOA:Q5XE32"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE32"
FT                   /protein_id="AAT86331.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVQLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   gene            204507..205169
FT                   /locus_tag="M6_Spy0197"
FT   CDS_pept        204507..205169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0197"
FT                   /product="3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86332"
FT                   /db_xref="GOA:Q5XE31"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE31"
FT                   /protein_id="AAT86332.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAMK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIKRIWG"
FT   gene            205132..206037
FT                   /locus_tag="M6_Spy0198"
FT   CDS_pept        205132..206037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0198"
FT                   /product="L-xylulose 5-phosphate 3-epimerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86333"
FT                   /db_xref="GOA:Q5XE30"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE30"
FT                   /protein_id="AAT86333.1"
FT                   /translation="MPSKMKSNVSGGNFMARPIGIYEKATPKQFTWRERLQFAKDLGFD
FT                   FVEMSVDESDARLARLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPAIEA
FT                   KSLKLMKQCIELAQDLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVML
FT                   SIEIMDDPFINSIEKYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALH
FT                   LKDTYAVTETSKGQFRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETK
FT                   AAIKEAQDFLYPLIEKAGLA"
FT   gene            206015..206743
FT                   /locus_tag="M6_Spy0199"
FT   CDS_pept        206015..206743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0199"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86334"
FT                   /db_xref="GOA:Q5XE29"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE29"
FT                   /protein_id="AAT86334.1"
FT                   /translation="MRKRGWHNMAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCR
FT                   ELGRIVIKPSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIV
FT                   HTHSTEAVGWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEF
FT                   SKRGLDPMAVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVARMNRLTEQINPRVEPAPR
FT                   YIMDKHYLRKHGPNAYYGQK"
FT   gene            206801..206941
FT                   /locus_tag="M6_Spy0200"
FT   CDS_pept        206801..206941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0200"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE28"
FT                   /protein_id="AAT86335.1"
FT                   /translation="MLIIVWASPFDLSFSMNYLNANEHKLDESYVVEFLETRYKVLDQL
FT                   R"
FT   gene            207062..208708
FT                   /locus_tag="M6_Spy0201"
FT   CDS_pept        207062..208708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0201"
FT                   /product="Transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86336"
FT                   /db_xref="GOA:Q5XE27"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE27"
FT                   /protein_id="AAT86336.1"
FT                   /translation="MMILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKI
FT                   NQALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVS
FT                   TERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQ
FT                   YLYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTIN
FT                   TQDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFK
FT                   LHLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDL
FT                   LKQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDD
FT                   IAYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQ
FT                   YQSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTE
FT                   LTKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            208961..210052
FT                   /locus_tag="M6_Spy0202"
FT   CDS_pept        208961..210052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0202"
FT                   /product="Metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86337"
FT                   /db_xref="GOA:Q5XE26"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE26"
FT                   /protein_id="AAT86337.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            210539..211735
FT                   /locus_tag="M6_Spy0203"
FT   CDS_pept        210539..211735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0203"
FT                   /product="Glycine betaine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86338"
FT                   /db_xref="GOA:Q5XE25"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE25"
FT                   /protein_id="AAT86338.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANEFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            211751..213478
FT                   /locus_tag="M6_Spy0204"
FT   CDS_pept        211751..213478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0204"
FT                   /product="Glycine betaine-binding protein"
FT                   /note="Glycine betaine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86339"
FT                   /db_xref="GOA:Q5XE24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE24"
FT                   /protein_id="AAT86339.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAIFLIAALGRGIMTMASGMADKGETVNIAYVQWDSEVASTHV
FT                   IAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGP
FT                   NLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLSSWE
FT                   LVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENINTIA
FT                   RKGLKKDLPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   gene            213609..216251
FT                   /locus_tag="M6_Spy0205"
FT   CDS_pept        213609..216251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0205"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86340"
FT                   /db_xref="GOA:Q5XE23"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE23"
FT                   /protein_id="AAT86340.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVQPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPEEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKASKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAAISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILAYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKTYIDTYFERYPRIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   gene            216429..216884
FT                   /locus_tag="M6_Spy0206"
FT   CDS_pept        216429..216884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0206"
FT                   /product="CoA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86341"
FT                   /db_xref="GOA:Q5XE22"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE22"
FT                   /protein_id="AAT86341.1"
FT                   /translation="MIYSFQNPSEDVLKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   gene            216936..217403
FT                   /locus_tag="M6_Spy0207"
FT   CDS_pept        216936..217403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0207"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86342"
FT                   /db_xref="GOA:Q5XE21"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE21"
FT                   /protein_id="AAT86342.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   gene            complement(217506..218369)
FT                   /locus_tag="M6_Spy0208"
FT   CDS_pept        complement(217506..218369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0208"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86343"
FT                   /db_xref="GOA:Q5XE20"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE20"
FT                   /protein_id="AAT86343.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGGSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDKVKEGTYLGAIAVIETSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   gene            218406..218591
FT                   /locus_tag="M6_Spy0209"
FT   CDS_pept        218406..218591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0209"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86344"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE19"
FT                   /protein_id="AAT86344.1"
FT                   /translation="MRQLTIILTILFWESMTNYGFFDKMIGARTTCHLEALHYDGNSGR
FT                   SKKLKTVYLDSKEEST"
FT   gene            218588..219730
FT                   /locus_tag="M6_Spy0210"
FT   CDS_pept        218588..219730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0210"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86345"
FT                   /db_xref="GOA:Q5XE18"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE18"
FT                   /protein_id="AAT86345.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFLGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            219948..220259
FT                   /locus_tag="M6_Spy0211"
FT   CDS_pept        219948..220259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0211"
FT                   /product="Zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86346"
FT                   /db_xref="GOA:Q5XE17"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE17"
FT                   /protein_id="AAT86346.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   ADHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            220263..220802
FT                   /locus_tag="M6_Spy0212"
FT   CDS_pept        220263..220802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0212"
FT                   /product="BioY"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86347"
FT                   /db_xref="GOA:Q5XE16"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE16"
FT                   /protein_id="AAT86347.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALFISGVLLVDVMGAIWLAAYTGMPLMTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            220942..221721
FT                   /locus_tag="M6_Spy0213"
FT   CDS_pept        220942..221721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0213"
FT                   /product="Metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86348"
FT                   /db_xref="GOA:Q5XE15"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE15"
FT                   /protein_id="AAT86348.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVEQIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPEGI
FT                   DPDNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            221697..222236
FT                   /locus_tag="M6_Spy0214"
FT   CDS_pept        221697..222236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0214"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86349"
FT                   /db_xref="GOA:Q5XE14"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="PDB:2NX8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE14"
FT                   /protein_id="AAT86349.1"
FT                   /translation="MELGESFLMPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKD
FT                   GEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGL
FT                   ARIPHVIYGASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRER
FT                   KKIAKHLIKEQSDPFD"
FT   gene            complement(222850..224082)
FT                   /locus_tag="M6_Spy0215"
FT   CDS_pept        complement(222850..224082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0215"
FT                   /product="S-layer protein"
FT                   /EC_number="3.2.1.-"
FT                   /note="Peptidoglycan endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86350"
FT                   /db_xref="GOA:Q5XE13"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE13"
FT                   /protein_id="AAT86350.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASKKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANMPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDHLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAI
FT                   LESLENQLLNRQEPLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   gene            224124..224231
FT                   /locus_tag="M6_Spy0216"
FT   CDS_pept        224124..224231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0216"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86351"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE12"
FT                   /protein_id="AAT86351.1"
FT                   /translation="MGRGKDFQKAKSCLERVMIFLGIQSILSQNEAMLT"
FT   gene            224896..225186
FT                   /locus_tag="M6_Spy0217"
FT   CDS_pept        224896..225186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0217"
FT                   /product="Enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86352"
FT                   /db_xref="GOA:Q5XE11"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE11"
FT                   /protein_id="AAT86352.1"
FT                   /translation="MPSEVVRIKKKQFTLQEFDFKIRKFLMEKYNIYDSESRYTSGSLF
FT                   LATKDSKHYEVDLFNKDDKLLSRDSFFKRYKDNKIFNSEEISHFDIYLKTH"
FT   gene            225271..225390
FT                   /locus_tag="M6_Spy0218"
FT   CDS_pept        225271..225390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0218"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE10"
FT                   /protein_id="AAT86353.1"
FT                   /translation="MRKYLQVIGASIAFAGVALCIDHMHDGVITRIEMIKSLK"
FT   gene            225642..226991
FT                   /locus_tag="M6_Spy0219"
FT   CDS_pept        225642..226991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0219"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86354"
FT                   /db_xref="GOA:Q5XE09"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE09"
FT                   /protein_id="AAT86354.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDKEEFARILTAAEKIKADSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYL
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDNPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   gene            complement(227339..228847)
FT                   /locus_tag="M6_Spy0220"
FT   CDS_pept        complement(227339..228847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0220"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86355"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE08"
FT                   /protein_id="AAT86355.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFAAQKNLQPSAFLDRRFLFFDVLLMLTWKRHRYPVHLPHLALF
FT                   EHLKSLPIFDNIKTIAVDELAPRTRVTFSSDDFDYLFLIYLTTDNSFLSGYWTSHQRQQ
FT                   LYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQ
FT                   YQGNMLLLDKLETVIKDWLYDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQ
FT                   ETVGNVIANFITSTIPSYKVELSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFP
FT                   KETRLFGLSLDCIQQQREDLIKTILALHQNHYQKRLEELWRVPS"
FT   gene            229268..229387
FT                   /locus_tag="M6_Spy0221"
FT   CDS_pept        229268..229387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE07"
FT                   /protein_id="AAT86356.1"
FT                   /translation="MPLFLIFFERASFLSALNLFPNLWYDKKMMKKEILKELF"
FT   gene            229400..229507
FT                   /locus_tag="M6_Spy0222"
FT   CDS_pept        229400..229507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0222"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE06"
FT                   /protein_id="AAT86357.1"
FT                   /translation="MDVDLKRQNDQALLVDVVSNQAYQRANTIAKSNDL"
FT   gene            229535..230206
FT                   /locus_tag="M6_Spy0223"
FT   CDS_pept        229535..230206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0223"
FT                   /product="Integral membrane protein (Rhomboid family)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86358"
FT                   /db_xref="GOA:Q5XE05"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE05"
FT                   /protein_id="AAT86358.1"
FT                   /translation="MTRLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITMKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(230304..231209)
FT                   /locus_tag="M6_Spy0224"
FT   CDS_pept        complement(230304..231209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0224"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86359"
FT                   /db_xref="GOA:Q5XE04"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE04"
FT                   /protein_id="AAT86359.1"
FT                   /translation="MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVE
FT                   EALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIR
FT                   QSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIA
FT                   VMRVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSI
FT                   LEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQV
FT                   KDDLKAYIIQLGKALEKTKP"
FT   gene            complement(231236..232252)
FT                   /locus_tag="M6_Spy0225"
FT   CDS_pept        complement(231236..232252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0225"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86360"
FT                   /db_xref="GOA:Q5XE03"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XE03"
FT                   /protein_id="AAT86360.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEVIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            232550..232999
FT                   /locus_tag="M6_Spy0226"
FT   CDS_pept        232550..232999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0226"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86361"
FT                   /db_xref="GOA:Q5XE02"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE02"
FT                   /protein_id="AAT86361.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            232992..234698
FT                   /locus_tag="M6_Spy0227"
FT   CDS_pept        232992..234698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0227"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86362"
FT                   /db_xref="GOA:Q5XE01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE01"
FT                   /protein_id="AAT86362.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINHIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIMVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLAQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMNSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            234698..236485
FT                   /locus_tag="M6_Spy0228"
FT   CDS_pept        234698..236485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0228"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86363"
FT                   /db_xref="GOA:Q5XE00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XE00"
FT                   /protein_id="AAT86363.1"
FT                   /translation="MMKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLT
FT                   ELGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHS
FT                   TNRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIG
FT                   LVWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQ
FT                   KAIIVQGVQEDTMTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTI
FT                   VLSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEE
FT                   VRPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPKGKMIAVVGPTGSGKTTIM
FT                   NLINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTIS
FT                   QDMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILD
FT                   EATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHE
FT                   LLHQKGFYAELYHNQFVFE"
FT   gene            236603..237370
FT                   /locus_tag="M6_Spy0229"
FT   CDS_pept        236603..237370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0229"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86364"
FT                   /db_xref="GOA:Q5XDZ9"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ9"
FT                   /protein_id="AAT86364.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            237480..237926
FT                   /locus_tag="M6_Spy0230"
FT   CDS_pept        237480..237926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0230"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86365"
FT                   /db_xref="GOA:Q5XDZ8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ8"
FT                   /protein_id="AAT86365.1"
FT                   /translation="MTKTRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            238007..239368
FT                   /locus_tag="M6_Spy0231"
FT   CDS_pept        238007..239368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0231"
FT                   /product="RadA"
FT                   /note="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86366"
FT                   /db_xref="GOA:Q5XDZ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDZ7"
FT                   /protein_id="AAT86366.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLKAVFS"
FT   gene            239554..240054
FT                   /locus_tag="M6_Spy0232"
FT   CDS_pept        239554..240054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0232"
FT                   /product="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86367"
FT                   /db_xref="GOA:Q5XDZ6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ6"
FT                   /protein_id="AAT86367.1"
FT                   /translation="MMSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVA
FT                   QALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFA
FT                   KHIHEHLGVDVSGQDFLPFQDVEDSVREDMAKLRASSLIPDDVVINGAVYDVDTGKMTQ
FT                   VME"
FT   gene            240149..240895
FT                   /locus_tag="M6_Spy0233"
FT   CDS_pept        240149..240895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0233"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86368"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDZ5"
FT                   /protein_id="AAT86368.1"
FT                   /translation="MYQVIHTNKESKMVDNRMRFTIDRSMQFPLVEIDLEHGGSVYLQQ
FT                   GSMVYHTENVTLNTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSDGDGKLALAPNT
FT                   PGQIVALELGEKQYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTL
FT                   LANSFGSIKKITLDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVINTFRGH
FT                   GEIYIQSLNLEQFAGTLKRYLPTSSN"
FT   gene            241076..242521
FT                   /locus_tag="M6_Spy0234"
FT   CDS_pept        241076..242521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0234"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86369"
FT                   /db_xref="GOA:Q5XDZ4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDZ4"
FT                   /protein_id="AAT86369.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            242915..244261
FT                   /locus_tag="M6_Spy0235"
FT   CDS_pept        242915..244261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0235"
FT                   /product="FasB"
FT                   /EC_number="2.7.3.-"
FT                   /note="Sensory transduction protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86370"
FT                   /db_xref="GOA:Q5XDZ3"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ3"
FT                   /protein_id="AAT86370.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLFVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   gene            244258..245541
FT                   /locus_tag="M6_Spy0236"
FT   CDS_pept        244258..245541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0236"
FT                   /product="FasC"
FT                   /EC_number="2.7.3.-"
FT                   /note="Sensory transduction protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86371"
FT                   /db_xref="GOA:Q5XDZ2"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ2"
FT                   /protein_id="AAT86371.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSIIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFIYLAIFIWVIVKLDRFAKDQLSQKLTQAQNE
FT                   RIAYLENYNQSIEQLYREIRTVKHDSENILISLKDSIDSGDIDLITRVYDTVIQQSTTS
FT                   MMRTNYEISSLDNIKETVIRSIMNSKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLF
FT                   TGLVDNAIETAKGSRRPFLSIAYFKQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHF
FT                   LTVLDSYPQITLSTKSDHYRLRQLLEMR"
FT   gene            245545..246285
FT                   /locus_tag="M6_Spy0237"
FT   CDS_pept        245545..246285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0237"
FT                   /product="FasA"
FT                   /note="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86372"
FT                   /db_xref="GOA:Q5XDZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDZ1"
FT                   /protein_id="AAT86372.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            246825..247184
FT                   /locus_tag="M6_Spy0238"
FT   CDS_pept        246825..247184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0238"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86373"
FT                   /db_xref="GOA:Q5XDZ0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDZ0"
FT                   /protein_id="AAT86373.1"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            247150..247977
FT                   /locus_tag="M6_Spy0239"
FT   CDS_pept        247150..247977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0239"
FT                   /product="60 kDa inner membrane protein YIDC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86374"
FT                   /db_xref="GOA:Q5XDY9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDY9"
FT                   /protein_id="AAT86374.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLATKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   gene            247989..248903
FT                   /locus_tag="M6_Spy0240"
FT   CDS_pept        247989..248903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0240"
FT                   /product="Jag"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86375"
FT                   /db_xref="GOA:Q5XDY8"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY8"
FT                   /protein_id="AAT86375.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINQKHAPAVNSADVEPEEIKATQKLEAEDTK
FT                   VVPLMPEDSPAQTPSNLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            248988..249110
FT                   /locus_tag="M6_Spy0241"
FT   CDS_pept        248988..249110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0241"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86376"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY7"
FT                   /protein_id="AAT86376.1"
FT                   /translation="MIIVAIDKVSTVRQRNSVKEETLYEMNGLLNERETVEKRK"
FT   gene            249218..249352
FT                   /locus_tag="M6_Spy0242"
FT   CDS_pept        249218..249352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0242"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86377"
FT                   /db_xref="GOA:Q5XDY6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDY6"
FT                   /protein_id="AAT86377.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            249626..250330
FT                   /locus_tag="M6_Spy0243"
FT   CDS_pept        249626..250330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0243"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86378"
FT                   /db_xref="GOA:Q5XDY5"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDY5"
FT                   /protein_id="AAT86378.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLMAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAGRFIEALKS"
FT   gene            250379..251698
FT                   /locus_tag="M6_Spy0244"
FT   CDS_pept        250379..251698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0244"
FT                   /product="N-acetylneuraminate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86379"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY4"
FT                   /protein_id="AAT86379.1"
FT                   /translation="MNMKKLASLAMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTEEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMKKIAEWTKFYSPYYNTIDGF
FT                   TEMRTLWFPMVQAVSNGDEKPEDALKAFTEKANKTIKKTQ"
FT   gene            251712..251816
FT                   /locus_tag="M6_Spy0245"
FT   CDS_pept        251712..251816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0245"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY3"
FT                   /protein_id="AAT86380.1"
FT                   /translation="MASFHGTCQMVTGKEPFLFLGEINRKRGISSERQ"
FT   gene            251803..252690
FT                   /locus_tag="M6_Spy0246"
FT   CDS_pept        251803..252690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0246"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86381"
FT                   /db_xref="GOA:Q5XDY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY2"
FT                   /protein_id="AAT86381.1"
FT                   /translation="MNVNKLKMRETLISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYS
FT                   MTDFTFVGFANYVRMFQDPIFMKSLINTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARS
FT                   FYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNYVLKYAHVIEQNISWLGDKHWALLAI
FT                   IVILLTTSVGQPIILYIAAMGNIDNSLMEAARVDGATEFQVFWNIKWPSLLPTTLYIAV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIAII
FT                   SFAQFKILGNDVEY"
FT   gene            252703..253533
FT                   /locus_tag="M6_Spy0247"
FT   CDS_pept        252703..253533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0247"
FT                   /product="N-acetylneuraminate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86382"
FT                   /db_xref="GOA:Q5XDY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY1"
FT                   /protein_id="AAT86382.1"
FT                   /translation="MTKKKLTASDILTTVMLCVLTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSIFISVATMFLVCGTSSLAGYALAKKRFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            253690..254352
FT                   /locus_tag="M6_Spy0248"
FT   CDS_pept        253690..254352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0248"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86383"
FT                   /db_xref="GOA:Q5XDY0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDY0"
FT                   /protein_id="AAT86383.1"
FT                   /translation="MTSKKQGLLYSLFNLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLFTTYSSYFKNYFKRGMRLGLIELLIMSICVLDLFLI
FT                   RNQSGLVFQGFKVLCIAVLFLVVILFLYAYPQAVRKELPLLILFKRSLLLAGIFFPWTF
FT                   AFLVVIGLLVFTLPLTLLTLFCGLSLLATMGISSLTYFYLLIMESLLRRFPLNNDIE"
FT   gene            254364..255278
FT                   /locus_tag="M6_Spy0249"
FT   CDS_pept        254364..255278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0249"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86384"
FT                   /db_xref="GOA:Q5XDX9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX9"
FT                   /protein_id="AAT86384.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGAISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDRIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIAHKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            255300..256238
FT                   /locus_tag="M6_Spy0250"
FT   CDS_pept        255300..256238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0250"
FT                   /product="N-acetylmannosamine kinase"
FT                   /EC_number="2.7.1.60"
FT                   /note="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86385"
FT                   /db_xref="GOA:Q5XDX8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX8"
FT                   /protein_id="AAT86385.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDEGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   gene            complement(256349..257191)
FT                   /locus_tag="M6_Spy0251"
FT   CDS_pept        complement(256349..257191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0251"
FT                   /product="Transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86386"
FT                   /db_xref="GOA:Q5XDX7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX7"
FT                   /protein_id="AAT86386.1"
FT                   /translation="MCFAMPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTA
FT                   SEIVKRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDY
FT                   DALINKTYELVNEEKLLNLAKLIDASERVYFFGKGSSGLVAREMKLRFMRLGLICDAYS
FT                   DTDGFTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSL
FT                   DIIPVSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   gene            257464..258255
FT                   /locus_tag="M6_Spy0252"
FT   CDS_pept        257464..258255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0252"
FT                   /product="Sec-independent protein translocase protein"
FT                   /EC_number="3.1.21.-"
FT                   /note="TatD"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86387"
FT                   /db_xref="GOA:Q5XDX6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX6"
FT                   /protein_id="AAT86387.1"
FT                   /translation="MTNKVEKLTIFDTHTHLNVAEFQGHEAEELALAQEMGVAYHNVVG
FT                   FDQATISGALALADQYPNVYATIGWHPTEAGSYSEAVEESIVSQLSHPKVIALGEIGLD
FT                   YHWMEDPKEVQIEVFKRQMQLAKDHDLPFVVHTRDALEDTYEVIKAAGVGPRGGIMHSY
FT                   SGSLEMAERFIELGMMISFSGVVTFKKALDIQEAAQHLPLDKILVETDAPYLTPVPKRG
FT                   KQNHTAYTRYVVDKIAELRGMTVEEVAKATTANAKRVFKLD"
FT   gene            258206..258817
FT                   /locus_tag="M6_Spy0253"
FT   CDS_pept        258206..258817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0253"
FT                   /product="Ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86388"
FT                   /db_xref="GOA:Q5XDX5"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX5"
FT                   /protein_id="AAT86388.1"
FT                   /translation="MQKQRLLMQRGYSSLTEKINIQEVLVVEGKDDTANLRRFYEVDTY
FT                   ETRGSAITEEDLERINRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHVFLNRNEAV
FT                   PSSKSKGRSLGVEHARFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRR
FT                   EYLGEKLRIGYANGKQLLKRLELFGITLAEVEEVMETYGE"
FT   gene            258907..259803
FT                   /locus_tag="M6_Spy0254"
FT   CDS_pept        258907..259803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0254"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86389"
FT                   /db_xref="GOA:Q5XDX4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDX4"
FT                   /protein_id="AAT86389.1"
FT                   /translation="MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQK
FT                   IVDTAEIDQNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQV
FT                   VNQDILKADLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQRE
FT                   VADRISAEPNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLI
FT                   EIKDEDFFFRVSRLSFVHRRKTLWNNLTSHFGKSEDIKTKLEKGLALADIKPSIRGEAL
FT                   SIQDFGKLADALKEVGL"
FT   gene            260228..261100
FT                   /locus_tag="M6_Spy0255"
FT   CDS_pept        260228..261100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0255"
FT                   /product="GTPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86390"
FT                   /db_xref="GOA:Q5XDX3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDX3"
FT                   /protein_id="AAT86390.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSLEELLPLLADKITVFMGQTGVGKS
FT                   TLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAED
FT                   LNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRE
FT                   TYKKVIKRK"
FT   gene            261110..261772
FT                   /locus_tag="M6_Spy0256"
FT   CDS_pept        261110..261772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0256"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86391"
FT                   /db_xref="GOA:Q5XDX2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX2"
FT                   /protein_id="AAT86391.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALNV"
FT   gene            261765..262397
FT                   /locus_tag="M6_Spy0257"
FT   CDS_pept        261765..262397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0257"
FT                   /product="Thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86392"
FT                   /db_xref="GOA:Q5XDX1"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX1"
FT                   /protein_id="AAT86392.1"
FT                   /translation="MSKVALFAGGDLSYISRDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSVSQKAFTDIKEKAELFITAHPEKSDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            262399..263670
FT                   /locus_tag="M6_Spy0258"
FT   CDS_pept        262399..263670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0258"
FT                   /product="RmuC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86393"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDX0"
FT                   /protein_id="AAT86393.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEEINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            263660..264598
FT                   /locus_tag="M6_Spy0259"
FT   CDS_pept        263660..264598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0259"
FT                   /product="CMP-binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86394"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW9"
FT                   /protein_id="AAT86394.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVSMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVTEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            264865..265704
FT                   /locus_tag="M6_Spy0260"
FT   CDS_pept        264865..265704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0260"
FT                   /product="Pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86395"
FT                   /db_xref="GOA:Q5XDW8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW8"
FT                   /protein_id="AAT86395.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEANIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            265677..268316
FT                   /locus_tag="M6_Spy0261"
FT   CDS_pept        265677..268316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0261"
FT                   /product="Surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86396"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW7"
FT                   /protein_id="AAT86396.1"
FT                   /translation="MEKGERMDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDR
FT                   ASGETKASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHL
FT                   KEQQDNEQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQVDQHSKET
FT                   ALSEQKASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSS
FT                   ELEKAKADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMK
FT                   APQGYPLEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFV
FT                   DPDNLTPEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRP
FT                   SFVYGQPGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGI
FT                   YDSIKYMLFTDHLHGNTYGHAINFLRVDKRNPNAPVYLGFSTSNVGSLNEHFVMFPESN
FT                   IANHQRFNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQ
FT                   AKVSQLEGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKL
FT                   ASLKAALHQTEALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLA
FT                   KTTSSLLNAQEALAALQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDL
FT                   QVAPPLTGVKPLSYSKIDTTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEM
FT                   VASNAIVSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTG
FT                   FRFRKESR"
FT   gene            268524..268937
FT                   /locus_tag="M6_Spy0262"
FT   CDS_pept        268524..268937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0262"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86397"
FT                   /db_xref="GOA:Q5XDW6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDW6"
FT                   /protein_id="AAT86397.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            268958..269428
FT                   /locus_tag="M6_Spy0263"
FT   CDS_pept        268958..269428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0263"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86398"
FT                   /db_xref="GOA:Q5XDW5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDW5"
FT                   /protein_id="AAT86398.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            269839..271917
FT                   /locus_tag="M6_Spy0264"
FT   CDS_pept        269839..271917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0264"
FT                   /product="Translation Elongation Factor G"
FT                   /note="EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86399"
FT                   /db_xref="GOA:Q5XDW4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDW4"
FT                   /protein_id="AAT86399.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            272238..273275
FT                   /locus_tag="M6_Spy0265"
FT   CDS_pept        272238..273275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0265"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86400"
FT                   /db_xref="GOA:Q5XDW3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDW3"
FT                   /protein_id="AAT86400.1"
FT                   /translation="MIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLT
FT                   DPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLE
FT                   ATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTT
FT                   NCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTG
FT                   AAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFG
FT                   YTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYF
FT                   AKIAK"
FT   gene            complement(273500..273616)
FT                   /locus_tag="M6_Spy0266"
FT   CDS_pept        complement(273500..273616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0266"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW2"
FT                   /protein_id="AAT86401.1"
FT                   /translation="MAEKTDLSSAYRRLKSPNIKTRKRALKIIHEYKRYGKK"
FT   gene            complement(273758..274567)
FT                   /locus_tag="M6_Spy0267"
FT   CDS_pept        complement(273758..274567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0267"
FT                   /product="Amino acid transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86402"
FT                   /db_xref="GOA:Q5XDW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW1"
FT                   /protein_id="AAT86402.1"
FT                   /translation="MNAVSMPILTPLEQTKCRLRRSQMSNSIIEIKNLKKSYGSNEVLK
FT                   DISLSVNKGEVISIIGSSGSGKSTLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYRE
