(data stored in SCRATCH3701 zone)

EMBL: CP000013

ID   CP000013; SV 1; linear; genomic DNA; STD; PRO; 904246 BP.
XX
AC   CP000013;
XX
PR   Project:PRJNA12554;
XX
DT   28-AUG-2004 (Rel. 81, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 7)
XX
DE   Borreliella bavariensis PBi chromosome, complete genome.
XX
KW   .
XX
OS   Borreliella bavariensis PBi
OC   Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-904246
RX   DOI; 10.1093/nar/gkh953.
RX   PUBMED; 15547252.
RA   Glockner G., Lehmann R., Romualdi A., Pradella S., Schulte-Spechtel U.,
RA   Schilhabel M., Wilske B., Suhnel J., Platzer M.;
RT   "Comparative analysis of the Borrelia garinii genome";
RL   Nucleic Acids Res. 32(20):6038-6046(2004).
XX
RN   [2]
RP   1-904246
RA   Gloeckner G., Schilhabel M., Lehmann R., Platzer M.;
RT   ;
RL   Submitted (01-JUN-2004) to the INSDC.
RL   Genome Analysis, Institute of Molecular Biotechnology, Beutenbergstr. 11,
RL   Jena, Thuringia 07745, Germany
XX
DR   MD5; 599b6cf2243c755e16d75830aec7a48e.
DR   BioSample; SAMN02603240.
DR   EnsemblGenomes-Gn; BG0047.
DR   EnsemblGenomes-Gn; BG0201.
DR   EnsemblGenomes-Gn; BG0205.
DR   EnsemblGenomes-Gn; BG0206.
DR   EnsemblGenomes-Gn; BG0215.
DR   EnsemblGenomes-Gn; BG0253.
DR   EnsemblGenomes-Gn; BG0397.
DR   EnsemblGenomes-Gn; BG0399.
DR   EnsemblGenomes-Gn; BG0424.
DR   EnsemblGenomes-Gn; BG0425.
DR   EnsemblGenomes-Gn; BG0426.
DR   EnsemblGenomes-Gn; BG0427.
DR   EnsemblGenomes-Gn; BG0430.
DR   EnsemblGenomes-Gn; BG0432.
DR   EnsemblGenomes-Gn; BG0433.
DR   EnsemblGenomes-Gn; BG0469.
DR   EnsemblGenomes-Gn; BG0470.
DR   EnsemblGenomes-Gn; BG0472.
DR   EnsemblGenomes-Gn; BG0473.
DR   EnsemblGenomes-Gn; BG0545.
DR   EnsemblGenomes-Gn; BG0546.
DR   EnsemblGenomes-Gn; BG0581.
DR   EnsemblGenomes-Gn; BG0622.
DR   EnsemblGenomes-Gn; BG0623.
DR   EnsemblGenomes-Gn; BG0624.
DR   EnsemblGenomes-Gn; BG0625.
DR   EnsemblGenomes-Gn; BG0633.
DR   EnsemblGenomes-Gn; BG0639.
DR   EnsemblGenomes-Gn; BG0645.
DR   EnsemblGenomes-Gn; BG0653.
DR   EnsemblGenomes-Gn; BG0712.
DR   EnsemblGenomes-Gn; BG0731.
DR   EnsemblGenomes-Gn; BG0766.
DR   EnsemblGenomes-Gn; BG0767.
DR   EnsemblGenomes-Gn; BG0782.
DR   EnsemblGenomes-Gn; BG0810.
DR   EnsemblGenomes-Gn; EBG00001459093.
DR   EnsemblGenomes-Gn; EBG00001459094.
DR   EnsemblGenomes-Gn; EBG00001459095.
DR   EnsemblGenomes-Gn; EBG00001459096.
DR   EnsemblGenomes-Gn; EBG00001459097.
DR   EnsemblGenomes-Gn; EBG00001459098.
DR   EnsemblGenomes-Gn; EBG00001459099.
DR   EnsemblGenomes-Gn; EBG00001459100.
DR   EnsemblGenomes-Gn; EBG00001459101.
DR   EnsemblGenomes-Gn; EBG00001459102.
DR   EnsemblGenomes-Gn; EBG00001459103.
DR   EnsemblGenomes-Gn; EBG00001459104.
DR   EnsemblGenomes-Gn; EBG00001459105.
DR   EnsemblGenomes-Gn; EBG00001459106.
DR   EnsemblGenomes-Gn; EBG00001459107.
DR   EnsemblGenomes-Gn; EBG00001459108.
DR   EnsemblGenomes-Gn; EBG00001459109.
DR   EnsemblGenomes-Gn; EBG00001459110.
DR   EnsemblGenomes-Gn; EBG00001459111.
DR   EnsemblGenomes-Gn; EBG00001459112.
DR   EnsemblGenomes-Gn; EBG00001459113.
DR   EnsemblGenomes-Gn; EBG00001459114.
DR   EnsemblGenomes-Gn; EBG00001459115.
DR   EnsemblGenomes-Gn; EBG00001459116.
DR   EnsemblGenomes-Gn; EBG00001459117.
DR   EnsemblGenomes-Gn; EBG00001459118.
DR   EnsemblGenomes-Gn; EBG00001459119.
DR   EnsemblGenomes-Gn; EBG00001459120.
DR   EnsemblGenomes-Gn; EBG00001459121.
DR   EnsemblGenomes-Gn; EBG00001459122.
DR   EnsemblGenomes-Gn; EBG00001459123.
DR   EnsemblGenomes-Gn; EBG00001459124.
DR   EnsemblGenomes-Gn; EBG00001459125.
DR   EnsemblGenomes-Gn; EBG00001459126.
DR   EnsemblGenomes-Gn; EBG00001459127.
DR   EnsemblGenomes-Gn; EBG00001459128.
DR   EnsemblGenomes-Gn; EBG00001459129.
DR   EnsemblGenomes-Gn; EBG00001459130.
DR   EnsemblGenomes-Gn; EBG00001459131.
DR   EnsemblGenomes-Gn; EBG00001459132.
DR   EnsemblGenomes-Gn; EBG00001459133.
DR   EnsemblGenomes-Gn; EBG00001459134.
DR   EnsemblGenomes-Gn; EBG00001459135.
DR   EnsemblGenomes-Gn; EBG00001459136.
DR   EnsemblGenomes-Gn; EBG00001459137.
DR   EnsemblGenomes-Gn; EBG00001459138.
DR   EnsemblGenomes-Gn; EBG00001459139.
DR   EnsemblGenomes-Gn; EBG00001459140.
DR   EnsemblGenomes-Gn; EBG00001459141.
DR   EnsemblGenomes-Tr; BG0047-1.
DR   EnsemblGenomes-Tr; BG0201-1.
DR   EnsemblGenomes-Tr; BG0205-1.
DR   EnsemblGenomes-Tr; BG0206-1.
DR   EnsemblGenomes-Tr; BG0215-1.
DR   EnsemblGenomes-Tr; BG0253-1.
DR   EnsemblGenomes-Tr; BG0397-1.
DR   EnsemblGenomes-Tr; BG0399-1.
DR   EnsemblGenomes-Tr; BG0424-1.
DR   EnsemblGenomes-Tr; BG0425-1.
DR   EnsemblGenomes-Tr; BG0426-1.
DR   EnsemblGenomes-Tr; BG0427-1.
DR   EnsemblGenomes-Tr; BG0430-1.
DR   EnsemblGenomes-Tr; BG0432-1.
DR   EnsemblGenomes-Tr; BG0433-1.
DR   EnsemblGenomes-Tr; BG0469-1.
DR   EnsemblGenomes-Tr; BG0470-1.
DR   EnsemblGenomes-Tr; BG0472-1.
DR   EnsemblGenomes-Tr; BG0473-1.
DR   EnsemblGenomes-Tr; BG0545-1.
DR   EnsemblGenomes-Tr; BG0546-1.
DR   EnsemblGenomes-Tr; BG0581-1.
DR   EnsemblGenomes-Tr; BG0622-1.
DR   EnsemblGenomes-Tr; BG0623-1.
DR   EnsemblGenomes-Tr; BG0624-1.
DR   EnsemblGenomes-Tr; BG0625-1.
DR   EnsemblGenomes-Tr; BG0633-1.
DR   EnsemblGenomes-Tr; BG0639-1.
DR   EnsemblGenomes-Tr; BG0645-1.
DR   EnsemblGenomes-Tr; BG0653-1.
DR   EnsemblGenomes-Tr; BG0712-1.
DR   EnsemblGenomes-Tr; BG0731-1.
DR   EnsemblGenomes-Tr; BG0766-1.
DR   EnsemblGenomes-Tr; BG0767-1.
DR   EnsemblGenomes-Tr; BG0782-1.
DR   EnsemblGenomes-Tr; BG0810-1.
DR   EnsemblGenomes-Tr; EBT00001612715.
DR   EnsemblGenomes-Tr; EBT00001612716.
DR   EnsemblGenomes-Tr; EBT00001612717.
DR   EnsemblGenomes-Tr; EBT00001612718.
DR   EnsemblGenomes-Tr; EBT00001612719.
DR   EnsemblGenomes-Tr; EBT00001612720.
DR   EnsemblGenomes-Tr; EBT00001612721.
DR   EnsemblGenomes-Tr; EBT00001612722.
DR   EnsemblGenomes-Tr; EBT00001612723.
DR   EnsemblGenomes-Tr; EBT00001612724.
DR   EnsemblGenomes-Tr; EBT00001612725.
DR   EnsemblGenomes-Tr; EBT00001612726.
DR   EnsemblGenomes-Tr; EBT00001612727.
DR   EnsemblGenomes-Tr; EBT00001612728.
DR   EnsemblGenomes-Tr; EBT00001612729.
DR   EnsemblGenomes-Tr; EBT00001612730.
DR   EnsemblGenomes-Tr; EBT00001612731.
DR   EnsemblGenomes-Tr; EBT00001612732.
DR   EnsemblGenomes-Tr; EBT00001612733.
DR   EnsemblGenomes-Tr; EBT00001612734.
DR   EnsemblGenomes-Tr; EBT00001612735.
DR   EnsemblGenomes-Tr; EBT00001612736.
DR   EnsemblGenomes-Tr; EBT00001612737.
DR   EnsemblGenomes-Tr; EBT00001612738.
DR   EnsemblGenomes-Tr; EBT00001612739.
DR   EnsemblGenomes-Tr; EBT00001612740.
DR   EnsemblGenomes-Tr; EBT00001612741.
DR   EnsemblGenomes-Tr; EBT00001612742.
DR   EnsemblGenomes-Tr; EBT00001612743.
DR   EnsemblGenomes-Tr; EBT00001612744.
DR   EnsemblGenomes-Tr; EBT00001612745.
DR   EnsemblGenomes-Tr; EBT00001612746.
DR   EnsemblGenomes-Tr; EBT00001612747.
DR   EnsemblGenomes-Tr; EBT00001612748.
DR   EnsemblGenomes-Tr; EBT00001612749.
DR   EnsemblGenomes-Tr; EBT00001612750.
DR   EnsemblGenomes-Tr; EBT00001612751.
DR   EnsemblGenomes-Tr; EBT00001612752.
DR   EnsemblGenomes-Tr; EBT00001612753.
DR   EnsemblGenomes-Tr; EBT00001612754.
DR   EnsemblGenomes-Tr; EBT00001612755.
DR   EnsemblGenomes-Tr; EBT00001612756.
DR   EnsemblGenomes-Tr; EBT00001612757.
DR   EnsemblGenomes-Tr; EBT00001612758.
DR   EnsemblGenomes-Tr; EBT00001612759.
DR   EnsemblGenomes-Tr; EBT00001612760.
DR   EnsemblGenomes-Tr; EBT00001612761.
DR   EnsemblGenomes-Tr; EBT00001612762.
DR   EnsemblGenomes-Tr; EBT00001612763.
DR   EuropePMC; PMC2688082; 19513109.
DR   EuropePMC; PMC2743244; 19505540.
DR   EuropePMC; PMC4370689; 25798594.
DR   EuropePMC; PMC4507553; 26273276.
DR   EuropePMC; PMC4939628; 27400788.
DR   EuropePMC; PMC5025617; 27632983.
DR   EuropePMC; PMC534632; 15547252.
DR   EuropePMC; PMC5445278; 28545549.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000013.
DR   SILVA-SSU; CP000013.
XX
CC   -------------- Genome Center
CC        Center: Institute of Molecular Biotechnology
CC        Center code: IMB
CC        Web site: http://genome.imb-jena.de/
CC        Contact: gscj-submit@genome.imb-jena.de
CC   -------------- Project Information
CC        Center project name: PBi_chr
CC   -------------- Summary Statistics
CC        Sequencing vector: pUC18; 100% of reads
CC        Chemistry: Dye-terminator Big Dye; 100% of reads
CC        Assembly program: Phrap; version 0.990329
CC        Consensus quality: 785024 bases at least Q40
CC        Consensus quality: 839235 bases at least Q30
CC        Consensus quality: 874907 bases at least Q20
CC        Coverage: 3.38
CC   --------------
CC   Annotation:
CC   Genes are annotated according to the Borrelia burgdorferi B31
CC   orthologs (AE000783.1).
CC   --------------
CC   Sequence Quality Assessment:
CC    This entry has been annotated with sequence quality
CC    estimates computed by the Phrap assembly program.
CC    All manually edited bases have been reduced to quality zero.
CC    Quality levels above 40 are expected to have less than
CC    1 error in 10,000 bp.
CC    Base-by-base quality values are not generally visible from the
CC    GenBank flat file format but are available as part
CC    of this entry's ASN.1 file.