FT                   KLGMVFQSFNLFENLNVLENAIVAQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPK
FT                   QLSGGQKQRVAIARALSVNPEAMLFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTH
FT                   EMEFARDVSDRIIFMDKGLIAEEGSPQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(274491..276077)
FT                   /locus_tag="M6_Spy0268"
FT   CDS_pept        complement(274491..276077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0268"
FT                   /product="ABC transporter amino acid-binding protein"
FT                   /note="Amino acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86403"
FT                   /db_xref="GOA:Q5XDW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDW0"
FT                   /protein_id="AAT86403.1"
FT                   /translation="MKQETYMKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPF
FT                   NWTQDDASNGAVPIEGTSQYANGYDVQVAKKIAKAMNKELLVVKTSWTGLIPALTSGKI
FT                   DMITAGMSPTKERRNEISFSNSYYTSQPVLVVTANGKYAEATSLKDFSGAKVTAQQGVW
FT                   HVNLLTQLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKK
FT                   GFAVAESDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKA
FT                   SFLGQMWAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALG
FT                   QKLFGWLLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSE
FT                   IVRGGIFAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLN
FT                   VISVVELYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRHIERRFDADTYTTGA
FT                   NQMQIAEVSNV"
FT   gene            276257..278182
FT                   /locus_tag="M6_Spy0269"
FT   CDS_pept        276257..278182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0269"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86404"
FT                   /db_xref="GOA:Q5XDV9"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV9"
FT                   /protein_id="AAT86404.1"
FT                   /translation="MKKILMTLVFCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRAGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVTWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKNKIVALETKISRRRTLLQLLFGKVIPLVEVGFLLWQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEVRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQMTQAEKRKS
FT                   NSVQGLGCLLLILNSGLLIYLAIKESGLALIYLALMVLTMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGG
FT                   GGGGAF"
FT   gene            278248..279087
FT                   /locus_tag="M6_Spy0270"
FT   CDS_pept        278248..279087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0270"
FT                   /product="Bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="Putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86405"
FT                   /db_xref="GOA:Q5XDV8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDV8"
FT                   /protein_id="AAT86405.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTELARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFLLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            279227..279994
FT                   /locus_tag="M6_Spy0271"
FT   CDS_pept        279227..279994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0271"
FT                   /product="Negative regulator of genetic competence"
FT                   /note="MecA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86406"
FT                   /db_xref="GOA:Q5XDV7"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDV7"
FT                   /protein_id="AAT86406.1"
FT                   /translation="MRMEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYS
FT                   VMDELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPED
FT                   FFKSLEQSMREKGDVKAHEKLEQIEEIMEDVVEATLANQSEAADPSTNHESEPLDYVHY
FT                   VLDFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEH
FT                   ANPGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   gene            280001..281170
FT                   /locus_tag="M6_Spy0272"
FT   CDS_pept        280001..281170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0272"
FT                   /product="Undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86407"
FT                   /db_xref="GOA:Q5XDV6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV6"
FT                   /protein_id="AAT86407.1"
FT                   /translation="MFSFTIDYVLVLIGALLMPLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFMSFLVASLGLIPTASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAMIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLMTMAIVSYFFLPQKDFFLTLTILVLIAAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            281292..282062
FT                   /locus_tag="M6_Spy0273"
FT   CDS_pept        281292..282062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0273"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86408"
FT                   /db_xref="GOA:Q5XDV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDV5"
FT                   /protein_id="AAT86408.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            282157..283419
FT                   /locus_tag="M6_Spy0274"
FT   CDS_pept        282157..283419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0274"
FT                   /product="ABC transporter-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86409"
FT                   /db_xref="GOA:Q5XDV4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV4"
FT                   /protein_id="AAT86409.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLEALKAIPELELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKTSANISVEVIAQAGSQIKFSGIDRLGP
FT                   SVTTYISRRGRLEKDANIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTAGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRILMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   gene            283450..284676
FT                   /locus_tag="M6_Spy0275"
FT   CDS_pept        283450..284676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0275"
FT                   /product="Cysteine desulfhydrase"
FT                   /EC_number="4.4.1.-"
FT                   /EC_number="4.4.1.16"
FT                   /note="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86410"
FT                   /db_xref="GOA:Q5XDV3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV3"
FT                   /protein_id="AAT86410.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLTNKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQSSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            284663..285142
FT                   /locus_tag="M6_Spy0276"
FT   CDS_pept        284663..285142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0276"
FT                   /product="IscU"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86411"
FT                   /db_xref="GOA:Q5XDV2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV2"
FT                   /protein_id="AAT86411.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   gene            285135..286553
FT                   /locus_tag="M6_Spy0277"
FT   CDS_pept        285135..286553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0277"
FT                   /product="ABC transporter-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86412"
FT                   /db_xref="GOA:Q5XDV1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV1"
FT                   /protein_id="AAT86412.1"
FT                   /translation="MSDINEKVELKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(286705..287886)
FT                   /locus_tag="M6_Spy0278"
FT   CDS_pept        complement(286705..287886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0278"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86413"
FT                   /db_xref="GOA:Q5XDV0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDV0"
FT                   /protein_id="AAT86413.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHAEDVIDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIVAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNYNHTLLLICLAIFIITILLLSLVVFAMGRQ"
FT   gene            complement(288054..289286)
FT                   /locus_tag="M6_Spy0279"
FT   CDS_pept        complement(288054..289286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0279"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86414"
FT                   /db_xref="GOA:Q5XDU9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU9"
FT                   /protein_id="AAT86414.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYMVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFDGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            289618..291588
FT                   /locus_tag="M6_Spy0280"
FT   CDS_pept        289618..291588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0280"
FT                   /product="OppA"
FT                   /note="Oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86415"
FT                   /db_xref="GOA:Q5XDU8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU8"
FT                   /protein_id="AAT86415.1"
FT                   /translation="MKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVFVND
FT                   PKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLRDGV
FT                   SWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEVGVK
FT                   ALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAYFLS
FT                   AFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYPNDP
FT                   TYKSAKKNYADNITYGMLSGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDFRQA
FT                   IQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEWKDV
FT                   NLADAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFKQSV
FT                   EASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDIMSP
FT                   VGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAYLTD
FT                   NAVDIPVVALGGTPRVTKAVPFSGGFSWAGSKGPLAYKGMKLQDKPVTAKQYEKAKEKW
FT                   MKAKAKSNAKYAEKLADHVEK"
FT   gene            291641..293155
FT                   /locus_tag="M6_Spy0281"
FT   CDS_pept        291641..293155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0281"
FT                   /product="OppB"
FT                   /note="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86416"
FT                   /db_xref="GOA:Q5XDU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU7"
FT                   /protein_id="AAT86416.1"
FT                   /translation="MRTTMKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDP
FT                   NYNKMTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEK
FT                   YIDSLGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARY
FT                   IRLEKDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVIS
FT                   QGQGRTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVD
FT                   PSMIHNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYV
FT                   VRFLGGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRF
FT                   ARSKGLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSI
FT                   KSANNSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            293155..294081
FT                   /locus_tag="M6_Spy0282"
FT   CDS_pept        293155..294081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0282"
FT                   /product="OppC"
FT                   /note="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86417"
FT                   /db_xref="GOA:Q5XDU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU6"
FT                   /protein_id="AAT86417.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            294090..295160
FT                   /locus_tag="M6_Spy0283"
FT   CDS_pept        294090..295160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0283"
FT                   /product="OppD"
FT                   /note="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86418"
FT                   /db_xref="GOA:Q5XDU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU5"
FT                   /protein_id="AAT86418.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            295153..296076
FT                   /locus_tag="M6_Spy0284"
FT   CDS_pept        295153..296076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0284"
FT                   /product="OppF"
FT                   /note="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86419"
FT                   /db_xref="GOA:Q5XDU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDU4"
FT                   /protein_id="AAT86419.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   gene            complement(296316..296462)
FT                   /locus_tag="M6_Spy0285"
FT   CDS_pept        complement(296316..296462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0285"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU3"
FT                   /protein_id="AAT86420.1"
FT                   /translation="MRKQEQDHHKQDVNQKKPEEMTKLERLQEENEYLRTEVAYLKKPR
FT                   NSV"
FT   gene            complement(296837..296971)
FT                   /locus_tag="M6_Spy0286"
FT   CDS_pept        complement(296837..296971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0286"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86421"
FT                   /db_xref="GOA:Q5XEA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XEA7"
FT                   /protein_id="AAT86421.1"
FT                   /translation="MVRLIQFSKVLTSPKRQLLYSIRFLIACQLLFHLFSISVLQEPL"
FT   gene            297062..298611
FT                   /locus_tag="M6_Spys1937"
FT   rRNA            297062..298611
FT                   /locus_tag="M6_Spys1937"
FT                   /product="16S ribosomal RNA"
FT   gene            298661..298736
FT                   /locus_tag="M6_Spys1938"
FT   tRNA            298661..298736
FT                   /locus_tag="M6_Spys1938"
FT                   /product="tRNA-Ala"
FT   gene            299032..301934
FT                   /locus_tag="M6_Spys1939"
FT   rRNA            299032..301934
FT                   /locus_tag="M6_Spys1939"
FT                   /product="23S ribosomal RNA"
FT   gene            302019..302135
FT                   /locus_tag="M6_Spys1940"
FT   rRNA            302019..302135
FT                   /locus_tag="M6_Spys1940"
FT                   /product="5S ribosomal RNA"
FT   gene            302141..302214
FT                   /locus_tag="M6_Spys1941"
FT   tRNA            302141..302214
FT                   /locus_tag="M6_Spys1941"
FT                   /product="tRNA-Asn"
FT   gene            302283..302356
FT                   /locus_tag="M6_Spys1942"
FT   tRNA            302283..302356
FT                   /locus_tag="M6_Spys1942"
FT                   /product="tRNA-Arg"
FT   gene            302352..302933
FT                   /locus_tag="M6_Spy0287"
FT   CDS_pept        302352..302933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0287"
FT                   /product="Competence-specific sigma factor"
FT                   /note="ComX"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86422"
FT                   /db_xref="GOA:Q5XA02"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XA02"
FT                   /protein_id="AAT86422.1"
FT                   /translation="MHNEKNNRTLMSCCFFVVLFILGIVKKKRRLKMSIETRAAFEKVK
FT                   PIILKLKRHYYIQLWDRDDWLQEGHIILLQLLERYPELIEEEERLYRYFKTKFSSYLKD
FT                   LLRRQESQKRQFHKLAYEEIGEVAHAIPSRGLWLDDYVAYQEVIASLENQLNSQERMQF
FT                   QALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   gene            303435..304019
FT                   /locus_tag="M6_Spy0288"
FT   CDS_pept        303435..304019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0288"
FT                   /product="Putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86423"
FT                   /db_xref="GOA:Q5XDU0"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDU0"
FT                   /protein_id="AAT86423.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWREHRVMAKLEEKYGKLSYQKGI"
FT   gene            304019..305137
FT                   /locus_tag="M6_Spy0289"
FT   CDS_pept        304019..305137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0289"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86424"
FT                   /db_xref="GOA:Q5XDT9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT9"
FT                   /protein_id="AAT86424.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLAERAHEEGLRPLDVMLTSAQNKYAIKDLIERINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGNKDVITTSRFPGTTLDKIEIPLDDGTFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLSRFDFINGERQGFTAF
FT                   FDNQLELHRTKLAGANAFYDKHVGTLLTPPGKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            305115..305471
FT                   /locus_tag="M6_Spy0290"
FT   CDS_pept        305115..305471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0290"
FT                   /product="Hypothetical RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86425"
FT                   /db_xref="GOA:Q5XDT8"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT8"
FT                   /protein_id="AAT86425.1"
FT                   /translation="MFVKRLFKNKKRSWKKMLTSKQRAFLKSEAHSLKPIVQIGKNGLN
FT                   DHIKTSIRQALDARELIKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSA
FT                   KKENRKLSPKVKAI"
FT   gene            305540..306172
FT                   /locus_tag="M6_Spy0291"
FT   CDS_pept        305540..306172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0291"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86426"
FT                   /db_xref="GOA:Q5XDT7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDT7"
FT                   /protein_id="AAT86426.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLCMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDYYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   gene            306169..306762
FT                   /locus_tag="M6_Spy0292"
FT   CDS_pept        306169..306762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0292"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86427"
FT                   /db_xref="GOA:Q5XDT6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT6"
FT                   /protein_id="AAT86427.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECPDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LKDKDILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAKLDLNQAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEY"
FT   gene            306738..307139
FT                   /locus_tag="M6_Spy0293"
FT   CDS_pept        306738..307139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0293"
FT                   /product="iojap protein family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86428"
FT                   /db_xref="GOA:Q5XDT5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT5"
FT                   /protein_id="AAT86428.1"
FT                   /translation="MQLFKGILMDNDMRNKMKKEELLKIVVEATDEKRAKDILALDLEG
FT                   LTSLTDYFVIASATNSRQLEAIADNIREKVKEAGGDASHVEGNSQAGWVLLDLTDVVVH
FT                   LFLEDERYHYNLEKLWHEAPAVALDAYLA"
FT   gene            307139..307930
FT                   /locus_tag="M6_Spy0294"
FT   CDS_pept        307139..307930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0294"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86429"
FT                   /db_xref="GOA:Q5XDT4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT4"
FT                   /protein_id="AAT86429.1"
FT                   /translation="MLQRDLVNTTGFLRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSL
FT                   RHLPKSKGRNRLLELACGTGIQSVRFAQAGFDVTGLDLSQDMLAIAKKRAQSAKKKIDF
FT                   IQGNMLDLSQVGQFDFVTCYSDSICYMQDEVDVGDVFKEVYDVLANDGIFIFDVHSTYQ
FT                   TDECFPGYSYHENADDFAMVWDTYADEAPHSVVHELTFFIQEDDGRFSRFDEVHEERTY
FT                   ELLTYDILLEQAGFKSFKVYADFEDKEPTKTSKRWFFVAYK"
FT   gene            308184..309290
FT                   /locus_tag="M6_Spy0295"
FT   CDS_pept        308184..309290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0295"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86430"
FT                   /db_xref="GOA:Q5XDT3"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDT3"
FT                   /protein_id="AAT86430.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTEDVIDYQ
FT                   KLIKVYEKKSKQMTAYLSTLEDTLSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILTYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKNERLN"
FT   gene            309627..309782
FT                   /locus_tag="M6_Spy0296"
FT   CDS_pept        309627..309782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0296"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86431"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT2"
FT                   /protein_id="AAT86431.1"
FT                   /translation="MVFIVMLKTILYFYFTKAFQSAIIRELESILVTLMLTIFNKILLK
FT                   GDKNGT"
FT   gene            309772..310488
FT                   /locus_tag="M6_Spy0297"
FT   CDS_pept        309772..310488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0297"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86432"
FT                   /db_xref="GOA:Q5XDT1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDT1"
FT                   /protein_id="AAT86432.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADL"
FT   gene            310691..311533
FT                   /locus_tag="M6_Spy0298"
FT   CDS_pept        310691..311533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0298"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86433"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDT0"
FT                   /protein_id="AAT86433.1"
FT                   /translation="MIKKQYLGRATIALASTLVLAACGSSKKAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   gene            311861..312706
FT                   /locus_tag="M6_Spy0299"
FT   CDS_pept        311861..312706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0299"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86434"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS9"
FT                   /protein_id="AAT86434.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            312956..314020
FT                   /locus_tag="M6_Spy0300"
FT   CDS_pept        312956..314020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0300"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86435"
FT                   /db_xref="GOA:Q5XDS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDS8"
FT                   /protein_id="AAT86435.1"
FT                   /translation="MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFDQGKIQLSANALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSNPKEALTQKFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            314021..314713
FT                   /locus_tag="M6_Spy0301"
FT   CDS_pept        314021..314713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0301"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86436"
FT                   /db_xref="GOA:Q5XDS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS7"
FT                   /protein_id="AAT86436.1"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFVIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(314752..316143)
FT                   /locus_tag="M6_Spy0302"
FT   CDS_pept        complement(314752..316143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0302"
FT                   /product="Branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86437"
FT                   /db_xref="GOA:Q5XDS6"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS6"
FT                   /protein_id="AAT86437.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAIFYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNTTNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDAFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFSDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKYFNNDPIVYRTTIGLTFIPAI
FT                   FDALLTLSQMTGLFNLPEPVTTFFQKTVPLGQFSMGWIIFAIIGFLLGFILSKTKKRRK
FT                   ANDII"
FT   gene            316377..317591
FT                   /locus_tag="M6_Spy0303"
FT   CDS_pept        316377..317591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0303"
FT                   /product="Serine/threonine sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86438"
FT                   /db_xref="GOA:Q5XDS5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDS5"
FT                   /protein_id="AAT86438.1"
FT                   /translation="MKKIYDLWVRVSLIKKIGIGVVIGVMLGILAPDLTGFSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGRQTNMTLIIFLYLFGTFASALVAVLTAYLFPLTL
FT                   VLNTPVNTELSPPQGVAEVFQSLLLKLVDNPINALATANYIGVLSWAIIFGLALKAASQ
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFTTISENGVGILSDYAFLILVLVGTMV
FT                   FVALVVNPLIAVLITRQNPYPLVLRCLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIPIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKKA"
FT   gene            complement(317646..318320)
FT                   /locus_tag="M6_Spy0304"
FT   CDS_pept        complement(317646..318320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0304"
FT                   /product="KtrA"
FT                   /note="Potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86439"
FT                   /db_xref="GOA:Q5XDS4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS4"
FT                   /protein_id="AAT86439.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(318330..319721)
FT                   /locus_tag="M6_Spy0305"
FT   CDS_pept        complement(318330..319721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0305"
FT                   /product="KtrB"
FT                   /note="Potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86440"
FT                   /db_xref="GOA:Q5XDS3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS3"
FT                   /protein_id="AAT86440.1"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSLEAFAAIVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSTAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(319791..320504)
FT                   /locus_tag="M6_Spy0306"
FT   CDS_pept        complement(319791..320504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0306"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /note="GidB"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86441"
FT                   /db_xref="GOA:Q5XDS2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDS2"
FT                   /protein_id="AAT86441.1"
FT                   /translation="MTPQDFYRTLEEDGFSLSSKQKEQFDTYFKLLVEWNTKINLTAIT
FT                   EENEVYLKHFYDSIAPILQGFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDAVTARAVARMQVLSELTIPF
FT                   LKIRGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            320654..321211
FT                   /locus_tag="M6_Spy0307"
FT   CDS_pept        320654..321211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0307"
FT                   /product="LemA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86442"
FT                   /db_xref="GOA:Q5XDS1"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDS1"
FT                   /protein_id="AAT86442.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            321258..322154
FT                   /locus_tag="M6_Spy0308"
FT   CDS_pept        321258..322154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0308"
FT                   /product="HtpX"
FT                   /note="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86443"
FT                   /db_xref="GOA:Q5XDS0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDS0"
FT                   /protein_id="AAT86443.1"
FT                   /translation="MLYQQISQNKQGTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            322385..322921
FT                   /locus_tag="M6_Spy0309"
FT   CDS_pept        322385..322921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0309"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86444"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR9"
FT                   /protein_id="AAT86444.1"
FT                   /translation="MMLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGN
FT                   VRYDKGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLV
FT                   LVLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQ
FT                   KENNPFASLQGLFDE"
FT   gene            323188..323874
FT                   /locus_tag="M6_Spy0310"
FT   CDS_pept        323188..323874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0310"
FT                   /product="Response regulator CsrR"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86445"
FT                   /db_xref="GOA:Q5XDR8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR8"
FT                   /protein_id="AAT86445.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEK
FT                   EFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   NILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   gene            323880..325382
FT                   /locus_tag="M6_Spy0311"
FT   CDS_pept        323880..325382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0311"
FT                   /product="Transmembrane histidine kinase CsrS"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86446"
FT                   /db_xref="GOA:Q5XDR7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR7"
FT                   /protein_id="AAT86446.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVIRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVDNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAGL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSNES"
FT   gene            325597..326091
FT                   /locus_tag="M6_Spy0312"
FT   CDS_pept        325597..326091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0312"
FT                   /product="Putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86447"
FT                   /db_xref="GOA:Q5XDR6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDR6"
FT                   /protein_id="AAT86447.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQKVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            326075..327250
FT                   /locus_tag="M6_Spy0313"
FT   CDS_pept        326075..327250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0313"
FT                   /product="Replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86448"
FT                   /db_xref="GOA:Q5XDR5"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR5"
FT                   /protein_id="AAT86448.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAVSIYQYFIHF
FT                   FDDGLQRHKFSDILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGDLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKTTAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKISQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            327251..328153
FT                   /locus_tag="M6_Spy0314"
FT   CDS_pept        327251..328153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0314"
FT                   /product="Primosomal protein"
FT                   /note="DnaI"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86449"
FT                   /db_xref="GOA:Q5XDR4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR4"
FT                   /protein_id="AAT86449.1"
FT                   /translation="MEKIGETMAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWATIKGSDETWQAKRV
FT                   MERVRYLAREFHLEGANRR"
FT   gene            328216..329526
FT                   /locus_tag="M6_Spy0315"
FT   CDS_pept        328216..329526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0315"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86450"
FT                   /db_xref="GOA:Q5XDR3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDR3"
FT                   /protein_id="AAT86450.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTIDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            329733..332831
FT                   /locus_tag="M6_Spy0316"
FT   CDS_pept        329733..332831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0316"
FT                   /product="SWF/SNF family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86451"
FT                   /db_xref="GOA:Q5XDR2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR2"
FT                   /protein_id="AAT86451.1"
FT                   /translation="MMARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYG
FT                   ADDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKMTSFG
FT                   SLFLDSLAMNEDDSVKYRLSALGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLI
FT                   KKEGFYQIGKNYFEQLSWLQFDPSSQDLIEFLWRLASDTDKGDNENIFPNHARHLRLPS
FT                   GFFEEGIHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVHRKSIELQIAEKN
FT                   VQYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSD
FT                   FKQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASH
FT                   LKKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQ
FT                   VKEMPKIAIKRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQ
FT                   KVSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFS
FT                   IKPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKV
FT                   LILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQTRDQIIEEGHQITITSYSSFRQDFET
FT                   YQAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVL
FT                   PGLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIETNYSNEMTDEQKAIYL
FT                   AQLRQMQDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMDYQGESGKLDSLRILL
FT                   TQIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKD
FT                   AFLISLKAGGVGINLTGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGT
FT                   IEEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   gene            333073..333675
FT                   /locus_tag="M6_Spy0317"
FT   CDS_pept        333073..333675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0317"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86452"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDR1"
FT                   /protein_id="AAT86452.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IARNEEFTAKATSRQAPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMAYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            333715..335043
FT                   /locus_tag="M6_Spy0318"
FT   CDS_pept        333715..335043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0318"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86453"
FT                   /db_xref="GOA:Q5XDR0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDR0"
FT                   /protein_id="AAT86453.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHMVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIINDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            335089..335571
FT                   /locus_tag="M6_Spy0319"
FT   CDS_pept        335089..335571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0319"
FT                   /product="Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86454"
FT                   /db_xref="GOA:Q5XDQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ9"
FT                   /protein_id="AAT86454.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEERIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            335683..337257
FT                   /locus_tag="M6_Spy0320"
FT   CDS_pept        335683..337257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0320"
FT                   /product="Aminodeoxychorismate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86455"
FT                   /db_xref="GOA:Q5XDQ8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ8"
FT                   /protein_id="AAT86455.1"
FT                   /translation="MALTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKEL
FT                   EAKEAARRTAQLYAEYKRQDAFQKESIAHNNKTAKHFQAIKDAVMTSEAIKPTLLSEKE
FT                   NSSLKTTSKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLI
FT                   SSIIITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNS
FT                   TVFSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTI
FT                   KQIAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIY
FT                   RLEGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVE
FT                   KEGSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPY
FT                   NIYTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEK
FT                   YVNSQIQ"
FT   gene            337282..337812
FT                   /locus_tag="M6_Spy0321"
FT   CDS_pept        337282..337812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0321"
FT                   /product="Transcription elongation factor"
FT                   /note="GreA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86456"
FT                   /db_xref="GOA:Q5XDQ7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDQ7"
FT                   /protein_id="AAT86456.1"
FT                   /translation="MFVFLIRSKKKREKTIMAEKTYPMTLTEKEQLEKELEELKLVRRP
FT                   EIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVA
FT                   IGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAA
FT                   TYDVEIISVEKTN"
FT   gene            complement(338027..338170)
FT                   /locus_tag="M6_Spy0322"
FT   CDS_pept        complement(338027..338170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0322"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ6"
FT                   /protein_id="AAT86457.1"
FT                   /translation="MESIVLRKETYQTYSFKIKQEIINKVLQNGQSLVSVSLDYTLPIL
FT                   KI"
FT   gene            complement(338436..339359)
FT                   /locus_tag="M6_Spy0323"
FT   CDS_pept        complement(338436..339359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0323"
FT                   /product="60 kDa inner membrane protein"
FT                   /note="YidC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86458"
FT                   /db_xref="GOA:Q5XDQ5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDQ5"
FT                   /protein_id="AAT86458.1"
FT                   /translation="MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPIN
FT                   KRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(339441..339752)
FT                   /locus_tag="M6_Spy0324"
FT   CDS_pept        complement(339441..339752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0324"
FT                   /product="Acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86459"
FT                   /db_xref="GOA:Q5XDQ4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ4"
FT                   /protein_id="AAT86459.1"
FT                   /translation="MCYNKSKEALLMQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGR
FT                   VWNNNDGTVEILAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGN"
FT   gene            339980..340717
FT                   /locus_tag="M6_Spy0325"
FT   CDS_pept        339980..340717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0325"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86460"
FT                   /db_xref="GOA:Q5XDQ3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ3"
FT                   /protein_id="AAT86460.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMVERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFNGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYKTPILATTLSKKSVDYKSLTYHERLALVLGNEGQGISAEMVALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            340756..341256
FT                   /locus_tag="M6_Spy0326"
FT   CDS_pept        340756..341256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0326"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86461"
FT                   /db_xref="GOA:Q5XDQ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDQ2"
FT                   /protein_id="AAT86461.1"
FT                   /translation="MHYTEDKEYMEHVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLRRKTLQS
FT                   HNR"
FT   gene            341271..341960
FT                   /locus_tag="M6_Spy0327"
FT   CDS_pept        341271..341960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0327"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86462"
FT                   /db_xref="GOA:Q5XDQ1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDQ1"
FT                   /protein_id="AAT86462.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            342138..342380
FT                   /locus_tag="M6_Spy0328"
FT   CDS_pept        342138..342380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0328"
FT                   /product="Hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86463"
FT                   /db_xref="GOA:Q5XDQ0"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDQ0"
FT                   /protein_id="AAT86463.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            342558..343352
FT                   /locus_tag="M6_Spy0329"
FT   CDS_pept        342558..343352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0329"
FT                   /product="Glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86464"
FT                   /db_xref="GOA:Q5XDP9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP9"
FT                   /protein_id="AAT86464.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKATLDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSVQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLSPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL"
FT   gene            343310..344335
FT                   /locus_tag="M6_Spy0330"
FT   CDS_pept        343310..344335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0330"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86465"
FT                   /db_xref="GOA:Q5XDP8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP8"
FT                   /protein_id="AAT86465.1"
FT                   /translation="MAETKNKCGACHLMSEKIYEYKDENNWFIGKMTGHNLISGWGVKH
FT                   RTIKKIDDLLDGIAATLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETQREIKVIPH
FT                   AGTILLMENAKLLAVYLPEGGVSTATFFATSEQGFGDTILIATRNEGKTKEFRNLFGQL
FT                   GYRVENLNDYPELPEVAETGTTFEENARLKAETISHLTGKMVLADDSGLKVDALGDLPG
FT                   VWSARFSGPDATDAKNNAKLLHELAMVFDQKKRSAQFHTTLVVAAPNKDSLVVEAEWPG
FT                   YIATQPKGENGFGYDPVFIVGETGRHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQ
FT                   S"
FT   gene            344314..344835
FT                   /locus_tag="M6_Spy0331"
FT   CDS_pept        344314..344835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0331"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86466"
FT                   /db_xref="GOA:Q5XDP7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDP7"
FT                   /protein_id="AAT86466.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAAD
FT                   ICLYGHLHRPAAWQVGQILFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            344832..345293
FT                   /locus_tag="M6_Spy0332"
FT   CDS_pept        344832..345293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0332"
FT                   /product="CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86467"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDP6"
FT                   /protein_id="AAT86467.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDFPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            345290..346036
FT                   /locus_tag="M6_Spy0333"
FT   CDS_pept        345290..346036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0333"
FT                   /product="DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86468"
FT                   /db_xref="GOA:Q5XDP5"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP5"
FT                   /protein_id="AAT86468.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLVGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLSFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLVGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPVTLEKYYKS"
FT   gene            346036..346740
FT                   /locus_tag="M6_Spy0334"
FT   CDS_pept        346036..346740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0334"
FT                   /product="ScpA"
FT                   /note="Segregation and condensation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86469"
FT                   /db_xref="GOA:Q5XDP4"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP4"
FT                   /protein_id="AAT86469.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEEDLEQDLLEKIEEYSRFKAVSQA
FT                   LAKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKNNHTVIER
FT                   DDYKIEDMMASIKQRLEKESVISLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQLS
FT                   NFGAIILRKEKK"
FT   gene            346737..347288
FT                   /locus_tag="M6_Spy0335"
FT   CDS_pept        346737..347288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0335"
FT                   /product="ScpB"
FT                   /note="Segregation and condensation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86470"
FT                   /db_xref="GOA:Q5XDP3"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP3"
FT                   /protein_id="AAT86470.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            347385..348131
FT                   /locus_tag="M6_Spy0336"
FT   CDS_pept        347385..348131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0336"
FT                   /product="Ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86471"
FT                   /db_xref="GOA:Q5XDP2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDP2"
FT                   /protein_id="AAT86471.1"
FT                   /translation="MLKRKKNIMRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDL
FT                   ATTVKSGDVVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYP
FT                   VGRLDWDTSGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDG
FT                   KKTKPARYNIVHVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLK
FT                   GLRPGEARRLNKKEISQLHNLANTKK"
FT   gene            348128..348391
FT                   /locus_tag="M6_Spy0337"
FT   CDS_pept        348128..348391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0337"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86472"
FT                   /db_xref="GOA:Q5XDP1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDP1"
FT                   /protein_id="AAT86472.1"
FT                   /translation="MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTK
FT                   GILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNAEKA"
FT   gene            348533..349117
FT                   /locus_tag="M6_Spy0338"
FT   CDS_pept        348533..349117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0338"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86473"
FT                   /db_xref="GOA:Q5XDP0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDP0"
FT                   /protein_id="AAT86473.1"
FT                   /translation="MWFFKLKRVNEIMTTKELINKNDKVKKARNHIVLFQPQIPQNTGN
FT                   IARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHL
FT                   ISKFAVNNYSQATYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVS
FT                   NTVCMVIYEALRQQGFQGLELKHTYEHDKLK"
FT   gene            349428..349991
FT                   /locus_tag="M6_Spy0339"
FT   CDS_pept        349428..349991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0339"
FT                   /product="Riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86474"
FT                   /db_xref="GOA:Q5XDN9"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN9"
FT                   /protein_id="AAT86474.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            349993..350646
FT                   /locus_tag="M6_Spy0340"
FT   CDS_pept        349993..350646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0340"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86475"
FT                   /db_xref="GOA:Q5XDN8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN8"
FT                   /protein_id="AAT86475.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQILLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILVIGLSRIYLGVHYPSDILAGFVLGFGILQFIYPFYKQKRFEWRFLLKQD"
FT   gene            350921..351859
FT                   /locus_tag="M6_Spy0341"
FT   CDS_pept        350921..351859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0341"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86476"
FT                   /db_xref="GOA:Q5XDN7"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN7"
FT                   /protein_id="AAT86476.1"
FT                   /translation="MCYNRNMKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVA
FT                   HGGCTFCTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVD
FT                   VIRDRYEQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSR
FT                   LINRAHSYDLYKETVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIK
FT                   LHLLHLMTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLI
FT                   GPMWSLNKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            351871..352452
FT                   /locus_tag="M6_Spy0342"
FT   CDS_pept        351871..352452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0342"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86477"
FT                   /db_xref="GOA:Q5XDN6"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN6"
FT                   /protein_id="AAT86477.1"
FT                   /translation="MTDLDRRKVMLKRPIHLSHDFLAEVVDKSSVVVDATMGNGNDTAF
FT                   LAQLAKKVYAFDVQEQAIRKTSERLAQLGLLNAELILAGHEAVDQYVTEPVRAAIFNLG
FT                   YLPSADKSIITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLD
FT                   QRKVSAMLYQPLNQVNTPPFLIMLEKLADV"
FT   gene            352546..353919
FT                   /locus_tag="M6_Spy0343"
FT   CDS_pept        352546..353919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0343"
FT                   /product="Magnesium and cobalt efflux protein"
FT                   /note="CorC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86478"
FT                   /db_xref="GOA:Q5XDN5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN5"
FT                   /protein_id="AAT86478.1"
FT                   /translation="MKSLYYFFRSYINMEDPVSQPLVIQFLLLVVLTLLNAFFSASEMA
FT                   LVSLNRSRVEQKAADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKV
FT                   ISGWLGNSATARTAGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGR
FT                   LVSPFVWLLSASTNLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVF
FT                   SLDEMMAREVMVPRTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKR
FT                   LLESGFRQGFDQINMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLV
FT                   TLEDLLEEIVGEIDDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTI
FT                   AGFYLTGIGTIPSQDQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            353925..354788
FT                   /locus_tag="M6_Spy0344"
FT   CDS_pept        353925..354788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0344"
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86479"
FT                   /db_xref="GOA:Q5XDN4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN4"
FT                   /protein_id="AAT86479.1"
FT                   /translation="MPSLFDEKCYNENVKTFTSNEGDAMTEKDYGQVTGMVHSTESFGS
FT                   VDGPGIRFIIFLQGCKLRCQYCHNPDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGG
FT                   ITVSGGEAMLQIDFITALFIEAKKLGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLIL
FT                   LDLKEIDEKQHKIVTRQPNKNILQFARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEF
FT                   VKTLKNVDKFEVLPYHTMGEFKWRELGIPYQLKGVKPPTKERVQNAKNLMQTESYTEYM
FT                   NRIHQS"
FT   gene            354913..355854
FT                   /locus_tag="M6_Spy0345"
FT   CDS_pept        354913..355854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0345"
FT                   /product="Manganese-dependent inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86480"
FT                   /db_xref="GOA:Q5XDN3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDN3"
FT                   /protein_id="AAT86480.1"
FT                   /translation="MIMSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTP
FT                   NEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRV
FT                   ANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTH
FT                   VSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQ
FT                   VNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAA
FT                   FNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            355900..356583
FT                   /locus_tag="M6_Spy0346"
FT   CDS_pept        355900..356583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0346"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86481"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN2"
FT                   /protein_id="AAT86481.1"
FT                   /translation="MSLFYVIIEGMITVFHSDKLTRQPFFQDLINYLDQHDHVILREIK
FT                   KAFPNVTGIDKAIESYVQAGYISRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYEN
FT                   ILAVVFETQLTNQTNHVMIKEKTNITRDDLTLANYFYRLKRGEKPSAEQMDLYDLLGDV
FT                   NQEYALKYMTTFLLKFTRKDLVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMTLDKESL
FT                   TFIAP"
FT   gene            complement(356628..357665)
FT                   /locus_tag="M6_Spy0347"
FT   CDS_pept        complement(356628..357665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0347"
FT                   /product="FhuG"
FT                   /note="Ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86482"
FT                   /db_xref="GOA:Q5XDN1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN1"
FT                   /protein_id="AAT86482.1"
FT                   /translation="MLFMVNKKRRPLLKSHRHLLGLYTSLILLLVSLMGLALSLGESHL
FT                   SFLDLIHVFLGKSSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGV
FT                   LGITIGAGISLAIVVSFSFFEQAHISHYLPLFAMLGAIVTTFSVYWLSLTKQGQIDPTR
FT                   LILTGVAVTTMLSSLMVALVGHINRYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWP
FT                   LTYSQAHFLNIMGLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAG
FT                   HFSTYLVGSNHKLTIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYL
FT                   MAKTK"
FT   gene            complement(357626..358678)
FT                   /locus_tag="M6_Spy0348"
FT   CDS_pept        complement(357626..358678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0348"
FT                   /product="FhuB"
FT                   /note="Ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86483"
FT                   /db_xref="GOA:Q5XDN0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDN0"
FT                   /protein_id="AAT86483.1"
FT                   /translation="MKTKHPFLCLERFCLKKTQIITKSHIFWLIFVLLSFSLCVAIYCH
FT                   LRFGAVALSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITR
FT                   NPIAEPGLLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKG
FT                   YHQLRLVLAGAMVSILLSALGQGITNYYHLANAVIGWQAGGLVGVNWQMIGYIAPLIIL
FT                   SLCLAQLLSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGL
FT                   VIPHLMKHFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCF
FT                   LWLIRRGGRY"
FT   gene            complement(358668..359600)
FT                   /locus_tag="M6_Spy0349"
FT   CDS_pept        complement(358668..359600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0349"
FT                   /product="Ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86484"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDM9"
FT                   /protein_id="AAT86484.1"
FT                   /translation="MKKLTLLLTLCLTTITLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVAATDLE
FT                   AITTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKHDYLQVLSDFGRIFNKEGKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEVIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVVAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLETLREAILSSEN"
FT   gene            complement(359626..360408)
FT                   /locus_tag="M6_Spy0350"
FT   CDS_pept        complement(359626..360408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0350"
FT                   /product="FhuC"
FT                   /note="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86485"
FT                   /db_xref="GOA:Q5XDM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDM8"
FT                   /protein_id="AAT86485.1"
FT                   /translation="MTTISAEDLTIAYEQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGVVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKVIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIVMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFQIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(360653..362098)
FT                   /locus_tag="M6_Spy0351"
FT   CDS_pept        complement(360653..362098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0351"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86486"
FT                   /db_xref="GOA:Q5XDM7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDM7"
FT                   /protein_id="AAT86486.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDADGYHYHYQGLSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFSFLADQVADQEHMFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISQEIASHIARPVEIISDREQAIQKAMSLCQGAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIAKHYL"
FT   gene            362186..363820
FT                   /locus_tag="M6_Spy0352"
FT   CDS_pept        362186..363820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0352"
FT                   /product="Export protein for polysaccharides and teichoic
FT                   acids"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86487"
FT                   /db_xref="GOA:Q5XDM6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDM6"
FT                   /protein_id="AAT86487.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSAIMYLGSPLFARLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAVSQIAEQLIRVIWMLLTTFFIMKLGSGDYASAVTQSTFAAFIGMVASMGVLGYYLWK
FT                   QGLLAAIFSKPDHTVSIDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEERAIHLFVAVLFQTLLLALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGLGMTVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            363987..364616
FT                   /locus_tag="M6_Spy0353"
FT   CDS_pept        363987..364616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0353"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86488"
FT                   /db_xref="GOA:Q5XDM5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDM5"
FT                   /protein_id="AAT86488.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            364840..365430
FT                   /locus_tag="M6_Spy0354"
FT   CDS_pept        364840..365430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0354"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86489"
FT                   /db_xref="GOA:Q5XDM4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDM4"
FT                   /protein_id="AAT86489.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            365922..366197
FT                   /locus_tag="M6_Spy0355"
FT   CDS_pept        365922..366197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0355"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86490"
FT                   /db_xref="GOA:Q5XDM3"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDM3"
FT                   /protein_id="AAT86490.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKG"
FT   gene            366320..367081
FT                   /locus_tag="M6_Spy0356"
FT   CDS_pept        366320..367081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0356"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86491"
FT                   /db_xref="GOA:Q5XDM2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDM2"
FT                   /protein_id="AAT86491.1"
FT                   /translation="MTVTSLIRTDRIGPKIEHCKDMPVLFSSFFDKIELLKSEGNKMIT
FT                   GKLITVEGPDGAGKTTVLEQLIPLLKQKVAQEILTTREPGGVAISEYIRELILDINHTA
FT                   MDPKTELLLYIAARRQHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLIKADIQWL
FT                   NEFATDGLEPDLTLYFDVPSEIGLARINANQQREVNRLDLETIEIHQRVRKGYLALAKE
FT                   HPKRIVTIDATKPLKEVVSVALEHVLALLLA"
FT   gene            367099..367974
FT                   /locus_tag="M6_Spy0357"
FT   CDS_pept        367099..367974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0357"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86492"
FT                   /db_xref="GOA:Q5XDM1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDM1"
FT                   /protein_id="AAT86492.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYENK
FT                   RQVFIIKDCDKMHVNAANSLLKYIEEPQGEAYIFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLYQLAQEKGLLNHQAKLVAKLATNTSHLERLLQTSKLLELITQAERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMSE"
FT   gene            367975..368232
FT                   /locus_tag="M6_Spy0358"
FT   CDS_pept        367975..368232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0358"
FT                   /product="Tpl"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDM0"
FT                   /protein_id="AAT86493.1"
FT                   /translation="MQLEFVMGKRSLSKDLPVATKVAAHRGKKAFEENTALATDLMKEV
FT                   SRLMIQNQLEMTFINSVFPLDQHVVLIPFSAEEHMDFYNC"
FT   gene            368321..368482
FT                   /locus_tag="M6_Spy0359"
FT   CDS_pept        368321..368482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0359"
FT                   /product="Signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86494"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL9"
FT                   /protein_id="AAT86494.1"
FT                   /translation="MWQATVLLSFLGKFLTVSIKILKNQGLSLTLGKATSPYDRLLCCL
FT                   YDEGGFYQ"
FT   gene            368636..368959
FT                   /locus_tag="M6_Spy0360"
FT   CDS_pept        368636..368959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0360"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86495"
FT                   /db_xref="GOA:Q5XDL8"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDL8"
FT                   /protein_id="AAT86495.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETVAKNPSKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            368964..369827
FT                   /locus_tag="M6_Spy0361"
FT   CDS_pept        368964..369827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0361"
FT                   /product="corrin/porphyrin methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86496"
FT                   /db_xref="GOA:Q5XDL7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDL7"
FT                   /protein_id="AAT86496.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNSYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDSDIAVVALPGASAGITALIASGLAPQPHVFYGFLPRKAGQQKAFFEDKHH
FT                   YTETQMFCESPYRIKDTLTNMLACYGDRQVVLVRELTKLFEEYQRGSISEILSYLEETP
FT                   LKGECLLIVAGAQVDSEIELTADVDLVSLVQKEIQAGAKPNQAIKTIAKAYQVNRQELY
FT                   QQFHDL"
FT   gene            369854..370246
FT                   /locus_tag="M6_Spy0362"
FT   CDS_pept        369854..370246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0362"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86497"
FT                   /db_xref="GOA:Q5XDL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL6"
FT                   /protein_id="AAT86497.1"
FT                   /translation="MTEDQATILILGVYGIILAVFSLSALLCLIANWRLFKRAGYKGWH
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGPKGLAVFGLFFP
FT                   GLASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(370293..370922)
FT                   /locus_tag="M6_Spy0363"
FT   CDS_pept        complement(370293..370922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0363"
FT                   /product="Copper homeostasis protein"
FT                   /note="CutC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86498"
FT                   /db_xref="GOA:Q5XDL5"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDL5"
FT                   /protein_id="AAT86498.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGVTAENCQNLSQLTGTAIVHGTKII"
FT   gene            371221..371577
FT                   /locus_tag="M6_Spy0364"
FT   CDS_pept        371221..371577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0364"
FT                   /product="Arsenate reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86499"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL4"
FT                   /protein_id="AAT86499.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLVSDFEVIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGKVL
FT                   QVGYRKPYQELDLG"
FT   gene            complement(371651..372562)
FT                   /locus_tag="M6_Spy0365"
FT   CDS_pept        complement(371651..372562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0365"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86500"
FT                   /db_xref="GOA:Q5XDL3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL3"
FT                   /protein_id="AAT86500.1"
FT                   /translation="MGARCPKSLIVSFFVTITTRLSVRKRCQMKLISWNIDSLNAALTG
FT                   ESPRALLSRAVLDTLVAQDADIIAIQETKLSAKGPTKKHIEALLSYFPNYLHVWRSSVE
FT                   PARKGYAGTMFLYKNTLNPVITFPEIDAPTTMDAEGRIITLEFEDFFVTQVYTPNAGDG
FT                   LRRLDDRQIWDHKYADYLTELDAQKPVLATGDYNVAHKEIDLANPSSNRRSPGFTDEER
FT                   QGFTNLLARGFTDTFRHLHGDIPHVYTWWAQRSKTSKINNTGWRIDYWLASNRLVDKVK
FT                   RSEMISSGERQDHTPILLDIDF"
FT   gene            372706..373893
FT                   /locus_tag="M6_Spy0366"
FT   CDS_pept        372706..373893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0366"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.13.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86501"
FT                   /db_xref="GOA:Q5XDL2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL2"
FT                   /protein_id="AAT86501.1"
FT                   /translation="MSMAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVI
FT                   PKGAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDHLTSPLILA
FT                   PVAAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDD
FT                   GINRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTM
FT                   DYVYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQL
FT                   DGGPAAFDSLQEVAEAVDHKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGLAMG
FT                   GSIGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            374158..379104
FT                   /locus_tag="M6_Spy0367"
FT   CDS_pept        374158..379104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0367"
FT                   /product="Lactocepin"
FT                   /EC_number="3.4.21.96"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86502"
FT                   /db_xref="GOA:Q5XDL1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL1"
FT                   /protein_id="AAT86502.1"
FT                   /translation="MEKKQRFSLRKYKSGTFSVLIGSVFLMMMTTTVAADELTTTSEPT
FT                   ITNHAQQQAQHLTNTELSSAESKPQDTSQITPKTNREKEQSQDLVSEPTTTELADTDAA
FT                   SMANTGPDATQKSASLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSMR
FT                   ISDVSTAKVKSKEDMLARQKAAGINYGSWINDKVVFAHNYVENSDNIKENQFEDFDEDW
FT                   ENFEFDAEAEPKAIKKHKIYRPQSTQAPKETVIKTEETDGSHDIDWTQTDDDTKYESHG
FT                   MHVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVFANDVMGSAESLFIKAIEDAVALG
FT                   ADVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYGSDHDDPLATNPD
FT                   YGLVGSPSTGRTPTSVAAINSKWVIQRLMTVKELENRADLNHGKAIYSESVDFKNIKDS
FT                   LGYDKSHQFAYVKESTDAGYNAQDVKGKIALIERDPNKTYDEMIALAKKHGALGVLIFN
FT                   NKPGQSNRSMRLTSNGMGIPSAFISHEFGKAMSQLNGNGTGSLEFDSVVSKAPSQKGNE
FT                   MNHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTSMASPQIAGASLLVKQYL
FT                   EKTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVT
FT                   GKDNYGSISLGNITDTMTFDVTVHNLSNKAKTLRYDTELLTDHVDPQKGRFTLTSRSLK
FT                   TYQGGEVTVPANGKVTVRVTMDVSQFTKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNI
FT                   PFVGFKGQFENLAVAEESIYRLKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNV
FT                   STKTISDNGLHTLGTFKNADGKFILEKNAQGNPVLAISPNGDNNQDFAAFKGVFLRKYQ
FT                   GLKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKSTTLLGTAFSGKSLTGAELP
FT                   DGYYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATFDPETNRFKPEPLKDRGLAG
FT                   VRKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQADGSFILPLDKAKLGDFYY
FT                   MVEDFAGNVAIAKLGDHLPQTLGKTPIKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQ
FT                   AQLAVVHRNQPQSQLTKMNQDFFISPNEDGNKDFVAFKGLKNNVYNDLTVNVYAKDDHQ
FT                   KQTPIWSSQAGASASAIESTAWYGITARGSKVMPGDYQYVVTYRDEHGKEHQKQYTISV
FT                   NDKKPMITQGRFDTINGVDHFTPDKTKALGSSGIVREEVFYLAKKNGRKFDVTEGKDGI
FT                   TVSDNKVYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGNVSFATLRDLKAVGKDKAVV
FT                   NFGLDLPVPEDKQIVNFTYLVRDADGKPIENLEYYNNSGNSLILPYGKYTVELLTYDTN
FT                   AAKLESDKIVSFTLSADNNFQQITFKMTMLATSQITAHFDHLLPEGSRVSLKTAQGQLI
FT                   PLEQSLYVPKAYGKTVQEGTYEVVVSLPKGYRIEGNTKVNTLPNEVHELSLRLVKVGDA
FT                   SDSTGDHKVMSKNNSQALTASATPTKTTTSATAKALPSAGEKMGLKLRIVGLVLLGLTC
FT                   VFSRKKSTKD"
FT   gene            379595..379774
FT                   /locus_tag="M6_Spy0368"
FT   CDS_pept        379595..379774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0368"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDL0"
FT                   /protein_id="AAT86503.1"
FT                   /translation="MYSKSINSSADATSDFYVRSEPNQLLFAMVKVAPIGIFETLGSKI
FT                   RHRIPKEVAAMSTT"
FT   gene            379852..380583
FT                   /locus_tag="M6_Spy0369"
FT   CDS_pept        379852..380583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0369"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86504"
FT                   /db_xref="GOA:Q5XDK9"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK9"
FT                   /protein_id="AAT86504.1"
FT                   /translation="MNEVKKATMSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQG
FT                   KRFAGVQTGNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWATKKGLHWYL
FT                   LSSVMLTGLAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKN
FT                   AAYLLTKGLYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYV
FT                   NYLLAQEFYHIQTKIKPIKRT"
FT   gene            380823..382823
FT                   /locus_tag="M6_Spy0370"
FT   CDS_pept        380823..382823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0370"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Protein secretion chaperonin CsaA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86505"
FT                   /db_xref="GOA:Q5XDK8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDK8"
FT                   /protein_id="AAT86505.1"
FT                   /translation="MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVF
FT                   YLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEV
FT                   VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVE
FT                   WVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLS
FT                   QLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVM
FT                   AHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIF
FT                   PRLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKE
FT                   VSKVEGSEKLLRFRVDAGDGQDRQILSGIAKCYPNEQELVGKKLQIVANLKPRKMMKQY
FT                   ISQGMILSAEHGDQLTVLTVDPSVPNGSIIG"
FT   gene            383153..383320
FT                   /locus_tag="M6_Spy0371"
FT   CDS_pept        383153..383320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86506"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK7"
FT                   /protein_id="AAT86506.1"
FT                   /translation="MLKSKRDIPSNHCCLAGLFVLLKKTIPVCLASSDDLGLALLDFCL
FT                   KNTSSLEGDK"
FT   gene            383317..384330
FT                   /locus_tag="M6_Spy0372"
FT   CDS_pept        383317..384330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0372"
FT                   /product="Ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86507"
FT                   /db_xref="GOA:Q5XDK6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK6"
FT                   /protein_id="AAT86507.1"
FT                   /translation="MTQHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYDSPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            384334..384822
FT                   /locus_tag="M6_Spy0373"
FT   CDS_pept        384334..384822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0373"
FT                   /product="NrdI"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86508"
FT                   /db_xref="GOA:Q5XDK5"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDK5"
FT                   /protein_id="AAT86508.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQKQTNNLITERTHPCHKPMRHTSH"
FT   gene            384789..386969
FT                   /locus_tag="M6_Spy0374"
FT   CDS_pept        384789..386969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0374"
FT                   /product="Ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86509"
FT                   /db_xref="GOA:Q5XDK4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK4"
FT                   /protein_id="AAT86509.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKDAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKCAYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KLFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVEAGNAA
FT                   NHAVGLGVMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYHAFKASCQLAKEKGAFAGF
FT                   SLSTYADGTYFAKYLQEDAKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECQSCMI"
FT   gene            386989..387159
FT                   /locus_tag="M6_Spy0375"
FT   CDS_pept        386989..387159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0375"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK3"
FT                   /protein_id="AAT86510.1"
FT                   /translation="MSPITCIGSVRSTFQDKQASALACLFLASKPVSLLLCEAFFEHQN
FT                   VKKKGHGVLFW"
FT   gene            complement(387175..387942)
FT                   /locus_tag="M6_Spy0376"
FT   CDS_pept        complement(387175..387942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0376"
FT                   /product="C3 family ADP-ribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86511"
FT                   /db_xref="GOA:Q5XDK2"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR016678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK2"
FT                   /protein_id="AAT86511.1"
FT                   /translation="MSGGTMLKKRYQLAMILLLSCFSLIWQTEGLVELFVCEYYERAVC
FT                   EGTPAYFTFSDQKGAETLIKKRWGKGLVYPRTEQEAMAAYTCQQAALINTSLDKTKGEL
FT                   SQLTPELRDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNDQFDP
FT                   HILCKIKLGTRYTKHSFMSTTALKNGAMTHRPVEVRICVKKGAKAAFVEPYSAVPSEVE
FT                   LLFPRGCQLEVVGAYVSQDHKKLHIEAYFKGSL"
FT   gene            388384..388824
FT                   /locus_tag="M6_Spy0377"
FT   CDS_pept        388384..388824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0377"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK1"
FT                   /protein_id="AAT86512.1"
FT                   /translation="MKTKSKRFLNLATLCLALLGTTLLMGRPVKAEVVSRDNSTEQTDI
FT                   MKRRYMDSTGISEKELEQKYGEDRFQGYLDGYKEGLEKSDIPKWSDIKVPDGRDDDYRD
FT                   GYEQGFLEGRREARPIASFFEAVWQVLTDIFGGWFSSNDSPQ"
FT   gene            388964..389263
FT                   /locus_tag="M6_Spy0378"
FT   CDS_pept        388964..389263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0378"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86513"
FT                   /db_xref="GOA:Q5XDK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDK0"
FT                   /protein_id="AAT86513.1"
FT                   /translation="MAFLGFSDPCVEKGVCMPEKKVLPVLSMVVSFVCLLDHIFFFATY
FT                   SYLYLPLVASSLALIGLVQNKGRQKVWSLAGLILAALAVAVVAYAYYDPTVIPY"
FT   gene            complement(389357..389458)
FT                   /locus_tag="M6_Spy0379"
FT   CDS_pept        complement(389357..389458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0379"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ9"
FT                   /protein_id="AAT86514.1"
FT                   /translation="MLKQIREEDHKSWHQRLSESIQDQWWNFKGLFQ"
FT   gene            complement(389912..390088)
FT                   /locus_tag="M6_Spy0380"
FT   CDS_pept        complement(389912..390088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0380"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ8"
FT                   /protein_id="AAT86515.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEDAIKWELDPDTSPAIRVTVSPE
FT                   NGTNKLQFTLPRG"
FT   gene            390165..390317
FT                   /locus_tag="M6_Spy0381"
FT   CDS_pept        390165..390317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ7"
FT                   /protein_id="AAT86516.1"
FT                   /translation="MSCGWEMARLFLVGADRFFPSQLLAVAILPLQSVWASGRVLRLPI
FT                   LLVAF"
FT   gene            390368..390685
FT                   /locus_tag="M6_Spy0382"
FT   CDS_pept        390368..390685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0382"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86517"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ6"
FT                   /protein_id="AAT86517.1"
FT                   /translation="MMRESTNLFLGVYRLPKVSISSIKENNMTFEEILPGLKAKKKYVR
FT                   TGWGGAENYVQLFDTLEVDGKVLQATPYFLIHVTGAGEGFSMWAPTPCDVLAEDWIEVN
FT                   D"
FT   gene            390678..391376
FT                   /locus_tag="M6_Spy0383"
FT   CDS_pept        390678..391376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0383"
FT                   /product="Short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86518"
FT                   /db_xref="GOA:Q5XDJ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ5"
FT                   /protein_id="AAT86518.1"
FT                   /translation="MTKVVLVTGCASGIGYAQARYFLRQGYHVYGVDKSDKPDLNGNFH
FT                   FIKLDLSSELSPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRRMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTASDFEPGGLADWVARETPIGRWTEPDEVAELSGFLASGKARSMQGEI
FT                   VKIDGGWTLK"
FT   gene            391452..392411
FT                   /locus_tag="M6_Spy0384"
FT   CDS_pept        391452..392411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0384"
FT                   /product="NAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86519"
FT                   /db_xref="GOA:Q5XDJ4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ4"
FT                   /protein_id="AAT86519.1"
FT                   /translation="MKLAVLGTGMIVKEVLPVLQKIDGIDLVAILSTVRSLTTAKDLAK
FT                   AYHMPLATSKYEAVLGNEEIDTVYIGLPNHLHFAYAKKALLAGKHVICEKPFTMTAGEL
FT                   DELVIIAKKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQYSSRYDAFKRG
FT                   DIAPAFNPKMGGGALRDLNIYNIHFVVGLFGRPKTVQYLANMDKGIDTSGMLVMDYEQF
FT                   KVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVQLSLHGHEPQVINHNKHGHRMY
FT                   EEFVAFRDMIDQRDFEKVNQALEHSRAVMSVLERAVHS"
FT   gene            392738..394081
FT                   /locus_tag="M6_Spy0385"
FT   CDS_pept        392738..394081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0385"
FT                   /product="Phosphoglycerate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86520"
FT                   /db_xref="GOA:Q5XDJ3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ3"
FT                   /protein_id="AAT86520.1"
FT                   /translation="MFMEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKL
FT                   MSNTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICI
FT                   LIGFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSA
FT                   LLPLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTM
FT                   YGDAGESAVASEEEKYNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYL
FT                   SQVANMSEAHIHFAISILEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYE
FT                   RLTATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIG
FT                   NMGANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            394180..395637
FT                   /locus_tag="M6_Spy0386"
FT   CDS_pept        394180..395637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0386"
FT                   /product="Glucosamine-1-phosphate acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /EC_number="2.7.7.23"
FT                   /note="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86521"
FT                   /db_xref="GOA:Q5XDJ2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDJ2"
FT                   /protein_id="AAT86521.1"
FT                   /translation="MMFQEKKRKYAIMRRYLNYYSKEKQMTNYAIILAAGKGTRMTSDL
FT                   PKVLHKVSGLTMLEHVFRSVKAISPEKAVTVIGHKSEMVRAVLADQSAFVHQTEQLGTG
FT                   HAVMMAETQLEGLEGHTLVIAGDTPLITGESLKSLIDFHVNHKNVATILTATAQDPFGY
FT                   GRIVRNKDGEVIKIVEQKDANEYEQQLKEINTGTYVFDNKRLFEALKCITTNNAQGEYY
FT                   LTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQRITQKHMVNGVTFQN
FT                   PETVYIESDVTIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIVDSEIGDNCVVTNSMIE
FT                   SSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSS
FT                   VNVGAGTITVNYDGQNKYETVIGDHAFIGSNSTLIAPLEIGDHALTAAGSTISKTVPID
FT                   SIAIGRSRQVTKEGYAKRLAHHPSRSK"
FT   gene            395668..396222
FT                   /locus_tag="M6_Spy0387"
FT   CDS_pept        395668..396222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0387"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86522"
FT                   /db_xref="GOA:Q5XDJ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ1"
FT                   /protein_id="AAT86522.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPERKILLVKQYRKAIERVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLTQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFGGEQ"
FT   gene            396219..396473
FT                   /locus_tag="M6_Spy0388"
FT   CDS_pept        396219..396473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0388"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86523"
FT                   /db_xref="GOA:Q5XDJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDJ0"
FT                   /protein_id="AAT86523.1"
FT                   /translation="MMGRPLLTDDIIEKARRMETFEPDDAVDFDTKVMTLPEKDEKARI
FT                   YKSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            396493..397188
FT                   /locus_tag="M6_Spy0389"
FT   CDS_pept        396493..397188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0389"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86524"
FT                   /db_xref="GOA:Q5XDI9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI9"
FT                   /protein_id="AAT86524.1"
FT                   /translation="MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELIL
FT                   VQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDPIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQTL
FT                   MTFLENLPV"
FT   gene            397339..397680
FT                   /locus_tag="M6_Spy0390"
FT   CDS_pept        397339..397680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0390"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI8"
FT                   /protein_id="AAT86525.1"
FT                   /translation="MTLKKHYYLLSLLALVTFGAAFNTSQSVSAQVYSNGGYRQGLTDE
FT                   KSHLQYSKDNAQLQLRNILNGYQDDLGKHYSSYYYYNLRTVMGLSSKQKIEEHYEKLKN
FT                   KLHDMYNHY"
FT   gene            complement(397779..398426)
FT                   /locus_tag="M6_Spy0391"
FT   CDS_pept        complement(397779..398426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0391"
FT                   /product="Iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86526"
FT                   /db_xref="GOA:Q5XDI7"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI7"
FT                   /protein_id="AAT86526.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQETKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIHQLGYNTQEVHQEAEVLEHT
FT                   VSDTFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLETHHLNINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            398569..399504
FT                   /locus_tag="M6_Spy0392"
FT   CDS_pept        398569..399504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0392"
FT                   /product="Manganese-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86527"
FT                   /db_xref="GOA:Q5XDI6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDI6"
FT                   /protein_id="AAT86527.1"
FT                   /translation="MMGKKMSLILGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIA
FT                   DMTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDVEKTSNADVIFYNGINLEDGGQAWFTK
FT                   LVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAK
FT                   DPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSA
FT                   YIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFT
FT                   DSIAKKGKPGDSYYAMMKWNLDKISEGLAK"
FT   gene            399541..400293
FT                   /locus_tag="M6_Spy0393"
FT   CDS_pept        399541..400293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0393"
FT                   /product="Manganese transport system ATP-binding protein"
FT                   /note="MntA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86528"
FT                   /db_xref="GOA:Q5XDI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI5"
FT                   /protein_id="AAT86528.1"
FT                   /translation="MFYLCKGDKMITTNNLCVTYDGNSNALEAINVTIDGPSIVGIIGP
FT                   NGAGKSTFMKAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVAL
FT                   GTYSKLGLFRRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESD
FT                   YIFLDEPFVGIDSVSEKIIVDLLKELKMAGKTILIVHHDLSKVEHYFDKLMILNKHLVA
FT                   YGNVCEVFTVDTLSKAYGNHLILGKEMV"
FT   gene            400294..401148
FT                   /locus_tag="M6_Spy0394"
FT   CDS_pept        400294..401148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0394"
FT                   /product="Manganese transport system membrane protein"
FT                   /note="MntB"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86529"