CC   ----------------------.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904246
FT                   /organism="Borreliella bavariensis PBi"
FT                   /strain="PBi"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290434"
FT                   /type_material="type strain of Borreliella bavariensis"
FT   gene            complement(443..526)
FT                   /locus_tag="BG0001"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(443..526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06860"
FT                   /db_xref="UniProtKB/TrEMBL:Q663B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06860.1"
FT                   /translation="MFKIFYGINIEIPRSKRINSLKEVDNL"
FT   gene            complement(629..1648)
FT                   /locus_tag="BG0002"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(629..1648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0002"
FT                   /product="beta-N-acetylhexosaminidase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0002"
FT                   /db_xref="EnsemblGenomes-Gn:BG0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06861"
FT                   /db_xref="GOA:Q663B0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q663B0"
FT                   /protein_id="AAU06861.1"
FT                   /translation="MGFLKALSFIFFCLNLFAIESLPEIDYEYFNKDKSDLVDLIRFLG
FT                   EFDFQTILKDRRLFIGIRNLTNFKNVQGLNADDINRIKKINPIGIILFRENLKDAEQTK
FT                   GLISAIKSHIGHDIFIAIDEEGGIVSRASENKKMGVYNFPAMEYVGNVKDLHLIYKIGE
FT                   VLAKQLRRLGINLNMAPVADIKFIPHTPLLNRTFGGYSAYNIGLMVEAFIDGMQNHGVF
FT                   SAIKHFPGLGGITTDTHKYLAFLPYSKSFLMLNNFVPFVFGKTSKFIMIGHANVPKISK
FT                   DITSMSKSIVNIIRENLNITSIMITDSYNMGAITRSFSNIENAIKKSLSSGINIVLIP"
FT   gene            complement(1636..3114)
FT                   /locus_tag="BG0003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(1636..3114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0003"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0003"
FT                   /db_xref="EnsemblGenomes-Gn:BG0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06862"
FT                   /db_xref="GOA:Q663A9"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06862.1"
FT                   /translation="MNVKVDKIFSEMILEKLNSGEIGINNFESIKYFPCDSHENIFNIS
FT                   DKILKFKLNKNLVEDNLKKYFYDFSKFLHSEEGDCYIFSSCDLENLGLILFPYLSFGIL
FT                   NGGSATSYFDLAKNRELNKDLYILYESKILEFKEKFGELPKGMTPAYINKDGSLGFSFF
FT                   ALKIRHLLMVAKKYESFYGRMIKPSIFQMTSCKTDEFISKFLEHLFADNLIKSVNFCNL
FT                   KKEDILTAIQPLIYCYEKLNGSKYQYFTFKDNKNDYSILACPAGHGQNFKILKDFYLQL
FT                   YESGKRFVYIGNVDNMGFTINFKALAIMALTNCSSGFEFSFKSKTDFKGGVLAVNSENR
FT                   LTCVDIGGGISSEIIQEFENKGNKLLFNCATGLFNLEYLIKNIDKIIEKMPIRIIEQDK
FT                   EVGKYISVEQITWEVLKLMENPLILTVDRSKRFLPAKLFIDMLLNSNYLEDRYKYCCRK
FT                   RVGNSNATKDLYCSLSTLLSKDYGLLNGCCRWAF"
FT   gene            3254..5041
FT                   /gene="femD"
FT                   /locus_tag="BG0004"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        3254..5041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femD"
FT                   /locus_tag="BG0004"
FT                   /product="phosphoglucomutase"
FT                   /note="ortholog to Borrelia burgdorferi BB0004"
FT                   /db_xref="EnsemblGenomes-Gn:BG0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06863"
FT                   /db_xref="GOA:Q663A8"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A8"
FT                   /protein_id="AAU06863.1"
FT                   /translation="MLKQYSLNMKNFKKAFDEMIFSASGFRKIFAKSKDEDSTENEIAN
FT                   EDKVLIALIFFTISNYFKIESRPYIGLGLDSRPTGNIIAEITIKILITSKEKIKFFGIL
FT                   PITEILACTKNSKDSKGFIYISASHNPAGYNGIKIGLNDGGVLNSAKTQEIIKQIKNNS
FT                   QNENLIKHLINTLNKFDEDKSHLEYYKKTIKLEKENKNQSYEVYKSLIHEIAYENDINN
FT                   KNIEILKKRILKNPIGIIAEMNGSSRINSIDKELIESLGLKIELHNDKMGIFKHNIIPE
FT                   GKSLNECKKLLQKKYIKDNSFELGYVPDCDGDRGNLVFIDKVTNTPSIIEAQKIFALVV
FT                   ISELSYLYYTGIKNNIAIVTNDATSLNIEKIANFFNAKVYRVEVGEANLTEMADDLRAQ
FT                   GFTVKISGEGSNGGCIIYPSRVRDPITTLLSIVKLLKMKELYQIWCKLSKNYYKEKYSL
FT                   KDILNTTNFYSNVIVSSKKANLTNLKIENQEILKSNYENLLIKEIKSNKLFQELSIVDY
FT                   EIINYEGKIQSKIRTGDASGGLKVLLKTNKEIVATLWMRISKTEPVTRVLSEVIYTKRN
FT                   ALFKLLEFNKRLIKKANLL"
FT   gene            complement(5126..6163)
FT                   /gene="trsA"
FT                   /locus_tag="BG0005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(5126..6163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trsA"
FT                   /locus_tag="BG0005"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0005"
FT                   /db_xref="EnsemblGenomes-Gn:BG0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06864"
FT                   /db_xref="GOA:Q663A7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A7"
FT                   /protein_id="AAU06864.1"
FT                   /translation="MKRKVMLTGDRPTGALHLGHYVGSVVNRLKFQEEYETYFIIADLH
FT                   TLTTKPDLKSINTIPFNVREMVLDYLACGINPNKVSIYLQSAIPELFELYLMFSMIVTV
FT                   ARLQRIPSIKDMSIAAGLKEIPYGLLGYPVLMSADILMAKANLVPVGRDNESHIEFARE
FT                   LARRFNHLYENNFFPIPESVFTDSRPLVGICGKNKMSKSLDNAIFLKDDENLLEKKIMS
FT                   MYTDPNRIRADIPGNVEGNPVFIYHSIFNSNHEEVEDLKSRYKKGKVGDVEVKKKLFLA
FT                   LNSFLKPIRDKRSFYEAQKKDYIDEIIFDGTSKTRFIANKVVKEVKDLVGLSKTWNGIK
FT                   YSVEK"
FT   gene            complement(6166..7254)
FT                   /locus_tag="BG0006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(6166..7254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0006"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0006"
FT                   /db_xref="EnsemblGenomes-Gn:BG0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06865"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A6"
FT                   /protein_id="AAU06865.1"
FT                   /translation="MFKDLNTNQGLRPWRVESVFYFIVIVLIFIGAFKIAEAVFKPLAI
FT                   SIVLGFLVYPVYTFLARFKVPKFLIVFIIFFLLFSFSYLIFIFVYYSVTVLMRQLPYYQ
FT                   NQLAFIMKDVLSRYKVDSSVINDMNFSGYIYPFLTRASNEIIGFTSSLVVVFLLLYFLL
FT                   SEIHVFGMKLDKVFKKRVSTRFIGALDTINNQIGKYLGIKILMSCLTGILVFIGLTLFG
FT                   QDFPLVWAVLTFVFNFIPSIGSILAVFFIVITSLIQFYPNLNIVLYIFIYNTSVQMLIG
FT                   NILEPKMQGKRLDISPFLLLCFLFFWGWLWGIVGLLIAYPFTVIVKVIVDNVSWLKSFS
FT                   VFLGGSEILSNISHVSGKDKEI"
FT   gene            complement(7308..8168)
FT                   /locus_tag="BG0007"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(7308..8168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0007"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0007"
FT                   /db_xref="EnsemblGenomes-Gn:BG0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06866"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06866.1"
FT                   /translation="MNERENIIALIFDFDNTLIYGNMQQVLFDEYCVDSCSFWKEVESL
FT                   EHVYKQNGYNIISNEMIYLSHFLTYVREGFFKSLDNRALFNLGAKLRFFEGVIDLFDEI
FT                   SKINKKLENNNSQIKIYIVSSGFRQMILGSKIAPYLSKVWACEFIDSYLMPFYELRDEK
FT                   FSKNKVLSSVCYFVDHTIKTRVIFEINKGSYEKINDRVPKSKREIPFKNIFYIADGFND
FT                   IPAFEILNNILNHCKNTLTVYHGNDKNAKKLFYENRVGDFAEANYSKGTKLYNWIMEKI
FT                   CLSCN"
FT   gene            8277..9047
FT                   /locus_tag="BG0008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        8277..9047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0008"
FT                   /db_xref="EnsemblGenomes-Gn:BG0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06867"
FT                   /db_xref="GOA:Q663A4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06867.1"
FT                   /translation="MIDINDLNHIKDTFSRILDLSLISILVYYIYKNVINSYSTNLLKG
FT                   MLIITSIGIISYYLNLYTIGWLLNYIANILPITIVILFNQEIKKIIMKIGNFNLAFKLS
FT                   NKKEETLKVISEILKAVKHLSENKSGSLICIEKKIQLEQIINKGTKIDALISSELLISL
FT                   FERETPLHDGAVIISKNKLKYAGSFLPLSNVDSISKAFGTRHRAGLGISENSDAITIIT
FT                   SEETGSISITVNAKLEYNLNLNEIRNKLNLELIE"
FT   gene            9052..10056
FT                   /locus_tag="BG0009"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        9052..10056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0009"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0009"
FT                   /db_xref="EnsemblGenomes-Gn:BG0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06868"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06868.1"
FT                   /translation="MKISKKITNIIKLLFDDWQNKAIAILIAILMFVAFNFNKIESITT
FT                   EKEFKIILNDQIALGKVPDFSKVKITIKVNKDDLKYLDLNKIILFIEASKIKIPGKYKL
FT                   PIKIKNLNSIHIAEYKLSKTNVLLNLDNKISKSVKIEPKFKLIEKDSKGEYFIAKYNIL
FT                   PENLLVYGPEQELKKINTIQTNVKEFDTRTLFVSDYLEVVPPNPLVMLEKSHVVINIYL
FT                   NKKYSNTTIKSPNLIFNNLKNGLAIKDIEKIINSENKMFVKIKTRLSEKQIKTHINNQN
FT                   IGLAFDLSSIKTPGIYNITTNIILKENINETEIYDYEPKKIKLEIIESSEIKP"
FT   gene            10053..10427
FT                   /locus_tag="BG0010"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        10053..10427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0010"
FT                   /product="holo-acyl-carrier protein synthase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0010"
FT                   /db_xref="EnsemblGenomes-Gn:BG0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06869"
FT                   /db_xref="GOA:Q663A2"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663A2"
FT                   /protein_id="AAU06869.1"
FT                   /translation="MKSIGCDIIKVGRFKNFLENKKKLERFFTHKEIENFKLKGGSVIE
FT                   SLAGKFAAKESLIKALSPLLQHKIHYGLKDIEVIKSLKGNAKFYLHNEIEKFAIKMNLK
FT                   IYLTISHEKEYAIAFVMVEN"
FT   gene            10431..11270
FT                   /locus_tag="BG0011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        10431..11270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0011"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0011"
FT                   /db_xref="EnsemblGenomes-Gn:BG0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06870"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:Q663A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06870.1"
FT                   /translation="MKKISYFTKEKIECPVCSFKFQKEELLTGSSRLIAGELKIDLKRE
FT                   YIKNNKYGNIYPRIYSITVCPKCYFATFPSEFNSIPKNKKEILQNKKSERKKINAIFDD
FT                   MINFSKSRTLKEGAASYILAMLCYEHLEKNHNPTLNQAKSAIRAAWTFEDLEKEEPNKN
FT                   YNYLQKIFYHKAAYLYKLVIEKDKDNSEPVSASTIFGPDTDKNYGYDSVLYLSGLLEYF
FT                   YGNKDNKEYRYKQLNDIKTTLSKIAGMGKSSKEKPSILLDKIKEVYFKISKEMKNLK"
FT   gene            11271..12011
FT                   /gene="hisT"
FT                   /locus_tag="BG0012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        11271..12011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisT"
FT                   /locus_tag="BG0012"
FT                   /product="pseudouridylate synthase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0012"
FT                   /db_xref="EnsemblGenomes-Gn:BG0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06871"
FT                   /db_xref="GOA:Q663A0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663A0"
FT                   /protein_id="AAU06871.1"
FT                   /translation="MKKILAEITYDGSIYHGFQIQPTKPTIQGEIEKALMKINKKKVKI
FT                   HSSGRTDKGVHAKKQIITFDININIQLNNLKKALNAILLKNSIKILKLKYMKNSFHPRF
FT                   NAQKRKYSYRILNSNNYYPWEGYQAHYVNKKLNISNLNQMAKILIGNHDFTTFSCIKDK
FT                   SKSKFRHIYLAKFKKRGKYIIFEIIGSSFLWKMVRSIIGTMLDIEIKNESISTFETILK
FT                   SKNRNLARTTAPANALFLDKVYYE"
FT   gene            12004..12594
FT                   /locus_tag="BG0013"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        12004..12594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0013"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0013"
FT                   /db_xref="EnsemblGenomes-Gn:BG0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06872"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06872.1"
FT                   /translation="MSNNILTKKLFLLKILTNNIEGKITENFEKINNEIKQKIEKVKIY
FT                   QKNENSEATTEISTKNKNLTNLLSNSSLQKKSINDYIIIYVNKNYLDEPSRDIIVKWCK
FT                   SINMHNYKIIDTIESLNLEISNKNLKAILSCEEIDFFLNQPLRIQIVRGIELRFKGIPL
FT                   VFTYLPTNQIKNPELKKEIWQDLKIIKGIIKYG"
FT   gene            12587..14569
FT                   /gene="priA"
FT                   /locus_tag="BG0014"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        12587..14569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BG0014"
FT                   /product="primosomal protein N"
FT                   /note="ortholog to Borrelia burgdorferi BB0014"
FT                   /db_xref="EnsemblGenomes-Gn:BG0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06873"
FT                   /db_xref="GOA:Q662Z8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z8"
FT                   /protein_id="AAU06873.1"
FT                   /translation="MDEHYHSTYYYEIAINIPLNKLFIYRSNLNLEIGIRVMVNFNGSN
FT                   KIGIITKKYPKSEFKEKFEFKIKEIIKIIDKTKIITEHNIDLAHWISRKTFSGFGETLF
FT                   FGLPKNSKSEKNQTLPSINEYPDHKKHLQLNNEQQNIYKEIIGSEKNNVFYLFGIPGSG
FT                   KTEIFIKLCEYYLTLEQQVLFLIPEISLGYQIIKRIKYALNMHHKIYEYNSKVSNSNKN
FT                   LIWNKVKNGESLIVVGIKSVLMLPFTKLKLIIMDEEHETTYKSENIPRFHSRHISFFLQ
FT                   KKFNAKFIMGSATPSLEAYHAMKHNQIKKIIMQNKFFQSKIEDIKIINMKKEPSTISSE
FT                   LLYSIQKSLNKKRQSLIFINKRGYLKNLECNECGHTIYCPNCSFSLIYHKKENKLLCHY
FT                   CSYKTKTASNCPQCESKDIKYKTYGIQLVEKELKKFLPNAKIARIDSDITKIENIDSII
FT                   KFENKEIDILIGTQIIAKGFNFKNIKTLGIINADIGIGLPDFRSSERIFTTLSQIMGRA
FT                   ARFKDDNTIIIQTKNPNYYAIKCAYKNQYEEFYEQELDIRKKLNYPPFNKIIRIIFRSK
FT                   NEESAKQKCWEFFEKSKEFLQEGIEHLGPSEAIMKKISKNYRYNIIYLSKSYGLLEKLV
FT                   NKTREKVKLTNTVYIEIDYYPISLI"
FT   gene            complement(14566..15186)
FT                   /gene="udk"
FT                   /locus_tag="BG0015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(14566..15186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="BG0015"
FT                   /product="uridine kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0015"
FT                   /db_xref="EnsemblGenomes-Gn:BG0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06874"
FT                   /db_xref="GOA:Q662Z7"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Z7"
FT                   /protein_id="AAU06874.1"
FT                   /translation="MAKIIGISGGSGSGKTTVVSKISEFIPEFVLISQDNYYKSVGDYE
FT                   YEFSKVNFDHPDAFDNNLFYEHLKNLKKNSPIDMPLYDFINHKRQLKTVMVVPTPVIIV
FT                   EGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLKRDISKRGRTLESVIDQYLNTTRWGY
FT                   YRFIEPTKEYADLIIPEGGHNDKALYVLSTFLKSLSKEGLDFV"
FT   gene            complement(15186..15467)
FT                   /gene="glpE"