FT                   /db_xref="GOA:Q5XDI4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI4"
FT                   /protein_id="AAT86529.1"
FT                   /translation="MSMKFFEGLMSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILRVNFFIGAIVFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLVVISLFFKELLLTSFD
FT                   PILAKSMGVKVNAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(401294..402100)
FT                   /locus_tag="M6_Spy0395"
FT   CDS_pept        complement(401294..402100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0395"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86530"
FT                   /db_xref="GOA:Q5XDI3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI3"
FT                   /protein_id="AAT86530.1"
FT                   /translation="MKKLLSLSLVAISLLSLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTSQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPKQDITITSIDIVKDYRFKN"
FT   gene            402317..404722
FT                   /locus_tag="M6_Spy0396"
FT   CDS_pept        402317..404722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0396"
FT                   /product="FtsK"
FT                   /note="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86531"
FT                   /db_xref="GOA:Q5XDI2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDI2"
FT                   /protein_id="AAT86531.1"
FT                   /translation="MVKRNQRKKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAML
FT                   RLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEW
FT                   HAFLFAMPRMLDQDIFLGTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSY
FT                   FIGFLFILLGLFLMTPWDIYDVSHFVKEAVDKLAVAYQENKEKRFIKREEHRLQAEKEA
FT                   LEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDEAS
FT                   LFDQEDLAYAHEEIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPD
FT                   KPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISN
FT                   LADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPL
FT                   GKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFMMIDPKMV
FT                   ELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGYNTKVEEFN
FT                   ASSEQKQIPLTLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVD
FT                   VISGLIKANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSF
FT                   ISDDDVERIVNFIKDQAEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLE
FT                   TQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN"
FT   gene            complement(404792..405145)
FT                   /locus_tag="M6_Spy0397"
FT   CDS_pept        complement(404792..405145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0397"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86532"
FT                   /db_xref="GOA:Q5XDI1"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI1"
FT                   /protein_id="AAT86532.1"
FT                   /translation="MMIYKLTALAFLIVTPLFAMIVTSLFKLNKKGFKFPDVALLLFAI
FT                   EIVLVSGKFFIHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVI
FT                   FYLILVIFIFTLA"
FT   gene            405358..406026
FT                   /locus_tag="M6_Spy0398"
FT   CDS_pept        405358..406026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0398"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86533"
FT                   /db_xref="GOA:Q5XDI0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDI0"
FT                   /protein_id="AAT86533.1"
FT                   /translation="MTTMIDFIISIDDCAVELDSRQSWKIRSPLSTILFLVFVCQLAGI
FT                   ETWKEMEDFIEMNEPLFATYVDLSEGCPSHDTLERVISLVNSDRLKELKVQFEQSLTSL
FT                   DAVHQLISVDGKTIRGNRGKNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLR
FT                   TIDIRKSIVTIDAMGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEEL
FT                   "
FT   gene            406093..406269
FT                   /locus_tag="M6_Spy0399"
FT   CDS_pept        406093..406269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0399"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86534"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDH9"
FT                   /protein_id="AAT86534.1"
FT                   /translation="MSSDIKWLCQNHPKWHKLRGIGMIRNTIDKDGQLSQENRYFIFSF
FT                   KNVLIFSQSDGIS"
FT   gene            406341..406466
FT                   /locus_tag="M6_Spy0400"
FT   CDS_pept        406341..406466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0400"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDH8"
FT                   /protein_id="AAT86535.1"
FT                   /translation="MEKEAKQMIDLKRNLFKIDVRAQKDEEKVFMRTACYFNKKT"
FT   gene            406499..406996
FT                   /locus_tag="M6_Spy0401"
FT   CDS_pept        406499..406996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0401"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86536"
FT                   /db_xref="GOA:Q5XDH7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH7"
FT                   /protein_id="AAT86536.1"
FT                   /translation="MQYCISVGGKNLNYRQNHNRRIFKMAKKVEKLVKLQIPAGKATPA
FT                   PPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLK
FT                   KAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTV
FT                   TD"
FT   gene            407102..407791
FT                   /locus_tag="M6_Spy0402"
FT   CDS_pept        407102..407791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0402"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86537"
FT                   /db_xref="GOA:Q5XDH6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH6"
FT                   /protein_id="AAT86537.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            408121..409119
FT                   /locus_tag="M6_Spy0403"
FT   CDS_pept        408121..409119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0403"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86538"
FT                   /db_xref="GOA:Q5XDH5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDH5"
FT                   /protein_id="AAT86538.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGKGILIDIY"
FT   gene            409198..409926
FT                   /locus_tag="M6_Spy0404"
FT   CDS_pept        409198..409926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0404"
FT                   /product="Uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86539"
FT                   /db_xref="GOA:Q5XDH4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH4"
FT                   /protein_id="AAT86539.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            409955..410512
FT                   /locus_tag="M6_Spy0405"
FT   CDS_pept        409955..410512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0405"
FT                   /product="Ribosome Recycling Factor"
FT                   /note="RRF"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86540"
FT                   /db_xref="GOA:Q5XDH3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH3"
FT                   /protein_id="AAT86540.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   gene            410620..411477
FT                   /locus_tag="M6_Spy0406"
FT   CDS_pept        410620..411477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0406"
FT                   /product="S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86541"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDH2"
FT                   /protein_id="AAT86541.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIQKEGFTFTLSKAEGERQIGDMV
FT                   TGFAYTDIKQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVDTGIPNKEIVVSLDMLP
FT                   EMKELWPKKGDKLYIRLEVDKKDRIWGLPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEEIKAAFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   gene            411550..412059
FT                   /locus_tag="M6_Spy0407"
FT   CDS_pept        411550..412059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0407"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="MsrA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86542"
FT                   /db_xref="GOA:Q5XDH1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH1"
FT                   /protein_id="AAT86542.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPEEISYKELVELYWAQTDPTDAFGQFEDRGDNYRPVIYYTTERQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQF
FT                   LEENWS"
FT   gene            412050..412271
FT                   /locus_tag="M6_Spy0408"
FT   CDS_pept        412050..412271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0408"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86543"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDH0"
FT                   /protein_id="AAT86543.1"
FT                   /translation="MVMRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFEL
FT                   ISRYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            412427..413602
FT                   /locus_tag="M6_Spy0409"
FT   CDS_pept        412427..413602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0409"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86544"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG9"
FT                   /protein_id="AAT86544.1"
FT                   /translation="MIITKKSLFVTSVALSLAPLATAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATTLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQSTVPMAPSATPSDVPTTPLASAKPDSFVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVPQEAVPTPKAAETTEVEPKTDISEDPTSANRPVPNE
FT                   SASEEVSSAAPAQAPAPAEKEKTSAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNAGL
FT                   QPQTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPENSALGDQVAQYAIDHM
FT                   AERGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            413875..415689
FT                   /locus_tag="M6_Spy0410"
FT   CDS_pept        413875..415689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0410"
FT                   /product="Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86545"
FT                   /db_xref="GOA:Q5XDG8"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG8"
FT                   /protein_id="AAT86545.1"
FT                   /translation="MMISLCLTIQGGLEMYYTSGNYEAFATPRKPEGVDQKSAYIVGTG
FT                   LAGLAAAVFLIRDGHMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREMENHFECM
FT                   WDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQSKEL
FT                   IHLIMKTEESLGDQTIEEFFSEDFFKSNFWVYWATMFAFEKWHSVVEMRRYAMRFIHHI
FT                   DGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKVAKTIH
FT                   MTVSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKALGGSWNLWENLAAQSD
FT                   DFGYPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSN
FT                   WMMSFAIHRQPHFKEQKDNETTVWIYGLYSNIEGNYVHKKIEECTGQEITEEWLYHLGV
FT                   PVDKIKDLASQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAESPSR
FT                   DTVFTTEYSIRTAMEAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLNDKKAIKDMDLP
FT                   IPALIEKIGHKKIKDTFIEELLKDANLI"
FT   gene            415848..416900
FT                   /locus_tag="M6_Spy0411"
FT   CDS_pept        415848..416900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0411"
FT                   /product="PhoH"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86546"
FT                   /db_xref="GOA:Q5XDG7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG7"
FT                   /protein_id="AAT86546.1"
FT                   /translation="MQEYSIDITLTHPDDVLALFGSNERHLKLIEAHLGVIVHARTERV
FT                   QVIGDDEEAVELARLTIKGLLVLVGRGMVVNTSDVVTALSMAESHQIDQFMALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYLSAKDVVRHPVVADIIKAYETSSEETKDLLKPKASDVEADYQPGL
FT                   TKYPVIGQEH"
FT   gene            416946..417521
FT                   /locus_tag="M6_Spy0412"
FT   CDS_pept        416946..417521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0412"
FT                   /product="Uracil DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86547"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG6"
FT                   /protein_id="AAT86547.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFEDYLPDYFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            417629..418177
FT                   /locus_tag="M6_Spy0413"
FT   CDS_pept        417629..418177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0413"
FT                   /product="Hypothetical Metal-Binding Protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86548"
FT                   /db_xref="GOA:Q5XDG5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDG5"
FT                   /protein_id="AAT86548.1"
FT                   /translation="MPNIPNEVGSPSLTINLMYIEMIDETGQVSQEIMEQTLDLLNFAA
FT                   QKTGKEEKEMSVTFVTNERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPS
FT                   LAEMMAEFDAYIGELFISIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEE
FT                   KEMFTLQEEILTAYGLTRQ"
FT   gene            418158..418565
FT                   /locus_tag="M6_Spy0414"
FT   CDS_pept        418158..418565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0414"
FT                   /product="Diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86549"
FT                   /db_xref="GOA:Q5XDG4"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG4"
FT                   /protein_id="AAT86549.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLLS
FT                   ACLACVAGLFFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            418685..419581
FT                   /locus_tag="M6_Spy0415"
FT   CDS_pept        418685..419581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0415"
FT                   /product="GTP-binding protein era"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86550"
FT                   /db_xref="GOA:Q5XDG3"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDG3"
FT                   /protein_id="AAT86550.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            419556..420077
FT                   /locus_tag="M6_Spy0416"
FT   CDS_pept        419556..420077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0416"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86551"
FT                   /db_xref="GOA:Q5XDG2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG2"
FT                   /protein_id="AAT86551.1"
FT                   /translation="MAIMRKNTNIVKRDHMPHDYISYIRSKVGHDKIILNFAGGILTND
FT                   DSKVLMQLRGDKKTWAIPGGTMELGESSLETCKREFLEETRIEVEAVRLLNVYTHFEEV
FT                   YPNGDAVQTIVFIYELTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEE
FT                   YFSDSFAMGH"
FT   gene            complement(420383..420637)
FT                   /locus_tag="M6_Spy0417"
FT   CDS_pept        complement(420383..420637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0417"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG1"
FT                   /protein_id="AAT86552.1"
FT                   /translation="MSGLFYHKSYFFKSEQVYDLLNEIRMRYPHAHIILIGNHINYEEI
FT                   FKNHYRVFGVIDTTSHKSLKSIRDQIQLYLDELYNSNNG"
FT   gene            421035..421280
FT                   /locus_tag="M6_Spy0418"
FT   CDS_pept        421035..421280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0418"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86553"
FT                   /db_xref="GOA:Q5XDG0"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDG0"
FT                   /protein_id="AAT86553.1"
FT                   /translation="MIKFAEEIQKEELFHIIGGYSATDCKNHLIGGITSGAIAGGVGAG
FT                   MATLGVGGVAGAFAGAHVGAIAGGLTCVGGMLFNGK"
FT   gene            421295..421477
FT                   /locus_tag="M6_Spy0419"
FT   CDS_pept        421295..421477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0419"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86554"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF9"
FT                   /protein_id="AAT86554.1"
FT                   /translation="MDNFLELQFEELVNISGGKGNIGSAIGGCLGGMLIAAAGGPITGG
FT                   AAAFVCVASGIAAYQ"
FT   gene            complement(421668..421934)
FT                   /locus_tag="M6_Spy0420"
FT   CDS_pept        complement(421668..421934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0420"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86555"
FT                   /db_xref="GOA:Q5XDF8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF8"
FT                   /protein_id="AAT86555.1"
FT                   /translation="MASLETTENLLTFYQFPHHIWSSIYSTNLIESLNKEIKRQNKKRV
FT                   VFPNEEALERCLVSIFEDYNIKFGARIHKGFGACFDTLDSLFD"
FT   gene            complement(422249..422428)
FT                   /locus_tag="M6_Spy0421"
FT   CDS_pept        complement(422249..422428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0421"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86556"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF7"
FT                   /protein_id="AAT86556.1"
FT                   /translation="MCKHTKRNKSCIVELRHFTRKRFIPMTQFTTELLNFLAQKQDIDE
FT                   FFRSSLEIAMNDLL"
FT   gene            422626..422898
FT                   /locus_tag="M6_Spy0422"
FT   CDS_pept        422626..422898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0422"
FT                   /product="Bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86557"
FT                   /db_xref="GOA:Q5XDF6"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF6"
FT                   /protein_id="AAT86557.1"
FT                   /translation="MQRDKFKNYEKKLFDMEIKKLETFHQMTIEKLAKVEGGKNNWQAN
FT                   VSGVIAAGSAGAAIGFPVCGVACGYIGAKTAITLWAGVTGATGGF"
FT   gene            422911..423111
FT                   /locus_tag="M6_Spy0423"
FT   CDS_pept        422911..423111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0423"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86558"
FT                   /db_xref="GOA:Q5XDF5"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF5"
FT                   /protein_id="AAT86558.1"
FT                   /translation="MTTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLLHPV
FT                   LAGGCVVGFTVGGAYLGYTAN"
FT   gene            423406..423600
FT                   /locus_tag="M6_Spy0424"
FT   CDS_pept        423406..423600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0424"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86559"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF4"
FT                   /protein_id="AAT86559.1"
FT                   /translation="MEVLKNGLAIINGGGKDGANIFLTGMAGAAQGVTVCAQTGVFIPW
FT                   QGYILCGAAGAATNIIWPH"
FT   gene            423650..423946
FT                   /locus_tag="M6_Spy0425"
FT   CDS_pept        423650..423946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0425"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86560"
FT                   /db_xref="GOA:Q5XDF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF3"
FT                   /protein_id="AAT86560.1"
FT                   /translation="MKTLDIIFNLSDRKMIFLENVEKLGGYIVPFTLIILSVAYNFRHP
FT                   YPIWAAVLGGISLIVIFIYFILIVYLYLRYRYLVWKKIPEIKINSTELSCNHI"
FT   gene            424125..424526
FT                   /locus_tag="M6_Spy0426"
FT   CDS_pept        424125..424526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0426"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86561"
FT                   /db_xref="GOA:Q5XDF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF2"
FT                   /protein_id="AAT86561.1"
FT                   /translation="MRNILRFLGIVIISAVILFSIGSFYDLPLMKNIQLICWSFILDLF
FT                   VFVYKQRQTTEVLTWYQVVKQFWLFIKCTILIPTLIAFIIIIGCLTSISEVSIYFYLHL
FT                   TVVCYTIGMILSLGRLISPNHSIFNKLKK"
FT   gene            complement(424565..424681)
FT                   /locus_tag="M6_Spy0427"
FT   CDS_pept        complement(424565..424681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF1"
FT                   /protein_id="AAT86562.1"
FT                   /translation="MTSFGKDEYSRMENRLFLKLQRYLLVTNYSLIESVTLN"
FT   gene            424777..425847
FT                   /locus_tag="M6_Spy0428"
FT   CDS_pept        424777..425847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0428"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86563"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDF0"
FT                   /protein_id="AAT86563.1"
FT                   /translation="MMMLRDVKVKTSSLLVGCAATLLVSLSSTVAADSVHSSDRRFGVG
FT                   YKEETTSQFSSDQPSQVVLYRGEANTVRFTYTNQMYLMKDIRIALDGSGKSLTAQTVPG
FT                   MGHVYEGFQTSARGIFTMSGVPESTVPVANPNVQTKYTRYFKVIDDMHNTMYKGTVFLV
FT                   QPQAWKYTMKSVDQLPVDDLNHIGVAGIERMTTLIKNAGALLTTGGSGAFPDNIKVSIN
FT                   PKGRQATITYGDGSTDIIPPAVLWKKGSVKEPTEADQSVGTPTPGIPGKFKRDQSLNEH
FT                   EAMVNVEPLSHVVKDNIKVIDEKSTGRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPA
FT                   TALPSVEMSAEDRLKS"
FT   gene            425940..426185
FT                   /locus_tag="M6_Spy0429"
FT   CDS_pept        425940..426185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0429"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86564"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE9"
FT                   /protein_id="AAT86564.1"
FT                   /translation="MHRLLNRLIPEEDNNKLSRAAKEVVTEPRLNNPFLLPKKVLSLED
FT                   DAAILNHLEEDRNVNKLFLEPVAAEAKREINFHPSD"
FT   gene            complement(426686..426955)
FT                   /locus_tag="M6_Spy0430"
FT   CDS_pept        complement(426686..426955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0430"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86565"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE8"
FT                   /protein_id="AAT86565.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPIPKHTIEKKRTAMTIGHSK
FT                   QNPHKKEALKHKKNKNKTLFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            427156..427263
FT                   /locus_tag="M6_Spy0431"
FT   CDS_pept        427156..427263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86566"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE7"
FT                   /protein_id="AAT86566.1"
FT                   /translation="MNGNDVSSMVLIQSFFITYQADKPAASAISLNMTA"
FT   gene            complement(427350..427529)
FT                   /locus_tag="M6_Spy0432"
FT   CDS_pept        complement(427350..427529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0432"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE6"
FT                   /protein_id="AAT86567.1"
FT                   /translation="MVNSDITVTYTLKDNLVALHKEYKTFVKKNITDKPITSDYDKAKV
FT                   IYNHLINEYTYATK"
FT   gene            428012..428893
FT                   /locus_tag="M6_Spy0433"
FT   CDS_pept        428012..428893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0433"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86568"
FT                   /db_xref="GOA:Q5XDE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE5"
FT                   /protein_id="AAT86568.1"
FT                   /translation="MKVGKMEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGE
FT                   SEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDY
FT                   AHKDYERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYN
FT                   TLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRD
FT                   ELNFYEKTVFLYVHGYYKLKQKEISGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLG
FT                   GKGDEDWSEADL"
FT   gene            429065..429892
FT                   /locus_tag="M6_Spy0434"
FT   CDS_pept        429065..429892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0434"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86569"
FT                   /db_xref="GOA:Q5XDE4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDE4"
FT                   /protein_id="AAT86569.1"
FT                   /translation="MPELPEVETVRRGLKALVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAVLLSSKKTIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNTLGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP"
FT   gene            429862..430482
FT                   /locus_tag="M6_Spy0435"
FT   CDS_pept        429862..430482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0435"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86570"
FT                   /db_xref="GOA:Q5XDE3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDE3"
FT                   /protein_id="AAT86570.1"
FT                   /translation="MSKMPEKKTMIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHD
FT                   LQEKGGRLYEALREAFGNQILKADGELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELA
FT                   AKRDHLAQSQAIFFMDIPLLMELGYQDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQ
FT                   RIASQLPIEEKKPYASLVIDNNGDMETLIKQVQSALLSLANPR"
FT   gene            430672..430959
FT                   /locus_tag="M6_Spy0436"
FT   CDS_pept        430672..430959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0436"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE2"
FT                   /protein_id="AAT86571.1"
FT                   /translation="MTTMTIAKGNQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRM"
FT   gene            431008..432174
FT                   /locus_tag="M6_Spy0437"
FT   CDS_pept        431008..432174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0437"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86572"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE1"
FT                   /protein_id="AAT86572.1"
FT                   /translation="MGPMMLSRLLNLNDTQTGVLNIVFKIADEKGWLLIDLKDLQAILK
FT                   EVGDHASDYSSHYGNIAKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGY
FT                   GAINILSATKLFQSPTLYTTFLLWLLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAP
FT                   KVFLEKVEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHALRAYTPKEQKAVR
FT                   VAADTFRQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSEIE
FT                   SQQLVQSSPFASKYSQSIDRESAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQA
FT                   ATKKANRRSVGRPHKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            432296..433489
FT                   /locus_tag="M6_Spy0438"
FT   CDS_pept        432296..433489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0438"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86573"
FT                   /db_xref="GOA:Q5XDE0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDE0"
FT                   /protein_id="AAT86573.1"
FT                   /translation="MNWRQNLKVAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYY
FT                   AGLAVAVTALASALFAPVWGKLADRYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILR
FT                   LLTGVFAGYVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQ
FT                   VFLLVGVILFLCSLMTAVYVKEEFKPIRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQ
FT                   ISAQSVAPILSLYIRHLGQTHNLMFTSGLVVSAMGFSSLFSSSYLGKLGDRFGNHRLLL
FT                   AALCYSFIMYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAY
FT                   NQMFSNLGQVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            433486..433632
FT                   /locus_tag="M6_Spy0439"
FT   CDS_pept        433486..433632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0439"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86574"
FT                   /db_xref="GOA:Q5XDD9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDD9"
FT                   /protein_id="AAT86574.1"
FT                   /translation="MRVKINLECSECGSNNYLTSKNKSSHPEKIKVPKYCPKERKVTLH
FT                   VET"
FT   gene            433678..433914
FT                   /locus_tag="M6_Spy0440"
FT   CDS_pept        433678..433914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0440"
FT                   /product="Protein translocase subunit secG"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86575"
FT                   /db_xref="GOA:Q5XDD8"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD8"
FT                   /protein_id="AAT86575.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            434008..436341
FT                   /locus_tag="M6_Spy0441"
FT   CDS_pept        434008..436341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0441"
FT                   /product="Exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86576"
FT                   /db_xref="GOA:Q5XDD7"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD7"
FT                   /protein_id="AAT86576.1"
FT                   /translation="MMKERIMTYLKEHGKSNVNDLAAALEMAGAKQFPSLIKTISKMES
FT                   QSLLRFSDDGSLALRKEREKKKEPTVQGVFRANKAGFGFLHVDENEDDMFIGRNDVGYA
FT                   IDGDTVEVVVKKPADRLKGTAAEAKIVAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQ
FT                   KIQQKIYIKKEPVVLKGTEIIKVDIDKYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLE
FT                   SMDIVSEFPAEVLAEANAISEAPTAKDLIGRVDLRQETTITIDGADAKDLDDAIHIKLL
FT                   DNGNYELGVHIADVSYYVTEGSSLDKEAIARGTSVYVTDRVVPMLPERLSNGICSLNPN
FT                   VDRLTQSALMEINPQGYVVNYQICQSVIKTTYRMTYSTVNDMIAGDEEALQEFASIADD
FT                   VTLMVTLHRILEAMRSKRGALNFDTQEAKVIVNDKGMPVDVVLRQRGIAERMIESFMLA
FT                   ANECVAEHFAKAKLPFIYRIHEEPKVEKLQQFIDYASTFGIHIQGTANKISQEALQAFM
FT                   AKVEGQPGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMV
FT                   REYNQPSQEKRDHFAQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGI
FT                   VSSVVKFGFFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLV
FT                   KADKETGDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGTKKKEPKEVAKAKTK
FT                   GKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            436344..436811
FT                   /locus_tag="M6_Spy0442"
FT   CDS_pept        436344..436811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0442"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86577"
FT                   /db_xref="GOA:Q5XDD6"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDD6"
FT                   /protein_id="AAT86577.1"
FT                   /translation="MAKGEGHILAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLANELKGSGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHEYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            436817..437536
FT                   /locus_tag="M6_Spy0443"
FT   CDS_pept        436817..437536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0443"
FT                   /product="Glutaminyl-peptide cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86578"
FT                   /db_xref="GOA:Q5XDD5"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD5"
FT                   /protein_id="AAT86578.1"
FT                   /translation="MSIMITKGQVRLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFS
FT                   KVGVYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKATCNCLGAYP
FT                   FEGDGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVD
FT                   GYLYANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQR
FT                   FLITGKLYPLMLEVVLD"
FT   gene            complement(437653..438300)
FT                   /locus_tag="M6_Spy0444"
FT   CDS_pept        complement(437653..438300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0444"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86579"
FT                   /db_xref="GOA:Q5XDD4"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDD4"
FT                   /protein_id="AAT86579.1"
FT                   /translation="MKILVTGFDPFGGEAINPALEAIKKLPATIHGAEIKCIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRA
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(438350..439276)
FT                   /locus_tag="M6_Spy0445"
FT   CDS_pept        complement(438350..439276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0445"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86580"
FT                   /db_xref="GOA:Q5XDD3"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD3"
FT                   /protein_id="AAT86580.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPAFNEQKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGDVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIITHIALMYLLAYY"
FT   gene            complement(439276..440016)
FT                   /locus_tag="M6_Spy0446"
FT   CDS_pept        complement(439276..440016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0446"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86581"
FT                   /db_xref="GOA:Q5XDD2"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD2"
FT                   /protein_id="AAT86581.1"
FT                   /translation="MQILATNVIIVILLKKEFFMEWIKLIGIVIIVLGFILKFDAIATV
FT                   VVAGLVTALVSGISFVDFLDILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQ
FT                   RVQSLTVGRLLTLYLIIRELAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDTE
FT                   KDDIKAMAAANENFGNFFAQNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIIS
FT                   IIIVAIYNYLFEKKMERQHQKGDN"
FT   gene            complement(440170..441156)
FT                   /locus_tag="M6_Spy0447"
FT   CDS_pept        complement(440170..441156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0447"
FT                   /product="Bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86582"
FT                   /db_xref="GOA:Q5XDD1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD1"
FT                   /protein_id="AAT86582.1"
FT                   /translation="MKYLSFCVTIALKFYLKEKSMTLLSIIVPCFNEEANILPYFEEMH
FT                   QLETSMSNQLAFEYIFIDDGSKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLK
FT                   EAKGNYITVMDVDLQDPPELLPVMYAKLKEGYDIVGTRRQNRQGEPLIRSMCSNLFYGL
FT                   IKHLSDTEMVNGVRDYRLMTRQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRK
FT                   YGKSRWHFWELLRYSLDGFINFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPV
FT                   SGWASTVSIILFMGGIQLFCMGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(441241..441618)
FT                   /locus_tag="M6_Spy0448"
FT   CDS_pept        complement(441241..441618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0448"
FT                   /product="Lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86583"
FT                   /db_xref="GOA:Q5XDD0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDD0"
FT                   /protein_id="AAT86583.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(441629..442294)
FT                   /locus_tag="M6_Spy0449"
FT   CDS_pept        complement(441629..442294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0449"
FT                   /product="NAD(P)H-dependent quinone reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86584"
FT                   /db_xref="GOA:Q5XDC9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC9"
FT                   /protein_id="AAT86584.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   VGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASYFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(442343..443428)
FT                   /locus_tag="M6_Spy0450"
FT   CDS_pept        complement(442343..443428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0450"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86585"
FT                   /db_xref="GOA:Q5XDC8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC8"
FT                   /protein_id="AAT86585.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTPYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTHTPKELLYFEG"
FT   gene            443601..444602
FT                   /locus_tag="M6_Spy0451"
FT   CDS_pept        443601..444602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0451"
FT                   /product="Catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86586"
FT                   /db_xref="GOA:Q5XDC7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC7"
FT                   /protein_id="AAT86586.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            444733..445731
FT                   /locus_tag="M6_Spy0452"
FT   CDS_pept        444733..445731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0452"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86587"
FT                   /db_xref="GOA:Q5XDC6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC6"
FT                   /protein_id="AAT86587.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRETYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADPKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            445733..447067
FT                   /locus_tag="M6_Spy0453"
FT   CDS_pept        445733..447067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0453"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86588"
FT                   /db_xref="GOA:Q5XDC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC5"
FT                   /protein_id="AAT86588.1"
FT                   /translation="MRVGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYKVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGDGPYLQDLKHLAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   IIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLSLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            447489..449432
FT                   /locus_tag="M6_Spy0454"
FT   CDS_pept        447489..449432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0454"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86589"
FT                   /db_xref="GOA:Q5XDC4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDC4"
FT                   /protein_id="AAT86589.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESLSKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNAEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFQR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRTSQTSKIPYQLIVGDKEMEDKSVNVRRYGSKATHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            449573..450565
FT                   /locus_tag="M6_Spy0455"
FT   CDS_pept        449573..450565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0455"
FT                   /product="Daunorubicin resistance ATP-binding protein"
FT                   /note="DrrA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86590"
FT                   /db_xref="GOA:Q5XDC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC3"
FT                   /protein_id="AAT86590.1"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQNYVRDIGAVFG
FT                   QRTQLWWDLALQETYVVLKEIYDVPEKAFRKRMDFLNEVLDLNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQSFGKMKSLSFELKPGQEQVVSQFMGLPDITVERHE
FT                   LSLDIQYDSSRYQTAEIIQKTMADFAVRDLKMTDVDIEDIVRRFYRKEL"
FT   gene            450669..451385
FT                   /locus_tag="M6_Spy0456"
FT   CDS_pept        450669..451385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0456"
FT                   /product="Daunorubicin resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86591"
FT                   /db_xref="GOA:Q5XDC2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC2"
FT                   /protein_id="AAT86591.1"
FT                   /translation="MGAFVAYYLWKAVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTK
FT                   SDSSFMIGEEVKDGSIIMRLLRPVHFAASYLFMEIGFRWIVLMSVGFPFLMVLSGIKVM
FT                   AGLSILQVLASSCLYLVSLLLAFLINFYFNICFGFSAFVFKNLWGSNLLKNALVAFMSG
FT                   SLIPLAFFPKMVSIVLSFLPFSSLVYTPVMIVIGKYSLSQIMEALSLQIFWLLVMVVLS
FT                   QVIWKKVQYHLTIQGG"
FT   gene            451387..452172
FT                   /locus_tag="M6_Spy0457"
FT   CDS_pept        451387..452172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0457"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86592"
FT                   /db_xref="GOA:Q5XDC1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC1"
FT                   /protein_id="AAT86592.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFIIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLGAYESAGS"
FT   gene            complement(452276..452833)
FT                   /locus_tag="M6_Spy0458"
FT   CDS_pept        complement(452276..452833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0458"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86593"
FT                   /db_xref="GOA:Q5XDC0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDC0"
FT                   /protein_id="AAT86593.1"
FT                   /translation="MRHRGLAGTILLHKILGAAAQSGASLDDLEHLAFDLATEIATIGF
FT                   ATKSASLPNAALPLFDLPDHQISYGIGIHGEEGYRTVPFMSSEHLAVEIVNKLQIKFHW
FT                   QEDEHFILLVNNLGTATDLEQGIFLNDIHQLLDLEGLHLPFIKNGKFMTSLDMTGISVT
FT                   LCRLKDRQWLDYLQAPTNAYAW"
FT   gene            complement(452892..453326)
FT                   /locus_tag="M6_Spy0459"
FT   CDS_pept        complement(452892..453326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0459"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86594"
FT                   /db_xref="GOA:Q5XDB9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB9"
FT                   /protein_id="AAT86594.1"
FT                   /translation="MSYLSQAAYLNQHSLNEENVMVTILNQTQTLISQYIASVLAAHPH
FT                   LVQLQDLPIIYNRHLDDQLIPILSGGGSGHEPAHSGFVGDGMLSAAIYGDIFTPPTATD
FT                   ILEALRFLDKGKGVFVIIKNFEADIREFRPSHSSSTTRRS"
FT   gene            complement(453281..453817)
FT                   /locus_tag="M6_Spy0460"
FT   CDS_pept        complement(453281..453817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0460"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86595"
FT                   /db_xref="GOA:Q5XDB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB8"
FT                   /protein_id="AAT86595.1"
FT                   /translation="MATSLITKKKIAKAFKKQLAVKSFDKISVVDIMDQAQIRRQTFYN
FT                   HFLDKYELLDWIFETELQEQVTHNLNYISGFQLLDELLFYFERNKTFYAQLFDIKGQND
FT                   FSSYFVDYCQVLMAKIISEYQSQEMSQSDDADYLAFLTHYHARALADMIKGYVSQSEPK
FT                   PCLTYLKQLILTSIH"
FT   gene            453969..454958
FT                   /locus_tag="M6_Spy0461"
FT   CDS_pept        453969..454958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0461"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86596"
FT                   /db_xref="GOA:Q5XDB7"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB7"
FT                   /protein_id="AAT86596.1"
FT                   /translation="MKKIMNDATQIVDDMLQGLAYMHDDLVERLDGYDVIVRKAEKTGK
FT                   VALISGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQILEAIKAADEGAGVFMVIK
FT                   NYSGDIMNFEMAQELAEMEGIDVASVVVDDDIAVENSLYTQGRRGVAGTILVHKILGHA
FT                   AREGKSLADIKALADELVLNIKTIGLALSGATVPEVGKPGFVLEDDEFEYGVGIHGEPG
FT                   YKKEKLQSSSVLAQELVTKLADSFDMSAGQHYGVLVNGLGATPLMEQYVFANDVAKLLA
FT                   EKDVTVSFKKIGDYMTSIDMAGLSLTLIKLDKDEWTEALQSDVITPAW"
FT   gene            454900..455544
FT                   /locus_tag="M6_Spy0462"
FT   CDS_pept        454900..455544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0462"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86597"
FT                   /db_xref="GOA:Q5XDB6"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB6"
FT                   /protein_id="AAT86597.1"
FT                   /translation="MTRMNGQKLFNQMLSHQLGKEEIMQAQDAIKWMTLFNDKIQVNKD
FT                   YLSQLDTPIGDGDHGGNMARGMSAVMENLAGKEFASAADVFKVVAMQLLGKVGGASGPL
FT                   YGSAFMGLSKASEDSSLADALQAGLDMIQKRGKAEKGEKTMVDVWIPVIEALKNDGLTK
FT                   DVVEEAVLATKDIQATKGRASYVGERSVGHIDPGSFSSGLLFEAMLEAEVV"
FT   gene            455544..455918
FT                   /locus_tag="M6_Spy0463"
FT   CDS_pept        455544..455918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0463"
FT                   /product="Dihydroxyacetone kinase phosphotransfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86598"
FT                   /db_xref="GOA:Q5XDB5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB5"
FT                   /protein_id="AAT86598.1"
FT                   /translation="MSDLGIIIVSHSKNIAQGVVDLISEVATDVAITYVGGTEDGGIGT
FT                   SFDQVQAIVDANPKDDLLAFFDLGSARMNIEMVSDFSDKIITLNVVPIVEGAYTAAALI
FT                   QAGADKDAILSQLEELAINK"
FT   gene            455936..456646
FT                   /locus_tag="M6_Spy0464"
FT   CDS_pept        455936..456646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0464"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86599"
FT                   /db_xref="GOA:Q5XDB4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB4"
FT                   /protein_id="AAT86599.1"
FT                   /translation="MNFTGELLGTFILVLLGDGVVSACILNKTKAQNSGWIAIVLGWGI
FT                   AVTVAVYISGFMSGAHLNPAVTLAMAAIGSLPWSQVVTYLVAQFLGAMLGALVLYLHYY
FT                   PHWNETKDAGTILACFSTGPAIRHTWSNLFGEALGTAVLVITVMAIGPNKVAAGFGPII
FT                   VGFVVMAVGFSLGATTGYAINPARDLGPRIMHALLPIPNKGDSDWSYAWIPVLGPILGG
FT                   VVSALIYQVILNMM"
FT   gene            456769..457350
FT                   /locus_tag="M6_Spy0465"
FT   CDS_pept        456769..457350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0465"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86600"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB3"
FT                   /protein_id="AAT86600.1"
FT                   /translation="MRVTMRRLLSTMIKCNQDLPKNSLVVDMTLEKAAQLYENQVLTDT
FT                   QRFRKIRLSESGLTLEVRFLKKQPVQWLSESTNSNQLEEKANKFLANDDQTINISQAAL
FT                   AHFLEDTGDQKPIHREVPYVLPGAFLLEQVSDKLAIDYRQLHLRFYAPVVLDSSIQLMM
FT                   KGRAIGLFQAGKLVAKGDYDHDGCLYCCRP"
FT   gene            457313..458467
FT                   /locus_tag="M6_Spy0466"
FT   CDS_pept        457313..458467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0466"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86601"
FT                   /db_xref="GOA:Q5XDB2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB2"
FT                   /protein_id="AAT86601.1"
FT                   /translation="MTMTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPV
FT                   PIDQVICGNTVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMA
FT                   SNLLVGGIESSSLQPESVYASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTK
FT                   EYLNHWTLRSHQKASYCQEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHV
FT                   ISAANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKYGLGM
FT                   ADMTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALE
FT                   IKNGRYGIAAIAAAGGQGFAVLLKYHKEFSHADKARILGKAMPK"
FT   gene            458424..459671
FT                   /locus_tag="M6_Spy0467"
FT   CDS_pept        458424..459671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0467"
FT                   /product="Long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86602"
FT                   /db_xref="GOA:Q5XDB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB1"
FT                   /protein_id="AAT86602.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTYQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLQGLKEGSCPIILHPNISGTFQQQIKHVDSELLKKADFAVLSS
FT                   GTTGKAKLFWRCLSTWTRLFDYQNKVFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLSLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELAHQAPNVKE
FT                   AHALKIGKGENETLILVLVLTKKDCLAPIKDFLALYLNSGQLPKYYLVIDCLPLKDNGK
FT                   INREVLLNKIPKQWLS"
FT   gene            459727..460761
FT                   /locus_tag="M6_Spy0468"
FT   CDS_pept        459727..460761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0468"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86603"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDB0"
FT                   /protein_id="AAT86603.1"
FT                   /translation="MCYNMVKKDEEKAMKQAILDRYQALKCYQNAGLSNQAFRAIAKEP
FT                   IIDNRLGSPTFWVIWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSL
FT                   LPDHIFWKELASLVDQAFPGKTLSQAGELEKRLHQFRYVISSQQAQSIRNHYKMIEMTD
FT                   AQALALFLRSKKGPCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWF
FT                   HTEFILDSTGFFLNEVDAEIVTEKGIVNGASFNYGTDGPRHWDLDVDPINRHDPQFRRD
FT                   TLKGFRSPKRVFRQWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPI
FT                   KGWF"
FT   gene            460923..461633
FT                   /locus_tag="M6_Spy0469"
FT   CDS_pept        460923..461633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0469"
FT                   /product="VicR"
FT                   /note="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86604"
FT                   /db_xref="GOA:Q5XDA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA9"
FT                   /protein_id="AAT86604.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            461626..462978
FT                   /locus_tag="M6_Spy0470"
FT   CDS_pept        461626..462978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0470"
FT                   /product="VicK"
FT                   /EC_number="2.7.3.-"
FT                   /note="Two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86605"
FT                   /db_xref="GOA:Q5XDA8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA8"
FT                   /protein_id="AAT86605.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            462982..463791
FT                   /locus_tag="M6_Spy0471"
FT   CDS_pept        462982..463791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0471"
FT                   /product="Zn-dependent hydrolase (beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86606"
FT                   /db_xref="GOA:Q5XDA7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA7"
FT                   /protein_id="AAT86606.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAVDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            464223..464915
FT                   /locus_tag="M6_Spy0472"
FT   CDS_pept        464223..464915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0472"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86607"
FT                   /db_xref="GOA:Q5XDA6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XDA6"
FT                   /protein_id="AAT86607.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVVIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            464916..468455
FT                   /locus_tag="M6_Spy0473"
FT   CDS_pept        464916..468455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0473"
FT                   /product="Chromosome partition protein smc"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86608"
FT                   /db_xref="GOA:Q5XDA5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA5"
FT                   /protein_id="AAT86608.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAALQQDLASYYAKRQSMEEDYQKFKQKKQVLSQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QRTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQEG
FT                   DKRVQELERDYQLNQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEIALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLTTCEGYLGTAESLVRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKALLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKNVLTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEARLEETAEKITKESEKNDTFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLADAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAINQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQEMTN"
FT   gene            complement(468709..469695)
FT                   /locus_tag="M6_Spy0474"
FT   CDS_pept        complement(468709..469695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0474"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86609"
FT                   /db_xref="GOA:Q5XDA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA4"
FT                   /protein_id="AAT86609.1"
FT                   /translation="MIISIAKIKIGKNFEIFFISGLPFSFYLLYNKKNGIDFCWESGKN
FT                   MKSKLGVTLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISCIRLINILDKLHITL
FT                   DEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSDYTLNSFEKTMVKSI
FT                   LHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINYNSYFLLTKEMLNNY
FT                   IYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLDNELNFYEQTVFLYA
FT                   TGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVNKD"
FT   gene            469780..470706
FT                   /locus_tag="M6_Spy0475"
FT   CDS_pept        469780..470706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0475"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86610"
FT                   /db_xref="GOA:Q5XDA3"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA3"
FT                   /protein_id="AAT86610.1"
FT                   /translation="MLVLYVSSKLIKRRRMKFMYSALLGNPVEHSISDELFEYLNHNIG
FT                   VLDEYKHKKILVDSVCLEDKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGS
FT                   VNNIYKSGNIITGTNTDWKGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISP
FT                   TVVYREPISENTRSLIKSFPDLKYITYKELADQQILNDIEIIINTTPVGMINYEESLPI
FT                   NFDHLDNVNYKDKYFIDVVFNPLHTKLHEYFGKKGAKIIDGLWVLIFQGIEAFSLWSDK
FT                   INDGKYFFSKDDVVLIHTFLEGKIKGK"
FT   gene            470703..471539
FT                   /locus_tag="M6_Spy0476"
FT   CDS_pept        470703..471539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0476"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86611"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA2"
FT                   /protein_id="AAT86611.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            471517..472275
FT                   /locus_tag="M6_Spy0477"
FT   CDS_pept        471517..472275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0477"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86612"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA1"
FT                   /protein_id="AAT86612.1"
FT                   /translation="MSILMEAKMNLSIFGLKNIPYLKEGDSIEKLIEESIKTSGFFIED
FT                   NDVLCIASKVVSIAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRL
FT                   DIKKNYIGCRLENGLKLTSGGIDRKSVDEVFLLPNNPDASAKRISEYLKKSLGKNVAVV
FT                   ITDSDGREDKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMG
FT                   QRGTGIPAVLIRGLDYKWSENTSIKEALNE"
FT   gene            472268..473254
FT                   /locus_tag="M6_Spy0478"
FT   CDS_pept        472268..473254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0478"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86613"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XDA0"
FT                   /protein_id="AAT86613.1"
FT                   /translation="MSRNPDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYSYISIEKPLCNRLEDLEEM
FT                   KSLVESHPHLAKKIFASEQYFFSKILEKLLQVDCFSLDKIKEITVNFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            473264..474463
FT                   /locus_tag="M6_Spy0479"
FT   CDS_pept        473264..474463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0479"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86614"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD99"
FT                   /protein_id="AAT86614.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSSIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            474447..475415
FT                   /locus_tag="M6_Spy0480"
FT   CDS_pept        474447..475415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0480"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD98"
FT                   /protein_id="AAT86615.1"
FT                   /translation="MFMMDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINIL
FT                   GSVKFINSNQQFIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEHSDTLLIHA
FT                   AAVYNPLSGHSILLLGDKGAGKTTVAMRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTS
FT                   FFKIRRTAVLSDNLLFKLFSKFFNRSLQFNKASWDDKISIFPKELGIRTCNFSTEISKI
FT                   YYIKTDKKEKQIYHSIWSDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEK
FT                   NNRVREQIVKGIFAKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            475470..476459
FT                   /locus_tag="M6_Spy0481"
FT   CDS_pept        475470..476459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0481"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86616"
FT                   /db_xref="GOA:Q5XD97"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD97"
FT                   /protein_id="AAT86616.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKFFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLEEEKQ
FT                   YPHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            476861..477127
FT                   /locus_tag="M6_Spy0482"
FT   CDS_pept        476861..477127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0482"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD96"
FT                   /protein_id="AAT86617.1"
FT                   /translation="MIYYRLGFIFNEFYPNISGWRQELKTKLTSISLISLHFIGVVDEQ
FT                   KKGEYLGSFSDTSEFLSRHPKIYIISFRYKNQFYILSNKKIDL"
FT   gene            477151..478308
FT                   /locus_tag="M6_Spy0483"
FT   CDS_pept        477151..478308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0483"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86618"
FT                   /db_xref="GOA:Q5XD95"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD95"
FT                   /protein_id="AAT86618.1"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSPL
FT                   KEAAINKLLCKAKNINATSSEELAYKDATFIILSLPTNLKFNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNQFHYNDIIFSPEFLREGSTIHDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSPSLLVGSSEAEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKTILNSSAKTIGIYRINSKKDSDNCRESSTIDVAKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            478393..479601
FT                   /locus_tag="M6_Spy0484"
FT   CDS_pept        478393..479601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0484"
FT                   /product="Macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86619"
FT                   /db_xref="GOA:Q5XD94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD94"
FT                   /protein_id="AAT86619.1"
FT                   /translation="MNNRKKNIQYLVYSKVIYRIGDVMFDFANNTFLAGLNPASLSLVA
FT                   VYQSLESVIGVLFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVL
FT                   TNVILAFMSAFSSPSYKAFTKEIVKKDSISQLNSLLETTSTVIKVTVPMVAIFLYKLLG
FT                   IHGVLLLDGLSFLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGFKYVYSHKSIFI
FT                   ITVLSALVNFFLAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKEL
FT                   SSMRLILFLSLSGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVD
FT                   NDFLGRVFGIIFTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITILSLVFRILFKKY
FT                   NIR"
FT   gene            complement(479704..479913)
FT                   /locus_tag="M6_Spy0485"
FT   CDS_pept        complement(479704..479913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0485"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86620"
FT                   /db_xref="GOA:Q5XD93"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD93"
FT                   /protein_id="AAT86620.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENIITD
FT                   ILLEICIALDCKIEDIVEIVDNNI"
FT   gene            complement(479903..481561)
FT                   /locus_tag="M6_Spy0486"
FT   CDS_pept        complement(479903..481561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0486"
FT                   /product="Chromosome segregation ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86621"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD92"
FT                   /protein_id="AAT86621.1"
FT                   /translation="MLIEMWSPVFKKHGEIREPIQFHSGLNVIMGMDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSRDTADPDIILVCDKSYSPTG
FT                   ETMDLGIFLNKLKKRYHLDSSELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARKYAFISNLVGGKKQFEANVSEIKRL
FT                   EYDLSHLQDTQQDKIDSDDIEKNQQKLQLRNTKLELDNSLRDKQRRLKLLDISIEFGLY
FT                   PTESDLTELQQYFPDTNLKKLYEVEAYHKKLATILDSEFSTERESLIAEIDELESQLTT
FT                   LSQELQELGNIPNLSSEYLENYSKLTATINALKEQNEAYLKESGLSKEKSEADADLKRS
FT                   TEDILLDLEVKINSKMREFNNILYPDIRKAPQINLNAHNSYSFYTPDDDGTGTKFKGMI
FT                   VFDLVMLYLTNLPALAHDSLLLSNVSYQATEALLKLYDQSRSLNKQVFLAFDKASSYSP
FT                   DANQLLSENTVLRLSSNGNELYGISWNKGENSDEI"
FT   gene            complement(481552..481776)
FT                   /locus_tag="M6_Spy0487"
FT   CDS_pept        complement(481552..481776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0487"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86622"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD91"
FT                   /protein_id="AAT86622.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEVKLCL"
FT   gene            complement(481776..482876)
FT                   /locus_tag="M6_Spy0489"
FT   CDS_pept        complement(481776..482876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0489"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86623"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD90"
FT                   /protein_id="AAT86623.1"
FT                   /translation="MELTQLKTQYPSLIIDASFITLAANATVKPQDKTYNTVNLLNRFF
FT                   LIWLDVASRSLSHHHVLSHPFKDWMTTMLDFPFHHEFIEFLGRWTHILITLPKRHHGQV
FT                   DTAIPRYLLVTIREKTGIVKLTTVQNTAFTTPSNQLKKQYGQFLLTESNNCCACPGCDR
FT                   PLILTSGNLAAENYEVSAIEKDKDAEPLNLIALCPDCFLTYQADSRKKIVTALKNVKKI
FT                   LVSAHNSQQAISDMKLDSGIVSVLTSLNKLKCDEYDISYDSKQLTDKISPENNRTLYQL
FT                   VKNQVIDNYLTIQKIIVNLDKQGKIDYEEIQYQTRSMYKKLKAAKHNNLAIFNTISEKL
FT                   HMATLQDIYFCQMIVSYFIQKCEVLE"
FT   gene            482862..483218
FT                   /locus_tag="M6_Spy0488"
FT   CDS_pept        482862..483218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0488"
FT                   /product="Plasmid stabilization system antitoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86624"
FT                   /db_xref="GOA:Q5XD89"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD89"
FT                   /protein_id="AAT86624.1"
FT                   /translation="MSQLQKRDTMSLQKRRITMAKTGTLNLRVDDSVKSAADDILKRLG
FT                   IPMSTAIDMFLNQIILTGGIPFDVSLPEAPQRVNVDYMSQEKFYDKLITSFEDAKTGNR
FT                   QDVREFLSQLKENA"
FT   gene            483218..483523
FT                   /locus_tag="M6_Spy0490"
FT   CDS_pept        483218..483523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0490"
FT                   /product="Plasmid stabilization system toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86625"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD88"
FT                   /protein_id="AAT86625.1"
FT                   /translation="MKEYQVTMSDDAKADLLSIYHYVRDELCAPQAADNLLERLSQGML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            483656..483814
FT                   /locus_tag="M6_Spy0491"
FT   CDS_pept        483656..483814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0491"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86626"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD87"
FT                   /protein_id="AAT86626.1"
FT                   /translation="MVLSPSDSKLSADHQSLSSDEQMTTVVEQARLDEIATSVLSRHLD
FT                   AFKELTE"
FT   gene            483919..484371
FT                   /locus_tag="M6_Spy0492"
FT   CDS_pept        483919..484371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0492"
FT                   /product="Portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86627"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD86"
FT                   /protein_id="AAT86627.1"
FT                   /translation="MGLLDLIGRKRARDKPQNSYEGQDFFYLFGRTTSGENVDEFKAMQ
FT                   TTAVYACVRILAEAVASLPIHIYERTENGKEKKLDHPLYFLLHDEPNPEMSSFIFRETI
FT                   MSHLLIWGNAYVQIIRDKSGMVSLLLKQKASVLIRKLLLIIWQRMP"
FT   gene            484413..484745
FT                   /locus_tag="M6_Spy0493"
FT   CDS_pept        484413..484745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0493"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86628"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD85"
FT                   /protein_id="AAT86628.1"
FT                   /translation="MTVSSSAWMTRLIFQQILSEYVKSLEVEADKVVIPGQNTPVFSWD
FT                   RDGNLSIDTPLLEVRGESLATQADFTTISLTPGPKGELWQTSVERLDIKVDKHISLTFK
FT                   NGVRID"
FT   gene            484883..485680
FT                   /locus_tag="M6_Spy0494"
FT   CDS_pept        484883..485680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0494"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86629"
FT                   /db_xref="GOA:Q5XD84"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD84"
FT                   /protein_id="AAT86629.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYRGEILFADMMTKEQYTEVAKKVLANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            485684..486508
FT                   /locus_tag="M6_Spy0495"
FT   CDS_pept        485684..486508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0495"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86630"
FT                   /db_xref="GOA:Q5XD83"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD83"
FT                   /protein_id="AAT86630.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQICQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVAELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLEARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            486508..488058
FT                   /locus_tag="M6_Spy0496"
FT   CDS_pept        486508..488058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0496"
FT                   /product="Cell division protein ftsY"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86631"
FT                   /db_xref="GOA:Q5XD82"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD82"
FT                   /protein_id="AAT86631.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQDKI
FT                   EAVQQEDVSSEGAGSVENGPEAASVNALVEEETGDNSNHPSEDTNEFAADKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSANEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATHDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKGVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(488112..489479)
FT                   /locus_tag="M6_Spy0497"
FT   CDS_pept        complement(488112..489479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0497"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86632"
FT                   /db_xref="GOA:Q5XD81"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD81"
FT                   /protein_id="AAT86632.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFSWQWIFICILPVPLIAGILAYYYLEDSPVSEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENASVNLYYLGLFILSFVLFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTLLGALLAPAFGKLYDQKGARLSLYLGNALFSL
FT                   SLIIMTLQTRHFMPLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTTMASLIANSQPEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            489807..490649
FT                   /locus_tag="M6_Spy0498"
FT   CDS_pept        489807..490649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0498"
FT                   /product="Transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86633"
FT                   /db_xref="GOA:Q5XD80"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD80"
FT                   /protein_id="AAT86633.1"
FT                   /translation="MLIKRVLNHNSAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLGVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSEMSYD
FT                   DDDAELLLVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            490651..492513
FT                   /locus_tag="M6_Spy0499"
FT   CDS_pept        490651..492513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0499"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86634"
FT                   /db_xref="GOA:Q5XD79"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD79"
FT                   /protein_id="AAT86634.1"
FT                   /translation="MTYQETAKAILAAVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KAISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQAVAFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLALFGAPVTPASYGSSVIPILMMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSNTMLTIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSSGANFTNALIAGAATIVLAFSLTWFMGIDEESPEQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGVVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   gene            492532..493956
FT                   /locus_tag="M6_Spy0500"
FT   CDS_pept        492532..493956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0500"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86635"
FT                   /db_xref="GOA:Q5XD78"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD78"
FT                   /protein_id="AAT86635.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKGKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(494055..494894)
FT                   /locus_tag="M6_Spy0501"
FT   CDS_pept        complement(494055..494894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0501"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86636"
FT                   /db_xref="GOA:Q5XD77"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD77"
FT                   /protein_id="AAT86636.1"
FT                   /translation="MFTCGGALMIRFLILAGYFELTMYLQLSGKLDQYINVRYSYLAYI
FT                   SMILSFILALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTV
FT                   SAKGYTFPLAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVT
FT                   ITTENYMEVMELIYLYPDEFVDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYG
FT                   LLTTGNQTSYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(494870..495772)
FT                   /locus_tag="M6_Spy0502"
FT   CDS_pept        complement(494870..495772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0502"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86637"
FT                   /db_xref="GOA:Q5XD76"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD76"
FT                   /protein_id="AAT86637.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVIAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            495906..496103
FT                   /locus_tag="M6_Spy0503"
FT   CDS_pept        495906..496103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0503"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86638"
FT                   /db_xref="GOA:Q5XD75"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD75"
FT                   /protein_id="AAT86638.1"
FT                   /translation="MKQTSYGLLGFVCSVVFSLVASLPSVLTSKGLSKLGIDAKPASIF
FT                   SSSSFFLWVIAISMTFFHSR"
FT   gene            496309..498441
FT                   /locus_tag="M6_Spy0504"
FT   CDS_pept        496309..498441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0504"
FT                   /product="transcription accessory protein"
FT                   /note="contains S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86639"
FT                   /db_xref="GOA:Q5XD74"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD74"
FT                   /protein_id="AAT86639.1"
FT                   /translation="MENNNNHNIAEALSVSLHQIEQVLALTAQGNTIPFIARYRKEVTG
FT                   NLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLADLEELYL
FT                   PYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPQEALAGAVDILV
FT                   EAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQGYRTLAL
FT                   NRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAMERRVRSEL
FT                   SDAAEDGAIHIFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKLLTTQVIY
FT                   PVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFPNTSYVIV
FT                   NESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDV
FT                   SQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREENGALTSR
FT                   ADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLDIQDLDDAA
FT                   KATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILDLKDLEIG
FT                   QKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTVWVSKIDL
FT                   DRHKVNLSLLPPRDTH"
FT   gene            498428..498865
FT                   /locus_tag="M6_Spy0505"
FT   CDS_pept        498428..498865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0505"
FT                   /product="Zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86640"
FT                   /db_xref="GOA:Q5XD73"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD73"
FT                   /protein_id="AAT86640.1"
FT                   /translation="MTLTNYVQEVSLADFGKPFHHKAYWNKRLKTTGGRFFPKDGHLDF
FT                   NPRMLEENGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTSSKS
FT                   KTNHHYSCQTCGQVYQRKRRINLAKYVCGNCHGKLIEKNQS"
FT   gene            498929..499201
FT                   /locus_tag="M6_Spy0506"
FT   CDS_pept        498929..499201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0506"
FT                   /product="stress-responsive transcriptional regulator"
FT                   /note="PspC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86641"
FT                   /db_xref="GOA:Q5XD72"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD72"
FT                   /protein_id="AAT86641.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            499473..500498
FT                   /locus_tag="M6_Spy0507"
FT   CDS_pept        499473..500498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0507"
FT                   /product="HPR(SER) kinase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="3.1.3.-"
FT                   /note="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86642"
FT                   /db_xref="GOA:Q5XD71"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD71"
FT                   /protein_id="AAT86642.1"
FT                   /translation="MVSLFLFSSEKMSICKGLTVDLCYNIEKGEIMTVTVKMLVQKVKL
FT                   DVVYATDNLLSKEITTSDISRPGLEMTGYFDYYAPERLQLFGMKEWSYLTQMTSHNRYS
FT                   VLKEMFKKDTPAVVVSRNLAIPKEMVQAAKEEGISLLSSRVSTSRLAGEMSYFLDASLA
FT                   ERTSVHGVLMDIYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWG
FT                   EPAEILRHLLEIRGVGIIDVMSLYGASAVKDSSQVQLAIYLENFEAGKVFDRLGNGNEE
FT                   ITFSGVRIPRIRIPVKTGRNVSVVIEAAAMNHRAKEMGFDATKTFEDRLTQLITKNEVS
FT                   Q"
FT   gene            500495..501274
FT                   /locus_tag="M6_Spy0508"
FT   CDS_pept        500495..501274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0508"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86643"
FT                   /db_xref="GOA:Q5XD70"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD70"
FT                   /protein_id="AAT86643.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESLWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            501296..501703
FT                   /locus_tag="M6_Spy0509"
FT   CDS_pept        501296..501703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0509"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86644"
FT                   /db_xref="GOA:Q5XD69"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD69"
FT                   /protein_id="AAT86644.1"
FT                   /translation="MDLVGISLMIIALAFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANILVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            501675..502124
FT                   /locus_tag="M6_Spy0510"
FT   CDS_pept        501675..502124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0510"
FT                   /product="Hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86645"
FT                   /db_xref="GOA:Q5XD68"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD68"
FT                   /protein_id="AAT86645.1"
FT                   /translation="MEKKEKSMNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAY
FT                   QAYKESPDDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQ
FT                   KTKETFAEVEAKEKQDDVIIDLNEDDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(502283..502567)
FT                   /locus_tag="M6_Spy0511"
FT   CDS_pept        complement(502283..502567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86646"
FT                   /db_xref="GOA:Q5XD67"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD67"
FT                   /protein_id="AAT86646.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLLAKVIKSLLM"
FT   gene            502766..503692
FT                   /locus_tag="M6_Spy0512"
FT   CDS_pept        502766..503692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0512"
FT                   /product="Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86647"
FT                   /db_xref="GOA:Q5XD66"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD66"
FT                   /protein_id="AAT86647.1"
FT                   /translation="MEKIIITATAESIEQVKALLAAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCAGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            503794..505080
FT                   /locus_tag="M6_Spy0513"
FT   CDS_pept        503794..505080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0513"
FT                   /product="Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86648"
FT                   /db_xref="GOA:Q5XD65"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD65"
FT                   /protein_id="AAT86648.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERRSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESPE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRT"
FT   gene            complement(505093..505221)
FT                   /locus_tag="M6_Spy0514"
FT   CDS_pept        complement(505093..505221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0514"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86649"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD64"
FT                   /protein_id="AAT86649.1"
FT                   /translation="MTHSPIILSSFEKISYCDIQLSKKTGSLFPTMVVYHLEKEGL"
FT   gene            505290..505502
FT                   /locus_tag="M6_Spy0515"
FT   CDS_pept        505290..505502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0515"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86650"
FT                   /db_xref="GOA:Q5XD63"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD63"
FT                   /protein_id="AAT86650.1"
FT                   /translation="MAEFTFNIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(505875..507380)
FT                   /locus_tag="M6_Spy0516"
FT   CDS_pept        complement(505875..507380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0516"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86651"
FT                   /db_xref="GOA:Q5XD62"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD62"
FT                   /protein_id="AAT86651.1"
FT                   /translation="MEENMSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFDRTANS
FT                   AELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVS
FT                   EDNYEIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIET
FT                   IYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFV
FT                   THHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQA
FT                   YADYLDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFW
FT                   PEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLA
FT                   KKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYD
FT                   FVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            507542..508444
FT                   /locus_tag="M6_Spy0517"
FT   CDS_pept        507542..508444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0517"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86652"
FT                   /db_xref="GOA:Q5XD61"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD61"
FT                   /protein_id="AAT86652.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRDRQLKPGTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDINDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   gene            complement(508553..509176)
FT                   /locus_tag="M6_Spy0518"
FT   CDS_pept        complement(508553..509176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0518"
FT                   /product="Phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86653"
FT                   /db_xref="GOA:Q5XD60"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD60"
FT                   /protein_id="AAT86653.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VAFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKITTMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNASLTILETKDYLTYDCLIWNDKSFLEV"
FT   gene            complement(509516..509995)
FT                   /locus_tag="M6_Spy0519"
FT   CDS_pept        complement(509516..509995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0519"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86654"
FT                   /db_xref="GOA:Q5XD59"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD59"
FT                   /protein_id="AAT86654.1"
FT                   /translation="MAKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(510086..510694)
FT                   /locus_tag="M6_Spy0520"
FT   CDS_pept        complement(510086..510694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0520"
FT                   /product="Thiamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86655"
FT                   /db_xref="GOA:Q5XD58"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD58"
FT                   /protein_id="AAT86655.1"
FT                   /translation="MIGKRYSFCAQKEFFMSPNTNVKYLIEAAIFAALAMALSFIPDFA
FT                   GWFSPSYGAIALVIFSLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTS
FT                   MGLAGSFSDSLIKTLRRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMS
FT                   AIWYSFSVNGTAGVLTFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(510918..511766)
FT                   /locus_tag="M6_Spy0521"
FT   CDS_pept        complement(510918..511766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0521"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86656"
FT                   /db_xref="GOA:Q5XD57"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD57"
FT                   /protein_id="AAT86656.1"
FT                   /translation="MRRKIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPSKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARAFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDAVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            512091..512594
FT                   /locus_tag="M6_Spy0522"
FT   CDS_pept        512091..512594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0522"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86657"
FT                   /db_xref="GOA:Q5XD56"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD56"
FT                   /protein_id="AAT86657.1"
FT                   /translation="MSAKLMSRIAIMSALCVVLRMVFSSLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFVLVLLLWRFVLYPLSQQFPKYQLGYQAF
FT                   LAALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVVMMLFRRLIG
FT                   EQKI"
FT   gene            512578..512961
FT                   /locus_tag="M6_Spy0523"
FT   CDS_pept        512578..512961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0523"
FT                   /product="Hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86658"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD55"
FT                   /protein_id="AAT86658.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQTQTPSVPKADHHVRLVVKE
FT                   DTNTIDEKVSFGKGDTVLEILKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVFK"
FT   gene            complement(513007..513531)
FT                   /locus_tag="M6_Spy0524"
FT   CDS_pept        complement(513007..513531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0524"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86659"
FT                   /db_xref="GOA:Q5XD54"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD54"
FT                   /protein_id="AAT86659.1"
FT                   /translation="MIPLTKLLITPRRCHMPNLYDFTVKAQNGNDLSLAAYKEKVVLIV
FT                   NTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTT
FT                   FPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPK
FT                   LIEEDLKALLG"
FT   gene            complement(513479..515353)
FT                   /locus_tag="M6_Spy0525"
FT   CDS_pept        complement(513479..515353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0525"
FT                   /product="Oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86660"
FT                   /db_xref="GOA:Q5XD53"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD53"
FT                   /protein_id="AAT86660.1"
FT                   /translation="MDRFSLHIPLKFCYTSLDYIVKETTMELKKRSEFPENELWDLTAL
FT                   YKDRQDFLLAIEKALQDIDLFKRNYEGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMP
FT                   QTTDFSDESFAQIAQAGDDFMTKANVALSFFDTALANADLDVLDTLEKNPYFSAAIRMA
FT                   KIQKEHLLSPDVEKALANLREVINAPYDIYTKMRASDFDMDDFEVDGKTYKNSFVSYEN
FT                   FYQNHENAEIREKAFRSFSNGLRKHQNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAE
FT                   QEVDRSLFDRQIDLIMTEFGPVAQKFLKHVAQVNGLEKMTFADWKLDIDNDLNPEVSID
FT                   GAYDLVMKSLAPLGQEYTKEIERYQTERWVDFAANANKDSGGYAADPYKVHPYVLMSWT
FT                   GRMSDVYTLIHEIGHSGQFIFSDNHQSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDD
FT                   PRQKRFALAHRLTDTYFHNFITHLLEAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDF
FT                   WGDAVDIDDDAALTWMRQAHYYMGLYSYTYSAGLVMSTAGYLNLKNNPDGAKEWLDFLK
FT                   SGGSRTPLDTAMLIGADIATEKPLRDTIQFLSDTVDQIINYTEEMSHA"
FT   gene            515422..518235
FT                   /locus_tag="M6_Spy0526"
FT   CDS_pept        515422..518235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0526"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86661"
FT                   /db_xref="GOA:Q5XD52"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD52"
FT                   /protein_id="AAT86661.1"
FT                   /translation="MVKSGMIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLEN
FT                   ITRRMIGDDAFTVIESIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISE
FT                   DVDLAYEINYQNNTDTDYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKT
FT                   ILELTTHIHKLLRKYRDAKAGVISLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNV
FT                   MQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCL
FT                   SATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRA
FT                   FHYIQSRLKQTQIQLTNQPAARMSSSVGLSTSAWSSPASLENPILAYDSPVDFKADLKA
FT                   IEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVD
FT                   DYSSLSETEKCDVLVQQLMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIK
FT                   QHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHD
FT                   IVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGR
FT                   GGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASIN
FT                   RMVTQMITDPNEIDSFREIMDSIVADSNIIYRKLVFDNPHFYDYFFEASPIKEVSSLNI
FT                   GSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHM
FT                   YQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEILDEWQLTKNVILAI
FT                   QDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIA
FT                   TGLRNSG"
FT   gene            518375..519679
FT                   /locus_tag="M6_Spy0527"
FT   CDS_pept        518375..519679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0527"
FT                   /product="Cell division protein ftsW"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86662"
FT                   /db_xref="GOA:Q5XD51"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD51"
FT                   /protein_id="AAT86662.1"
FT                   /translation="MIISRSRGKTMKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVS
FT                   LIQAHANPFKSVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARF
FT                   FTTAIKGAHGWIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWP
FT                   TQWNDLRDWRVYSLLMVLLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVMITG
FT                   LSTVFLGTIAVIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGW
FT                   FGQGLGNSIEKRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKN
FT                   PFNAMMALGVGGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNI
FT                   DASEKRDDIFKEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            complement(519696..519836)
FT                   /locus_tag="M6_Spy0528"
FT   CDS_pept        complement(519696..519836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0528"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD50"
FT                   /protein_id="AAT86663.1"
FT                   /translation="MEFHALFLPQQKAAVLAHVTRKNKKSAEQFKFFEHQTGIVYILKS
FT                   P"
FT   gene            519982..521229
FT                   /locus_tag="M6_Spy0529"
FT   CDS_pept        519982..521229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0529"
FT                   /product="Protein Translation Elongation Factor Tu"
FT                   /note="EF-TU"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86664"
FT                   /db_xref="GOA:Q5XD49"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD49"
FT                   /protein_id="AAT86664.1"
FT                   /translation="MAYRLSIKYILLEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTL
FT                   TAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPG
FT                   HADYVKNMITGAAQMDGAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDD
FT                   EELLELVEMEIRDLLSEYDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPE
FT                   PERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVE
FT                   MFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGR
FT                   HTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIR
FT                   EGGRTVGSGIVSEIEA"
FT   gene            521469..522227
FT                   /locus_tag="M6_Spy0530"
FT   CDS_pept        521469..522227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0530"
FT                   /product="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86665"
FT                   /db_xref="GOA:Q5XD48"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD48"
FT                   /protein_id="AAT86665.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEARAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEAGSFLALLDFLN"
FT   gene            complement(522326..523561)
FT                   /locus_tag="M6_Spy0531"
FT   CDS_pept        complement(522326..523561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0531"
FT                   /product="Factor essential for expression of methicillin
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86666"
FT                   /db_xref="GOA:Q5XD47"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD47"
FT                   /protein_id="AAT86666.1"
FT                   /translation="MALIEISQEQFDHYCHSLVHHSFIQTSEMASLMAKRGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISHPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   RLTHSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFMVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTEQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGKFDGSDGVLRFKQNFNGFILQKPGTFRCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(523548..524789)
FT                   /locus_tag="M6_Spy0532"
FT   CDS_pept        complement(523548..524789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0532"
FT                   /product="Factor essential for expression of methicillin
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86667"
FT                   /db_xref="GOA:Q5XD46"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD46"
FT                   /protein_id="AAT86667.1"
FT                   /translation="MGIKLMYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKDNWKH
FT                   ERISFYENGVQVAAAACLIRKLPLGFTMIYIPRGPIMDYANFELLDFVIKTLKTFGKSK
FT                   RALFVKIDPSLVIKQTLEGKESKENDVTLSIIAFLKKLGVEWSGRTKELEDTIQPRIQA
FT                   NIYAKDFDFDILPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGK
FT                   SYYQKLLDIYAGQSYITMASLDLPEQKKLLIQQLDKALAEQARLTDKSKPSKVAENQKT
FT                   IARLQKDLTILSEQLAAGKTRIPLAATLTLIYGETSENLYAGMDDNYRNYQAPLLTWYE
FT                   TAKEAFKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFAGEFNIPVGLVSSLAILTY
FT                   NLRKKLRSTTNGTN"
FT   gene            complement(524774..525583)
FT                   /locus_tag="M6_Spy0533"
FT   CDS_pept        complement(524774..525583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0533"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86668"
FT                   /db_xref="GOA:Q5XD45"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD45"
FT                   /protein_id="AAT86668.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLG
FT                   VHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            complement(525734..525967)
FT                   /locus_tag="M6_Spy0534"
FT   CDS_pept        complement(525734..525967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0534"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86669"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD44"
FT                   /protein_id="AAT86669.1"
FT                   /translation="MEFYALFLSLGSQKSRVTSLPVLTPLLPQQKAAVLAHVTRRNKKS
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(526039..527442)
FT                   /locus_tag="M6_Spy0536"
FT   CDS_pept        complement(526039..527442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0536"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86670"
FT                   /db_xref="GOA:Q5XD43"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD43"
FT                   /protein_id="AAT86670.1"
FT                   /translation="MVNCNFITLLSISKLVCLFYQFLLILSIFDIIKIMNEKVFRDPVH
FT                   NYIHIDNPLIYDLINTKEFQRLRRIKQVPTTAFTFHGAEHSRFSHCLGVYEIARRVTAI
FT                   FEEKYADIWNKDESLVTMTAALLHDIGHGAYSHTFEALFHTDHETFTQEIITNPETEIN
FT                   AILVRHAPDFPDKVASVINHTYPNKQVVQLISSQIDCDRMDYLLRDSYFSAANYGQFDL
FT                   MRILRVIRPVEDGIVFEHSGMHAVEDYIVSRFQMYMQVYFHPASRAVELILQNLLKRAQ
FT                   HLYPKQQAYFQKTAPGLIPFFEKKANLADYIALDDGVMNTYFQVWMASEDHILSDLASR
FT                   FINRKILKSVTFDQDSRGELERLRQLVESVGFDPDYYTGIHINFDLPYDIYRPELENPR
FT                   TQIEMMQKDGSLAELSQLSPIVKALTGTTYGDRRFYFPKEMLELDDLFAPSKETFMSYI
FT                   SNGHFHFSQ"
FT   gene            527423..527809
FT                   /locus_tag="M6_Spy0535"
FT   CDS_pept        527423..527809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0535"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86671"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD42"
FT                   /protein_id="AAT86671.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGGYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            528039..530720
FT                   /locus_tag="M6_Spy0537"
FT   CDS_pept        528039..530720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0537"
FT                   /product="Calcium-transporting ATPase"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86672"
FT                   /db_xref="GOA:Q5XD41"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD41"
FT                   /protein_id="AAT86672.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSEDASIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGTLQSSSADIAFDNTTLRVMNFANDTKVDPSGKLIGDPTETALVQ
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRSITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(530804..531808)
FT                   /locus_tag="M6_Spy0538"
FT   CDS_pept        complement(530804..531808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0538"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86673"
FT                   /db_xref="GOA:Q5XD40"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD40"
FT                   /protein_id="AAT86673.1"
FT                   /translation="MYAMQRKVTIKDIAELAKTSKTTVSFYLNGKFDKMSEETKNRIKS
FT                   TIEATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNS
FT                   NYDPSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWV
FT                   KTNNYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMII
FT                   DENQTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEW
FT                   TKFSSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(531863..533788)
FT                   /locus_tag="M6_Spy0539"
FT   CDS_pept        complement(531863..533788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0539"
FT                   /product="Oligohyaluronate lyase"
FT                   /EC_number="4.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86674"
FT                   /db_xref="GOA:Q5XD39"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD39"
FT                   /protein_id="AAT86674.1"
FT                   /translation="MERKCPMSLAFTRFKETVNPDFCRNYLLDYQADSYADRKRIADLL
FT                   LTNTFLFEDNWDMEPCHIPYHLDPITWQKAITDDPEWNFMLNRQTYLQKLILVYLVERD
FT                   ERYLLKAKSFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFNALTKQEES
FT                   LILASLEKQLHFLHANYLDKYSLSNWGILQTTAILLADAYYGSNLDIAAATAFARKELT
FT                   QQIALQILEDGSQFEQSTMYHVEVLKALLELTALVPDYLPQLRPTLLAMSDYLLKMTGP
FT                   DHKQIPLGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLP
FT                   IQTLPTFAHHFEHSGHITINQESYYLFFKNGPIGSSHTHSDQNSLCLYYKGEPLFCDAG
FT                   RYTYKEEPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHIYFID
FT                   GSYQTQFSDRNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLDVKTDHLS
FT                   DLRLISDCPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPL
FT                   QTGKRNPIETALAWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNE
FT                   IIRLKH"
FT   gene            complement(533857..534738)
FT                   /locus_tag="M6_Spy0540"
FT   CDS_pept        complement(533857..534738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0540"
FT                   /product="PTS system, N-acetylgalactosamine-specific IID
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86675"
FT                   /db_xref="GOA:Q5XD38"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD38"
FT                   /protein_id="AAT86675.1"
FT                   /translation="MNFTTNLNKSMQQLSKEANKMTGSNKLTKKDYLKTALRAFFLQNG
FT                   FNYSNYQGIGYANVIYPALKKHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVML
FT                   ENNRSEEETRNIKMALMGPLAGIGDSLSQFCLAPLFSTIAASLASDGLVLGPILFFLAM
FT                   NIILTAIKIGSGLYGYKVGTSFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPI
FT                   TFAAGKVDAANAAQKFVTIQGMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVLLTVL
FT                   IGIIGSWLGILA"
FT   gene            complement(534665..535447)
FT                   /locus_tag="M6_Spy0541"
FT   CDS_pept        complement(534665..535447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0541"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86676"
FT                   /db_xref="GOA:Q5XD37"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD37"
FT                   /protein_id="AAT86676.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWSFAILGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(535466..535954)
FT                   /locus_tag="M6_Spy0542"
FT   CDS_pept        complement(535466..535954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0542"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86677"
FT                   /db_xref="GOA:Q5XD36"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD36"
FT                   /protein_id="AAT86677.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKYLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDAKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHQVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(535990..537189)
FT                   /locus_tag="M6_Spy0543"
FT   CDS_pept        complement(535990..537189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0543"
FT                   /product="Unsaturated glucuronyl hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86678"
FT                   /db_xref="GOA:Q5XD35"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD35"
FT                   /protein_id="AAT86678.1"
FT                   /translation="MTRSLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYTIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTSEAREAALKAADKLVQRYQDKGGFIQAWG
FT                   VLGKKEDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFRDDSEQSRDSSATAIAVCGIHEMLKTLPDHDPDKKTYEAAMHSM
FT                   LRALIKDYANKDLNPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            complement(537189..537626)
FT                   /locus_tag="M6_Spy0544"
FT   CDS_pept        complement(537189..537626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0544"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86679"
FT                   /db_xref="GOA:Q5XD34"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD34"
FT                   /protein_id="AAT86679.1"
FT                   /translation="MIAIIVMGHGHFASGIVSSLELIAGQQEKVTAIDFTAEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLSNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVSGLITCSKEGIVDWKTLSQQEDGTTDDELGGI"
FT   gene            537962..538756
FT                   /locus_tag="M6_Spy0545"
FT   CDS_pept        537962..538756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0545"
FT                   /product="Gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86680"
FT                   /db_xref="GOA:Q5XD33"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD33"
FT                   /protein_id="AAT86680.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLTAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKAVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGATEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            538781..539422
FT                   /locus_tag="M6_Spy0546"
FT   CDS_pept        538781..539422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0546"
FT                   /product="Galactose-6-phosphate isomerase LacB subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86681"
FT                   /db_xref="GOA:Q5XD32"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD32"
FT                   /protein_id="AAT86681.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKYGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFKEYFFANAEPSELVAYLKSVLEQ"
FT   gene            539412..540452
FT                   /locus_tag="M6_Spy0547"
FT   CDS_pept        539412..540452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0547"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86682"
FT                   /db_xref="GOA:Q5XD31"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD31"
FT                   /protein_id="AAT86682.1"
FT                   /translation="MNSNSILTRKGGHMSKLLLVGEPLIRVSPNQFQPLTNACDAQLFF
FT                   GGSEVNIARTLGGFGLEVRLFTALPDNPVGHAFHQFLKQIGVDMTLTAWQGNRVGLYYL
FT                   ENGFGCRASQVYYDRCGSSFSALDKDSLDLAAIFEGIRHFHFSGISLALGKKTQDLIEI
FT                   LAREARKRQVCVSFDLNFRSSMIAAADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFD
FT                   RNKADATMIRERLAGLYQRYQLQAIYHTERSNDAQGSNRFKAYAYDGQFYESCEVTTPV
FT                   LQRVGSGDAFVAGLLYQLLEGNEKQRNLDFAVATASLKCTVAEDQLYHSVQQVEAVLAN
FT                   QRDVQR"
FT   gene            540439..541092
FT                   /locus_tag="M6_Spy0548"
FT   CDS_pept        540439..541092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0548"
FT                   /product="4-Hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /EC_number="4.1.2.14"
FT                   /note="2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86683"
FT                   /db_xref="GOA:Q5XD30"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD30"
FT                   /protein_id="AAT86683.1"
FT                   /translation="MSRGDDMGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGI
FT                   KTIEVTYTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQFIVGPNFN
FT                   RAVALICHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGISFIRAIKSPLPQVE
FT                   VMVTGGVSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            541383..542039
FT                   /locus_tag="M6_Spy0549"
FT   CDS_pept        541383..542039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0549"
FT                   /product="Beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /EC_number="2.7.1.41"
FT                   /note="Glucose-1-phosphate phosphodismutase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86684"
FT                   /db_xref="GOA:Q5XD29"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD29"
FT                   /protein_id="AAT86684.1"
FT                   /translation="MLMIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDF
FT                   IGGNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLEQLKKQG
FT                   IKLAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQ
FT                   LLVVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            542684..543859
FT                   /locus_tag="M6_Spy0550"
FT   CDS_pept        542684..543859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0550"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86685"
FT                   /db_xref="GOA:Q5XD28"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD28"
FT                   /protein_id="AAT86685.1"
FT                   /translation="MSFFFLEVLTYFDYDSSMTIKAEIKALAKEIGISKIGFTTADNFD
FT                   YLEKSLRASVEEGRNSGFEHKVIEDRISPERLLESAKTIISIGVAYPHKLPQQPQKTPY
FT                   KRGKITPSSWGLDYHYVVGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAG
FT                   IGFIGKNGLVISKEYGSYMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDG
FT                   SMNAKRCLSFQTQDKGMMDIEFRKKIKTVIYGCDICQICCPYNKGINNSPATEIDPELA
FT                   QPELIPFLSLSNGQFKEKFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKN
FT                   NNPIHTATAIWALGEIVKKPNDEMLAFMSHLTLKDEDSQKELELIRRKWQV"
FT   gene            544013..545026
FT                   /locus_tag="M6_Spy0551"
FT   CDS_pept        544013..545026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0551"
FT                   /product="Bacterial Peptide Chain Release Factor 2"
FT                   /note="RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86686"
FT                   /db_xref="GOA:Q5XD27"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD27"
FT                   /protein_id="AAT86686.1"
FT                   /translation="MEEEIALLENHMTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQ
FT                   ELSDETELLLEMLDEDDSLKEELEENLMQLDKIMGAYEMTLLLSEPYDHNNAILEIHPG
FT                   SGGTEAQDWGDLLLRMYTRFGNANGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKS
FT                   EMGVHRLVRISPFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQN
FT                   VNKVSTGVRLTHIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKG
FT                   DKKEITWGSQIRSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            545045..545737
FT                   /locus_tag="M6_Spy0552"
FT   CDS_pept        545045..545737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0552"
FT                   /product="Cell division ATP-binding protein"
FT                   /note="FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86687"
FT                   /db_xref="GOA:Q5XD26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD26"
FT                   /protein_id="AAT86687.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            545700..546659
FT                   /locus_tag="M6_Spy0553"
FT   CDS_pept        545700..546659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0553"
FT                   /product="Cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86688"
FT                   /db_xref="GOA:Q5XD25"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD25"
FT                   /protein_id="AAT86688.1"
FT                   /translation="MMKKKEIMVTMIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLT
FT                   LVGVFAATLLNIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDK
FT                   IAQIKGVKKITFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITK
FT                   KIRTIEGVEAADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRK
FT                   RDIEIMRLVGAKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNL
FT                   SMYPLDPYVYYLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(546969..547667)
FT                   /locus_tag="M6_Spy0554"
FT   CDS_pept        complement(546969..547667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0554"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86689"
FT                   /db_xref="GOA:Q5XD24"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD24"
FT                   /protein_id="AAT86689.1"
FT                   /translation="MPFIFRYSFFNKALIFWYTILMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIISKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIINVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSWGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTIC
FT                   HEKNANPFFH"
FT   gene            547808..548599
FT                   /locus_tag="M6_Spy0555"
FT   CDS_pept        547808..548599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0555"
FT                   /product="(R,R)-butanediol dehydrogenase"
FT                   /EC_number="1.1.1.4"
FT                   /EC_number="1.1.1.303"
FT                   /note="Acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86690"
FT                   /db_xref="GOA:Q5XD23"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD23"
FT                   /protein_id="AAT86690.1"
FT                   /translation="MTKKYEVEDMSKVAIVTGAGQGIGFAIAKRLHADGFKIGILDYNE
FT                   ETAQAAVDKLSPEDAVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDT
FT                   ITEEQFEKAFAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTK
FT                   FAVRGITQTLAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMEQFAKD
FT                   ITLKRLSEPEDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            548707..551208
FT                   /locus_tag="M6_Spy0556"
FT   CDS_pept        548707..551208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0556"
FT                   /product="ATP-dependent helicase, DinG family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86691"
FT                   /db_xref="GOA:Q5XD22"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD22"
FT                   /protein_id="AAT86691.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIIDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLSHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLVYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKPYQISKSFPINMALLGLEERPKQTQFAQLIDEDYHQGVAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRVQDDKDFTRNKVLVFDE
FT                   AQKLMLQLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVSHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRQDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            551543..552736
FT                   /locus_tag="M6_Spy0557"
FT   CDS_pept        551543..552736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0557"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86692"
FT                   /db_xref="GOA:Q5XD21"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD21"
FT                   /protein_id="AAT86692.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIETLKEAIRRLHVFMESNEIN"
FT   gene            552757..554103
FT                   /locus_tag="M6_Spy0558"
FT   CDS_pept        552757..554103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0558"
FT                   /product="Asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86693"
FT                   /db_xref="GOA:Q5XD20"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD20"
FT                   /protein_id="AAT86693.1"
FT                   /translation="MSKKLISIVNVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPVTPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            554533..555423
FT                   /locus_tag="M6_Spy0559"
FT   CDS_pept        554533..555423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0559"
FT                   /product="ATP-binding protein"
FT                   /note="contains P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86694"
FT                   /db_xref="GOA:Q5XD19"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD19"
FT                   /protein_id="AAT86694.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQASLRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            555420..556397
FT                   /locus_tag="M6_Spy0560"
FT   CDS_pept        555420..556397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0560"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86695"
FT                   /db_xref="GOA:Q5XD18"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD18"
FT                   /protein_id="AAT86695.1"
FT                   /translation="MKNPKMTVIGGGTGISIILKSLRNEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGNLIIAGISEMQG
FT                   STYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYQGMIDHVYVTN
FT                   TYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEVVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            556394..557305
FT                   /locus_tag="M6_Spy0561"
FT   CDS_pept        556394..557305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0561"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86696"
FT                   /db_xref="GOA:Q5XD17"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD17"
FT                   /protein_id="AAT86696.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSFIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLTAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYLQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   gene            557438..558835
FT                   /locus_tag="M6_Spy0562"
FT   CDS_pept        557438..558835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0562"
FT                   /product="Dipeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86697"
FT                   /db_xref="GOA:Q5XD16"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD16"
FT                   /protein_id="AAT86697.1"
FT                   /translation="MACTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIVVKPEDQP
FT                   RHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVTMSATETITTNSRVL
FT                   GADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSDEHDIWWL
FT                   ETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLCSADLKDFIDTYHLDLTYSH
FT                   EHFNPRYAFGSQRDKDRHYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYRKITVEDV
FT                   KYVLSSHYQDMGYDPYGSEGTPVSKKVFRPIGINRTSQTAILHIRPNKPQEIAAIQWMA
FT                   YGSMPFNTMVPFFTQVKTIPDYFANTYENVSTDNFYWTNRLIAALADPHYNHHETDLDN
FT                   YLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILFDASNLMT
FT                   NRFSLSD"
FT   gene            558987..560534
FT                   /locus_tag="M6_Spy0563"
FT   CDS_pept        558987..560534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0563"
FT                   /product="High-affinity zinc uptake system protein znuA
FT                   precursor"
FT                   /note="Hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86698"
FT                   /db_xref="GOA:Q5XD15"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD15"
FT                   /protein_id="AAT86698.1"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGVIGNDGDVSMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGAGHDHHHEDADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTEKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEPNAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            560676..561407
FT                   /locus_tag="M6_Spy0564"
FT   CDS_pept        560676..561407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0564"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86699"
FT                   /db_xref="GOA:Q5XD14"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD14"
FT                   /protein_id="AAT86699.1"
FT                   /translation="MNKMPKEQPLYLQIVDDLEVKIKKSMTANDKLLSERELSDLYGVS
FT                   HITIRLALKELELRGLIYKKQGKGTYVSGIKEPATDLSSTYSFTEQMKKMGKMPKTEFL
FT                   SFEQYQVTPYLSGLLEIDVDTDVFELERLRIADDMPLMFERSYIPAQPFQGLSIADLKR
FT                   KALYDIFAKDYQETIRLAEEEFYASIALDYEAGLLGIKKGDPVLHIIRKTYDDKNILIE
FT                   LTFSIARADQFRYRVQHHPNG"
FT   gene            561427..562626
FT                   /locus_tag="M6_Spy0565"
FT   CDS_pept        561427..562626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0565"
FT                   /product="Galactosamine-6-phosphate deaminase
FT                   (isomerizing)"
FT                   /EC_number="3.5.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86700"
FT                   /db_xref="GOA:Q5XD13"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD13"
FT                   /protein_id="AAT86700.1"
FT                   /translation="MFTKSQEALEALGAAITTKEIKQEPRLWQETMTFFDETRDSLDSF
FT                   LKRVCKSANGNNVHVIFTGAGTSEYIGNTICPYLKKVGNRQCYLFESVASTDLVAAPDY
FT                   YLAEEETVLLVSFARSGNSPESVAAVNLINQLVPNSYHLTITCAKDGELAKKAQQDERS
FT                   YLYLMPEDANDAGFAMTGSFTCMMLAALLIFDDATDLSQKQSYVADMVFAGQAILDQEE
FT                   RLQELADLGFERLVYLGSAGLAKLTQEAQLKMLELTAGQVATLYESSMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLL
FT                   PDAYLAFPMILVAQTLALLTAVTLGNSPDTPSATGTVNRVVKGVTIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(562723..562983)
FT                   /locus_tag="M6_Spy0566"
FT   CDS_pept        complement(562723..562983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0566"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86701"
FT                   /db_xref="GOA:Q5XD12"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD12"
FT                   /protein_id="AAT86701.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(563098..564039)
FT                   /locus_tag="M6_Spy0567"
FT   CDS_pept        complement(563098..564039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0567"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86702"
FT                   /db_xref="GOA:Q5XD11"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD11"
FT                   /protein_id="AAT86702.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLAWISQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGQCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSASLEENQAIFRELIAVCQEI"
FT   gene            564433..564882
FT                   /locus_tag="M6_Spy0568"
FT   CDS_pept        564433..564882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0568"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86703"
FT                   /db_xref="GOA:Q5XD10"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD10"
FT                   /protein_id="AAT86703.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSEQFALTGAIKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            565058..565342
FT                   /locus_tag="M6_Spy0569"
FT   CDS_pept        565058..565342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0569"
FT                   /product="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86704"
FT                   /db_xref="GOA:Q5XD09"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD09"
FT                   /protein_id="AAT86704.1"
FT                   /translation="MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   ARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRQYQTQHLTGGDIND"
FT   gene            565323..566597
FT                   /locus_tag="M6_Spy0570"
FT   CDS_pept        565323..566597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0570"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86705"
FT                   /db_xref="GOA:Q5XD08"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD08"
FT                   /protein_id="AAT86705.1"
FT                   /translation="MVTLMIKSIATLPKPSLKEALGLIGLALPIGVAVGVIDVIFGKGL
FT                   LFLSEYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFEVGHGQKDQISPILI
FT                   PLILFSTWVTHLFGASAGREGVAVQIGATISHYCRRFVTSQEAARHLLIMGMAAGFAGL
FT                   FQTPIAAVVFALEVLLVGTLRYCALLPSLVAACVASWTSHSLGLEKFTIVLEETLTITP
FT                   LTLVKLIGLGLIFGLVGNSFAYLLGWFKPYLSQKLPNPYLRIAFIGVLLSICLMIGHVG
FT                   RYSGLGTHLLAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFAIGASLGIVLA
FT                   PYLGLPVLLVAALGYTTVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMVSHRH
FT                   SIYSYQKVVMINLKDMTVNQMDLKK"
FT   gene            566712..567059
FT                   /locus_tag="M6_Spy0571"
FT   CDS_pept        566712..567059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0571"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86706"
FT                   /db_xref="GOA:Q5XD07"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD07"
FT                   /protein_id="AAT86706.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            567306..567377
FT                   /locus_tag="M6_Spys1943"
FT   tRNA            567306..567377
FT                   /locus_tag="M6_Spys1943"
FT                   /product="tRNA-Arg"
FT   gene            568074..568643
FT                   /locus_tag="M6_Spy0572"
FT   CDS_pept        568074..568643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0572"
FT                   /product="DNA gyrase related protein"
FT                   /note="probably a hydrolase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86707"
FT                   /db_xref="GOA:Q5XD06"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD06"
FT                   /protein_id="AAT86707.1"
FT                   /translation="MKGMNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFSLPGDHDAVY
FT                   QKLKESTAIAVATFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILEKIATSGSRNFLI
FT                   SHRDCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDIDSGLVIGDRLI
FT                   DKQAGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            568644..570596
FT                   /locus_tag="M6_Spy0573"
FT   CDS_pept        568644..570596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0573"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86708"
FT                   /db_xref="GOA:Q5XD05"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD05"
FT                   /protein_id="AAT86708.1"
FT                   /translation="MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGL
FT                   HHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVF
FT                   TVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADL
FT                   EIIGTTDVTGTTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGME
FT                   QEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELEGIAVEVAMQYTTSYQETVMSFA
FT                   NNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPN
FT                   PQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRA
FT                   REVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIR
FT                   GKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIR
FT                   TLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSI
FT                   GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPR
FT                   RDFIEENAVYSTLDI"
FT   gene            570964..572688
FT                   /locus_tag="M6_Spy0574"
FT   CDS_pept        570964..572688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0574"
FT                   /product="Septation ring formation regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86709"
FT                   /db_xref="GOA:Q5XD04"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD04"
FT                   /protein_id="AAT86709.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLAHVKRNNEQLKNEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(572820..573278)
FT                   /locus_tag="M6_Spy0575"
FT   CDS_pept        complement(572820..573278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0575"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86710"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD03"
FT                   /protein_id="AAT86710.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDHAINLKETRLEVILKQTKNDQLSKQPPEKTKSFWKRFLKK"
FT   gene            573505..573639
FT                   /locus_tag="M6_Spy0576"
FT   CDS_pept        573505..573639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0576"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86711"
FT                   /db_xref="GOA:Q5XD02"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD02"
FT                   /protein_id="AAT86711.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSVSFNW"
FT   gene            573785..574813
FT                   /locus_tag="M6_Spy0577"
FT   CDS_pept        573785..574813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0577"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86712"
FT                   /db_xref="GOA:Q5XD01"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:3ZLF"
FT                   /db_xref="PDB:3ZLG"
FT                   /db_xref="PDB:3ZLH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XD01"
FT                   /protein_id="AAT86712.1"
FT                   /translation="MIALDGTPNKGKLGANAILGVSIAVARAAADYLEVPLYTYLGGFN
FT                   TKVLPTPMMNIINGGSHSDAPIAFQEFMIMPVGAPTFKEGLRWGAEVFHALKKILKERG
FT                   LVTAVGDEGGFAPKFEGTEDGVETILKAIEAAGYEAGENGIMIGFDCASSEFYDKERKV
FT                   YDYTKFEGEGAAVRTSAEQVDYLEELVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQ
FT                   LVGDDFFVTNTEYLARGIKENAANSILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRS
FT                   GETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNL
FT                   KK"
FT   gene            575583..575744
FT                   /locus_tag="M6_Spy0578"
FT   CDS_pept        575583..575744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0578"
FT                   /product="Streptolysin S precursor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86713"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XD00"
FT                   /protein_id="AAT86713.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            575966..576916
FT                   /locus_tag="M6_Spy0579"
FT   CDS_pept        575966..576916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0579"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /note="SagB"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86714"
FT                   /db_xref="GOA:Q5XCZ9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ9"
FT                   /protein_id="AAT86714.1"
FT                   /translation="MSFFTKEQQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPTKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYIKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            576913..577971
FT                   /locus_tag="M6_Spy0580"
FT   CDS_pept        576913..577971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0580"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /note="SagC"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86715"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ8"
FT                   /protein_id="AAT86715.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENTLEPETFANLMEVISGLYYNDMLMLEDDYNLEENIMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSDALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHTCTLNPPHSADFDSLERRVLARLQDSTLYQHFANQILPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            577991..579349
FT                   /locus_tag="M6_Spy0581"
FT   CDS_pept        577991..579349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0581"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /note="SagD"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86716"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ7"
FT                   /protein_id="AAT86716.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKPCPKIIVDDPDIEVILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            579324..579995
FT                   /locus_tag="M6_Spy0582"
FT   CDS_pept        579324..579995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0582"
FT                   /product="SagE"
FT                   /note="Streptolysin S putative self-immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86717"
FT                   /db_xref="GOA:Q5XCZ6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ6"
FT                   /protein_id="AAT86717.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSLESIDSKTFFMGLVFCVLIVLIELIFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEETIYRFLWFNILAFQWHLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYGSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            579992..580675
FT                   /locus_tag="M6_Spy0583"
FT   CDS_pept        579992..580675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0583"
FT                   /product="SagF"
FT                   /note="Streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86718"
FT                   /db_xref="GOA:Q5XCZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ5"
FT                   /protein_id="AAT86718.1"
FT                   /translation="MMLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLMALSYQDFLDVL
FT                   LSLFQFVVIILVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLIL
FT                   IFDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGIVILVDSLFYLGLLILLGEQSLTS
FT                   LATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILTVTYLMI
FT                   SCKEY"
FT   gene            580698..581621
FT                   /locus_tag="M6_Spy0584"
FT   CDS_pept        580698..581621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0584"
FT                   /product="SagG"
FT                   /note="Streptolysin S export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86719"
FT                   /db_xref="GOA:Q5XCZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ4"
FT                   /protein_id="AAT86719.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLTQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            581630..582757
FT                   /locus_tag="M6_Spy0585"