FT                   /locus_tag="BG0016"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(15186..15467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="BG0016"
FT                   /product="glpE protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0016"
FT                   /db_xref="EnsemblGenomes-Gn:BG0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06875"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z6"
FT                   /protein_id="AAU06875.1"
FT                   /translation="MLEKIKNGAKILDIRSPKEYSKSHYFKSINIPFNNLFAKKDKLGD
FT                   FESQIIVYGKSFNKSYEAKKVLKSMGFKNVFVAGTLKDMPQTKREEVS"
FT   gene            15690..16655
FT                   /locus_tag="BG0017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        15690..16655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0017"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0017"
FT                   /db_xref="EnsemblGenomes-Gn:BG0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06876"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z5"
FT                   /protein_id="AAU06876.1"
FT                   /translation="MKKKKKISSRRIKKKLKLLFIIVAKKIKTITKNPKLIFDSTIQIT
FT                   LGSALMAISTNVLYIPHGLLSGGIGGIALMLHYLLSFNLGWTIFALNIPLFLIGIKFLN
FT                   ITFIIQSWIAMGLYSIVINYSQFLQNKIHLNDMMLVSILAGLISGLGLGLIFKGKGSSG
FT                   GSDIIAMIIKEKYSISIGTTNFIVNLAVLILATFFFNIEIALYTLIASFVTSIMTDKTS
FT                   TGFGNQKAILIISDKGKEIAYLLTNKLKLAATLIDGKGAWAGTEKTIVFIVVPIMRLSR
FT                   IKYISQKVDPNCFITVINTNEITGGKIIPDSISSKQEISN"
FT   gene            complement(16652..17635)
FT                   /locus_tag="BG0018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(16652..17635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0018"
FT                   /db_xref="EnsemblGenomes-Gn:BG0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06877"
FT                   /db_xref="GOA:Q662Z4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06877.1"
FT                   /translation="MIRLKKEFTVKENALRLDLYLSNNLEVFTRSQIKRRNVEAFKKSN
FT                   GKFFNIKLSKPVLKNDEILIEFDEEESSQIDYLRPNNIPITIIYEDSNIIVLNKPQGIL
FT                   SHPGISHWDDTVVNFLLYHIKRLKINFNEEKVRPGIVHRLDKDTSGVLICAKNINTLSF
FT                   LAQQFKDKRTNKVYIAIVKGNFNSFSGSIESFIDRDKYNRKKFSVSKDRGKKALTEYRL
FT                   LLNFRGYSLLALKPKTGRTHQLRVHMKYLNFPILGDEVYGRVDSSFKTATLMLHSYKLE
FT                   VDVGKNSFKKFISEFPKRFVIFLSNFYKSDELNLIIDNLVLFLKDF"
FT   gene            complement(17637..18149)
FT                   /locus_tag="BG0019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(17637..18149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0019"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0019"
FT                   /db_xref="EnsemblGenomes-Gn:BG0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06878"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06878.1"
FT                   /translation="MLIGSLLLFFSVLNVYSNSLDYSKLNFNYLKLSIAKSLPLQDKLT
FT                   SSGNFASQKKNNIPVFDKDDSFLYKNIQENKALNLENDLESKSAKDLFRFSAISIGSFP
FT                   IVLFLSLFFFDVGYYFYSGMNANYVPYPFSNGPSFSKDEIYKKFIISASIGAMVALTIA
FT                   LIDYLLQ"
FT   gene            complement(18157..19827)
FT                   /gene="pfpB"
FT                   /locus_tag="BG0020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(18157..19827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpB"
FT                   /locus_tag="BG0020"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase, beta subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0020"
FT                   /db_xref="EnsemblGenomes-Gn:BG0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06879"
FT                   /db_xref="GOA:Q662Z2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Z2"
FT                   /protein_id="AAU06879.1"
FT                   /translation="MNTSLFQQERKKYVPKLPNILKKDFKNISLVYGEKTEAIQDRQAL
FT                   KEFFKNTYGLPIVSFTEGESSNLSFSKALNIGIILSGGPAPGGHNVISGIFDAIKKFNA
FT                   NSKLFGFKGGPLGLLENDKIELTESLVNSYRNTGGFDIVSSGRTKIETEEHYDKALLVA
FT                   KENNLNAIVIIGGDDSNTNAAILAEYFKKKGENIQVIGVPKTIDADLKNNHIEISFGFD
FT                   SATKIYSEMIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAK
FT                   KKTLFEIVDEMVFVILKRSLNGDNFGIVIVPEGVIEFIPEVKSLMVELCNIFDKNIVEF
FT                   KGLNIEGMKEVFVAKLSDYMKKVYLSLPLFIQFELVNSILERDPHGNFNVSRVPTEKLF
FT                   IEMVQARLSEMKKRGEYKGSFIPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAAILILNG
FT                   LTGYMSCIKNLNSKPTDWIAGGVPLTMLMNMEERYGVQKPVIKKALVDLEGRPFKEFVE
FT                   NRDKWAFNNLYLYPGPVQYFGSSEIVDEITETLKLELLK"
FT   gene            complement(19905..20945)
FT                   /locus_tag="BG0021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(19905..20945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0021"
FT                   /product="S-adenosylmethionine: tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0021"
FT                   /db_xref="EnsemblGenomes-Gn:BG0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06880"
FT                   /db_xref="GOA:Q662Z1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Z1"
FT                   /protein_id="AAU06880.1"
FT                   /translation="MKTKEFHFNLPYSLIAQYPSEKRGSSRLMVLDPKLQKIYHENSVN
FT                   NILKYINSDTFIIFNNSKVRKSRMYAESELGNNIEFLILDRIGTDLFTALISKSKKQIV
FT                   GNVYKFPEGLMGEILSKNNSEIVLKFDNNVDEDYFEKHGFVPIPPYIKRDYDKIDEDRY
FT                   QTVYSKYVGSAASATAGLHFSRDLFSTFEKNNIEYDFITLHVGLGTFLPVRSKKVEEHN
FT                   MHFETFLIEDCVATRLENAKFLGKKILSIGTTTLRALESSYDNKLKKFKTGQQSTNLFI
FT                   YPGKNYCFKFVDMLFTNFHTPQSTLLMLVSSFAGKDFVFSSYEEAINKGYKFFSYGDAM
FT                   LVLNHI"
FT   gene            complement(20920..21963)
FT                   /gene="ruvB"
FT                   /locus_tag="BG0022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(20920..21963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="BG0022"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="ortholog to Borrelia burgdorferi BB0022"
FT                   /db_xref="EnsemblGenomes-Gn:BG0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06881"
FT                   /db_xref="GOA:Q662Z0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Z0"
FT                   /protein_id="AAU06881.1"
FT                   /translation="MKDENSINFLSSNESYLYDKSENELRPKVFEDFKGQVNVKETLSI
FT                   FIRASKERGEALDHVFLSGPPGLGKTTLASIIAFEMNASIKITSAPAFDKPKDIIGILT
FT                   GLDEKSILFIDEIHRLRPIIEEMLCIAMEDYELDWVIGQGANARTVRMPLPKFTLIGAT
FT                   TKPGKVTSPLYARFGITARFELYSEIELVEIIKRNSIILNIEIEEDAAFLLARSSRGTP
FT                   RIANRLLRRIRDIAQVTGSLVVTSDIVSIGLEMLRIDGEGLDEQDRNILRSLILKFNGG
FT                   PVGVDTLAISVGETADSLEDFYEPYLIMKGFINRTHRGRKATEFAYLHLNLEMKEEDIS
FT                   ENQRVSF"
FT   gene            complement(22008..22598)
FT                   /gene="ruvA"
FT                   /locus_tag="BG0023"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(22008..22598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="BG0023"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="ortholog to Borrelia burgdorferi BB0023"
FT                   /db_xref="EnsemblGenomes-Gn:BG0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06882"
FT                   /db_xref="GOA:Q662Y9"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Y9"
FT                   /protein_id="AAU06882.1"
FT                   /translation="MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFKLSDKVE
FT                   LFTYLYARENELKLFGFLNSDERETFKSLIGVSGIGPRAALRVLSNIRYNDFKEAIDRE
FT                   DVELVSKIKGIGKKMAGKMFLHLQGKLLINNELESSLFGFKELEESIVSMGFDRKIVNS
FT                   KLKEACDLIEFSNLKDSEKEQFLFKEVLKRMSN"
FT   gene            22668..23807
FT                   /locus_tag="BG0024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        22668..23807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0024"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0024"
FT                   /db_xref="EnsemblGenomes-Gn:BG0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06883"
FT                   /db_xref="GOA:Q662Y8"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06883.1"
FT                   /translation="MKNQFLYSYFLLITSIFLISSITIAAEETTTALKVLNGFKVEIFL
FT                   NNTIEKPRGITSDQDGNIFIGSGSTFAYFVTKNKKIYTIAKTLKKPIGIAYWENKLYIS
FT                   SVDKIYVVKNVKEEINKSIKANKDYTWKMQIFSLLPKNTTKMHAGRYIKVDPKNNKLIV
FT                   NIGSQHNAKIPQKKEAIILSIDLKTKKEEIIAFGVRNSVGFDFHPISNEIYFSDNGQDR
FT                   LGDNIPPDEINLIIKDKEHFGFPYMFGKNQKNYNFYNKAPKNTKFSPSIYELPAHVAPL
FT                   GIHFYQGNNFPKEYINKLFIAEHGSWNRSSPVGYRITTLDIDPKKRIAKNYKVFLSGFL
FT                   KHDNSKFGRPVDIITYYDGSILFSDDFGNKIYRVYYEKI"
FT   gene            complement(23822..24553)
FT                   /locus_tag="BG0025"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(23822..24553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0025"
FT                   /db_xref="EnsemblGenomes-Gn:BG0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06884"
FT                   /db_xref="GOA:Q662Y7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06884.1"
FT                   /translation="MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDVES
FT                   NPRLRVAVNKAKVANMPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTD
FT                   NKNRTSSDVKSVLAKGGGSLGTPGSVSYMFYRKGLIVYNLEKYLEDEIMEFALEAGVED
FT                   ILVSNNEAEVITSPDDFDKVLSFLKTKFKEEMAEVALIPENKISLNKEQAEKIILLIEK
FT                   LEDFDDVQEVIHNLEIPEELS"
FT   gene            complement(24554..25459)
FT                   /gene="folD"
FT                   /locus_tag="BG0026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(24554..25459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BG0026"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /note="ortholog to Borrelia burgdorferi BB0026"
FT                   /db_xref="EnsemblGenomes-Gn:BG0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06885"
FT                   /db_xref="GOA:Q662Y6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Y6"
FT                   /protein_id="AAU06885.1"
FT                   /translation="MNTVFNGKDFANKYYLILKEFLKQHDLRDKIALKVVLANNEPASK
FT                   LYVSIKNRVAKEIGLNVEVIKFSANSVQSDILEVIDRENKNLSTDGIIVQLPLLRHMDS
FT                   NSILNSIVYSKDVDGLSFVNLGKMILGDKKGFIPCTALAVLKILLDEGIRTSGKTVVVV
FT                   GRSPLVGKPISILLSSKPYDATVIVCHSKSIYLDVYLRQADIVISAVGKPKLIDKSMLC
FT                   GEPYVIDIGISEIETDNGKILSGDTDFDNIKDCVKFITPVKGGIGPVTVLMLMFNTIKA
FT                   HLINNNMFDILDRLEKLVEV"
FT   gene            25610..26248
FT                   /locus_tag="BG0027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        25610..26248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0027"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0027"
FT                   /db_xref="EnsemblGenomes-Gn:BG0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06886"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06886.1"
FT                   /translation="MKKYFFITLIAVLLIGVNIKKIEAAVNIDRHTNSTLGIDLSVGVP
FT                   IFYNDLSRAYPTNLYPGGIGAIKYQYHILNNLAIGLELRYMFNFDINHSFNILNPDSSV
FT                   GKIFYSVPITFSINYIFDVGELFQIPVFTNIGFSLNTYGDRNNNITNLRTFDALPTIAF
FT                   GSGILWNFNYKWSFGATTSWWMMFEFGNSAKMAHFALISLSVTVNVNKL"
FT   gene            26256..27305
FT                   /locus_tag="BG0028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        26256..27305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0028"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0028"
FT                   /db_xref="EnsemblGenomes-Gn:BG0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06887"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y4"
FT                   /protein_id="AAU06887.1"
FT                   /translation="MKQKYENYFKKKIILNLLIFLILTCSSESIFSQLGNLQKIKHEYN
FT                   ILGSSSPRGISLVGETLYIAAMHLFKKENGKVEKIDLSDSYEFINDIVNVSGKTYLLAQ
FT                   NKKAELEVCELNGKDWALKFKKPLKAYKFLKSVGNDGIKEAYILAIDKNNQERIFNLQG
FT                   VDKTPSQATKNDKFYQISNEGNLITGNSLKIWQIHNNTYTNIDYQQAKEIMPIIKTNIR
FT                   GFSEILVMTGGYNSLETKFKMYSDANNYTTPIFIQEEVGEFSGYFAREFNDVILIGSNN
FT                   GFAEFTKNKEGIFALQAPSKSVEPGAYNGSHLSKTGLNDIIPVSNNTIYILTQGKGLWK
FT                   LENKKLTKE"
FT   gene            complement(27291..27722)
FT                   /locus_tag="BG0029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(27291..27722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0029"
FT                   /db_xref="EnsemblGenomes-Gn:BG0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06888"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06888.1"
FT                   /translation="MLNKIFVDADSCNFKIIKFLQKFILHNKSKLIVVSNKFLSLEKTE
FT                   NVFLEVVDDVDAFILNLADRYSLVITRDIFFAKLLLDLGVKVMNDEGQIFNINNINYLY
FT                   FRSKINLNFQIKIKKYYDVDFNKFRYEKFITNFYSLFFS"
FT   gene            complement(27712..28347)
FT                   /gene="lepB-1"
FT                   /locus_tag="BG0030"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(27712..28347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-1"
FT                   /locus_tag="BG0030"
FT                   /product="signal peptidase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0030"
FT                   /db_xref="EnsemblGenomes-Gn:BG0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06889"
FT                   /db_xref="GOA:Q662Y2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y2"
FT                   /protein_id="AAU06889.1"
FT                   /translation="MAPYLTFEQRLLRKRQRKIFLKYVLTFLMLNFFFTKFILQIFMIK
FT                   GNEMLPTITKNASLFFVATHITSFFIPLKMNDIVLYEDFRLSNNFLLTLIKDFFFLNKI
FT                   FKRASYKVSRIAAVQGDYVYVRGLNVLVNKKDTDFFYLNGNLVSYYKLNNFFNTDEVVK
FT                   CFILKKNEVFLLNDNLSVLNDSRIFGPINKNAIVSFLAFRVVDYKIVK"
FT   gene            complement(28349..29329)
FT                   /gene="lepB-2"
FT                   /locus_tag="BG0031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(28349..29329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-2"
FT                   /locus_tag="BG0031"
FT                   /product="signal peptidase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0031"
FT                   /db_xref="EnsemblGenomes-Gn:BG0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06890"
FT                   /db_xref="GOA:Q662Y1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y1"
FT                   /protein_id="AAU06890.1"
FT                   /translation="MSLRRLDNFASFLVYSVEKYLTYRKRKKYFCKLRAKKRGFLLNFL
FT                   FDFVAAAIFVLVINQYFVQAYKIPSGSMENTLQIGDFLFVDKFSYGPELLPGLFKINGF
FT                   KAPEESDVIIFENPEYKSKGVFFDIFQRILYMLTLSFIDLDRDEYGNPNVRFLVKRGVF
FT                   ADGKIVRFNSGKAYIKREGEENFILEDSYRDLVDQNFNIKKIVANEDYGIYGDFAMFVA
FT                   LSQLNINLSSIPDFSFFDVRVIDRFEFERLEYKYLSAFMPYVDYYMEKAIIRDYGIYVP
FT                   YGYILPIGDNRDNSHDGRFFGVINKNKVLGKTLIIYLPFSRVGFI"
FT   gene            29400..30863