FT   CDS_pept        581630..582757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0585"
FT                   /product="SagH"
FT                   /note="Streptolysin S export transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86720"
FT                   /db_xref="GOA:Q5XCZ3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ3"
FT                   /protein_id="AAT86720.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLEAKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKVITNNINQQNADLINMLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVD
FT                   YVKVSSIQTSKGMTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIRLTGVSPS
FT                   LLVFGKLIGAMLATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLG
FT                   ISIKNEAFLTVASNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIF
FT                   GGQYNPIPVTLIVNISIGTIFIILALIGMRKQVTT"
FT   gene            582754..583872
FT                   /locus_tag="M6_Spy0586"
FT   CDS_pept        582754..583872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0586"
FT                   /product="SagI"
FT                   /note="Streptolysin S export transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86721"
FT                   /db_xref="GOA:Q5XCZ2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ2"
FT                   /protein_id="AAT86721.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   GVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGG
FT                   TLSQAWPYLLALMGTALALIIFSSLLLKPTRL"
FT   gene            complement(583984..584202)
FT                   /locus_tag="M6_Spy0587"
FT   CDS_pept        complement(583984..584202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0587"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86722"
FT                   /db_xref="GOA:Q5XCZ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ1"
FT                   /protein_id="AAT86722.1"
FT                   /translation="MLIVTKTFHKINTFLHLFLITLVFMFIENVFLKYFDNSFINKNEL
FT                   SREVAFDNMLSKKHSNNSNIAIAFNKR"
FT   gene            584444..587176
FT                   /locus_tag="M6_Spy0588"
FT   CDS_pept        584444..587176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0588"
FT                   /product="Endonuclease/Exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86723"
FT                   /db_xref="GOA:Q5XCZ0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCZ0"
FT                   /protein_id="AAT86723.1"
FT                   /translation="MINKKCIIPVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKTNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERTYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPQKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLVRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLEVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNMPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPTYRYVDIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNAAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGRVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKTGDSLVYVITLLGTASLLVPILLLTKGKKES"
FT   gene            587454..587954
FT                   /locus_tag="M6_Spy0589"
FT   CDS_pept        587454..587954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0589"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86724"
FT                   /db_xref="GOA:Q5XCY9"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCY9"
FT                   /protein_id="AAT86724.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNG
FT                   IFNKAFVYFSFFFATSMFTVAIELYFFGAPFLLTWFTTALGELVSLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            588148..590106
FT                   /locus_tag="M6_Spy0590"
FT   CDS_pept        588148..590106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0590"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86725"
FT                   /db_xref="GOA:Q5XCY8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY8"
FT                   /protein_id="AAT86725.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPHQLSEPLTITVRG
FT                   EAYMSRQSFKAINEARQENGETEFANPRNAAAGTLRQLDTSVVAKRQLATFLYQEASPT
FT                   ARNQQNEVLAELADLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKEDFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRKF"
FT   gene            590120..591142
FT                   /locus_tag="M6_Spy0591"
FT   CDS_pept        590120..591142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0591"
FT                   /product="Diacylglycerol kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86726"
FT                   /db_xref="GOA:Q5XCY7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCY7"
FT                   /protein_id="AAT86726.1"
FT                   /translation="MKKQLRARLIYNPTSGQELMRKSVPEVLDILEGFGYETSAFQTTA
FT                   QKNSALNEARRAAKAGFDLLIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARA
FT                   LKVPRGNPSQAAKLIGKNQTIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFG
FT                   YLAYLAKGVELLPRVSNVPVKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDG
FT                   MFTLILIKTANLFEIVHLLRLILDGGKHITDRRVEYIKTSKIVIEPQCGKRMMINLDGE
FT                   YGGDAPITLENLKNHITFFADTDLISDDALVLDQDELEIEEIAKKFAHEVEDLEQELEE
FT                   "
FT   gene            591534..591731
FT                   /locus_tag="M6_Spy0592"
FT   CDS_pept        591534..591731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0592"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86727"
FT                   /db_xref="GOA:Q5XCY6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCY6"
FT                   /protein_id="AAT86727.1"
FT                   /translation="MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMIL
FT                   GVAFIEGTFFVTLVMAFILK"
FT   gene            591766..592482
FT                   /locus_tag="M6_Spy0593"
FT   CDS_pept        591766..592482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0593"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86728"
FT                   /db_xref="GOA:Q5XCY5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY5"
FT                   /protein_id="AAT86728.1"
FT                   /translation="MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLK
FT                   PEGKQTALEYLISFVDGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNG
FT                   YNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTN
FT                   FLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFT
FT                   KLTATYLGKKVNESEE"
FT   gene            592500..592994
FT                   /locus_tag="M6_Spy0594"
FT   CDS_pept        592500..592994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0594"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86729"
FT                   /db_xref="GOA:Q5XCY4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY4"
FT                   /protein_id="AAT86729.1"
FT                   /translation="MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQI
FT                   SRDIDQAEQSRLSAQQLETKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAK
FT                   RLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE
FT                   A"
FT   gene            592994..593530
FT                   /locus_tag="M6_Spy0595"
FT   CDS_pept        592994..593530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0595"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86730"
FT                   /db_xref="GOA:Q5XCY3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY3"
FT                   /protein_id="AAT86730.1"
FT                   /translation="MTKKEQALIEQYAKSLVEVASEHHSLDALQADVLAILETFVTTNL
FT                   DQSLSSLAVPHAEKIKLLTLLKGNNSVYMNNFLNLILQNEREAYLYQMLQTVLNEIAIV
FT                   SNQYDVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVID
FT                   TSIRRQLQAFKMNLK"
FT   gene            593546..595054
FT                   /locus_tag="M6_Spy0596"
FT   CDS_pept        593546..595054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0596"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86731"
FT                   /db_xref="GOA:Q5XCY2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY2"
FT                   /protein_id="AAT86731.1"
FT                   /translation="MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLD
FT                   NAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALI
FT                   GRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTI
FT                   VVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDG
FT                   QIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFG
FT                   SDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEE
FT                   ALYDYFDVHYNDLFETIRTTKDLPEEAALDAAIKAFKEHSNFKS"
FT   gene            595070..595945
FT                   /locus_tag="M6_Spy0597"
FT   CDS_pept        595070..595945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0597"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86732"
FT                   /db_xref="GOA:Q5XCY1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY1"
FT                   /protein_id="AAT86732.1"
FT                   /translation="MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQI
FT                   YASKIRQITTDLLKSELTIGSDNPMLVSRPVKKTGYIVITSDKGLVGGYNSKILKSVMD
FT                   MITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQPSFEQVRQIISQSVDMFV
FT                   NEIFDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTGFELEPNRHDILDQL
FT                   LPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEIT
FT                   EIVAGANALE"
FT   gene            596107..597513
FT                   /locus_tag="M6_Spy0598"
FT   CDS_pept        596107..597513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0598"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86733"
FT                   /db_xref="GOA:Q5XCY0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCY0"
FT                   /protein_id="AAT86733.1"
FT                   /translation="MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVL
FT                   EVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEE
FT                   PFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTV
FT                   LIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGAR
FT                   MRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATE
FT                   MGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPA
FT                   VDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGR
FT                   ARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDHLPEDAFRSVGPIED
FT                   VIKKAEKMGF"
FT   gene            597526..597942
FT                   /locus_tag="M6_Spy0599"
FT   CDS_pept        597526..597942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0599"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86734"
FT                   /db_xref="GOA:Q5XCX9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCX9"
FT                   /protein_id="AAT86734.1"
FT                   /translation="MTQMTVQVVTPDGIKYDHHAKCISVTTPDGEMGILPNHINLIAPL
FT                   QVHEMKIRRGGEDEKVDWIAINGGIIEIKDNVVTVVADSAERDRDIDVSRAERAKLRAE
FT                   REIAQAETTHNIDEVRRAKVALRRALNRINVSKK"
FT   gene            598208..598465
FT                   /locus_tag="M6_Spy0600"
FT   CDS_pept        598208..598465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0600"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86735"
FT                   /db_xref="GOA:Q5XCX8"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX8"
FT                   /protein_id="AAT86735.1"
FT                   /translation="MVCYNNPMELLMKIIAFSCHLFFIGLSYQLLISVIDWTKFSHYHP
FT                   ENLGRLRLFVFLLATALGYLVSHCMLELIQISQMLFFEFR"
FT   gene            598530..599801
FT                   /locus_tag="M6_Spy0601"
FT   CDS_pept        598530..599801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0601"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86736"
FT                   /db_xref="GOA:Q5XCX7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCX7"
FT                   /protein_id="AAT86736.1"
FT                   /translation="MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRN
FT                   VPILSDVFTMNNVVRGLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGP
FT                   ILARNGHAKVSMPGGCTIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMD
FT                   FPSVGATQNLMMAATLADGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGV
FT                   THLRGVEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEE
FT                   YGIRVQANTPKLKPVTVKTLPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLE
FT                   EMRRMGLQSEILRETAMIHGGRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHL
FT                   DRGYYQFHEKLAKLGATISRSSEV"
FT   gene            599805..599993
FT                   /locus_tag="M6_Spy0602"
FT   CDS_pept        599805..599993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0602"
FT                   /product="EpuA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86737"
FT                   /db_xref="GOA:Q5XCX6"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX6"
FT                   /protein_id="AAT86737.1"
FT                   /translation="MTNGLKYVLEQMLLLLVIAALACLFLAIGLMIGYSFMGDGQSPWH
FT                   ILSMDKWAELVNKFTGK"
FT   gene            600029..600895
FT                   /locus_tag="M6_Spy0603"
FT   CDS_pept        600029..600895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0603"
FT                   /product="DNA-entry nuclease"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86738"
FT                   /db_xref="GOA:Q5XCX5"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX5"
FT                   /protein_id="AAT86738.1"
FT                   /translation="MLAKKKRKRVLNSFLLILLVLGSNCLAKSDFIASNHPIKQLYQTL
FT                   VGEKKKSLLTHNNLPADVPTEALAASVLTPSIKKQLGPDVQWNGAGAYIINRNKTDLNA
FT                   KVASLPYANNETKWVQEQKVPKRANALLTKSTRQYRNRYQTDNAYRNFKPAGWHRLHRL
FT                   KGSYDHAVDRGHLLGYALVGGLKGLDASTGNPDNIATQLSWANQANKPYSTGQNYYEGL
FT                   VCRALDKGHRVRYRVTLLYDGDNLLASGSHLEAKSSDDSLTFNVFVPNVQPGLTVDYRT
FT                   RQIAINL"
FT   gene            601100..602221
FT                   /locus_tag="M6_Spy0604"
FT   CDS_pept        601100..602221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0604"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86739"
FT                   /db_xref="GOA:Q5XCX4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCX4"
FT                   /protein_id="AAT86739.1"
FT                   /translation="MVPRVNAPLIKWRSGTLFSSLKEGKTMDLQAQLEELKTKTLETLQ
FT                   SLTGNHTKELQDLRVAVLGKKGSLTELLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEE
FT                   QAKIVEAAKIQAQLDAESIDVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFE
FT                   VEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDQHDFSKGPLKMV
FT                   SPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGEERSIRLRPS
FT                   YFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFA
FT                   FGLGQERIAMLRYGINDIRGFYQGDQRFSEQFN"
FT   gene            602416..604836
FT                   /locus_tag="M6_Spy0605"
FT   CDS_pept        602416..604836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0605"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86740"
FT                   /db_xref="GOA:Q5XCX3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCX3"
FT                   /protein_id="AAT86740.1"
FT                   /translation="MGTKIMLVSYKWLKELVDIDVTPAALAEKMSTTGIEVEGIEVPAE
FT                   GLSKLVVGHVLSCEDVPETHLHLCQVDTGDETPRQIVCGAPNVKAGIKVIVAVPGARIA
FT                   DNYKIKKGKIRGMESLGMICSLQELGLSDSIIPKEFSDGIQILPEEAVPGDAIFKYLDL
FT                   DDHIIELSITPNRADALSMRGVAHEVAAIYGKSVSFPQKNLQESDKATSEAIEVAIASD
FT                   KVLTYASRVVENVKVKPSPQWLQNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDYDK
FT                   FEDHKIVARAARQGESLVTLDGEKRDLTTEDLVITVADKPVALAGVMGGQATEIDGNSQ
FT                   TVVLEAAVFDGKSIRKTSGRLNLRSESSSRFEKGVNYATVLEALDFAAAMLQELAEGQV
FT                   LSGHVQAGQLPTEPVEVSTSLDYVNVRLGTELTFADIQRIFNQLGFGLTGDETRFTVAV
FT                   PRRRWDISIPADLVEEIARIYGYDKLPTTLPEAGGTAAELTPTQALRRKVRGLAEGLGL
FT                   TEIISYALTTPEKAIEFAVAPSHLTELMWPMSVERSALRQNMVSGMLDTVAYNVARKQS
FT                   NLALYEIGKIFEQEVNPKEDLPNEVNHFAFAICGLVAQKDFQTQAQAVDFYHAKGILDT
FT                   LFANLNLKVQYVPTKDLANMHPGRTALILLDEQVIGFVGQVHPGTAKAYSIPETYVAEL
FT                   DMAALEAALPSDQTFVEITKFPAMTRDVALLLDREVSHQTIVTAIESAGVKRLTKIKLF
FT                   DVYEGATIQAGQKSMAYSLTFQNPNDNLTDEEVAKYMEKITKSLTEQVGAEVR"
FT   gene            604912..605325
FT                   /locus_tag="M6_Spy0606"
FT   CDS_pept        604912..605325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0606"
FT                   /product="Salt-stress induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86741"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX2"
FT                   /protein_id="AAT86741.1"
FT                   /translation="MEKNIRRWRKIRMYQTKITGNRLYHTVSKGYGDSVTLFGKTDQGE
FT                   TPMSLLVIALSSCVTMCVQGFYHRQFQQDTLAVSAEASYEEEVFELLVRIDDVLDDKKK
FT                   ADLLAYIGAYCRVKQLLKPEVTVTITLEGLSHV"
FT   gene            605318..605704
FT                   /locus_tag="M6_Spy0607"
FT   CDS_pept        605318..605704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0607"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86742"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR016996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX1"
FT                   /protein_id="AAT86742.1"
FT                   /translation="MSDASLKTYQKQWAYQKYWVMAHSQQHYNALRELFKGNQWSEEKV
FT                   LTFHCLIEEAQAIPPTVKSLRTAYQHVWGYFKKVASQEEKDHFKDLDAQLETKSEEMLC
FT                   FLQEMTAHYQPSYLLSCRLITKGP"
FT   gene            605777..606853
FT                   /locus_tag="M6_Spy0608"
FT   CDS_pept        605777..606853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0608"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86743"
FT                   /db_xref="GOA:Q5XCX0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCX0"
FT                   /protein_id="AAT86743.1"
FT                   /translation="MFLALNEMKQSKLRYGLIAGLLCLVAYLMFFLSGLAFGLMQENRS
FT                   AVDLWKADSVLLAKDADATLTLSQVSRAQENQITADKVAPLAQLNTVAWSVKNPKDADK
FT                   VKVSLFGIDSNSFIRPNIVKGRLFKTNKEVVLDQSLAKEEAFAIGKDFYTSSSSQALTI
FT                   VGYTQNARFSVAPVVYMNLEAFETLKYGEPLPKDKQVVNAFITKGSLIDYPKKDFQKLD
FT                   IKTFITKLPGYSAQLLTFGFMISFLVIISAIIIGIFMYILTIQKAPIFGIMKAQGISNK
FT                   TITTAVLMQTFFLSFLGSGLGLLGTWLTSLLLPTVVPFQSNWFLYLAIFVSMICFALLG
FT                   TLFSVFNIIRIDPLKAIG"
FT   gene            606860..607531
FT                   /locus_tag="M6_Spy0609"
FT   CDS_pept        606860..607531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0609"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86744"
FT                   /db_xref="GOA:Q5XCW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW9"
FT                   /protein_id="AAT86744.1"
FT                   /translation="MMSVLTFKQVIKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGS
FT                   GKSTFLTIAGGLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQ
FT                   QQLELVDHLTGSKEKAKANQLFDDLGITGLKHQLPQELSGGERQRAAIARALYHDPALI
FT                   LADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLEYCDKVYRMQDGELRQE
FT                   R"
FT   gene            complement(607636..608553)
FT                   /locus_tag="M6_Spy0610"
FT   CDS_pept        complement(607636..608553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0610"
FT                   /product="Neutral zinc metallopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86745"
FT                   /db_xref="GOA:Q5XCW8"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW8"
FT                   /protein_id="AAT86745.1"
FT                   /translation="MKTDDLRESQQVEDRRGQSSGSFGGGGLGGGLLLQLLFSRGGWKT
FT                   KLVILLLLLVMGGGGLSGVLGGKPSSTNNNAYQSSQVTRTNGDKASQEQVSFVSKVFAS
FT                   TEDYWTKTFREKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQKVYLDISFYNE
FT                   LSTKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASARQGKSKAKANQLNVKLELQAD
FT                   YYAGAWANYVQGQGLLEKGDIEEAMAAAHAVGDDTLQEETYGRTVPDSFTHGTSKQRQR
FT                   WFDRGYQYGDFEHGDTFSIPYSKL"
FT   gene            608704..611919
FT                   /locus_tag="M6_Spy0611"
FT   CDS_pept        608704..611919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0611"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86746"
FT                   /db_xref="GOA:Q5XCW7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCW7"
FT                   /protein_id="AAT86746.1"
FT                   /translation="MKLIYTEMSYSMTEILVNEARKAADQGYRVFYIAPNSLSFEKERE
FT                   VLTLLPERGTFSIIVTRFVQMSRYFTVESSPSKQHLDDTTLAMIFYRALMQLKPEDLPS
FT                   YGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDHPQKQEDLIKIIELAETIMIQQDY
FT                   NQDSPLQSFARAIKLGLLNNQLSKTVVVIDGFSRFSAEEDYLLSLLNNNCQEVITGSYV
FT                   SQKAYQKSFIKGNIYEASLHFLQDLAQKYHIKPVFATSNQVFKPAFSRLTQLFEATHDF
FT                   SQVDWQLQKNDLDHFSLWQCHHQKEEIEHVAKSIRQKLYEGYRYKDILVLLGDMDAYQL
FT                   QIGPIFDKFEIPYYLGKAEPMAAHPLVQFIESLERSQRYNWRREDILNMLKSGLFGCFD
FT                   DSDIDRFEEYTQFADIKGFTKFSKPFTINSSRQYPLDFLNEMRQDIVLPLQELFKSQKQ
FT                   LGASLVDKLILFLKKIRLAENMQGLAQSQLEVEKNEEVWKRFTDILTSFHHIFGQEKLR
FT                   LSDCLALIKTGMKSAQYRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHH
FT                   SGLLSDQERARINEIRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF
FT                   DDLSPYLKELINFGLPLLDKGKNYLSYDNSDIGNYKALLSQIIAINRQDLIEMSDQDKM
FT                   FWTVVLRYLRKQLRKQQLELPTSDYRLSTKSLSKEVIEVCFPKGIPLKLSATALTVFYN
FT                   NQYNYFLKYVLNLNKTESIHPDSRIHGQYLHRVFERLMKDHTQEPFDNKLKQAIYHTNQ
FT                   ESFFQQVYQDNAEAEYSLAILEDIVRSTAPILQLNQNIKVIDQEKNFHLDMGNEILVHG
FT                   IIDRIDQLSDGSLGVVDYKSSANQFDIGTFYNGLSPQLVTYLAALKQIAPHDINQLFGA
FT                   MYLHLQDPKLDLVTFKQIDNTLVESIYKALTYKGIFSEVEKEHLSTGAYQTKNALYSND
FT                   ELETLLNYNKYLYLKAVKHIKKGHFLINPYTSDGKTVQGDQLKAITRFEADLDMAQARR
FT                   LVTLPAKEKKECFLTLMRKESHL"
FT   gene            611880..615548
FT                   /locus_tag="M6_Spy0612"
FT   CDS_pept        611880..615548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0612"
FT                   /product="ATP-dependent nuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86747"
FT                   /db_xref="GOA:Q5XCW6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCW6"
FT                   /protein_id="AAT86747.1"
FT                   /translation="MLFNINEKGEPLVISFAPFLSPEAIKYLQENERCSDQSQKRTAQQ
FT                   IEAIYTSGQNILVSASAGSGKTFVMVERILDKILRGVSIDRLFISTFTVKAATELRERI
FT                   ENKLYSQIAQTTDFQMKVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRIM
FT                   QDKAEQDVLKQEVFSKLFSEFMNQKEAPVFRALVKNFSGNCKDTSAFRELVYTCYSFSQ
FT                   STENPKIWLQENFLSAAKTYQRLEDIPDHDIELLLLAMQDTANQLRDVTDMEDYGQLTK
FT                   AGSRSAKYTKHLTIIEKLSDWVRDFKCLYGKAGLDRLIRDVTGLIPSGNDVTVSKVKYP
FT                   VFKTLHQKLKQFRHLETILMYQKDCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIA
FT                   HFAIKILEENTDIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNGHNRFMVGDIKQSI
FT                   YRFRQADPQIFNQKFRDYQKKPEQGKVILLKENFRSQSEVLNVSNAVFSHLMDESVGDV
FT                   LYDEQHQLIAGSHAQTVPYLDRRAQLLLYNSDKDDGNAPSDSEGISFSEVTIVAKEIIK
FT                   LHNDKGVPFEDITLLVSSRTRNDIISHTFNQYGIPIVTDGGQQNYLKSVEVMVMLDTLR
FT                   TINNPRNDYALVALLRSPMFAFDEDDLARIALQKDNELDKDCLYDKIQRAVIGRGAHPE
FT                   LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYFDFVASQAKAEQAQANL
FT                   YALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAAPKQAVNLMTIHKSKGLQ
FT                   FPYVFILNCDKRFSMTDIHKSFILNRQHGIGIKYLADIKGLLGETTLNSVKVSMETLPY
FT                   QLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSKSQEITDPKKLGKLLPLALR
FT                   EQLLTFQDWLLAIADIFSTEDLYFDVRFIEDSDLTQESVGRLQTPQLLNPDDLKDNRQS
FT                   ETIARALDMLEAVSQLNANYEAAIHLPTVRTPSQLKATYEPLLEPIGVDIIEKSSRSLS
FT                   DFTLPHFSKKAKVEASHIGSALHQLMQVLPLSKPINQQTLLDALRGIDSNEEVKTALDL
FT                   KKIESFFCDTSLGQFFQTYQKHLYREAPFAILKLDPISQEEYVLRGIIDAYFLFDDHIV
FT                   LVDYKTDKYKQPIELKKRYQQQLELYAEALTQTYKLPVTKRYLVLMGGGKPEIVEV"
FT   gene            615664..616500
FT                   /locus_tag="M6_Spy0613"
FT   CDS_pept        615664..616500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0613"
FT                   /product="Arginine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86748"
FT                   /db_xref="GOA:Q5XCW5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW5"
FT                   /protein_id="AAT86748.1"
FT                   /translation="MTKRNKYTMNFKKIRFGFLLCLLLYPLAACNKSEQLNHYERIKKT
FT                   RKLVVAVSPDYAPFEFKALVNGKDTIVGADVQLAQAIADELDVDLELSPMSFDNVLSSL
FT                   QTGKADLAISGISHTKERAKVYDFSIPYYQAENAIVMRASDAKVTKNISDLSGKKVAAQ
FT                   KGSIEEGLVKIQLPKANLISLTAMGEAINELKAGQVYAVTLETPVAAGFLAQHKDLALA
FT                   PFSLKTSDGDAKAVALPKNSGDLTKAVNKVIAKLDEQERYKSFIAETIALTKNTMK"
FT   gene            616605..616817
FT                   /locus_tag="M6_Spy0614"
FT   CDS_pept        616605..616817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0614"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86749"
FT                   /db_xref="GOA:Q5XCW4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCW4"
FT                   /protein_id="AAT86749.1"
FT                   /translation="MKMLQYLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESR
FT                   KREFYEKPSVKRKRKSEAARKRKKF"
FT   gene            complement(616944..617306)
FT                   /locus_tag="M6_Spy0615"
FT   CDS_pept        complement(616944..617306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0615"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86750"
FT                   /db_xref="GOA:Q5XCW3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW3"
FT                   /protein_id="AAT86750.1"
FT                   /translation="MVKELKAFLFRGNIIELAVAVIIGGAFGAIVTSFVNDIITPLILN
FT                   PALKAANVENITQLSWNGVKYGSFLGAVINFLIIGTSLFFVVKAAEKAMPKKEKEAAAP
FT                   TQEELLTEIRDLLAQK"
FT   gene            617436..619250
FT                   /locus_tag="M6_Spy0616"
FT   CDS_pept        617436..619250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0616"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86751"
FT                   /db_xref="GOA:Q5XCW2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW2"
FT                   /protein_id="AAT86751.1"
FT                   /translation="MGFLWGGDDLAIDKEMISQVKNSVNIVDVIGEVVKLSRSGRHYLG
FT                   LCPFHKEKTPSFNVVEDRQFFHCFGCGKSGDVFKFIEEYRQVPFLESVQIIADKTGMSL
FT                   NISPSQAVIASQHKHPNHALMTLHEDAAKFYHAVLMTTTIGQEARKYLYQRGLDDQLIE
FT                   HFNIGLAPDESDYLYQALSKKYEEGQLVASGLFNLSDQSNTIYDAFRNRIMFPLSDDRG
FT                   HIIAFSGRIWTAADTEKRQAKYKNSRGTVLFNKSYELYHLDKARPVIAKTHEVFLMEGF
FT                   MDVIAAYRSGYENAVASMGTALTQEHVNHLKQVTKKVVLIYDGDDAGQHAIAKSLELLK
FT                   DFVVEIVRIPNKMDPDEFVQRHSPEAFADLLKQSRISNVEFFIDYLKPTNVDNLQSQIV
FT                   YVEKMAPLIAQSPSITAQHSYINKIADLLPNFDYFQVEQSVNALRIQDRQKRQGQIAQA
FT                   VSNLVTLPMPKSLTAIAKTESHLMHRLLHHDYLLNEFRHRDDFYFDTSTLELLYQRLKQ
FT                   QGHITSYDLSEMSEEVNRAYYNVLEENLPKEVALGEIDDILSKRAKLLAERDLHKQGKK
FT                   VRESSNKGDHQAALEVLEHFIAQKRKME"
FT   gene            619259..620368
FT                   /locus_tag="M6_Spy0617"
FT   CDS_pept        619259..620368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0617"
FT                   /product="RNA polymerase sigma factor rpoD"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86752"
FT                   /db_xref="GOA:Q5XCW1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW1"
FT                   /protein_id="AAT86752.1"
FT                   /translation="MTKQKEITTFNVQVAEFIRHHKKEGTAIDDDVTEKLVIPFALDAD
FT                   QIDDLLERLTDGGISITDKEGNPSSKYIVEEPKPEELTDEELIGSNSAKVNDPVRMYLK
FT                   EIGVVPLLTSEEEKELAVAVAKGDLMAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQE
FT                   GNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVRE
FT                   QRNLLQELGQDPTPEQIAERMEMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIED
FT                   EVIENPVDYTTRVVLREQLDEVLDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTR
FT                   ERIRQIEAKALRKLRHPSRSKQLRDFIED"
FT   gene            620605..620943
FT                   /locus_tag="M6_Spy0618"
FT   CDS_pept        620605..620943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0618"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86753"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCW0"
FT                   /protein_id="AAT86753.1"
FT                   /translation="MSDTPKYTQDQVIAIKNRILEALETVIDPELGIDVVNLGLIYEIR
FT                   FNDNGYTEIDMTLTTMGCPLADLLTDYIHDALQDVPEVTKTEVKLVWYPAWTVDKMSRY
FT                   ARIALGIR"
FT   gene            621081..621935
FT                   /locus_tag="M6_Spy0619"
FT   CDS_pept        621081..621935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0619"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86754"
FT                   /db_xref="GOA:Q5XCV9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV9"
FT                   /protein_id="AAT86754.1"
FT                   /translation="MILITGSNGQLGTELRYLLDERGVDYVAVDVAEMDITNEDKVEAV
FT                   FAQVKPTLVYHCAAYTAVDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYV
FT                   FDGNKPVGQEWVETDRPDPKTEYGRTKRLGELAVERYAEHFYIIRTAWVFGNYGKNFVF
FT                   TMEQLAENHSRLTVVNDQHGRPTWTRTLAEFMCYLTENQKAFGYYHLSNDAKEDTTWYD
FT                   FAKEILKDKAVEVVPVDSSAFPAKAKRPLNSTMNLDKAKATGFVIPTWQEALKAFYQQG
FT                   LKK"
FT   gene            622054..623208
FT                   /locus_tag="M6_Spy0620"
FT   CDS_pept        622054..623208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0620"
FT                   /product="alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86755"
FT                   /db_xref="GOA:Q5XCV8"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV8"
FT                   /protein_id="AAT86755.1"
FT                   /translation="MQDVFIIGSRGLPAKYGGFETFVEELISHQSSKNIRYHVACLSDT
FT                   KHKVHFDYKGADCFYLNPPKLGPARVIAYDMMAITYALSYSDQHQIQNPIFYVLGNTVG
FT                   AFIAPFVKQIHNRGGRFFINPDGLEWKRSKWSRPVQAYLKFSEKQMTRQADLVISDNIG
FT                   IDRYLKQVYPWSKTCFIAYGTQTQPSRLTTADSKVRTYFQTFDISEKDYYLILGRFVPE
FT                   NNYETAIKEFMASSTKRDLVIICNHEGNAYFKQLLAETECDKDPRIKFVGTLYDKELLA
FT                   YIREQAYAYIHGHEVGGTNPGLLEALAHTNLNLVLGVDFNQSVAKSAALYWTKQKGQLV
FT                   ELINQVDAGFDSDHLGKEAKAIIQEHYTWEKIVGEYEALFLNEH"
FT   gene            623198..624130
FT                   /locus_tag="M6_Spy0621"
FT   CDS_pept        623198..624130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0621"
FT                   /product="alpha-L-Rha alpha-1,3-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86756"
FT                   /db_xref="GOA:Q5XCV7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV7"
FT                   /protein_id="AAT86756.1"
FT                   /translation="MNINILLSTYNGERFLAEQIQSIQRQTVNDWTLLIRDDGSTDGTQ
FT                   DIIRTFVKEDKRIQWINEGQTENLGVIKNFYTLLRHQKADVYFFSDQDDIWLDNKLEVT
FT                   LLEAQKHEMTAPLLVYTDLKVVTQHLAICHDSMIKTQSGHANTSLLQELTENTVTGGTM
FT                   MITHALAEEWTTCDGLLMHDWYLALLASATGKLVYLDIPTELYRQHDANVLGARTWSKR
FT                   MKNWLTPHHLVNKYWWLITSSQKQAQLLLDLPLKPNDHELVTAYVSLLDMPFTKRLATL
FT                   KRYGFRKNRIFHTFIFRSLVVTLFGYRRK"
FT   gene            624175..624936
FT                   /locus_tag="M6_Spy0622"
FT   CDS_pept        624175..624936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0622"
FT                   /product="Polysaccharide export ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86757"
FT                   /db_xref="GOA:Q5XCV6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV6"
FT                   /protein_id="AAT86757.1"
FT                   /translation="MVKTDFKLRYQGSAIGYLWSILKPLMMFTIMYLVFIRFLRLGGNV
FT                   PHFPVALLLANVIWSFFSEATSMGMVSIVSRGDLLRKLNFSKHIIVFSAVLGALINFLI
FT                   NLVVVLIFALINGVTISGYSYLSLFLFIELVVLVLGIALLLSNVFVYYRDLAQVWEVLL
FT                   QAGMYATPIIYPITFVLDSHPLAAKLLMLNPVAQMIQDFRYLLIDRANVTIWQMSTNWF
FT                   YIVIPYLVPFVILFIGIFVFKKNADRFAEII"
FT   gene            624936..626141
FT                   /locus_tag="M6_Spy0623"
FT   CDS_pept        624936..626141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0623"
FT                   /product="Polysaccharide export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86758"
FT                   /db_xref="GOA:Q5XCV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV5"
FT                   /protein_id="AAT86758.1"
FT                   /translation="MINREIAVKVQHVSKTFKLPTEATKSFRTTLVNRLRGIKGFTEQH
FT                   VLKDINFDVYKGDFFGIVGRNGSGKSTLLKIISQIYIPEKGQVTVDGKMVSFIELGVGF
FT                   NPELTGRENVYMNGAMLGFTKDEVDDMYNDIVDFAELHHFMNQKLKNYSSGMQVRLAFS
FT                   VAIKAQGDVLILDEVLAVGDEAFQRKCNDYFMERKDSGKTTILVTHDMGAVKKYCNRAV
FT                   LIEDGLVKAYGEPFDVANQYSVDNTETAEDAMNAEKISVSDIAKDLKVSLISNPRITPN
FT                   DTITFEVSYEVLKDDFTYIAFSLTDIDRNIWVYNDNSLDYPTQGIGRKCISYQCQLSQL
FT                   NDIKLKLEVTVRDKNGQMLLFSTAEQSPQIVIQRNDIDQDDLSALDSASGLYQRNGKWV
FT                   FH"
FT   gene            626166..627173
FT                   /locus_tag="M6_Spy0624"
FT   CDS_pept        626166..627173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0624"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86759"
FT                   /db_xref="GOA:Q5XCV4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV4"
FT                   /protein_id="AAT86759.1"
FT                   /translation="MYKVSIICTNYNKAPWISDALDSFLSQVTDFEVEIIVIDDASTDD
FT                   SREILKSYQKKSSGKIKLLFNETNIGITKTWIKACLYAKGKYIARCDGDDYWTDSFKLQ
FT                   KQVDVLEASKRSRWCNTDFDFVNSQGDLLYANAFSSGHTPLTDTYEKVLALKGMTMAST
FT                   WLVDADLMRQVNQKINVDTPDDTFDIQLELFQLTQLTYIKDSTTVYRMTTDSDSRPTDT
FT                   PKMIHRIQKLLDTQLNYLKKYNQVDTKEVSKLLLQQDAKQEIRIHELSCFIQELQQTIV
FT                   DKTKQQETREVELQNVIEEQKNQLSELRQQYHAIINSRQWKYTSKLIAFIRRKK"
FT   gene            627170..628915
FT                   /locus_tag="M6_Spy0625"
FT   CDS_pept        627170..628915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0625"
FT                   /product="alpha-L-Rha alpha-1,2-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="alpha-L-Rha alpha-1,3-L-rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86760"
FT                   /db_xref="GOA:Q5XCV3"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV3"
FT                   /protein_id="AAT86760.1"
FT                   /translation="MNRILLYVHFNKYNKISAHVYYQLEQMRSLFSKIVFISNSKVSHE
FT                   DLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLITMGFDKLEEFDSLTIMNDTCFGPIWEM
FT                   APYFENFEEKEAVDFWGITNNRGTKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYE
FT                   NVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSFMPHPDFSYYNPTAILKHHVPFI
FT                   KVKAIDANQHIAPYLLNLIRETINYPIDLIVSHMSQISLPDAKYLLSQKYLNCQRLAKQ
FT                   TCQKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADI
FT                   RVTGNRGRDIYPMLLLKDKLSQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKPADS
FT                   ILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDT
FT                   FVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLVYIAWGNSYDFR
FT                   IVKNPYELTPFIDNKLLNLREDEGAHTYVNFNQMGGIKGALKYIIVGPAKAMKYIFLRL
FT                   MEKLK"
FT   gene            628912..631386
FT                   /locus_tag="M6_Spy0626"
FT   CDS_pept        628912..631386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0626"
FT                   /product="Phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86761"
FT                   /db_xref="GOA:Q5XCV2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV2"
FT                   /protein_id="AAT86761.1"
FT                   /translation="MIKDTFLKTNWLNIRHHIILLVFSFYFSFYSLAKELVSSTAQPVN
FT                   YYTHLLNVSFVGYIISLIGLSYYLSRQVSRQLFLKTSFIVISYLIVSYWVQITQHLNDK
FT                   RFDIWSLTKNQFYQFQALPSLLIILVMATLIKILVAYFAIEKDRFGLLGYQGNTFSVAL
FT                   ILAVVPINDIHLLKLISSRFSELVTAGNSQIALLKISGLLIVLLVIFATIIYVVLNALK
FT                   HLKSNKSSFSVAATTSLFLALVFNYTFQYGVKGDEALLGYYVFPGATLFQIVAITLVAL
FT                   LAYVITNRYWPTTFFLLILGTIISVVNDLKESMRSEPLLVTDFVWLQELGLVTSFVKKS
FT                   VIVEMVVGLAICIVVAWYLHGRVLAGKLFMSPVKRASAVLGLFIVSCSMLIPFSYEKEG
FT                   KILSGLPIISALNNDNDINWLGFSTNARYKSLAYVWTRQVTKKIMEKPTNYSQETIASI
FT                   AQKYQKLAEDINKDRKNNIADQTVIYLLSESLSDPDRVSNVTVSHDVLPNIKAIKNSTT
FT                   AGLMQSDSYGGGTANMEFQTLTSVPFYNFSSSVSVLYSEVFPKMAKPHTISEFYQGKNR
FT                   IAMHPASANNFNRKTVYSNLGFSKFLALSGSKDKFKNIENVGLLTSDKTVYNNILSLIN
FT                   PSESQFFSVITMQNHIPWSSDYPEEIVAEGKNFTEEENHNLTSYARLLSFTDKETRAFL
FT                   EKLTQINKPITVVFYGDHLPGLYPDSAFNKHIENKYLTDYFIWSNGTNEKKNHPLINSS
FT                   DFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEVKAIQNDLKNIQYDVTIGKGY
FT                   LLKHKTFFKISR"
FT   gene            631565..632260
FT                   /locus_tag="M6_Spy0627"
FT   CDS_pept        631565..632260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0627"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86762"
FT                   /db_xref="GOA:Q5XCV1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV1"
FT                   /protein_id="AAT86762.1"
FT                   /translation="MKKLIIIPAYNESSNIVNTIRTIESDAPDFDYIIIDDCSTDNTLA
FT                   ICQKQGFNVISLPINLGIGGAVQTGYRYAQRCGYDVAVQVDGDGQHNPCYLEKMVEVLV
FT                   QSSVNMVIGSRFITKEGFQSSFARRIGIKYFTWLIALLTGKKITDATSGLRLIDRSLIE
FT                   RFANHYPDDYPEPETVVDVLVSHFKVKEIPVVMNERQGGVSSISLTKSVYYMIKVTLAI
FT                   LVVRLKGNR"
FT   gene            632262..632603
FT                   /locus_tag="M6_Spy0628"
FT   CDS_pept        632262..632603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0628"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86763"
FT                   /db_xref="GOA:Q5XCV0"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCV0"
FT                   /protein_id="AAT86763.1"
FT                   /translation="MTVTASLFISFIVLTFVFFLINLIKKDKLAIKYSLLWFILALLIL
FT                   LFTWLPNILNKMSHFLGIHSPTNMLFFLGFCLSLAIIFSLTNNISLQNDKVKRLTQEVA
FT                   LMKKEKTND"
FT   gene            632596..633882
FT                   /locus_tag="M6_Spy0629"
FT   CDS_pept        632596..633882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0629"
FT                   /product="AmrA"
FT                   /note="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86764"
FT                   /db_xref="GOA:Q5XCU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCU9"
FT                   /protein_id="AAT86764.1"
FT                   /translation="MINPSKQNQTIFLWNMLGSLSTAVISVILLMVVTRLLTSADSDIY
FT                   AFAYSFANMMVVVGLFQVRNYQATDINEKYSFSQYLVARLMTCLLMLAITVIYLTLTKT
FT                   DSYKSTIVFLVCFYRSTDAFSDLYQGMFQQHERLDIAGKSLAYRNTLIFMVYTAIILYS
FT                   KNLTLALVAVCIVSLVFIMYYDIGHSKKFQKLMFSELLSNISFQNSLKLLKESFPLFLN
FT                   GFLIIYIYTQPKYAIELMTTLGEVALGSQTIFNILFMPAFVMNLLILFFRPHITQMAIA
FT                   LIRGQIKEFNKIQVQLFAYLGVFSLIVLVGSGLFGIPFLSILYGTNLTDYWVDFMLIML
FT                   GGSIGSFATVIDNILTAMRKQQLLLIPYTGGFLISLLITNLFVMKYHILGAALSFLITM
FT                   LVWLGLSIMIYLFIMNRFKKGRVNATIYD"
FT   gene            633863..635359
FT                   /locus_tag="M6_Spy0630"
FT   CDS_pept        633863..635359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0630"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86765"
FT                   /db_xref="GOA:Q5XCU8"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCU8"
FT                   /protein_id="AAT86765.1"
FT                   /translation="MQQSMTKVKYLWKENNNYIYSTFLTLFLTVILYANSLNLPLKFIS
FT                   LLFVVSTLLIVFLPKKLEVATIIFILAFGTISAIISPINDIPDEYVHYSRTVYISEGDI
FT                   NLTNNNKKLRISKDVDKLIKQSGKTFITSNLKATKHSTREYSYPYIKGTNAYYSFSYIP
FT                   QALGILVGNALDLPILLTYYFGRLCNLISYAMLAFIAIKLSGSFKQVIAVVTLLPMNIY
FT                   LAASFNQDGFAIGLVLVTIGLFINLLSSKDKSNYNTKFFLYLVLCGLLVLSKFTYFLLV
FT                   CLPLFIPNEKFGKNTKLVILKKLGGLLLIFLFAAMWFRLYGQVKTPYVADFLKEVNVSQ
FT                   QVKNMLESPIVYSSIIIRHMVINLINMNNIFQFGALSYGITNLFPLYVCFFFFVYISNA
FT                   SKITINIVEKMGIIFVISAIIGATVLAMYLTWTPVGSSTVLGVQSRYLIGIIPLVLLLF
FT                   SSQQQKFKQIEDILSDKLAIHVSLLFILAMLMSTIFRYYH"
FT   gene            635441..636676
FT                   /locus_tag="M6_Spy0631"
FT   CDS_pept        635441..636676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0631"
FT                   /product="Peptidase T"
FT                   /EC_number="3.4.11.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86766"
FT                   /db_xref="GOA:Q5XCU7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCU7"
FT                   /protein_id="AAT86766.1"
FT                   /translation="MRWPMKYDNLLDRFIKYVKVNTRSDPDSETTPSTESQEAFALTIL
FT                   KPEMEAIGLQDVHYNPVNGYLIGTLPANNPTLTRKIGFIAHMDTADFNAENVNPQIIDN
FT                   YQGEDITLGSSNYKLDPKAFPNLNNYIGQTLITTDGTTLLGADDKSGIAEIMTAIEFLT
FT                   SQPQIEHCDIKVAFGPDEEIGVGADKFEVADFEVDFAYTMDGGPLGELQYETFSAAALE
FT                   VTFLGRNVHPGTAKDQMINALQLAIDFHEKLPAKERPEYTDGYQGFYHLTGLTGTVEEA
FT                   RASYIIRDFEEASFEARKVKVENIAQSMNAQLGTKRVLVELNDQYYNMKKVIEKDMTAI
FT                   ELAKEVMEELTIKPVIEPIRGGTDGSKISFMGIPTPNIFAGGENMHGRFEFVSLQTMER
FT                   AVDVIIGLVCKA"
FT   gene            636717..637205
FT                   /locus_tag="M6_Spy0632"
FT   CDS_pept        636717..637205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0632"
FT                   /product="Pore forming protein ebsA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86767"
FT                   /db_xref="GOA:Q5XCU6"
FT                   /db_xref="InterPro:IPR020215"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCU6"
FT                   /protein_id="AAT86767.1"
FT                   /translation="MIKLFGKIRYHWQPELSWSIIYWSIAFAPIFVGLSLLYERTEIPS
FT                   RVFILFAIFAVLVGIGLHRYFIIENNGILRIVSFKLFGPRKLLISTITKIEVTKSTLCL
FT                   HVEDKSYLFYMRKWPKKYFLDALAVNPYFQGEVILSDNFIKLDYFEVYQHDKKALTRG"
FT   gene            complement(637192..637389)
FT                   /locus_tag="M6_Spy0633"
FT   CDS_pept        complement(637192..637389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0633"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86768"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCU5"
FT                   /protein_id="AAT86768.1"
FT                   /translation="MKVSIIPEKCIACGLCQTYSSLFDYHDNGIVTFSSSSETSQSICP
FT                   SDKDAILAVKSCPTKALTLE"
FT   gene            637438..637914
FT                   /locus_tag="M6_Spy0634"
FT   CDS_pept        637438..637914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0634"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86769"
FT                   /db_xref="GOA:Q5XCU4"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCU4"
FT                   /protein_id="AAT86769.1"
FT                   /translation="MAKEPWEEKIVDDTIGTRTRKSRNAFISTPWLTALLSVFFVIIVA
FT                   ILFIFFYTSNSGSNRQAETNGFYGASTHKKTRKASNAKKTSSSSTTTDTTPSSEETLAS