FT                   /locus_tag="BG0032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        29400..30863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0032"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0032"
FT                   /db_xref="EnsemblGenomes-Gn:BG0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06891"
FT                   /db_xref="GOA:Q662Y0"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Y0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06891.1"
FT                   /translation="MKEIDENSNIDLFEVKLKPILGIVPKVYVFLTTIILLLSLVSILI
FT                   IIPKFKNPGAYLKINSNIENTYIYLNEKYIGRTPLNKYINTTEGILKAKRMGFKTYEQN
FT                   IKIHNKFFGSYNLQINLELVDPEKIIEQRQKELSIMVKIKNTNENTKLIPVFSLISSEL
FT                   KEHPEYIKKFLKDSIPYLNSIEMFKDFLDSYKVVYSIDQSNSNQEEIWNSLKTNFDLEN
FT                   RANPLFLENLDKDLKILTKNKPWIKKLTKTLDNENIQLISKNEKINIKLPRFKKINSNK
FT                   IEKIQNYKLDSKNISLKSTYSIKEFLIQEQNVTKYEYQDFLKENPKWTLNNKENLIKEQ
FT                   LVDENYLKNFNQIGLNEAITGISYFSAMEYANWYSKKLPKGFKARLPISQEWELYQKEP
FT                   NKKSLNINEISKKVGFWNLMQNSSFNDIAMFKNEKNFYNENSNFYSLVTEVRTYSHKNN
FT                   NLINPSTKASFLKNWSSPNIGFRLIVSKE"
FT   gene            30875..31327
FT                   /gene="smpB"
FT                   /locus_tag="BG0033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        30875..31327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BG0033"
FT                   /product="small protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0033"
FT                   /db_xref="EnsemblGenomes-Gn:BG0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06892"
FT                   /db_xref="GOA:Q662X9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662X9"
FT                   /protein_id="AAU06892.1"
FT                   /translation="MNTNTLLLENKKAKFNYFIEEKVSCGIVLKGTEVKSIKAKKLSFN
FT                   NSFASIKKEEFWLENLHVSKYKEGNIFNHDELRPRKLLIKKQELQRLKKFKEKEGYTLI
FT                   PISFYLKKSIIKVEVGICKGKKLYDKREILKQKSIKKDLSREIKYK"
FT   gene            complement(31401..31934)
FT                   /locus_tag="BG0034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(31401..31934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0034"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0034"
FT                   /db_xref="EnsemblGenomes-Gn:BG0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06893"
FT                   /db_xref="InterPro:IPR008420"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06893.1"
FT                   /translation="MNKFLIFILVTFCAFSSFAQDDSKSTFNLGVGEKFLVYETNKKDS
FT                   LVPFLLNLFLGFGIGSFAQGDILGGSLILGFDAVGIGLILTGAYLDIKAFDNNAKKADF
FT                   KWTWGKGMMLAGVVTMAVTRLTEIVLPFTFANNYNRKLKNSLNIALGGFEPSFDINMGQ
FT                   ASALGFGLSFKKSY"
FT   gene            complement(32002..33882)
FT                   /gene="parC"
FT                   /locus_tag="BG0035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(32002..33882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="BG0035"
FT                   /product="DNA topoisomerase IV"
FT                   /note="ortholog to Borrelia burgdorferi BB0035"
FT                   /db_xref="EnsemblGenomes-Gn:BG0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06894"
FT                   /db_xref="GOA:Q662X7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X7"
FT                   /protein_id="AAU06894.1"
FT                   /translation="MDIRSVLKDNFLQYSSYVIKDRAIASVVDGFKPVQRRIIHSLFEM
FT                   HDGNFHKVANVVGNTMKYHPHGDTSIYEALVNIANKDLFIEKQGNFGNLFTGDPASASR
FT                   YIECRLTPLAFDVLYSKEITVYESSYDGRNNEPLLYPAKIPVILIQGSEGIAVGMAAKI
FT                   LPHNFNEILSAVKSELLGETYDIYPDFPTGGIVDVNEYADGNGKILVRAKIETLDEKTI
FT                   VIRELPFGETTESLISSIEKAIRKNYIKVSSINDFTAENVAIELSLPRGVYASEVIEKL
FT                   YHYTNCQISISVNLLLLSERYPVVYTIKDLIKFHADHLQKILKMELELQKSKILEKIFY
FT                   KTLEQIFIEKKIYKLLETISKEENIVSIILSEVLKYKESFSREVLKEDVENLLKIPIRK
FT                   ISLFDIDKNFKDIKILNKELKSVNSNISSIRGYSINFIDLLLAKYSKDHQRKTEISLIK
FT                   SKNVKEIATKNMKVYLNLAEGFVGTSLFDGEFIGNASYYDKILIFRENSYVLKNIEDKA
FT                   FIDKKNICALVYDINNSKEQIFSIIYLNKLDKFYYIKRFKIDKFITDKVYEFLGENDEF
FT                   VDFSLNPKFVEFSTNKDIVKRIEIANFMVKSRSSIGKRISSNNLKKVKFK"
FT   gene            complement(33882..35681)
FT                   /gene="parE"
FT                   /locus_tag="BG0036"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(33882..35681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="BG0036"
FT                   /product="DNA topoisomerase IV"
FT                   /note="ortholog to Borrelia burgdorferi BB0036"
FT                   /db_xref="EnsemblGenomes-Gn:BG0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06895"
FT                   /db_xref="GOA:Q662X6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X6"
FT                   /protein_id="AAU06895.1"
FT                   /translation="MKTQNYDESKIITLSSLEHIRLRSGMYIGRLGDGSNIDDGIYILI
FT                   KEIIDNSIDEFIMGYGNEIFIKKENNLIAIRDYGRGIPLGKVVESVSVINTGAKYNDDV
FT                   FQFSVGLNGVGTKAVNALSSKFLVRSTRNGKSFEALFSKGNLLESREMESSDKDGTYVE
FT                   FLADSEIFGKYSYSEDFLKRRFFHYACLNKGLIINYNNQIFESKNGLLDFLNSEIKSDD
FT                   LLYDIVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTNDGGTHQTGFREGFVRAINDFLK
FT                   KTYSSTDIREGLVATLSVKIKDPIFESQTKNKLGNIETRGNVAREVQKIISEILYKDKI
FT                   LAKLIEKKVVDNERLRKELSSVRKEARERAKKISFKIPKLKDCKFHFNDSSKQSEQTMI
FT                   FLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMMVALGIEES
FT                   IENLRYNKVVIATDADFDGFHIRNLLLTFFLTFFEDLILNGHMYILETPLFRVRNKKIT
FT                   IYCYSEEEKKKAMIQLKGGYEVTRFKGLGEISPNEFKSFIDINNIKLTKVDLFNIKEIK
FT                   EKLGFYMGQNTPERRNFIMENLI"
FT   gene            complement(35702..36439)
FT                   /gene="plsC"
FT                   /locus_tag="BG0037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(35702..36439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="BG0037"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0037"
FT                   /db_xref="EnsemblGenomes-Gn:BG0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06896"
FT                   /db_xref="GOA:Q662X5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X5"
FT                   /protein_id="AAU06896.1"
FT                   /translation="MKILRSVITYFNLLLFFLILIFFLFPFYLICNIFSLERYVIRFSF
FT                   ILMRACIKIGLWLAGIKIIVTGSENIPPKGNVIIMGNHIAAMDPLIFIYTFVNPFVILA
FT                   KHSLLRVPFVNLVLIVMGAIFVNRKSIRSAAAAEAKAIKVMREGRSIGIFPEGTRNRGG
FT                   DTKVFKKGAIKMALKTGTSILPVTLYNTNNFFIKNIIFNSGVSVYIHVHPLIDVLKLSE
FT                   YEKENLTSIIRDQIVKKLETINI"
FT   gene            complement(36448..37986)
FT                   /locus_tag="BG0038"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(36448..37986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0038"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0038"
FT                   /db_xref="EnsemblGenomes-Gn:BG0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06897"
FT                   /db_xref="GOA:Q662X4"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06897.1"
FT                   /translation="MVKVLIASLINFSKELIRLYNCFYIYFCRFLFLFFFFTFLACSKA
FT                   SKDFIVFNKDVKSSPKIDNPNSNVLEINKMEDFFGDIIDLKGYKILAVQQENLNLDVYF
FT                   EQVVLAQNFSNLNAYLFIIGFDPKIKVGTILFKTQIDIDPKNSYNMYLEDITGDYDFNI
FT                   VVQGFLKDKSVLYVFQKSVLNDVSSYKPIFFDKVNGTVLINKYARSSAYEENRSRESYP
FT                   ISLEKYEKVGEDLIISKIEKYEYSHVQGKYYLSSVSEKVGKIDNNIYKTLKNLSKDEVY
FT                   RFLHGVWYDAYNYNKKQGKEIDEVLFLSFGRQSSEINLFRKNSQEVAKIEYISKPAYNT
FT                   LNVSAKSLFSDLIVYNFWIKIVDKENIEIKIDTSTNSYDNSGFSGSFKRFDENASNVVK
FT                   KKGNNIYFIPSGNYAYKDKIYDFSYPHLTYIDENKIYYGIFNIFPLKNNFVLEYEIDMG
FT                   SYKLIESFFLEHIERVVQKQKFSTIILNPIKILKDDVSLVKGQKLKLERIEKIG"
FT   gene            complement(37998..39500)
FT                   /locus_tag="BG0039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(37998..39500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0039"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0039"
FT                   /db_xref="EnsemblGenomes-Gn:BG0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06898"
FT                   /db_xref="GOA:Q662X3"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06898.1"
FT                   /translation="MRKRSRKVKNDLVALESKEKKVGIWGVFALILIVLGFIIAPLLPG
FT                   IFDNSHSSGLKFGSYKGQPIYYKKDSKFAKYVNYYSNLYSRLQGNAKNINIDYNAWYLA
FT                   FMKYVEDIAFFDLVKKYNFYISKEMLNKNLLRSPEYLDSNGNFSSKRYIKASDYQKVKI
FT                   YDDMVENILFSNVKIFLNSNLIFPDSLFNLIKDMSTVERHISYLSLSYQDFSNKEAISY
FT                   AEKNLNLFKRLSLASIRFKNMNDAKSAYDKLLNKTPFEELAKLYSDDIANFKGVVSLDK
FT                   YYFDLDLNIEKKEDLNSIFSLRDSEFSKPIKIKNKNEYQIYKAFGNVHDFDKNSDRDIS
FT                   SVKNYIETYEPSVIEGYLENKLNNFLSDVKFSSLSQALEKYRFSLKEEIVNLSYNVNIY
FT                   PNTLKELVEFNNSKSFYNVVFGLKENSWSKPFVANKKVYLFFLNSAKKRSKPFKEELKN
FT                   EKLLDNFNIANSGLITDFLLNKKDFVNNFNESFFALQNFSQN"
FT   gene            39692..40543
FT                   /gene="cheR-1"
FT                   /locus_tag="BG0040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        39692..40543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR-1"
FT                   /locus_tag="BG0040"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0040"
FT                   /db_xref="EnsemblGenomes-Gn:BG0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06899"
FT                   /db_xref="GOA:Q662X2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X2"
FT                   /protein_id="AAU06899.1"
FT                   /translation="MNMNQNKFNLNINITKDELSRLIKIVYNNFGINLSEKKKMLIESR
FT                   LSSLLKVKGFKNFTEYINFLEKSTGNIQLIELVDKISTNHTYFFRESKHFDFLNNKILP
FT                   NLTEKILKSENPEIRIWSAGCSSGEEPYTIAMILQEYMENNKANFKVKILATDISISVL
FT                   REAHEGIYPEDRIINLPKYLKTKYLNQLQDDKFQVKEILKKMVYFKKLNLMDEKFPFSK
FT                   KFDLIFCRNVMIYFDEKTRNNLANKLNFYLKDDSYLLIGHSETIRGNKNLEYIMPATYK
FT                   KN"
FT   gene            complement(40626..41297)
FT                   /gene="phoU"
FT                   /locus_tag="BG0041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(40626..41297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BG0041"
FT                   /product="phosphate transport system regulatory protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0042"
FT                   /db_xref="EnsemblGenomes-Gn:BG0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06900"
FT                   /db_xref="GOA:Q662X1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X1"
FT                   /protein_id="AAU06900.1"
FT                   /translation="MIRRRLTKQLEIIKDYLWDMKECVLKIIEDSLIALESKDKSLAKK
FT                   IINEDEKIIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHATKIVR
FT                   VVLLLESDLDDFDFLNLYFKPLREMADTAKEMLSDIFDAYFDGDFTKILKIVKYDNIID
FT                   KLFSKQKSIVIDAMKKNPENLDYLLNILFLNSFLERVGDHVATIGELLYFIRIGEKVNL
FT                   T"
FT   gene            complement(41308..42342)
FT                   /locus_tag="BG0042"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(41308..42342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0042"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0043"
FT                   /db_xref="EnsemblGenomes-Gn:BG0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06901"
FT                   /db_xref="UniProtKB/TrEMBL:Q662X0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06901.1"
FT                   /translation="MIKKYLIYISLLFVVFEVCPESAFISQSDSYELDFSSREVDINVN
FT                   TNSKFNLSFKDESWIYIKNNENRGFIKLIGESYENGAIFAFQTFKKEGKIKLLFSYQNV
FT                   NNSIEFNKMIILKITNKFEIKIPSSGGVSDENKDIISNNSLELGRDSINITPEEVIAGA
FT                   LNLSYINDYKGAIDLLNRYNFNDDKYILLKAEIYYKNRDYLKSYENYLKLKSRCFQSIV
FT                   FDLIKLGIELNIKEEVLENARYLVENNIDFPESIYLEIFEFLVIKGEYEFALNFSSLYF
FT                   PKYVNSIFLDKYSYVLGKLYESESKHKDFLKALHYYKLVINNYPFSYYYERAKIRYLFL
FT                   KRFF"
FT   gene            complement(42339..42740)
FT                   /locus_tag="BG0043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(42339..42740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0043"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0044"
FT                   /db_xref="EnsemblGenomes-Gn:BG0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06902"
FT                   /db_xref="GOA:Q662W9"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06902.1"
FT                   /translation="MQDGKFSFRKYFLILIFLIFIVSGITYFYSTQMLEKSQRFVEDNL
FT                   DAKVKLVDMEDFYFDLNESLNMDDFFIPRPDFLNENLNKNLVIDGLIKNKFLDENFFKD
FT                   LWIKKENLFNIDIEKENEKLIDKILEFSK"
FT   gene            complement(42766..45213)
FT                   /locus_tag="BG0044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(42766..45213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0044"
FT                   /product="P115 protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0045"
FT                   /db_xref="EnsemblGenomes-Gn:BG0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06903"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W8"
FT                   /protein_id="AAU06903.1"
FT                   /translation="MVLKKIVLLGFKSFLNRQEFEIDGNLSFIVGPNGCGKSNLIDAVR
FT                   FCMGEDNLKFLRVEDISDLISVSKSGKSNFSEITLFFSNIDSEKSTLREFGENFYIRRR
FT                   LYKDGSSEYYFNNKILNFQDYNKLLNRFQFKKSPYMFITQGRVEDISLGRNVNLKSLIE
FT                   QASGIDVLKIEEEEALKNFKQSNQNLSSLLTLQENLKQKYNNIKNVYLLRKKHQDLSQK
FT                   LEALEKTIILKKLFNINFDINVLKNELNLDGLSKFLSSSFKEKLEFYSFREKNVVNNIQ
FT                   ALEKVLELAKSKILGLEIKIQKLEQEKSVKMNLEDKLVKSKSNFEEKKKSINNDLHQLN
FT                   SLLKEKKNEFFSLSDEINRYTKSFFELVDLILSVLKSAKSEEFVLLKENILDSLKLFEE
FT                   SLSIKYIKEIRVNLIKYIGKDENLFALLKDKIEPILDQNVDLKKFLLEKNSLKSNLAKE
FT                   ITNIERLIEEKTLKLNDALGELEYIELSKFKNLDEIKLIDGNLEFLSESKNSLDEEIKD
FT                   LYLKLDNLNLEKSDIQLKLNNLVGASKSNNEPFKEKDLSSSVFFNNFKKTNYYEYIKKQ
FT                   TEYEFLLNSNLSIKNEIENFNISNKMSDKFRLEEDIITRELLQKEINAINLGDYVFFNI
FT                   DKEFDETKDRFEKVSLQVEDLKLSKYSLQKLQKKIKSEIYKKFRESFDEINKNFSYFFK
FT                   KIFKGTAILFYNENTDNVEIRINFSNKFVKNNNMLSGGESTLVSMAFLFALYYYSPACF
FT                   CMLDEVDAALDFENSKKLSLLLKELGKKIQLLVITHNAYVSEGGENLIGITLDNGESKV
FT                   FNI"
FT   gene            45306..45851
FT                   /gene="rnhB"
FT                   /locus_tag="BG0045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        45306..45851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BG0045"
FT                   /product="ribonuclease H"
FT                   /note="ortholog to Borrelia burgdorferi BB0046"
FT                   /db_xref="EnsemblGenomes-Gn:BG0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06904"
FT                   /db_xref="GOA:Q662W7"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662W7"
FT                   /protein_id="AAU06904.1"
FT                   /translation="MICGIDEVGRGCIFGPVLSAAVVFKKKPNFIKELDDSKKLKKEKR
FT                   EYLSSLILENSYYAFAEISNIIIEKINIHNATLLAMQTAYENLKLNCSLVFVDGKFVPK
FT                   ITAKTVKAIIKGDSIIDEIKAASIIAKVKRDKLMDEYDKIYPLYLLRKNKGYPTKEHKN
FT                   AIKKYGVLSLHRRNFKLI"
FT   gene            complement(45866..46228)
FT                   /locus_tag="BG0046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(45866..46228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0047"
FT                   /db_xref="EnsemblGenomes-Gn:BG0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06905"
FT                   /db_xref="GOA:Q662W6"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06905.1"
FT                   /translation="MGERGEVYSDKLFTESERTYFFNIKENRKGDYFLNIVESKRSPSG
FT                   DFERHSIFVYEENISEFESNLLKAIAVIKKKVSTGSVDPSMRHDRGGYGEKSKLDDSRF
FT                   QNKSHLSGGRFKKKDY"
FT   gene            46379..46450
FT                   /gene="trnG"
FT                   /locus_tag="BG0047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            46379..46450
FT                   /gene="trnG"
FT                   /locus_tag="BG0047"
FT                   /product="tRNA-Gly"
FT   gene            complement(46765..46884)
FT                   /locus_tag="BG0048"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(46765..46884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0048"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0049"
FT                   /db_xref="EnsemblGenomes-Gn:BG0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06906"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06906.1"
FT                   /translation="MDLTENANIVSCRQRESLKTSKINAKNNNFTSSNLVMAA"
FT   gene            47007..47681
FT                   /locus_tag="BG0049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        47007..47681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0049"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0050"
FT                   /db_xref="EnsemblGenomes-Gn:BG0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06907"
FT                   /db_xref="GOA:Q662W4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W4"
FT                   /protein_id="AAU06907.1"
FT                   /translation="MFNEFLWFAMLITTYSFLIIISVFFKKNGLFAWVAVAIIIANIQV
FT                   LKQITIFGINATLGNIIYASSYIATDILSEFYGKKTSKKAVYIGFISFIVFAVLTNAQI
FT                   HFMSNRTQENFKSLENIFSSIPALLLASLVAYLVSQLNDVYLYQFIKKKFPKFLFFRTN
FT                   GSTLISGLIDTLIFVSIATYFKVFPKQAFLDIVISTYLIKGFAGILGTPFIYFAKYIKL
FT                   QK"
FT   gene            47758..48447
FT                   /locus_tag="BG0050"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        47758..48447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0050"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0051"
FT                   /db_xref="EnsemblGenomes-Gn:BG0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06908"
FT                   /db_xref="GOA:Q662W3"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W3"
FT                   /protein_id="AAU06908.1"
FT                   /translation="MFDLSLWIGVLLFTYITLGILYRFFGKSGLFCFNAIISTISNIII
FT                   LRNVKTFGMSLNLSGITFLSALFSLNLMVEKYNKKEATNSVILGLLLNITFTIMINFMI
FT                   VFNHNKLDTSDIHFKILFNNFTYILTILIGTYVFFLSQYINILLYDYFKQIKIKSLWII
FT                   HPLSRLISGYLANLLVSISITTILKFYPEVKNIELIEGSLIFTLMIITIDTIFYLFLNS
FT                   WKKIREV"
FT   gene            complement(48444..49100)
FT                   /gene="spoU"
FT                   /locus_tag="BG0051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(48444..49100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="BG0051"
FT                   /product="spoU protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0052"
FT                   /db_xref="EnsemblGenomes-Gn:BG0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06909"
FT                   /db_xref="GOA:Q662W2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W2"
FT                   /protein_id="AAU06909.1"
FT                   /translation="MDNDVLKRIEVLSEFITDKKKARIEEVLSRRTNYLTFVLEDIFQP
FT                   QNASATIRTGEILGFSDVHIISKRNKCTLNPDVTLGSSQWINLNRYNNTKFALDRLKSD
FT                   GYSIVATSLDEQSINLEDFPINNKMAVFFGTELTGLSAEAFEAADLYLKIPMHGFTQSY
FT                   NISVAVAIVMYSLSIRLRKSSINYLLDEAEKSNLKLKYYRQVVKNYQFIENLINS"
FT   gene            49183..49854
FT                   /gene="ung"
FT                   /locus_tag="BG0052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        49183..49854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BG0052"
FT                   /product="uracil DNA glycosylase"
FT                   /note="ortholog to Borrelia burgdorferi BB0053"
FT                   /db_xref="EnsemblGenomes-Gn:BG0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06910"
FT                   /db_xref="GOA:Q662W1"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662W1"
FT                   /protein_id="AAU06910.1"
FT                   /translation="MKVKIEESWKEVLNNEFNKGYFKKLVKFIKHEYKTKKGKIFPPPK
FT                   LIFNAFDSLPFKDIKVVIIGQDPYHGKNQANGLAFSVDSEIKIPPSLQNIFKEIEKSLK
FT                   IKTLPNGDLKRWAIQGVFLINTILTVEEGKPSSHKDIGWEIFTDEVIKIISKNLENIVF
FT                   MLWGNLARSKKKLINPTKHLILETSHPSPYSANNGFLGSNHFSDALNYLKQHNKNKINF
FT                   Q"
FT   gene            complement(49952..50314)
FT                   /locus_tag="BG0053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(49952..50314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0053"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0054"
FT                   /db_xref="EnsemblGenomes-Gn:BG0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06911"
FT                   /db_xref="GOA:Q662W0"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q662W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06911.1"
FT                   /translation="MDLIRFCIFIIFVIVSIFIILLILIQDEQGDGIGGVFGGGSSSIF
FT                   GAKSSSVAVKITGFFIAFFFIFVVLLSFMNTKRADNSFLNDIKTENKNSSTFWDNENNE
FT                   SDTNINKSKEEDLKEK"
FT   gene            complement(50330..51091)
FT                   /locus_tag="BG0054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(50330..51091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0054"
FT                   /product="triosephosphate isomerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0055"
FT                   /db_xref="EnsemblGenomes-Gn:BG0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06912"
FT                   /db_xref="GOA:Q662V9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662V9"
FT                   /protein_id="AAU06912.1"
FT                   /translation="MRKTFLAGNWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPF
FT                   TALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLG
FT                   ETDEIINKKILTGLKHPFKYLILCVGETLNERDSEKTLDVVLNQVKKGLDGVSESDIKR
FT                   IILAYEPIWAIGTGKTATKEEAEEVHKAIRLEIMKLYSKSVSDNVIIQYGGSVNSSNVK
FT                   ELMNEPDIDGALIGGASLKAESFLSIINNVL"
FT   gene            complement(51093..52274)
FT                   /gene="pgk"
FT                   /locus_tag="BG0055"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(51093..52274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="BG0055"
FT                   /product="phosphoglycerate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0056"
FT                   /db_xref="EnsemblGenomes-Gn:BG0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06913"
FT                   /db_xref="GOA:Q662V8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662V8"
FT                   /protein_id="AAU06913.1"
FT                   /translation="MSIKTVKDFNSFAGKRALVRCDFNVPLKEGNISDDTRIKAALPTI
FT                   EYLKEKGARIVLISHLGRPEGKKNLKYSLKPVANKLSELLGQDVKMLSDCIGREIVNNT
FT                   LQMKDGDVVLLENVRFYAEEEKNDKNFAKKLSENGDVFVNDAFGAAHRAHASTVGVSDY
FT                   LPSVGGFLMEKEDKFLGEVLKNPERPFVSIIGGSKVSSKIAVLESLLSKSNVVVIGGGM
FT                   AYTFLHSKGYSIGKSLLESEYIDIASSFLKKAKELDVKVILPLDHIVADDFNKNSTPEY
FT                   IDSFDIPENKIGMDVGGKTLKEIEKVIKTAKTIIWNGPLGVFEFDSFSKGTAMVAEMVA
FT                   SCAGLTIVGGGDSVAAVNKFNLSDKITHVSTGGGASLEYLEGKILPGIKVLEK"
FT   gene            complement(52300..53307)
FT                   /gene="gap"
FT                   /locus_tag="BG0056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(52300..53307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="BG0056"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /note="ortholog to Borrelia burgdorferi BB0057"
FT                   /db_xref="EnsemblGenomes-Gn:BG0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06914"
FT                   /db_xref="GOA:Q662V7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V7"
FT                   /protein_id="AAU06914.1"
FT                   /translation="MKLAINGFGRIGRNVFKIAFERGIDVVAINDLTDPKTLAHLLKYD
FT                   STFGVYNKKVESRDGAIVVDGREIKIIAERDPKNLPWAKLGIDVVIESTGVFSSATSDK
FT                   GGYLDHVNHAGAKKVILTVPAKDEIKTIVLGVNDQDINSDLKAVSNASCTTNCLAPLAK
FT                   VLHESFGIEHGLMTTVHAYTNDQRILDLPHSDLRRARAAALSIIPTSTGAAKAVGLVLP
FT                   ELKGKLNGTSMRVPVPTGSIVDLTVQLKKKDVTKEEINFALKKASETPELKGILGYTED
FT                   PIVSSDIKGNSHSSIVDGLETMVLENGFAKVLSWYDNEFGYSTRVVDLAQKLVK"
FT   gene            complement(53382..55352)
FT                   /locus_tag="BG0057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(53382..55352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0057"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0058"
FT                   /db_xref="EnsemblGenomes-Gn:BG0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06915"
FT                   /db_xref="GOA:Q662V6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039340"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06915.1"
FT                   /translation="MNFNRFLMLFLFNFSVLLGSDTTALGHYQKAHEYYLSKRYYDAID
FT                   ELVEAIKINPNYYEAYKFIASIYYSLKIYTQAQFFIEKAYKMSNEDIEYKILYANILLK
FT                   NNKIDQAKKIYSEVLVKQRNNINALVGLASIFEQNGLFIAAANYYLSILDYSQNNYSAF
FT                   EHLIDIYQRLGMHDKIRHLINKVRVNFLSFPDFHKRVAEFYISINNLGLAEKYALNYLA
FT                   LIESSYKDFGVVGAYRLLALVYLHEFKYEDAIESLQKAILVNKDSDELYYLLGYSYLKF
FT                   GNIEKAILNLERAKNLKKDLEFYSIALEESFFASNFRNFLKNNSNAKISKHYENEGFKA
FT                   FKSLDLNKALFNAKNSIDIWPDNDSARFLLSKIYKLMNLDIMSYEQLFYLVKQRNSTDS
FT                   RILDFYDVVSFDVRKSLFYKYGYKSIADFNKLYDDRTVYRMAIFTQSENKFFGANDLIL
FT                   RYAERVLERNLNIEIVNYNFDYNKNRDYLINNFSEGFSYSRNNNLDLFLIFDFKADILK
FT                   NTATLLVNVFSGKTGIKVSSFSYDVGGVNYLSNALNSFSKDFHDYLPKKGKILQIKNED
FT                   ALINLGQVNGVLKGDIFLILKEGALNGETRDSNFIVYKRSDILGEILIEDTSDYISRGT
FT                   IKSSTFLKDYIQEGATVLVKR"
FT   gene            complement(55349..56128)
FT                   /gene="tlyC"
FT                   /locus_tag="BG0058"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(55349..56128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="BG0058"
FT                   /product="hemolysin"
FT                   /note="ortholog to Borrelia burgdorferi BB0059"
FT                   /db_xref="EnsemblGenomes-Gn:BG0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06916"
FT                   /db_xref="GOA:Q662V5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V5"
FT                   /protein_id="AAU06916.1"
FT                   /translation="MLGFFNFKNKKKKKGNPKNDLEDKSNIETSLIKNFNALKETIVKE
FT                   IMIPRIGVIFVDYAKSKDELLKVVTSSSHSRFPVYHGTIDNIVGIIHTRDVLLHMCKKD
FT                   FYEIDLKDIMRKVMFVPESKKTDSLLKEFQENHVHIAIVVDEYGGVSGLVTLEDILEEI
FT                   VGDIQDEFDNELDEIVRLDDGSYLCDARILIEDLNEKLNLNLPNGDFDTLGGFVYDLFG
FT                   RIPLKNEKVEYNNLVFSIKNMHQRNIKVIKISEKEGL"
FT   gene            complement(56129..56587)
FT                   /locus_tag="BG0059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(56129..56587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0060"
FT                   /db_xref="EnsemblGenomes-Gn:BG0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06917"
FT                   /db_xref="GOA:Q662V4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662V4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06917.1"
FT                   /translation="MSKSDLNLLVENIKFEHLSVFHDFILSVLNTLSISDFELSVILCD
FT                   NVYIQKLNNKFRNKNEPTDVLSFNYNELNEGLVGGINYKIQGDLIISFEYLKFSAQEFN
FT                   VEIYEELQRVTIHGILHLMGHNHETNDFQKEGMLILQENVLRKNKRVF"
FT   gene            complement(56676..57029)
FT                   /gene="trxA"
FT                   /locus_tag="BG0060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(56676..57029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BG0060"
FT                   /product="thioredoxin"
FT                   /note="ortholog to Borrelia burgdorferi BB0061"
FT                   /db_xref="EnsemblGenomes-Gn:BG0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06918"
FT                   /db_xref="GOA:Q662V3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V3"
FT                   /protein_id="AAU06918.1"
FT                   /translation="MAVSLTKEDFVAKVFDYKNNKEWSFIGKRPAIIDFYADWCGPCKM
FT                   LSPIFEKFSKKYENRIDFYKVDTDKEQDVVSVLGVKSLPTILFIPVDGKPKVSVGFLQE
FT                   DAFENIIKDFFGF"
FT   gene            57103..57819
FT                   /locus_tag="BG0061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        57103..57819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0061"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0062"
FT                   /db_xref="EnsemblGenomes-Gn:BG0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06919"
FT                   /db_xref="GOA:Q662V2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06919.1"
FT                   /translation="MNLMLITFNEFKTGISLNDTRAEHLVKILKLKDNDKFKFGILGER
FT                   NIYHCIYKKDKKLFFKKIFKIEESNKLKKLNVLIGMIRPLVARRIIKELASIGIYEIIF
FT                   FNTELTQKSYLNSKIFKNNDYEKHLIAGAMQGGTTYLPKIKIMKNLKESLKYIEQENFE
FT                   IKILLEKDSKKKLIDIEQINNATIIVGPERGFTEKEKQLITQYNFSPCSISSNILRTET
FT                   AIIAASIITASKLINV"
FT   gene            complement(57871..58815)
FT                   /locus_tag="BG0062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(57871..58815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0062"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0063"
FT                   /db_xref="EnsemblGenomes-Gn:BG0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06920"
FT                   /db_xref="GOA:Q662V1"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:Q662V1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06920.1"
FT                   /translation="MPKATTRALLLVIFGSLIVSFAIFFMVLENKEIAVVPNLYSLTLE
FT                   DAIIELQRKELIPHIEFKFSSSALDKGKVIEQGPKPGTVLRHNNKVIIFISKGAIINRV
FT                   DSFIGKNINDVIINLKANSFDNSKLLYHIVKPLEVESELPKGIIIRQNPSPGSQISSLT
FT                   DLQFLISKGKDHLDKHIKNYIGIYYKDAIASLLNDGISFDLDLANTGDFGNVVFQSIPS
FT                   GTKINESDKILITIAKPKVDNKIVFGILTYKLRQHPSYVDISVRLKGLDGENSLIYSFK
FT                   SKGGLIKLPYEVYKGSMIELYIYDKLINQTVIN"
FT   gene            complement(58928..59875)
FT                   /gene="fmt"