FT                   SEGTGETLTVLAGEGAASIAARAGISVEQLQALNPEHMTQGYWYANPGDQVTIK"
FT   gene            637929..638609
FT                   /locus_tag="M6_Spy0635"
FT   CDS_pept        637929..638609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0635"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86770"
FT                   /db_xref="GOA:Q5XCU3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCU3"
FT                   /protein_id="AAT86770.1"
FT                   /translation="MKAIKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIA
FT                   LTHGYTDKEVALILEELEKNPISFKKAKDGSQLVFLGDEDVTLVIRQNDVTNNVSWVSA
FT                   LPEIREELVHQQRRIAQAGGIIMDGRDIGTVVLPDAELKIFLVASVEERAERRYKENLE
FT                   KGIESDFETLKEEIAARDYKDSHRKVSPLKAAEDALIFDTTGVSIDGVVQFIQEKAEKI
FT                   VDMS"
FT   gene            638771..639301
FT                   /locus_tag="M6_Spy0636"
FT   CDS_pept        638771..639301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0636"
FT                   /product="Translation Initiation Factor 3"
FT                   /note="IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86771"
FT                   /db_xref="GOA:Q5XCU2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCU2"
FT                   /protein_id="AAT86771.1"
FT                   /translation="MKIIAKKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQSLADAS
FT                   NVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFE
FT                   TKLRNGRKFLEKGNKVKVSIRFKGRMITHKEIGAKVLADFAEATQDIAIIEQRAKMDGR
FT                   QMFMQLAPISDKK"
FT   gene            639343..639540
FT                   /locus_tag="M6_Spy0637"
FT   CDS_pept        639343..639540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0637"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86772"
FT                   /db_xref="GOA:Q5XCU1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCU1"
FT                   /protein_id="AAT86772.1"
FT                   /translation="MPKQKTHRASAKRFKRTGSGGLKRFRAFTSHRFHGKTKKQRRHLR
FT                   KAGLVSSGDFKRIKAMVTGL"
FT   gene            639599..639958
FT                   /locus_tag="M6_Spy0638"
FT   CDS_pept        639599..639958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0638"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86773"
FT                   /db_xref="GOA:Q5XCU0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCU0"
FT                   /protein_id="AAT86773.1"
FT                   /translation="MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYY
FT                   AYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVADAA
FT                   AFTALADAAKAKLGK"
FT   gene            complement(640249..642465)
FT                   /locus_tag="M6_Spy0639"
FT   CDS_pept        complement(640249..642465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0639"
FT                   /product="Phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86774"
FT                   /db_xref="GOA:Q5XCT9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT9"
FT                   /protein_id="AAT86774.1"
FT                   /translation="MEMTSLGKNDKEVATVKKFKTLITGFINTRLGFIITLLFCYWIKT
FT                   LWAYHTDFSLDLGNIYQVFLTIINPIPLAFLLLGVALYVKNTRAFYICSWVVYIILNIL
FT                   LISNSIYYREFSDFITVSAMLASSKVSAGLGDSALNLLRIWDIIYILDFIILISLSITK
FT                   KIKNDQRPFNKRAAFAITALSSLLLSINLFLAEIDRPELLTRGFSNTYIVRALGLPAFT
FT                   LYSGNQTYQAQKERNGATAEELIDVKTYVKGHYAAPDPQYFGIGKGKNIIVLHLESFQQ
FT                   FLIDYKLKEGDKEYEVTPFINSLYHSNATLAFPNFFHQVKAGKTSDAETMMENSLFGLN
FT                   SGSFMVNYGGENTQFATPSILAQKGGYTSAVFHGNVGTFWNRNNAYKQWGYNYFFDSSY
FT                   FSKQNSKNSFQYGLNDKYMFKDSIKYLEQMQQPFYTKFITVSNHYPYTSLKGESSEEGF
FT                   PLAKTDDETINGYFATANYLDAALKSFFDYLKATGLYENSIFVLYGDHYGISNSRNSSL
FT                   APLLGKDSETWSEYDNAMLQRVPYMIHIPGYTNGSIKETFGGEIDALPTLLHILGIDTS
FT                   QFVQLGQDLLSPQNSQIVAQRTSGTYMTPEYTNYSGRLYNTQTGLEITNPDEMTIAKTK
FT                   EIRSAVAQQLAASDAIQTGDLLRFDTQNGLKAIDPNQFIYTKQLKQLKDISAKLGSEST
FT                   SLYSKNGHKSTQKLFKAPSYLELNPVEADAATSELKEDNTKNRE"
FT   gene            642567..643730
FT                   /locus_tag="M6_Spy0640"
FT   CDS_pept        642567..643730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0640"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86775"
FT                   /db_xref="GOA:Q5XCT8"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT8"
FT                   /protein_id="AAT86775.1"
FT                   /translation="MNKLYIDSFVEKKLTAGVQLLDEKDFSNIKEKNQLVQLVTKSNRP
FT                   IGTAYISKQNKGIGWYLGPEKIDLSISYFVSLFSVAKAKRQDFAQSDETNAYRLFNQEG
FT                   DGFGGVTIDLYKDFAVFSWYNAFVYDKKEMIMEAFQQVFPEVKGAYEKCRFKGPDTETA
FT                   HLYGELAQETFSILENGIAYQVFLNEGLMTGIFLDQHDVRRALVDGLAMGKSLLNLFSY
FT                   TAAFSVAAAMGGAIETTSVDLAKRSRELSLAHFEHNQLNLASHHFVVMDVFEYFKYAKR
FT                   KKLIFNVIVIDPPSFARNKKQTFSVSRDYHKLITEALDILSPKGTIIASTNAANMTVSQ
FT                   FKKQIIKGFGSRRPESMTLQQLPSDFTINKADERSNYLKVFTIKVRE"
FT   gene            643727..644413
FT                   /locus_tag="M6_Spy0641"
FT   CDS_pept        643727..644413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0641"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86776"
FT                   /db_xref="GOA:Q5XCT7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCT7"
FT                   /protein_id="AAT86776.1"
FT                   /translation="MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVA
FT                   PAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVF
FT                   QEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRG
FT                   FKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVL
FT                   EMDISN"
FT   gene            644507..645673
FT                   /locus_tag="M6_Spy0642"
FT   CDS_pept        644507..645673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0642"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86777"
FT                   /db_xref="GOA:Q5XCT6"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCT6"
FT                   /protein_id="AAT86777.1"
FT                   /translation="MRYLTAGESHGLSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGR
FT                   GARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVK
FT                   HPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILI
FT                   FGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIV
FT                   QGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPT
FT                   QGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDP
FT                   TALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF"
FT   gene            645734..646075
FT                   /locus_tag="M6_Spy0643"
FT   CDS_pept        645734..646075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0643"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86778"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCT5"
FT                   /protein_id="AAT86778.1"
FT                   /translation="MSQEIYDYANQLERAVRALPEYQKVLEVKEAIQADASASQLFDEF
FT                   VAMQEKIQGMMQSGQMPTAEEQTSIQELSQKIEANDQLKAYFEAQQALSVYMSDIERIV
FT                   FAPLKDLVK"
FT   gene            646287..647648
FT                   /locus_tag="M6_Spy0644"
FT   CDS_pept        646287..647648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0644"
FT                   /product="Glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86779"
FT                   /db_xref="GOA:Q5XCT4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT4"
FT                   /protein_id="AAT86779.1"
FT                   /translation="MIKMVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTC
FT                   VNLGCVPKKVMWYGAQVADILGTYAKDYGFDFKEKAFDFKQLKANRQAYIDRIHASYER
FT                   GFEQNGVDRIYDYAVFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISSDGF
FT                   FALDEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKTIVDVLVDEMA
FT                   VNGPRLHTHAEVAKVVKNTDESLTLYLKDGQEVEVDQLIWAIGRKPNLEVFSLDKTGVT
FT                   LNDKGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAAGRRLSERLFNSKTDEKLDYQ
FT                   NVATVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTV
FT                   GDTEKIVGLHGIGYGVDEMIQGFVVAIKMGATKADFDNTVAIHPTGSEEFVTMR"
FT   gene            complement(647736..649028)
FT                   /locus_tag="M6_Spy0645"
FT   CDS_pept        complement(647736..649028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0645"
FT                   /product="folypolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="dihydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86780"
FT                   /db_xref="GOA:Q5XCT3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT3"
FT                   /protein_id="AAT86780.1"
FT                   /translation="MLEGQEIVMTTYDSISWIHTFKANGRKTDLARMAWLLEALGRPQD
FT                   KFPAIHVVGTNGKGSVTAYLQHILSTSGYQVGTFTSPFIISFHDRICLNGQPISDLELA
FT                   QCVSVIRPILTKMSLETNWDRPTEFELVTLIMFCYFANLKPVDIAIIEAGIGGKTDATN
FT                   VFHALAVVCPSISFDHQERLGYSLAEIAHQKAEVIKAKEPVIIGQLEQEASQVFQQVTQ
FT                   KAGSRLYQLGKDFLLNPSEKTFSFQHDNLNLTKLRLKLLGQHQKANACLAIMTAQLLRK
FT                   SFPKISPKTIQKGIEATTWPGRSEFIQPNLLLDGAHNPDSIAKLKSLLQEEFPKRPIHI
FT                   LFAGLKRKPLADLLAQLDTFEVSVTTFDFPEANLLEDYPDKYPQVKDYRDWLQGSVTSD
FT                   ELFVVTGSLYFISEVRQYCLSNANIFKNIFP"
FT   gene            complement(649034..649495)
FT                   /locus_tag="M6_Spy0646"
FT   CDS_pept        complement(649034..649495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0646"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86781"
FT                   /db_xref="GOA:Q5XCT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT2"
FT                   /protein_id="AAT86781.1"
FT                   /translation="MILKEKNMSSRYSRQQKPRKSGGVPTEHIKTGFTAFQKSIALIGS
FT                   ILSIIVATITISRALQPVPDKTSNDTPKESSNTIVKIIEKESSQGNQNHTGTSETTDDN
FT                   KTTLPSSSTAPSHNETTPTAPETPSTTEGTQLPNATGAEDANTGLPTNP"
FT   gene            649709..650851
FT                   /locus_tag="M6_Spy0647"
FT   CDS_pept        649709..650851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0647"
FT                   /product="Cysteine desulfhydrase"
FT                   /EC_number="4.4.1.-"
FT                   /EC_number="4.4.1.16"
FT                   /note="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86782"
FT                   /db_xref="GOA:Q5XCT1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCT1"
FT                   /protein_id="AAT86782.1"
FT                   /translation="MIYFDNAATTIPYGEALKTYQEVATKIYGNPSSLHQLGTNASRIL
FT                   EASRKQIAGLLGVKSEEIFFTSGGTESANWAIKGIAFEKTAFGKHIIISAIEHPAVSES
FT                   VKWLLTQGFEVSYAPVTTQGVVDVNALAELIRPDTILISIMAVNNEMGAIQPIRAISNL
FT                   LANQPTITFHVDAVQAIGKIPLCDYMTNRVDLASFSGHKFHSVRGVGFLYKKAGKRLNP
FT                   LLSGGGQEQELRSTTENVAGIASMAKALRIVTEKQVSVLPKLTAMRDVIYKALSAYPDV
FT                   TVFSAQEGFAPNILTFGIRGVRGEVIVHAFEKYEIYISTTSACSSKAGKPAGSLVAMGI
FT                   PVKTAQTAVRISLDDDNDMGQVEQFLTIFKQIYDKTQKVR"
FT   gene            650863..652077
FT                   /locus_tag="M6_Spy0648"
FT   CDS_pept        650863..652077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0648"
FT                   /product="Thiamine biosynthesis protein"
FT                   /note="ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86783"
FT                   /db_xref="GOA:Q5XCT0"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCT0"
FT                   /protein_id="AAT86783.1"
FT                   /translation="MDYSEIMVRHGELSTKGKNRMRFINKLKNNIQDVLAPFPAITVRS
FT                   DRDRTHVYLNGTDYQPVVEALKLVFGVQALSPVYKLEKSVPLLVTAVQDIMTSLYRDGL
FT                   TFKIATKRSDHAFELDSRELNSLLGGAVFEVLPNIQAQMKHPDVTLKVEIRDEAAYISY
FT                   EEIKGAGGLPVGTSGKGMLMLSGGIDSPVAGYLALKRGLDIEVVHFASPPYTSPGALAK
FT                   AQDLTRRLTRFGGNIQFIEVPFTEIQEEIKNKAPEAYLMTLTRRFMMRITDAIREQRKG
FT                   LVIVNGESLGQVASQTLESMQAINAVTSTPIIRPVVTMDKLEIIEMAQAIDTFDISIQP
FT                   FEDCCTIFAPDRPKTNPKLGNAEKYEERFDIDGLVQRAVSGIVVTEITPEIVNDEVENL
FT                   IDALL"
FT   gene            652115..653407
FT                   /locus_tag="M6_Spy0649"
FT   CDS_pept        652115..653407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0649"
FT                   /product="Capsule biosynthesis protein"
FT                   /note="CapA"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86784"
FT                   /db_xref="GOA:Q5XCS9"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS9"
FT                   /protein_id="AAT86784.1"
FT                   /translation="MILLKSLYKGFFAAMKEENFEARCYNREKGGCVLIKTIPYKKTMA
FT                   AVVALIVALLLFGLIYDLLGVQKNKLAAQKSAQPKVKTARVVANGDILIHDILYMSARK
FT                   ADDTYDFTPYFEYVKDWISGADLAIGDYEGTISPDYPLAGYPLFNAPEEIAGALKNTGY
FT                   DVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKESFLIKNVNGIKIAILG
FT                   YSYGYNGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTIVMPQMGTEYALEPTA
FT                   EQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMGNFISNQRLETVDDI
FT                   WTERGLLMDLTFEKKVNKTKIKTVEAHPTMVLAKGKGIVGKEGFELYNYRTMVLEDFIK
FT                   GGKYHDKIDEETKAKVALAYQEINDLVNLKW"
FT   gene            complement(653419..654402)
FT                   /locus_tag="M6_Spy0650"
FT   CDS_pept        complement(653419..654402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0650"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86785"
FT                   /db_xref="GOA:Q5XCS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS8"
FT                   /protein_id="AAT86785.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGVRC"
FT   gene            654707..655021
FT                   /locus_tag="M6_Spy0651"
FT   CDS_pept        654707..655021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0651"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86786"
FT                   /db_xref="GOA:Q5XCS7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCS7"
FT                   /protein_id="AAT86786.1"
FT                   /translation="MSTYAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGG
FT                   DKTVVGTPVVEGATVVGTVEKQGKQKKVVTFKYKPKKGSHRKQGHRQPYTKVVINAINA
FT                   "
FT   gene            655033..655359
FT                   /locus_tag="M6_Spy0652"
FT   CDS_pept        655033..655359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0652"
FT                   /product="hypothetical ribosome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86787"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS6"
FT                   /protein_id="AAT86787.1"
FT                   /translation="MIKAIFTRQKNGQLSSVTLTGHAGSGKHGFDIVCASVSTLAINFV
FT                   NSLEVLADCQALVDLNDVEGGYMAITIPPHDNKEEVQLLFESFLLGMTSLAKDSSKFVN
FT                   TQVI"
FT   gene            655387..655680
FT                   /locus_tag="M6_Spy0653"
FT   CDS_pept        655387..655680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0653"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86788"
FT                   /db_xref="GOA:Q5XCS5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCS5"
FT                   /protein_id="AAT86788.1"
FT                   /translation="MLKMNLANLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGG
FT                   SILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPVAK"
FT   gene            656039..656953
FT                   /locus_tag="M6_Spy0654"
FT   CDS_pept        656039..656953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0654"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86789"
FT                   /db_xref="GOA:Q5XCS4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS4"
FT                   /protein_id="AAT86789.1"
FT                   /translation="MNIQQLRYVVAIANNGTFREAASKLFVSQPSLSVSIKDLEAELGF
FT                   QIFNRTTSGTVLTSQGLVFYEKALEVVKSFDSFEKTFSQADLDQNEFSIASQHYDFLPP
FT                   LITAFSQQYDGHRVFRIFESTTIQILDEVAQGNSEIGIIYLNVDNQKGLFQRMDKLGLE
FT                   YVSLIPFTTHIYLSKTHPLANHEALYLNDIQGLPAVRFTQERDEYLYYSENFVDTSECP
FT                   RIYNVSDRATLNGILERTNAFATGSGFLDHRSVNGIKVIPLADHIDNQMIYVKRKDKNL
FT                   SVAGATFVTILKDYFDKRRKALT"
FT   gene            656950..657408
FT                   /locus_tag="M6_Spy0655"
FT   CDS_pept        656950..657408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0655"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86790"
FT                   /db_xref="GOA:Q5XCS3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCS3"
FT                   /protein_id="AAT86790.1"
FT                   /translation="MKKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPFIPGIVSLTY
FT                   LQNNGAAFSILQDQQWFFVAITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFI
FT                   DRLRLAYVIDMVHLDFVDFAIFNVADSYLTVGVILLVICLWKEEDYGD"
FT   gene            657398..658288
FT                   /locus_tag="M6_Spy0656"
FT   CDS_pept        657398..658288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0656"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86791"
FT                   /db_xref="GOA:Q5XCS2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS2"
FT                   /protein_id="AAT86791.1"
FT                   /translation="MEINVITSGQRLDKALADLSPLSRGQANDQIKQGLVLVNGQQKKA
FT                   KYTVQAGDVICFELPKEEVLEYQAQNIPLDIIYEDDALAIINKPQGMVVHPSAGHPSGT
FT                   MVNALMYHIKDLSSINGVVRPGIVHRIDKDTSGLLMVAKTDAAHQALAEELKAKKSLRK
FT                   YLAIVHGNLPNDRGMIEAPIGRSEKDRKKQAVTAKGKEAVTRFTVLERFGDYSLVELQL
FT                   ETGRTHQIRVHMAYIGHPVAGDPLYGPRKTLSGHGQFLHAKTLGLTHPMTGKEMIFTVE
FT                   APEIFQKVLKLLRKK"
FT   gene            658684..659205
FT                   /locus_tag="M6_Spy0657"
FT   CDS_pept        658684..659205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0657"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PyrR; Pyrimidine operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86792"
FT                   /db_xref="GOA:Q5XCS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCS1"
FT                   /protein_id="AAT86792.1"
FT                   /translation="MKTKEIVDDVTMKRAITRITYEIIERNKQLDNVVLAGIKTRGVFL
FT                   ARRIQERLHQLEGLDLPIGELDTKPFRDDMRVEEDTTLMSVDITGKDVILIDDVLYTGR
FT                   TIRAAIDNLVSLGRPARVSLAVLVDRGHRELPIRADYVGKNIPTSSVEEIVVEVVEVDG
FT                   RDRVSIIDPT"
FT   gene            659221..660480
FT                   /locus_tag="M6_Spy0658"
FT   CDS_pept        659221..660480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0658"
FT                   /product="Uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86793"
FT                   /db_xref="GOA:Q5XCS0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCS0"
FT                   /protein_id="AAT86793.1"
FT                   /translation="MKDVIYDVEEVPKAGMLVGLSFQHLFAMFGATVLVPILVGIDPSV
FT                   ALLSSGLGTLAHLSVTKFKIPAYMGSSFAYIAAMQLLMRTNGIGAVAQGAMTGGLVYLI
FT                   VALIVKAIGNDWIDNILPPIVVGPTVMVIGLSLASTAVNDVMLKNGNYNLTYLVIGLVT
FT                   LLSVIFFNIYGKGIVAIVPLLLGLLVGYVVALLVGVLTGQEIVDFTNVAQAKWFSIPSV
FT                   EIPFLTYGVKFYPSAILTMAPIAFVTMTEHFGHIMVLNSLTKRDYFKDPGLEKTLTGDG
FT                   FAQIIAGFLGAPPVTSYGENIGVMALNKIFSVYVIAGAAVIAALLSFIGKVSALIQSIP
FT                   TPVIGGISVALFGVIASSGLKILIESKVDMDNKKNLLIASVILVSGIGGLMLQVNGLQI
FT                   SGVAFSTLLGIILYQVLPEK"
FT   gene            660487..661476
FT                   /locus_tag="M6_Spy0659"
FT   CDS_pept        660487..661476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0659"
FT                   /product="Aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86794"
FT                   /db_xref="GOA:Q5XCR9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCR9"
FT                   /protein_id="AAT86794.1"
FT                   /translation="MLLDHLHSHQSLVIKGIIMSVVNNRVALTNLVSMEALTTEEVLGL
FT                   INRGSEYKAGKVVISDHQKDLVANLFFENSTRTHKSFEVAEKKLGLTVLDFNADASAVN
FT                   KGESLYDTVLTMSALGTDICVIRHPEDDYYKELVESPTITASIVNGGDGSGQHPSQCLL
FT                   DLLTIYEEFGRFEGLKIAIAGDLTHSRVAKSNMQILKRLGAELYFYGPEEWYSEAFNAY
FT                   GTYIAIDQIIKELDVLMLLRVQHERHDGHQSFSKEGYHQAFGLTQERYQQLKDSAIIMH
FT                   PAPVNRDVEIADSLVEAPKARIVSQMANGVFVRMAIIEAILNGRNKNS"
FT   gene            661520..662602
FT                   /locus_tag="M6_Spy0660"
FT   CDS_pept        661520..662602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0660"
FT                   /product="Carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86795"
FT                   /db_xref="GOA:Q5XCR8"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCR8"
FT                   /protein_id="AAT86795.1"
FT                   /translation="MTKRLLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQ
FT                   SYNGQILTFTYPLIGNYGINRDDYESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIK
FT                   GIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQHLKDQLRATVLPTNTIEQVSTKTA
FT                   YPAPGIGKNIVLVDFGLKHSILREFSKRQCNITVVPFNITAEEVLQLNPDGLMLSNGPG
FT                   NPEDLPEALDMIRGVQGKIPIFGICMGHQLFSLANGAKTCKMTFGHRGFNHAVREIATG
FT                   RIDFTSQNHGYAVERSSLPDTLMVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHD
FT                   ASYLFDEFLEMIDSWRCTSK"
FT   gene            662574..662771
FT                   /locus_tag="M6_Spy0661"
FT   CDS_pept        662574..662771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86796"
FT                   /db_xref="GOA:Q5XCR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR7"
FT                   /protein_id="AAT86796.1"
FT                   /translation="MILGDVRVNSKSVAISRLYHLLLLYLLTFTVDLVPYQKYYLMLLC
FT                   EATNRERNARRTQVNNLVKS"
FT   gene            662803..666024
FT                   /locus_tag="M6_Spy0662"
FT   CDS_pept        662803..666024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0662"
FT                   /product="Carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86797"
FT                   /db_xref="GOA:Q5XCR6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCR6"
FT                   /protein_id="AAT86797.1"
FT                   /translation="MLTLPLLVVFLVSLIMPKRKDIQKIMVIGSGPIIIGQAAEFDYAG
FT                   TQACLALKEEGYKVILVNSNPATIMTDKEIADKVYIEPLTLEFVNRIIRKERPDAILPT
FT                   LGGQTGLNMAMALSKAGILDDLEIELLGTKLSAIDQAEDRDLFKQLMQELDQPIPESTI
FT                   VKTVDEAVTFARDIGYPVIVRPAFTLGGTGGGICSSEEELCEITENGLKLSPVTQCLIE
FT                   RSIAGFKEIEYEVMRDSADNALVVCNMENFDPVGIHTGDSIVFAPTQTLSDIENQMLRD
FT                   ASLKIIRALKIEGGCNVQLALDPYSFKYYVIEVNPRVSRSSALASKATGYPIAKLAAKI
FT                   AVGLTLDEMINPITGTTYAMFEPALDYVVAKIPRFPFDKFEHGERQLGTQMKATGEVMA
FT                   IGRNLEESLLKACRSLEIGVCHNEMTSLSNISDEELVTKVIKAQDDRLFYLSEAIRRGY
FT                   SIEELESLTKIDLFFLDKLLHIVEIEQELQMHVDHLESLKKAKRYGFSDQKIAEIWQKD
FT                   ESDIRAMRHSHSLYPVYKMVDTCAAEFDAKTPYFYSTYELENESVQSNKESILVLGSGP
FT                   IRIGQGVEFDYATVHSVKAIQKAGYEAIIMNSNPETVSTDFSVSDKLYFEPLTFEDVMN
FT                   VIDLEQPKGVIVQFGGQTAINLAQSLSDAGVTILGTQVEDLDRAEDRDLFEKALKELGI
FT                   PQPQGQTATNEEEALEAAKKIGFPVLVRPSYVLGGRAMEIVENKEDLREYIRTAVKASP
FT                   EHPILVDSYIFGKECEVDAISDGKSVLIPGIMEHIERAGVHSGDSMAVYPPQQLSKQIQ
FT                   ETIAEYTKRLAIGLNCIGMMNVQFVIKNEQVYVIEVNPRASRTVPFLSKVTGIPMAQIA
FT                   TKLILGQTLKDLGYEDGLYPQSQLVHIKAPVFSFTKLAQVDSLLGPEMKSTGEVMGSDT
FT                   SLEKALYKAFEANNSHLSEFGQIVFTIADDSKAEALSLARRFKAIGYQIMATQGTAAYF
FT                   AEQGLSACLVGKIGDAANDIPTLVRHGHVQAIVNTVGIKRTADKDGQMIRSSAIEQGVP
FT                   LFTALDTAKAMLTVLESRCFNIEAI"
FT   gene            666231..667502
FT                   /locus_tag="M6_Spy0663"
FT   CDS_pept        666231..667502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0663"
FT                   /product="periplasmic component of efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86798"
FT                   /db_xref="GOA:Q5XCR5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR5"
FT                   /protein_id="AAT86798.1"
FT                   /translation="MSKRGKIKITTKTKLITASVITLVLIITGVVLWKQQQNTLTADIA
FT                   KEPYSTVSVTEGSIASSTLLSGTVKALSEEYIYFDANKGNDATVTVKVGDQVTQGQQLV
FT                   QYNTTTAQSAYDTAVRSLNKIGRQINHLKTYGVPAVSTETNKDEATGEETTTTVQPSAQ
FT                   QNANYKQQLQDLNDAYADAQAEVNKAQIALNDTVVISSVSGTVVEVNNDIDPSSKNSQT
FT                   LVHVATEGQLQVKGTLTEYDLANVKVGQSVKIKSKVYSNQEWTGKISYVSNYPTESNAG
FT                   STTPAGSTGAGSSTGAAYDYKIDIISPLNQLKQGFTVSVEVVNEAKQALVPLTAVIKKD
FT                   KKHYVWTYDDATGKAKKVEVTLGNADAQQQEIHKGVAVGDIVIANPDKNIKPDKKLEGV
FT                   ISIGTNTKPEKDSQSKNKKSGVDK"
FT   gene            667502..668212
FT                   /locus_tag="M6_Spy0664"
FT   CDS_pept        667502..668212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0664"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86799"
FT                   /db_xref="GOA:Q5XCR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR4"
FT                   /protein_id="AAT86799.1"
FT                   /translation="MSHEKKQLMQLSNIVKSYQNGDQVLKVLKGINLTVYEGEFLAIMG
FT                   PSGSGKSTLMNIIGLLDRPTSGDYTLHNTKIEILNDRELANVRNDEIGFVFQQFFLLAK
FT                   LTALQNVELPLIYAGVNVSKRREQAKQFLEKVGLGRRIKHLPSELSGGQKQRVAIARAL
FT                   VNDPSIILADEPTGALDTKTGQQIMELLTELNKEGKTIIMVTHEPEIADFATRKIIIRD
FT                   GDITTDTTASVVID"
FT   gene            668224..669444
FT                   /locus_tag="M6_Spy0665"
FT   CDS_pept        668224..669444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0665"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86800"
FT                   /db_xref="GOA:Q5XCR3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR3"
FT                   /protein_id="AAT86800.1"
FT                   /translation="MENWKFALSSIWGHKMRSILTMLGIIIGVAAVVIIMGLGNAMKNS
FT                   VTSTFSSKQKDIQLYFQEKGEEEDLYAGLHTHENNHEVKPEWLEQIVKDIDGIDSYYFT
FT                   NSATSTISYEKKKVDNASIIGVSKDYFNIKNYDIVAGRTLTDNDYSNFSRIILLDTVLA
FT                   DDLFGEGNYKSALNKVVSLSDKDYLVIGVYKTDQTPVSFDGLSGGAVMANTQVASEFGT
FT                   KEIGSIYIHVNDIQNSMNLGNQAADMLTNISHIKDGQYAVPDNSKIVEEINSQFSIMTT
FT                   VIGSIAAISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRLKILSQFLIESVVLTVL
FT                   GGLIGLLLAQLSVGALGNAMTLKGACISLDVALIAVLFSASIGVFFGMLPANKASKLDP
FT                   IEALRYE"
FT   gene            669656..671431
FT                   /locus_tag="M6_Spy0666"
FT   CDS_pept        669656..671431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0666"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86801"
FT                   /db_xref="GOA:Q5XCR2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR2"
FT                   /protein_id="AAT86801.1"
FT                   /translation="MSGNELFKIKEISSMTFLSDLISLMTKIRLSWVIKAGIFQLLFVT
FT                   IANIVLSEFFYFILDVTGQYHLDKDNVVTFLKNPIALALLGAYLFLLAAFIHLEFFALY
FT                   RIIADQEISFYLFRKQFSYYLRGLWKTFSGYQLLLFLLYILLTIPVLHIGLSSVITQKL
FT                   YLPEFIVGELSKITSTKYLLYGSLILVFYLNLRLVYFLPLIAINHRTVAQAWRESWQKT
FT                   KKKHILLWMKLFAINGLTLVVLSLAISMILIFVDMFNPKGNNIIVQLGALTFTWELIFF
FT                   TTIFFKLCSAMILKEAIEPQKQYDEPRRSNKAYVVIFIVVTVGFAYQSLERLTFFDTSH
FT                   SKTVIAHRGLVSAGVENSLEALEGAKKAGSDYVELDLILTKDNHFVVSHDNRLKRLAGV
FT                   NKTIRNLTLKEVEHLTSHQGHFSGRFVSFDTFYQKAKKLNMPLLIELKPIGTEPGNYVD
FT                   LFLETYHRLGISKDNKVMSLDLEVIEAIKKKNPSITTGYIIPIQFGFFGDEFVDFYVIE
FT                   DFSYRSYLSSQAFWNNKEIYVWTINDPKRIEHYLLKPIQGIITDQPALTNQLIKDLKQD
FT                   NSYFSRLVRIISSLY"
FT   gene            671558..671830
FT                   /locus_tag="M6_Spy0667"
FT   CDS_pept        671558..671830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0667"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86802"
FT                   /db_xref="GOA:Q5XCR1"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCR1"
FT                   /protein_id="AAT86802.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVA
FT                   ENQITIKEDRVLEWLSKGAQPSDTVRNILSKAGVMAKFHDQKFSK"
FT   gene            671840..672079
FT                   /locus_tag="M6_Spy0668"
FT   CDS_pept        671840..672079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0668"
FT                   /product="RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86803"
FT                   /db_xref="GOA:Q5XCR0"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCR0"
FT                   /protein_id="AAT86803.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDNLTIKIEDTPDFLEYHLDLDAQDIG
FT                   RVIGKKGRTITAIRSIVYSVPTLGKKVRLVIDEK"
FT   gene            672088..672195
FT                   /locus_tag="M6_Spy0669"
FT   CDS_pept        672088..672195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0669"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ9"
FT                   /protein_id="AAT86804.1"
FT                   /translation="MRWIEKLVDLKSTSFLNSKNLNISEMKRLDFSVFS"
FT   gene            673011..676037
FT                   /locus_tag="M6_Spy0670"
FT   CDS_pept        673011..676037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0670"
FT                   /product="Cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86805"
FT                   /db_xref="GOA:Q5XCQ8"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ8"
FT                   /protein_id="AAT86805.1"
FT                   /translation="MKKHLKTVALTLTTVSVVTHNQEVFSLVKEPILKQTQASSSISGA
FT                   DYAESSGKSKLKINETSGPVDDTVTDLFSDKRTTPEKIKDNLAKGPREQELKAVTENTE
FT                   SEKQINSGSQLEQSKESLSLNKRVPSTSNWEICDFITKGNTLVGLSKSGVEKLSQTDHL
FT                   VLPSQAADGTQLIQVASFAFTPDKKTAIAEYTSRAGENGEISQLDVDGKEIINEGEVFN
FT                   SYLLKKVTIPTGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPDNLK
FT                   AIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRGNSLKVIGEASFQDNDLS
FT                   QLMLPDGLEKIESEAFTGNPGDDHYNNRVVLWTKSGKNPYGLATENTYVNPDKSLWQES
FT                   PEIDYTKWLEEDFTYQKNSVTGFSSKGLQKVKRNKNLEIPKQHNGVTITEIGDNAFRNV
FT                   NFQNKTLRKYDLEEVKLPSTIRKIGAFAFQSNNLKSFEASDDLEEIKEGAFMNNRIETL
FT                   ELKDKLVTIGDAAFHINHIYAIVLPESVQEIGRSAFRQNGANNLIFMGSKVKTLGEMAF
FT                   LSNRLEHLDLSEQKQLTEIPVQAFSDNALKEVLLPASLKTIREEAFKKNHLKQLEVASA
FT                   LSHIAFNALDDNDGDEQFDNKVVVKTHHNSYALADGEHFIVDPDKLSSTIVDLEKILKL
FT                   IEGLDYSTLRQTTQTQFRDMTTAGKALLSKSNLRQGEKQKFLQEAQFFLGRVDLDKAIA
FT                   KAEKALVTKKATKNGQLLERSINKAVSAYNNSAIKKANVKRLEKELDLLTGLVEGKGPL
FT                   AQATMVQGVYLLKTPLPLPEYYIGLNVYFDKSGKLIYALDMSDTIGEGQKDAYGNPILN
FT                   VDEDNEGYHALAVATLADYEGLDIKTILNSKLSQLTSIRQVPTAAYHRAGIFQAIQNAA
FT                   AEAEQLLPKPGTHSEKSSSSESANSKDRGLQSNPKTNRGRHSAILPRTGSKGSFVYGIL
FT                   GYTSVALLSLITAIKKKKY"
FT   gene            676057..676458
FT                   /locus_tag="M6_Spy0671"
FT   CDS_pept        676057..676458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0671"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86806"
FT                   /db_xref="GOA:Q5XCQ7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ7"
FT                   /protein_id="AAT86806.1"
FT                   /translation="MITQEMKDLINNQLAMVATVDAKGQPNIGPKRSMRLWDDKTFIYN
FT                   ENTDGQTRINIEDNGKIEIAFVDRERLLGYRFVGTAEIQTEGAYYEAAKKWAQGRMGVP
FT                   KAVGIIHVERIFNLQSGANAGKEINSESN"
FT   gene            complement(676638..677513)
FT                   /locus_tag="M6_Spy0672"
FT   CDS_pept        complement(676638..677513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0672"
FT                   /product="Cobalt-zinc-cadmium resistance protein"
FT                   /note="CzcD"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86807"
FT                   /db_xref="GOA:Q5XCQ6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ6"
FT                   /protein_id="AAT86807.1"
FT                   /translation="MPASKKVIIIFILNLSFSLIEFIFGTLFFSGAILADAVHDFGDAI
FT                   AIGISAILERKAVKKESSNFSLGYKRFSLLGALTTNLILISGSLLVMIETIPKLWHPTI
FT                   VNYDGMFVLAIFAIIINGFASFIIHSNQTKNEEILSLHFLEDILGWLAIIILSLILKWK
FT                   PWYILDPLLSIAIASFILSKALPKLVATANIFLDGVPDSIDYCALHHELSQLPHIVSVN
FT                   QLNVWSMDGIDHRATIHCCLRESTTEKHCKKSIRLICQRYNINSVTVEIDTSLNEHQHH
FT                   CSSLSSIEVN"
FT   gene            677640..678170
FT                   /locus_tag="M6_Spy0673"
FT   CDS_pept        677640..678170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0673"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86808"
FT                   /db_xref="GOA:Q5XCQ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ5"
FT                   /protein_id="AAT86808.1"
FT                   /translation="MSDMTKDRQIKKTKTAIYSAFLALLQKKEYSKITVRDMIALANVG
FT                   RSTFYAHYESKEMLLKELCEELFHHLFRQKRNVTFEDYLVHILKHFEQNKDSIATLLLS
FT                   NDPYFLLRFKNELEHDVYPNLRCKYIDKTTIPEVFLKQFVLSSFIETLKWWLHQRQRMS
FT                   ANELLKYYLELIK"
FT   gene            678385..678903
FT                   /locus_tag="M6_Spy0674"
FT   CDS_pept        678385..678903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0674"
FT                   /product="16S rRNA processing protein"
FT                   /note="RimM"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86809"
FT                   /db_xref="GOA:Q5XCQ4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCQ4"
FT                   /protein_id="AAT86809.1"
FT                   /translation="MEYFNVGKIVNTQGLQGEMRVLSVSDFAEERFKKGSQLALFDDKD
FT                   QFVQEVTIVSHRKQKNFDIIKFKDMYHINAIEKYKGYTLKVSKANQGDLQEGEFYYHQI
FT                   IGMAVYEKDRLIGYVKEILQPGANDVWVVKRQGKRDLLLPYIPPVVLSVDVPNKRVDVE
FT                   LMEGLDDED"
FT   gene            678893..679612
FT                   /locus_tag="M6_Spy0675"
FT   CDS_pept        678893..679612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0675"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86810"
FT                   /db_xref="GOA:Q5XCQ3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCQ3"
FT                   /protein_id="AAT86810.1"
FT                   /translation="MKIDILTLFPEMFAPLEHSIVGKAKEKGLLDIHYHNFRDYAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERYD
FT                   FSEEERKLLDKIKEALG"
FT   gene            679624..680616
FT                   /locus_tag="M6_Spy0676"
FT   CDS_pept        679624..680616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0676"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86811"
FT                   /db_xref="GOA:Q5XCQ2"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCQ2"
FT                   /protein_id="AAT86811.1"
FT                   /translation="MKDKAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPA
FT                   ILYPEKMIYDIPAYPSLTGVELTENLIKQLSRFEDRTTICLKEEVLTFDKVKGGFSIRT
FT                   NKAEHFSKAIIIACGNGAFAPRTLGLESEENFADHNLFYNVHQLDQFAGQKVVICGGGD
FT                   SAVDWALALEDIAESVTVVHRRDAFRAHEHSVELLKTSTVNLLTPYVPKALKGIGNLAE
FT                   KLVIQKVKEDEVLELELDSLIVSFGFSTSNKNLKNWNLDYKRSSITVSPLFQTSQEGIF
FT                   AIGDAAAYNGKVDLIATGFGEAPTAVNQAINYIYPDRDNRVVHSTSLID"
FT   gene            680794..681852
FT                   /locus_tag="M6_Spy0677"
FT   CDS_pept        680794..681852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0677"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86812"
FT                   /db_xref="GOA:Q5XCQ1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCQ1"
FT                   /protein_id="AAT86812.1"
FT                   /translation="MTTTDKETFSSFMNKILAGTAIAIVVALIPNAILATFLKPLLPNM
FT                   AATEFLHIVQVFQFFTPIMAGFLIGQQFKFNPMQQLAVGGAAYIGSGAWAYTEVIQKGV
FT                   ATGTFQLRGIGDLINMMITASLAVLAVKYFGNRFGSLTIILLPITIGTGVGYIGWKFLP
FT                   YVSYVTTLIGQGINSFTTLQPILMSILIAVAFSLIIVSPISTVAIGLAIGLNGMAAGAA
FT                   SMGIASTAAVLVWATLKVNKSGVPIAIALGAMKMMMPNFLKHPIMAIPMVFTAAISSLT
FT                   VPLFNLVGTPASSGFGLVGAVGPIASLAGGSSILIIILAWIIVPFAVAFAAHKVSKDIL
FT                   KLYKEDIFVFEG"
FT   gene            681865..682788
FT                   /locus_tag="M6_Spy0678"
FT   CDS_pept        681865..682788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0678"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86813"
FT                   /db_xref="GOA:Q5XCQ0"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XCQ0"
FT                   /protein_id="AAT86813.1"
FT                   /translation="MLVYIAGSGAMGCRFGYQISKTNNDVILLDNWEDHINAIKENGLV
FT                   VTGDVEETVKLPIMKPTEATQEADLIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGL
FT                   GHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQGVGALNLQSMDPNNQDAGHQVADL
FT                   LNKANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASEDGLKMVKEIIHEF
FT                   VIVGQAEGVELNEEEITQYVMDTSVRAAHHYPSMHQDLVQNHRLTEIDFINGAVNTKGE
FT                   KLGINTPYCRMITELVHAKEAVLNIQ"
FT   gene            683044..683757
FT                   /locus_tag="M6_Spy0679"
FT   CDS_pept        683044..683757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0679"
FT                   /product="Fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86814"
FT                   /db_xref="GOA:Q5XCP9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP9"
FT                   /protein_id="AAT86814.1"
FT                   /translation="MAKITEENYVSLEDLMQLLNSSESTIRRDLGELEQEGRLHRVHGG
FT                   AELFHSLQEELSNQEKSVKNSHIKKTIAQRASQFIYDNDVIFIDAGTTTEFLLPFLQAK
FT                   NLTVVTNSIHHAARLVELSIETIIVGGYVKQTTDASIGNVALEQIRQMNFDKAFLGMNG
FT                   IDDSYLTTPDMEEAVIKKAVLSNAKLAYILVDGTKIGQVSFVKVAPINDVTIITLGGSA
FT                   SILKQIKEKAKVIEL"
FT   gene            683754..684665
FT                   /locus_tag="M6_Spy0680"
FT   CDS_pept        683754..684665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0680"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86815"
FT                   /db_xref="GOA:Q5XCP8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP8"
FT                   /protein_id="AAT86815.1"
FT                   /translation="MIYTVTLNPSIDFIVRIDQINLGSVNRMASDDKFAGGKGINVSRI
FT                   LQRLDIASTATGFLGGFTGRFIEESLSAEGVKTDFVKGDQDTRINVKIKSQEETEINGQ
FT                   GPVISREQLEDLKTKLSQLTAEDTVVFAGSAPANLGNAVYKELLPLVRQSGAQVVCDFE
FT                   GQTLIDALTYNPLLVKPNNHELEAIFGTILTSLDDVETYARRLLEMGAQNVIISMAGDG
FT                   ALLVTKEATYFAKPIKGEVKNSVGAGDSMVAGFTGEFMKSQNPIEALKWGVACGTATAF
FT                   SDDLATIAFIKETYHKVEVEKR"
FT   gene            684662..686608
FT                   /locus_tag="M6_Spy0681"
FT   CDS_pept        684662..686608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0681"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86816"
FT                   /db_xref="GOA:Q5XCP7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP7"
FT                   /protein_id="AAT86816.1"
FT                   /translation="MKIQDLLRKDIMILDLQAISKEVAIDEMITKLVEKDIVHDFDVFK
FT                   KSIMTREEQTSTGLGDGIAMPHSKNIVVDKPAVLFAKSNKGVDYKALDGQPTDLFFMIA
FT                   APQGANDTHLAALAELSQYLLKDGFADKLRAAATPEAVIAVFDEASTAKEEVVAPTSGQ
FT                   DFIVAVTACPTGIAHTYMAEEALKKQAAEMGVAIKVETNGASGVANRLTAEDIQRAKGV
FT                   IVAADKAVEMDRFDGKQFIARPVADGIKKSQELISLILNNEGHTYHAKNRKSETAVSSE
FT                   KTSLGGAFYKHLMGGVSQMLPFVIGGGIMIALAFLLDNMLGVPNDQLGSLGSYHEIAAI
FT                   FMNIGGAAFSFMLPVLAGYIAYSIAEKPGLVAGFVAGAIASSGLAFGKVPFAAGGEVSL
FT                   GLTGVPSGFLGTLVGGFLAGGVILALRKLLAGLPRSLEGVKSILLYPLLGVLVTGFLML
FT                   FVNIPMAAINTALNDFLQGLSGSSAVLMGLLVGGMMAVDMGGPVNKAAYVFGTGTLAAT
FT                   VANGGSVVMAAVMAGGMVPPLAVFVATLLFKDKFTKEERESGLTNIVMGLSFITEGAIP
FT                   FGAADPARAIPSFIAGSALTGALVGLAGIKLMAPHGGIFVIALTSNPILYLVFVVIGAL
FT                   VSGILFGALRKKA"
FT   gene            686701..687300
FT                   /locus_tag="M6_Spy0682"
FT   CDS_pept        686701..687300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0682"
FT                   /product="Autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86817"
FT                   /db_xref="GOA:Q5XCP6"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP6"
FT                   /protein_id="AAT86817.1"
FT                   /translation="MKVKKRRRRAKSSVNRLVLGLVLLNLIVSMWTLKLGNQRLAPYAD
FT                   HETLTFVRKISHAAQSVAQKKQLYSSVMMAQAILESNNGKSQLSQKPYYNFFGIKGSYK
FT                   ERSVIFPTLEDDGQGNLYQIDAAFRSYGSLTACFLDYARVLNDPLYDKTHKKFWSHYQD
FT                   ATATLTGTYATDTTYHTKLNELIEWYQLTNFDGLMK"
FT   gene            687453..688160
FT                   /locus_tag="M6_Spy0683"
FT   CDS_pept        687453..688160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0683"
FT                   /product="Autolysin"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86818"
FT                   /db_xref="GOA:Q5XCP5"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP5"
FT                   /protein_id="AAT86818.1"
FT                   /translation="MTKKKGKLVLISLFVLAACLGAYSAMRQSHKTSNVSAETIASSST
FT                   RHFIDEIGPTASTIGQERDLYASVMIAQAILESSNGKSSLSQAPYYNFFGIKGAYNGSS
FT                   VTMSTWEDDGNGNTYTIDQAFRAYPSIADSLNDYADLLSSSTYIGARKSNTLSYQDATA
FT                   ALTGLYATDTSYNLKLNNIIATYGLTAYDVANSSAQETGLATSGYVWNEYRRNYTDAET
FT                   LAVDEAWAKRMTY"
FT   gene            complement(688316..688435)
FT                   /locus_tag="M6_Spy0684"
FT   CDS_pept        complement(688316..688435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0684"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86819"
FT                   /db_xref="GOA:Q5XCP4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP4"
FT                   /protein_id="AAT86819.1"
FT                   /translation="MSRKRNSPDNGIMESFFGILKSEMFYGYENNYKSLEDSE"
FT   gene            complement(688638..688757)
FT                   /locus_tag="M6_Spy0685"
FT   CDS_pept        complement(688638..688757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0685"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86820"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP3"
FT                   /protein_id="AAT86820.1"
FT                   /translation="MIFIFGLNKLKALDKYDQLTYNNIDTKSKTAQIELRPKS"
FT   gene            complement(689117..690130)
FT                   /locus_tag="M6_Spy0686"
FT   CDS_pept        complement(689117..690130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0686"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86821"
FT                   /db_xref="GOA:Q5XCP2"
FT                   /db_xref="InterPro:IPR015117"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP2"
FT                   /protein_id="AAT86821.1"
FT                   /translation="MRKRCYSTSAVVLAAVTLFALSVDRGVIADSFSANQEIRYSEVTP
FT                   YHVTSVWTKGVTPPAKFTQGEDVFHAPYVAKQGWYDITKTFNGKDDLLCGAATAGNMLH
FT                   WWFDQNNEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPG
FT                   LSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKL
FT                   LTSRHDFKEKTLKEISDLIKKDKALGLSHTYANVRINHVINLWGADFDSNGNLEAIYVT
FT                   DSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN"
FT   gene            690286..690405
FT                   /locus_tag="M6_Spy0687"
FT   CDS_pept        690286..690405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M6_Spy0687"
FT                   /product="unknown phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M6_Spy0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAT86822"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XCP1"
FT                   /protein_id="AAT86822.1"
FT                   /translation="MVVLKNGRFFDDMLLHEEVSNRRAVIEERREEALMKLDK"
FT   gene            690634..690810
FT                   /locus_tag="M6_Spy0688"
FT