FT                   /locus_tag="BG0063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(58928..59875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BG0063"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0064"
FT                   /db_xref="EnsemblGenomes-Gn:BG0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06921"
FT                   /db_xref="GOA:Q662V0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662V0"
FT                   /protein_id="AAU06921.1"
FT                   /translation="MKIFFVSSSFIALEVFKEILRHYEVVGVLTLPDKPKGRGQKLSQN
FT                   VIKVEAIAKDIKVFDPLILDNNTLNSIRDLNPDLMLVFSYGKIFKKEFLDIFRMGCINV
FT                   HPSLLPKYRGVSPIQSAILNGDCVSGITIQSMALEMDSGNILVQKKFKIRSYDTSYDIS
FT                   KLVSSLSPSLVLEALEKISKGFLGIPQKSSEATFCSFLKKELGFIDFNLSSFEIKNRIN
FT                   ACNPWPLVRAKLDYSDIIFHRADFWEIDLYKERKVGEIVDFDPERGLFVNTGKGILFLL
FT                   EVQRPGRRVLDFKSFYNGSRQLIGRVFSSVGGIY"
FT   gene            complement(59872..60432)
FT                   /gene="def"
FT                   /locus_tag="BG0064"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(59872..60432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BG0064"
FT                   /product="polypeptide deformylase"
FT                   /note="ortholog to Borrelia burgdorferi BB0065"
FT                   /db_xref="EnsemblGenomes-Gn:BG0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06922"
FT                   /db_xref="GOA:Q662U9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U9"
FT                   /protein_id="AAU06922.1"
FT                   /translation="MEAFWKNKISVFFCLKGGWIFMEMVFYPNDLLRVKTKQIDNIDNK
FT                   IRDYAKKMIELMDISGGVGLAAPQVGLDLSLFVVRENRMARPLVFINPSITETSYELNS
FT                   YKEGCLSIPGVYYNLMRPNGIVVKFYDENGKSFTIENSDFLARIIQHEMDHLNGILFID
FT                   YYEERIKNKLLKPYMRERGFKTK"
FT   gene            complement(60405..61091)
FT                   /locus_tag="BG0065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(60405..61091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0065"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0066"
FT                   /db_xref="EnsemblGenomes-Gn:BG0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06923"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06923.1"
FT                   /translation="MRFIIAFLMILNQGFSGLFSLPEDIIFESSYEIAIKKAQKLDKNV
FT                   LILVGRDIKENLIKDFLNSFRNDEIIHTVSKKNVFLVIDKDNEIFNKINRQKSPTIFFV
FT                   DSKNEQIKAAYAGTVLSGVQFDKDFLNYVIGTIKSASVLEKQKNYEINTINERIFFYKT
FT                   LKGDWRLKLNGKDKKLVLFDTDLKEFLVFKDIDENKLYAIPKSRIGNIYFSLAGNEEWK
FT                   LFGKIK"
FT   gene            complement(61088..62866)
FT                   /locus_tag="BG0066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(61088..62866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0066"
FT                   /product="peptidase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0067"
FT                   /db_xref="EnsemblGenomes-Gn:BG0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06924"
FT                   /db_xref="GOA:Q662U7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U7"
FT                   /protein_id="AAU06924.1"
FT                   /translation="MDINKRLALLRDHMRKNGVDAYLVTGYDPHFSEYSHERYGARKFI
FT                   TGFSGSFGTVIITLSKAVLFTDGRYFLQADQELKGTQVTLIKLGVKGYPDIFTYINLNL
FT                   QESKLGIYSDEINIKFYKELSRKCKNTHIEVLNQDLIDLIWESRPQLEFSHVVELIDTE
FT                   KNNKRVEKIKSIYLTLENNSADFYVITALDEIAWILNLRGSDVKESALFYSFLLISKNQ
FT                   DRKNVLFIDTKKLDSSVKEALENENFEIEAYSNFYCYLDRIRHEGKFFVSLYTNLRVLK
FT                   LLGENNVILGESIIGDLKAVKTDYELLKMKEAHVIDAIGLIKFLHKFKSLSKAELAELD
FT                   EIDIADMLLHFRKLNKDFFSSSFDSIVGFKENGALPHYKPKRGKKINTNGLLLIDSGGS
FT                   YFGLGTTDVTRVFLIGNASGEEKHDYTLVLKAFISLASLKFPYGSSGAFLDGICRLPLL
FT                   KNELNFIHGTGHGVGFFLNVHELPVSISPNSNYPFKGSEVVSIEPGLYRTFSHGIRIEN
FT                   LVFVRQAFANDFGTFLEFENLTLVPFEKELIVKEMLSEDELNYINNYHECVFLTLKEHF
FT                   NDEEELKFLAKLTSRI"
FT   gene            62979..63869
FT                   /locus_tag="BG0067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        62979..63869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0068"
FT                   /db_xref="EnsemblGenomes-Gn:BG0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06925"
FT                   /db_xref="GOA:Q662U6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06925.1"
FT                   /translation="MKNIKAVASDLDGTLLVSKSYIGAFTELVIKKLTKEKKKFIIATG
FT                   RSKNEIIQITKKIDQLQVSFFITLNGAKVYNQEWKLIKSHNLSPKVIKKILNLRDKKFS
FT                   HIPHFLHKADQYDDQLNIDIKTKIAIDECQKFRKESNLLRHEIVSPVNKIKEIKDFNEL
FT                   ENFENVAKIILAGKEESLIEYEAMILDKYKGEINAYLSTPNSLEIVDHKVSKGNALKEV
FT                   LKTINIDLSETIAFGDGFNDTDMLENVKKGLLMRNSNYRLKAMLPYLEVIGTNDEEAVA
FT                   NYINDNVLEEPIREE"
FT   gene            63870..65108
FT                   /locus_tag="BG0068"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        63870..65108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0068"
FT                   /product="aminopeptidase II"
FT                   /note="ortholog to Borrelia burgdorferi BB0069"
FT                   /db_xref="EnsemblGenomes-Gn:BG0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06926"
FT                   /db_xref="GOA:Q662U5"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U5"
FT                   /protein_id="AAU06926.1"
FT                   /translation="MEKDLIKYAELIILKGINLQKNQCVLIQGSIENYNFLKILAKKAY
FT                   EHGAKYVKLNIKDIDILKSRLKFSQEKSLEFIPNFEKSFLEEMVQDKWARINVDDTENF
FT                   EDLKESIGQKMSIYQKALNLASKTLSQAIMSNEIAWCVVCSPGPKWASKVLNKKEGNET
FT                   LEEFFKIQKKILLLDRENPIKEWESHGERLHKRCKILNELNLEKVIFKNEKTNLEVYLL
FT                   ETSLWTGGSEKIKETEIEFNANMPTEEVFTTPNYKKTKGIVYATRPVMVLGTLISGIWL
FT                   KFENGKVVDFGCSDEKQKEILKSHIETDIQAKYIGEVALVDSSSLIYQSNLIFYSTLYD
FT                   ENASCHIALGAAYPSCLSNEEDLKTDTDKLNYGCNVSLIHTDLMIGSDDLDVIGVDKNE
FT                   KEYAIIKAGKFAI"
FT   gene            65123..65584
FT                   /locus_tag="BG0069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        65123..65584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0070"
FT                   /db_xref="EnsemblGenomes-Gn:BG0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06927"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06927.1"
FT                   /translation="MIRALLTNDLFLSCFVSGISAQVIKYGIQTVKTRKLKLTPVHLLK
FT                   KIFLETGGMPSSHSSTVTALSTSIAITEGIRHNFIIALAFALITIRDSFGVRYMSGVQA
FT                   EYLNALSEKLKKEIKIGPTEIKVVKGHKKKEVLTGIIIGIVSAYIVCYL"
FT   gene            65601..67073
FT                   /locus_tag="BG0070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        65601..67073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0070"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0071"
FT                   /db_xref="EnsemblGenomes-Gn:BG0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06928"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06928.1"
FT                   /translation="MLRFLSLLCLIATMPLINSCDVAQFGDYKPLYFTNEADLKTANEY
FT                   INSLGYKTISEYTTKIDILDFPENKKITINETNKLNNLDLRKNIFLKKLPNLFNIENKK
FT                   LLYVENRFKTINFKNLKKELNINVDMHSADYKTKINFISSIIFLIIIILLIFLNPANSI
FT                   FTLIFLLISSLTFIISKEIMYFYPFTVLSYLLFSIINNFNKNYNKIYLKEINFLTLITK
FT                   IKHLLFFFTFATLYFITITAFFTTNIDPTFIAFVAIPALCIFLIFSWIKTESNFKDTFL
FT                   FPIEIKERKKEEKKTLKFKIAIHLLLFTLSLMPFVYSSYILNSYKNINYLYSKKLNYFD
FT                   YLNPNNIYIMLGYNKDMPNIVGYLSHILYQNELKYNITAKYGKIPKNIKENYFEVKNNK
FT                   IEINPKTVYEVDKSFIDEALKKDLASLFLNNKNPILIYKENKDNINIDKKNYKMLFLFS
FT                   LPFFVLLFLFKAIRFTILLNINEKTYKKYIQG"
FT   gene            67081..69399
FT                   /locus_tag="BG0071"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        67081..69399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0071"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0072"
FT                   /db_xref="EnsemblGenomes-Gn:BG0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06929"
FT                   /db_xref="GOA:Q662U2"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06929.1"
FT                   /translation="MLDLEKVKTIFKKYNKYEVNIDEIQIPEYALIPLETENSKSIIYI
FT                   IEKQKIEENQILSKNSNIELYTYSPISGIVEKIYTANFPDGKKLKSALIKFQGKIKTEK
FT                   TPIEDEISREKTLAKLIQLGIPWFNENSLFQFINKCKKIDKMILLTNGKDVFTNISEAL
FT                   MAEKLEDILSGFQIIDKIFKFKEITIISNKDKLKKAFEKLNIFKNKKIKIKSLENAYPY
FT                   TNHEMIMHFLYNNKNAKDDINPLNNILLVNIEDLYNTNIVINNNNPYKEKFVAINGNKK
FT                   IKSRILKVKIGTSFSQVINEKIDTKKYEIFLNNPVNKIKIETLNIPITRDIYSITILKK
FT                   KSIYDKIRALFISSFSPLQMEDIIFSYLKNEKINDNSKLKIFKYTDKEVEEEIHKVQKE
FT                   IKGKILNESLINEVIYTENNLKDIYFAIILSLLPSLMFSFLNNTKFMTDTLLLIFISVA
FT                   IYVPIMLKINYKCLSFFVYNALIISIILPLNLAITLKIASLLFTFLVFFYFFRLSAFLA
FT                   NPILISFMFFVLNFPVSFKQTYQEELKNSTPIIPTWNEIISTNPNIKNFKSLNTLTRYE
FT                   NKNIDAIENFVNKNIFSVFNIIVTRFHIESLLGVNNEKTISPILLYFGLLLIVGKYIIN
FT                   KLIPLSFYISLMTISYITHNIGMLSHISSDMLTLLISPIPMLLIFTMATEVQITPHFKF
FT                   EQILYGSILAFIYFLILSYIPFETLSVIISIFILQASSNLIKKYSLTFKIKKIMHFLKK
FT                   NKGKALKPLQEDEKDIIKL"
FT   gene            69396..69956
FT                   /locus_tag="BG0072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        69396..69956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0072"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0073"
FT                   /db_xref="EnsemblGenomes-Gn:BG0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06930"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06930.1"
FT                   /translation="MTNNLITCLIINNLTLIHFVGFEDIKIKNNEILIKKYVIITITSL
FT                   LIYSISFYLYKLLEKNNLLFLMPIFYVILIYMLILSFKVLNDMFIVYNKKSNYSNDFML
FT                   SNSSLIAITFFALDKNNGFLEGLEILILSVLGILIALMSIISIKKNFDKKPKINILENE
FT                   PIYFFIMFILSLIPNIIILIYNK"
FT   gene            69997..71049
FT                   /locus_tag="BG0073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        69997..71049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0073"
FT                   /product="peptide chain release factor 2"
FT                   /note="ortholog to Borrelia burgdorferi BB0074"
FT                   /db_xref="EnsemblGenomes-Gn:BG0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06931"
FT                   /db_xref="GOA:Q662U0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q662U0"
FT                   /protein_id="AAU06931.1"
FT                   /translation="MNKPKAFGGSFDKKEIQDKIEKYEKEIHQKNFWNDPKRAQEVIKA
FT                   QSILKNKIDPWEELINKIKDLSDLCEIVENEKDINSLEIEFNVLEKQYKNLLTISYFKE
FT                   ELDINSAFLTIHSGAGGTEACDWVAMLYRMYSRYAERKKYKTELIDLLEAEGGIKSITI
FT                   EIKGEYAYGLLKSEVGIHRLIRISPFDAAKKRHTSFASVFVDPVIDEKIEIIIKPEDIR
FT                   IDTYRASGAGGQHVNKTSSAVRITHIETGIVTQSQSDRSQHKNKDMAMKVLKSRLYEYY
FT                   KNKEDKKNKSKQEVKKEISWGNQIRSYVFQPYNLVKDHRTKFENSNTTSVMDGNIDNFI
FT                   EEYLKWKSLN"
FT   gene            71031..72440
FT                   /locus_tag="BG0074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        71031..72440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0074"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0075"
FT                   /db_xref="EnsemblGenomes-Gn:BG0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06932"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06932.1"
FT                   /translation="MEKFKLTLVMPLLIFTIYKIHSQSNIEYNFSYIINTKKENIDLKK
FT                   GIEKQLNKVYDKITEHVVSNDDKNIIEDIYINQDIIKTELEISKLKKEMDIKKLQNIIN
FT                   AKEKHNTETKIDELKKNIQNIKSKKKRFAEYFSNLKKLKVKYKKIEEQTNISNLNKEFF
FT                   IREELFFISYIDLKKIENYYLLEISNVTPEKIETEKAVFKTSSSVNEIADKITKHSFKK
FT                   ILGREFLKININVKNNSDAKIYINEKFVSKGIYYNNIFDISKIPNKEIEIQITSTNFEN
FT                   YSIKRKVKNADSIILNIDLKRTISKKVEIKSNVKSKVFKKGIFMGETPIEIEKPENQDI
FT                   ILLKSEGYKDKFKLINKEKDQVEIEMIKTIKNRLSNKRDKFYINLAVFTLSTIGTIFAG
FT                   TLLNNAEALYKITGNHFINKILTAEDVYMAKAEQMTAKFLFGAGITLTIGSFISLITHL
FT                   VEYIKEANLGE"
FT   gene            72477..73322
FT                   /gene="ftsY"
FT                   /locus_tag="BG0075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        72477..73322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BG0075"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="ortholog to Borrelia burgdorferi BB0076"
FT                   /db_xref="EnsemblGenomes-Gn:BG0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06933"
FT                   /db_xref="GOA:Q662T8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T8"
FT                   /protein_id="AAU06933.1"
FT                   /translation="MGILEKIKNLFKSKQQENIIENLEDILLESDINNEIVIEIINKLT
FT                   KEKNKNEKTIIEKLKELLSNYINIKKFTLENNKLNILLIVGINGIGKTSSIAKLANKLK
FT                   NEGKNILISAADTFRAAAIEQMKVYGEQIGIRIISQNQGSDPSAVIFDSISSAKIKNYD
FT                   ALIIDTAGRLQNKENLIKELQKINNVILKQIKNTNINYQKILVIDSTIGKNTNSQAEIF
FT                   NKAIEIDGIIITKLDSSSRAGVIINISKILEKPIYFTTFGETLEDIKEFDINEYLNKLL
FT                   "
FT   gene            73319..74347
FT                   /locus_tag="BG0076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        73319..74347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0076"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0077"
FT                   /db_xref="EnsemblGenomes-Gn:BG0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06934"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06934.1"
FT                   /translation="MKKKQLILLLFITQIIYAKSYFASDTFFNKYQKLNEKPKKGFYIE
FT                   YHLIDDTEKLYLYKETNLIKYKTIQIIENTRKITYYDTKDTKRKEEVYDNLNNKIQEIE
FT                   YDSKGKILETANYFYENGNLISKNLKTINQKPKLIFYSKDENGKLLKITGSNFQIWNYG
FT                   INGDIKSTYFDIKKSTTKAIKYDDKKRNLNSTIIVNNKIKSKEKNQYLDEQKIVNTVEE
FT                   ANTKIISTYQRNNLIKEETYKNNELIKINDFQYNSSDMIIFQNTKEKDKDQYTNTKIEY
FT                   EYNKDNQLKSKKIYENDIIYLKTEYHNDNEYEEEIYYNKKPALRVKHKNGKIIEEKPIG
FT                   TN"
FT   gene            74348..75601
FT                   /locus_tag="BG0077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        74348..75601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0077"
FT                   /product="hypothetical protein"
FT                   /note="fused from Borrelia burgdorferi BB0078 and BB0079"
FT                   /db_xref="EnsemblGenomes-Gn:BG0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06935"
FT                   /db_xref="GOA:Q662T6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06935.1"
FT                   /translation="MGIRNFLLKKLILEEKNSLALTIVIILSITLGEIIIILTISIMNG
FT                   FQNDFFLSTTNVESGNLKIENELTKEEIKKIKKIEEIKHINKIYETQGIGIQDYYYPTI
FT                   LHIIAVDIKDLKKDQNFITFTGLEKDELDLKDDEIIIGNVLSYNFNLLKNDTLRLIIAD
FT                   EIKNFISLENDIKNFKIKSIFKSNYAKINENLIFMNIDYFIKNNLLRNSNINYQVKTKN
FT                   LNPSNKLIEKIKAINQKIKVKTWNEYNKEFYKALKIERNTMLIILTSIFIVIAVNAYYL
FT                   QKRIIINKNKAILILLSMGLRIKKIKQIFFIHSIIICTIGGLLGLILGISISLNINEIL
FT                   KIIDNLVNSLINFLNQILALEIDGIKIQIVKDTITPKLFLSDLVFTFCFACFSTIYSSM
FT                   KATKKIGSQKNIETINGS"
FT   gene            75603..76283
FT                   /locus_tag="BG0078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        75603..76283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0078"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0080"
FT                   /db_xref="EnsemblGenomes-Gn:BG0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06936"
FT                   /db_xref="GOA:Q662T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T5"
FT                   /protein_id="AAU06936.1"
FT                   /translation="MENILIIKNLCKAYKKNKTKIQVIENLNLTVTKGEFISIQGKSGC
FT                   GKSTLFNMISGIDKIDSGEIISCGIVLKNANEKTLSLYKNRQIGLVFQNYNLINEFNVT
FT                   ENIILPKIISGQETKETVNKKALDLMKILKIENRAKHYPSELSGGESQRVAIARALINE
FT                   PDIILCDEPTGNLDLSTAKTVENLLINTTKNFRKTLILVSHNPQFANKADSKYEFKDRT
FT                   LKKL"
FT   gene            76280..77533
FT                   /locus_tag="BG0079"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        76280..77533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0081"
FT                   /db_xref="EnsemblGenomes-Gn:BG0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06937"
FT                   /db_xref="GOA:Q662T4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06937.1"
FT                   /translation="MMLLKLTEITKIAYIIFKNSTNKIALIGSGISLSLVMIPLIIVYY
FT                   MSSNIMTSTINKYIESEGFSIQIEYNNTNKTNYLKDRLSSFKKKYNYKDLNYFFEKRTY
FT                   GIIGNNKKQGVLIRAIENEFILENKSIKLIKGTKNLKKDSILIPNQIKNKLNLNLNEKI
FT                   DILIPNAKNHKILPRIKKFHISGIIETGLKDIDNNLVLISLENENLMSKKFSKSIIGIE
FT                   TNFNSIKNNEILKQNLETEFQEFQIKTFYELYLNKYNNLDISKKLLIFIMALIIIFASI
FT                   NISSSISMLIFENKKKIAILKSIGMNNLNIKIIFLLISLTLSTTFCGIGIIIGNYLTLK
FT                   ISYLINFVDNVLNFFLKIFGEENSEILNSEYYVSEFQIDLSLSFSLTLLSLYMLINILT
FT                   TLVPLNIVSNLKEKEILR"
FT   gene            complement(77545..78843)
FT                   /locus_tag="BG0080"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(77545..78843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0080"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0082"
FT                   /db_xref="EnsemblGenomes-Gn:BG0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06938"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06938.1"
FT                   /translation="MNNSKTSEDRIKIYLSKLKKYKSKILSKKSIKNIIEISDISDNDI
FT                   ENMGLHFKKSYARVKRFVDVGKIDVAFRELESIYFYSLHDKSIFSLFFFLFKEITDKLN
FT                   TKESKKKMIHVSLQAKEFGIRNDLDLIDYYESKKSKSRMLILALSSILIFFISLITYRS
FT                   FQSFIGVNENGKASLKEKFTPPLISQGLPPITMATDLVVEAANLISDSKDLYYIEIEDA
FT                   KVLVFEDAHLYQLKAGVVSKEHPVKKISYRVTIYDDLGRSVFNQVFDKESDFSLKWGKN
FT                   VYIPIDVISSIPRAIDVNPKKVVLDIIEVDFFKNVDDKIGVNLDSDSFILKFKYIGNYF
FT                   KKSFGICKANTVIEVFNSSKDVIKNLEIEIGYIDKEGRIIRSLKRKLISSANSFLKSKS
FT                   KQSFTISTIFLNEIYPTIEKDFSSIKIYNVMIK"
FT   gene            complement(78836..79156)
FT                   /locus_tag="BG0081"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(78836..79156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0081"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0083"
FT                   /db_xref="EnsemblGenomes-Gn:BG0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06939"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06939.1"
FT                   /translation="MKEVIYRFEKDEDYKMVPINNIYGNVTNTGEIFCDLVFESTEISE
FT                   EIAYTKTKEGVLEDASKELKRGEEGKIVLINSFIGISITKTTARNIAYWLLKKVDELED
FT                   NE"
FT   gene            79339..80607
FT                   /gene="nifS"
FT                   /locus_tag="BG0082"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        79339..80607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="BG0082"
FT                   /product="nifS protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0084"
FT                   /db_xref="EnsemblGenomes-Gn:BG0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06940"
FT                   /db_xref="GOA:Q662T1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T1"
FT                   /protein_id="AAU06940.1"
FT                   /translation="MDFKQIKSNAEKVKFLRKDFPILNKQFDNKHIIYFDNAATSQKPK
FT                   KVIYSIIEYYENYNANVHRSGHKFAIQSSIKIEKTRELVKNFINAESSKNIIFTSGTTD
FT                   GINIIANSFFYSKYFKKKDEIILTTLEHNSNLLPWANLAKLANLTIKFAKFNEMGIITP
FT                   EEIEKLITEKTKLISISGINNTLGTMNDLESIGKIAKKYNISLFVDAAQMAPHIKIDVK
FT                   KIGCDFLVFSGHKMLAPTGIGILYISNNMAEKLDSPKLGGNTVEEIFIKNEKIKFKSLD
FT                   APNKFESGTPNIAGIIGLKEAIKYINNISMDFILEHDQQLIEYGVKKLQELDEVEFLLN
FT                   TNLKRNSIISFTVKNIHSHDIETYLDTIGIATRAGKTCSYVAFFPENLNKNHLLRISFY
FT                   FYNTQEEIDIFILGLKKVIKELS"
FT   gene            complement(80538..80690)
FT                   /locus_tag="BG0083"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(80538..80690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06941"
FT                   /db_xref="GOA:Q662T0"
FT                   /db_xref="UniProtKB/TrEMBL:Q662T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06941.1"
FT                   /translation="MLINPKIKVNQKERFLINFVMIFIFLYFYESSFITFFNPNIKISI
FT                   SSCVL"
FT   gene            80811..81239
FT                   /locus_tag="BG0084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        80811..81239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0084"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0085"
FT                   /db_xref="EnsemblGenomes-Gn:BG0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06942"
FT                   /db_xref="GOA:Q662S9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06942.1"
FT                   /translation="MLTEEIKKKLIKLSKVNNYIIHKIKTNQNLKHQSKCGDQILFQII
FT                   EANNGKFNLKHYASGCMILLASANALNKLCNNKPKSEILSLVQKVINGDFANLEEIDTS
FT                   LKIFNIFTNTNRKDCFLLPYKSLKDSLVNYKPLRRTIR"
FT   gene            complement(81232..81492)
FT                   /locus_tag="BG0085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(81232..81492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06943"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06943.1"
FT                   /translation="MPITIERSRAVPSFLIPAGARFINILSLGKLKFEFFIADFTLSLD
FT                   SLISLPASPTISIPGIPFLMSISISISSPSYPIDECEWIFI"
FT   gene            81551..82342
FT                   /locus_tag="BG0086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        81551..82342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="split from Borrelia burgdorferi BB0086"
FT                   /db_xref="EnsemblGenomes-Gn:BG0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06944"
FT                   /db_xref="GOA:Q662S7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06944.1"
FT                   /translation="MQLDGKIRSIKAVLPAVALAKEKKIKFAIVPFENLEEAYLIDGLN
FT                   IWSVKDLKETLNIIEQLKDNILPPRTDIKPQAVIEQDYVLDYDFKNIKGQQRVKRAIEI
FT                   AIAGGHNIMLFGPPGSGKTLSIKCAQSILPPLTNKELIETNRIWSISGKLIDRKIIKQR
FT                   PFRNPHHTASKEGIIGGGPNPLPGEVSLAHNGVLFLDEALEFKKSILQSLREPIEDKSI
FT                   SISRASFKLFKYPANFQLMLAMNLCPCGNLGKKNTDCFCLQ"
FT   gene            82379..82771
FT                   /locus_tag="BG0087"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        82379..82771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="split from Borrelia burgdorferi BB0086"
FT                   /db_xref="EnsemblGenomes-Gn:BG0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06945"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06945.1"
FT                   /translation="MLDRIDIRVSTRAINNEKLFGETSESSSEIKRRIIKARNIQNIRY
FT                   ENFANINKNSDLNSDHIEKFCELSAILKNDLIYILNKLNISSRATHSILKIARTISDLK
FT                   EEKNISREALLEAIEHRKNGENMLEK"
FT   gene            complement(82801..83751)
FT                   /gene="ldh"
FT                   /locus_tag="BG0088"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(82801..83751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BG0088"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="ortholog to Borrelia burgdorferi BB0087"
FT                   /db_xref="EnsemblGenomes-Gn:BG0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06946"
FT                   /db_xref="GOA:Q662S5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662S5"
FT                   /protein_id="AAU06946.1"
FT                   /translation="MLKSNKVVLIGAGGVGSSFAYALTIDNSLVHELVIIDVNENKAKG
FT                   EVMDLNHGQMFLKKNINVLFGTYKDCINADIVVITAGLNQKPSETRLDLVDKNSEIFKD
FT                   IITNVVSSGFDGIFVIASNPVDIMTYVTMKYSKFPIHKVIGTGTILDTSRLRYFLSDRL
FT                   NVNTQNIHSYIMGEHGDSSFATWDETKIAMKPLSEYLAEGKITEIELDEIHKKVVNAAY
FT                   EVIKLKGATYYAIGLGIKNIVNAIIGDQNIILPISSYINGQYGGLVKDIYIGAPAIVCK
FT                   EGVKEVLNFKISPKELEKFNSSANQLKSYIDKIEF"
FT   gene            complement(83874..85679)
FT                   /gene="lepA"
FT                   /locus_tag="BG0089"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(83874..85679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="BG0089"
FT                   /product="GTP-binding membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0088"
FT                   /db_xref="EnsemblGenomes-Gn:BG0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06947"
FT                   /db_xref="GOA:Q662S4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662S4"
FT                   /protein_id="AAU06947.1"
FT                   /translation="MSISIRKKNFCIIAHIDHGKSTLADRFIQKAKIISDRDFKSQMLD
FT                   SMEIERERGITIKSQVVTITYKSNDGDCYELNFVDTPGHVDFSYEVSRAISSCEGALLL
FT                   IDASQGIQAQTVSNFYMAFEHDLEIIPVINKIDLPNANIDFVKKQIKNDLGLNEEIAIS
FT                   ISAKNGIGIDDLLEAICKHVPSPRGSIKDPLRALIFDSHYDSYRGVVVHFRIFEGQIKT
FT                   GDKIRLMHTNSEHLIEEIGVFKISLERKDRLEAGDVGYFIAGIKNISDVKIGDTVTLCD
FT                   CPALSPLEGFKEVKPVVFSSVYPVDANQYDDLLKAMDRLKLNDASLTFEKDSSSALGHG
FT                   FKCGFLGLLHLEVIQERIEREFDLNVILTSPSVRYKIIPKKGESYFIESPEQFHGNEAI
FT                   EGVLEPYIRANIIVPTEFLGNIMSVCLLKRGVQTSLIYLDTKRVELIYKMPLSEILFDF
FT                   YDKIKSVSRGYASFDYELLDYEYTDLVRLDILVNGDRVDALSQLVFKDSAKTKAIGICK
FT                   KLKDEIARQQFKIAIQGAIGSNVIARETISPVRKDVTAKCYGGDITRKRKLLEKQKEGK
FT                   KRMKMVGNVEIPQRAFLAVLKSNDN"
FT   gene            complement(85713..86699)
FT                   /locus_tag="BG0090"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(85713..86699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0090"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0089"
FT                   /db_xref="EnsemblGenomes-Gn:BG0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06948"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06948.1"
FT                   /translation="MFVIMRNLVLFFFALPFSISLISSSNKNFPYWILLEKGRQFLYSK
FT                   SEFSKSNLTHAINYLQEALLRKGVYPEASYYLSVAYGMSGNAVLEKLNLYKSFEDKDYL
FT                   LDESFEKKILFSLAKMAELENNYVDTIDYLNDILNKFSTKKDYYSYHDYSQGENSIPNN
FT                   KFNISFYLTSYLKQVRGAFGIDFTFNLYRFKNYNVIDTHQLLSKVYLRLSAYELSITHG
FT                   LIAAVGILTRMYDYVCYYEPVYQFRNLRSFVQKINEYKAIKNAFESTDFWEIVYNVAVA
FT                   TYAYSNGKYRFRSIDTWKLIVDLAPKFSPYITKSRSQIKNSVFKKKG"
FT   gene            complement(86759..87193)
FT                   /locus_tag="BG0091"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(86759..87193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0091"
FT                   /product="V-type ATPase, subunit K, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0090"
FT                   /db_xref="EnsemblGenomes-Gn:BG0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06949"
FT                   /db_xref="GOA:Q662S2"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S2"
FT                   /protein_id="AAU06949.1"
FT                   /translation="MDIGLIGVNSALTISAIGSALGMGAAGSAAIGAWKRCYMQGKPAP
FT                   FLLIVFVSAPLTQIIYGYILMNTLYEVMMQTNPWLLLGAGIGGGFAIAVSGFAQGKAAA
FT                   GACDAFSETGKGFATYLLVLGLIESVALFVMVFLMIFKFV"
FT   gene            complement(87210..89036)
FT                   /locus_tag="BG0092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(87210..89036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0092"
FT                   /product="V-type ATPase, subunit I, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0091"
FT                   /db_xref="EnsemblGenomes-Gn:BG0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06950"
FT                   /db_xref="GOA:Q662S1"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S1"
FT                   /protein_id="AAU06950.1"
FT                   /translation="MIVKMKKVLLLTLSKYKKESLEILRDFGAVHINFCNKNSDSLKKS
FT                   IDNRRILLQAFSLLREDGSVKALKSSNGNFLDIAKSIVNLGNEIKEFQDIKRSLLHERN
FT                   LISVWGNFSLEYINKLKESNIYIQFFKIQKSEYKNLLRDPNVDVLLIENVKNTSYFVSV
FT                   GEFEQKIAIADEFKFNFDLDYINNKLKVVDEILDQKLTQISLFNKYIDILRDEIKNYDQ
FT                   IVEFEQVLADMQTDFEDFSYITGFVPAESQESLKSSVLKAGFAVQFADPEENDIIPTYI
FT                   KRKGIANLAAPIFNILETIPGYKERDISFIFMLFFFVFFGMIIGDAAYGVIFFLIGILL
FT                   SLSFILKGKPLTPVHGLIFYLSVSSILYGSMTGTWFGSPLILEMFPILNSFKVSYLTDK
FT                   NSVQNIIFICFSIGVLQISLAHAWNFLRQVKEKPYIHSIAQIGWLIGIAGLYYLVLNLI
FT                   LSQSRFPMYNAVYYAIYMGVALVFVFGKQDGSNFFKCILKSFGGIIEQFLTTVSGFADI
FT                   ISYIRLFAVGLAGLSISASFNAMSMPLLKSSNIGFIAAGIIVILFGHVLNIMLSLLSVI
FT                   VHGVRLNMLEFSNHLGQEWSGYAYKPFRKIKK"
FT   gene            complement(89047..89643)
FT                   /gene="atpD"
FT                   /locus_tag="BG0093"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(89047..89643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BG0093"
FT                   /product="V-type ATPase, subunit D"
FT                   /note="ortholog to Borrelia burgdorferi BB0092"
FT                   /db_xref="EnsemblGenomes-Gn:BG0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06951"
FT                   /db_xref="GOA:Q662S0"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q662S0"
FT                   /protein_id="AAU06951.1"
FT                   /translation="MPKIKLTKNDLKKQKDELKMFKRYLPTLQLKKQQLYMEIVRIENS
FT                   YRIKNLEQQKLKDSISNWISLFSEKFPFESWIQVKTVIKKSVNIAGVAIPIFDSIEYED
FT                   IRHDLLFTPYWVDKGIETLKIVIQINVELEILKKQIDLLLKEFRVTSQRVNLFEKVMIP
FT                   TAKANIKKINIYLGDQQTAAVVRGKIAKSNLIKKK"
FT   gene            complement(89646..90950)
FT                   /gene="atpB"
FT                   /locus_tag="BG0094"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(89646..90950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BG0094"
FT                   /product="V-type ATPase, subunit B"
FT                   /note="ortholog to Borrelia burgdorferi BB0093"
FT                   /db_xref="EnsemblGenomes-Gn:BG0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06952"
FT                   /db_xref="GOA:Q662R9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662R9"
FT                   /protein_id="AAU06952.1"
FT                   /translation="MKRVYSKIECIAGNVITVTAQGIKYGELAIVKAKDTSSLAEVIKL
FT                   DREKVSLQVYGGTRGISTSDEIKFLGHSMQVSFSDNLLGRIFDGSGNPRDGGPSLDDNL
FT                   IEIGGPSANPAKRIVPRNMIRTGLPMIDVFNTLVESQKLPIFSVSGEPYNELLLRIALQ
FT                   AEVDLIILGGMGLKHDDYLTFKDSLEKGGALSRTIFFVHTANDSVVESLTVPDISLSVA
FT                   EKFALKGKKVLVLLTDMTNFADAMKEISITMEQVPSNRGYPGDLYSQLAYRYEKAIDFE
FT                   GAGSITILTVTTMPGDDVTHPVPDNTGYITEGQYYLKGGRIEPFGSLSRLKQMVNGRTR
FT                   DDHRTIMDSMIKLYASSKDSVEKKAMGFNMTKWDEKLLKYSNMFESKMMDLSVNIPLEE
FT                   ALDLGWDILASCFSPKETGIKTDLIEKYWPKKETS"
FT   gene            complement(90972..92699)
FT                   /gene="atpA"
FT                   /locus_tag="BG0095"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(90972..92699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BG0095"
FT                   /product="V-type ATPase, subunit A"
FT                   /note="ortholog to Borrelia burgdorferi BB0094"
FT                   /db_xref="EnsemblGenomes-Gn:BG0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06953"
FT                   /db_xref="GOA:Q662R8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662R8"
FT                   /protein_id="AAU06953.1"
FT                   /translation="MKTKGKVVGVNGNLVTIEVEGSVSMNEVLFIKTAGRNLKAEIIRV
FT                   RGNEVDAQVFELTKGISVGDVVEFTDKLLTVELGPGLLTQVYDGLQNPLPELAIQCGFF
FT                   LERGVYLRPLNKDKKWNFKKTAKVGDSVIAGDFLGFVIEGTVHHQIMIPFYKRDSYKIV
FT                   EIVNDGNYSIDEQIAVIEDDSGMKHSITMSFHWPVKIPITNYKERLIPSEPMLTQTRII
FT                   DTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDIVIIAACGERAGEVVETLKEFPE
FT                   LIDPKTGKSLMDRTCIICNTSSMPVAAREASVYTAITIGEYYRQMGLDILLLADSTSRW
FT                   AQAMREMSGRLEEIPGEEAFPAYLESVIASFYERAGIVVLNNGDIGSVTVGGSVSPAGG
FT                   NFEEPVTQATLKVVGAFHGLTRERSDARKFPAISPLESWSKYKGVIDSKKAEYARSFLV
FT                   KGNEINQMMKVVGEEGISSEDFLIYLKSELLDSCYLQQNSFDSVDAAVSSERQNYMFDI
FT                   VYNILKTNFEFSDKLQARDFMNELRQNLLDMNLSSFKDYKFNKLEQALSELVNLKKVI"
FT   gene            complement(92713..93258)
FT                   /locus_tag="BG0096"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(92713..93258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0096"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0095"
FT                   /db_xref="EnsemblGenomes-Gn:BG0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06954"
FT                   /db_xref="UniProtKB/TrEMBL:Q662R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06954.1"
FT                   /translation="MLDSYYYVLSSLPYIDLKSLKNYSVSDFLNNVEISLSKKDFNFLK
FT                   GLLEFKVAKGESRVFDLFLDFEDTIRYTLAVLRAEKLGLSKDFYLESAYYSSYYLSILR
FT                   NICLKENSFEIELSVDLLKWQFLTDLEIGHEFDFEKVIIYFLKLRLFLRHNLFKEKLGI
FT                   QNFDNICQNLIDKTSEKV"
FT   gene            complement(93268..93867)
FT                   /locus_tag="BG0097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(93268..93867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0097"
FT                   /product="V-type ATPase, subunit E, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0096"
FT                   /db_xref="EnsemblGenomes-Gn:BG0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06955"
FT                   /db_xref="GOA:Q662R6"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662R6"
FT                   /protein_id="AAU06955.1"
FT                   /translation="MQFEVKDLINKIKKDGLEEAERISNDIIFKAKKEAEEIVARAEEA
FT                   VGALKAKSEKEINDYKRHALEASRQAIRDLIIGVEKNLKSLFENTLKDNVAEVFSDNDF
FT                   LSELIIKITDSWIKEEKLVIQLNESDFSGLEQILRLKLGNKLKEGIEIKPFKGISKGFK
FT                   IQKKNTGLQYDFSVETIADILFDYLNPRFKEVIKVV"
FT   gene            complement(94053..94439)
FT                   /locus_tag="BG0098"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(94053..94439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0098"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0097"
FT                   /db_xref="EnsemblGenomes-Gn:BG0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06956"
FT                   /db_xref="UniProtKB/TrEMBL:Q662R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06956.1"
FT                   /translation="MNIAKFNEFENILFHICLDVDFVLEDEFGNSYDIHPNRPFRGKAA
FT                   NGLLDGLFSVTTTFTSGYGSKFGRGYLIIIEILTLNFVDDEFWNKINRRGIEIFKEGLK
FT                   NKFPSKNIDIVLDGNVYKIIGQFF"
FT   gene            complement(94445..96781)
FT                   /locus_tag="BG0099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(94445..96781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0099"
FT                   /product="DNA mismatch repair protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0098"
FT                   /db_xref="EnsemblGenomes-Gn:BG0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06957"
FT                   /db_xref="GOA:Q662R4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q662R4"
FT                   /protein_id="AAU06957.1"
FT                   /translation="MQNKYFKNIDFYEILSLVSKYVSNPDTVNLLNNQEILKTRESLEK
FT                   MFSFVNIIKMLFESCKGYPNSFINSLEYSISLLSKENSRASIENLRDIMGFLDEVLRIN
FT                   LFLHKNSDIKNLNVQILSDLLFLSPELKNLLSELKEYIDVDTLELKSGVVKEYDSIEFE
FT                   IKNLNRQVEKQIKRVISLNLEYLASNIVYYKSNKYTLALKSNFKGKIKGNVISVSSSGE
FT                   TFYIEPNDIVNYNNKLNYLDLEKKRIILKILQNLSSKVHKNVLLLDNLYNNFLYYDSLK
FT                   ARALYGIKTKGIFPEISNVLNIFDAHHPLLKDSKAITFTPAENRIVIITGPNAGGKTVT
FT                   LKTIGLLSAMFQFGIPIVVSESSTFKIFDNIFIDIGDDQSISNSLSTFSSHMSNISYIL
FT                   KHTTKKSLVIFDEFCSGTDIDQSQALAISILEYLININSYVLISTHYNALKYFAYTHEG
FT                   VINASMRMDLETMEPNYNLIFSIPGESYAFNVASRFLIDRSIVIRANEIYSSQKTEVNK
FT                   ILERLVEKEKDLLSIKESMNKKLIQIELREKEVENIYQDLLLKEKNIETELLNEQNEFL
FT                   KNSRKVLENLVREIKEGNVNVEKNKAFISDLEKNIDFKLNKVNSLNSKRNIATDFKIGD
FT                   RVRIVNSNAKGKIVGISKKKITVNVGAFNVSVSNSEISLENFTEHKKEGDKNFSFSIDY
FT                   NKENLLSFTIDIRGMRSIDALDFLNKKIDNIILNGINKFEIIHGKGEGHLMREVHNLLK
FT                   ELKFIKKYYFAHPSDGGAGKTIVEI"
FT   gene            complement(96771..97694)
FT                   /locus_tag="BG0100"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(96771..97694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0099"
FT                   /db_xref="EnsemblGenomes-Gn:BG0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06958"
FT                   /db_xref="GOA:Q662R3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06958.1"
FT                   /translation="MNYLEFEVIWGVNNIYSILELKSKLIYEGIFKGKILETGCKEYSP
FT                   LVPGDIVLGYVYGSRKVYIDKRVSRKNILWRYNRKVDLRQAIVSNVDNVLIVNSANFPE
FT                   MKNFFIDRVLVVAEEQNIVPVIVINKIDKGISQRVEEFSEIYKNLGYRVLKTSVKTFEG
FT                   IKEVKEILRNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISEKYSRGKHTTVYSISFH
FT                   SENWIIVDTPGIKEFGVETLPFENLKYYFKEFENFASFCKYKSCLHVSEPHCSVTNSLG
FT                   NGISKPRYESYLKILSELKNYKNYAK"
FT   gene            complement(97691..98473)
FT                   /gene="murI"
FT                   /locus_tag="BG0101"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(97691..98473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="BG0101"
FT                   /product="glutamate racemase"
FT                   /note="ortholog to Borrelia burgdorferi BB0100"
FT                   /db_xref="EnsemblGenomes-Gn:BG0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06959"
FT                   /db_xref="GOA:Q662R2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q662R2"
FT                   /protein_id="AAU06959.1"
FT                   /translation="MKNFKEVIIVFDSGIGGLSYFKYIKNKMDGYQYVYVADNKNFPYG
FT                   EKSSEYLLEAVLYLIEKLNKIYNISALILACNTISVSVYNKLNFIFPVVYTLPEVSSIS
FT                   DLVLKRVLLIATNTTLESKFVKDQVNMHNDLIIKAAGELVNFVEYGEKYRKDAIRCLEA
FT                   LKFEVVNTGREIVFLGCTHYLHLKAMIEDFLKIPVYENRELVVQSLIRSINFPQYKDSY
FT                   YKNDVDLVDEFYLTKNENLTFYQNFCKKYNLHFKGTIV"
FT   gene            98636..100024
FT                   /gene="asnS"
FT                   /locus_tag="BG0102"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        98636..100024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="BG0102"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0101"
FT                   /db_xref="EnsemblGenomes-Gn:BG0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06960"
FT                   /db_xref="GOA:Q662R1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662R1"
FT                   /protein_id="AAU06960.1"
FT                   /translation="MFSSIKDILENPILNSNVTINGWIRTKRSNGKIGFIEINDGSTLK
FT                   GIQAVINEEENQFTEKDLKKLTTGASISLTGLLVESPAKGQNYEIKIYSFNVIGEADSK
FT                   TYPLQKKRHTFEFLREIPHLRIRTNTFGAIARVRNKISYKIHEYFQKNGFFYINTPIIT
FT                   SNDGEGAGEMFRVSTLKFNKPNNSLSNIDFKDDFFGKEAFLSVTGQLHGEAYAMALSKI
FT                   YTFGPTFRAENSNTTRHASEFWMIEPEMAFYKLNDNISLAEDLLKYLLSSILNECSQDM
FT                   DFLENYIEKGLIKKLENVINSNFEVITYTKAIEILESSKKNFEIKPCWGIDLQTDHERY
FT                   LTEEIFKKPIAVIDYPKNFKAFYMKINKDNKTVKGMDILVPRIGEIIGGSEREDDLQKL
FT                   ENRIKELNLNIEHLNWYLDLRRFGSTPHSGFGLGLERLVQYTTGISNIRDSIPFPRTPK
FT                   NLYF"
FT   gene            100039..100560
FT                   /locus_tag="BG0103"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        100039..100560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0103"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0102"
FT                   /db_xref="EnsemblGenomes-Gn:BG0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06961"
FT                   /db_xref="UniProtKB/TrEMBL:Q662R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06961.1"
FT                   /translation="MRLIKLYKLMLLFLFLTRLFPVKDEKSNNKLELFSNVETKIKKKS
FT                   KTYDLNSNFKKAKKKSVFKKDTNNAKNINSNIYIQKSKKINYPDRNLSNNINQKTTNNR
FT                   NFKTNHYVKVYPSYKNDNFEAIKNINKYPIKTEKTHLLIGPILKDNLGIIIKMVKTKGY
FT                   TLIEYIESNN"
FT   gene            complement(100557..101153)
FT                   /locus_tag="BG0104"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(100557..101153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0104"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0103"
FT                   /db_xref="EnsemblGenomes-Gn:BG0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06962"
FT                   /db_xref="GOA:Q662Q9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06962.1"
FT                   /translation="MKKYISYEEIRINGFKLAYKIYKDGFIPDIMYVSLRGGAYLGNII
FT                   SEFFKFVKADKPLLYAAVVARSYDIFNEQQKKIMIDGWTYDPKYLRAGDKVLFVDDIFD
FT                   TGRTIVYLRGEVLKKGIENKNVKIAVYDYKDHGFVDYIPDYYVNKYTNQEELNTWIHYG
FT                   NHELTGLNESEYKNSFRYIDDELNEVLKFLAKNKS"
FT   gene            complement(101341..102765)
FT                   /gene="htrA"
FT                   /locus_tag="BG0105"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(101341..102765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="BG0105"
FT                   /product="periplasmic serine protease DO"
FT                   /note="ortholog to Borrelia burgdorferi BB0104"
FT                   /db_xref="EnsemblGenomes-Gn:BG0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06963"
FT                   /db_xref="GOA:Q662Q8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q8"
FT                   /protein_id="AAU06963.1"
FT                   /translation="MEKKFFSGFILSFLALGIGFFIGMHYLDSNRSNIVFAEEKDNTVQ
FT                   ALQDSFREVSKKILSSSVEVHATGVIKQSFPIPFFFFDMPEFDSERKSNWAGSGVIIGR
FT                   DSQKKSLFYVVTNSHVVDKATELEVVSYDKKKHKAKLIGKDEKKDIALISFESDDATIK
FT                   VADLGDSDKLEIGDWVMAVGSPFQFSFTVTAGIVSGLQRSANPNLQSRNLFIQTDAAIN
FT                   RGNSGGPLVNIKGEVIGINAWIASNSGGNIGLGFAIPVNNIKSTVDFFLKGKKIESAWL
FT                   GISFYPLKTRDSEVLKSLGVEGKDVSAAIIASLYPGSPAVKSGLKAGDIIVKVNGVSMS
FT                   VFQDVTSYISDFYAGEKVNVEILRGNVKKNIEIVLAVRPKDKELSSSKMLPGFIVYPLV
FT                   EDIKAQLNLRNWIKGVVVDYIDKNLASNIKMKSGDVILSVNSQSVSNLREFYDALKIGK
FT                   NTYKILRGNDSFKISF"
FT   gene            complement(102836..103591)
FT                   /gene="map"
FT                   /locus_tag="BG0106"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(102836..103591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BG0106"
FT                   /product="methionine aminopeptidase"
FT                   /note="ortholog to Borrelia burgdorferi BB0105"
FT                   /db_xref="EnsemblGenomes-Gn:BG0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06964"
FT                   /db_xref="GOA:Q662Q7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q7"
FT                   /protein_id="AAU06964.1"
FT                   /translation="MTRLRLKSKDEIKKIKASARLLALTLLEVERNIVPGISTKELDLI
FT                   AYDFIIKNRAKPAFKGYHGFKGTICASVNEEVIHGIPGKRKLASGDIISIDCGVILDGF
FT                   YSDMAKTFKVGSVDPSIDKLLEVTNASLYKGIAEMKVGNRILNISKAIEEYIKPFGFGI
FT                   VREYTGHGVGFQLHEEPSVPNYYAPFFKNIRIQEGMVLAIEPMVNLKGHKVSIKSDGWT
FT                   VFASDLSYSAHFEHTVAVVDGLPLILSEV"
FT   gene            complement(103584..105251)
FT                   /locus_tag="BG0107"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(103584..105251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0107"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0106"
FT                   /db_xref="EnsemblGenomes-Gn:BG0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06965"
FT                   /db_xref="GOA:Q662Q6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06965.1"
FT                   /translation="MKKNKTLVFILLFLLSVFLGGFYFYFNPNILYFLRGEKDFSKLII
FT                   GIDFYIDKKKFADAKKAIRFSSYYANTEFKWLSLIKRAKVWALNTGDYHLMVDVTNLSV
FT                   KVLPGNLKLRALEVYSKLKIGLLKDAYKIANQYLLNNEEYRGLYDEVFIKNLSADNKVL
FT                   DFNKFIDKIYREKDARVFEEIGLNLKNNAFLVNAMLLYIEKKNMDAAKRILFKIKEDKN
FT                   FFKELAYISYNLNDLDFTISNLKFFKNEDDPTLLFLLADAYFKKGDINNAKNEYLKLYT
FT                   KFPDYNVLVYLNLALIANNENDFKKAISYLNKANELFKDNKIISYYLANIYFRIKNYFK
FT                   ANEIIANYKEDPLFFKIYFALNYANSEYEAKKSYLWRLFYKTEYNSRIAQFLAWNLLLY
FT                   SDLKDLDLFFKIYNFSENKQDWYDFYKFYYYFLKRNFTSSKRVIFDNKSQKYMFGVYYN
FT                   LGVLSFSEKDYKEAERYFNKGVSLLPSSFYDKDASTHYECELVSKIYLKQGINYLYLGK
FT                   MEKGKESILTSYSFCKTDQGRLYKNMIDTLRERKLNFD"
FT   gene            complement(105238..105666)
FT                   /gene="nusB"
FT                   /locus_tag="BG0108"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(105238..105666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="BG0108"
FT                   /product="N-utilization substance protein B"
FT                   /note="ortholog to Borrelia burgdorferi BB0107"
FT                   /db_xref="EnsemblGenomes-Gn:BG0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06966"
FT                   /db_xref="GOA:Q662Q5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Q5"
FT                   /protein_id="AAU06966.1"
FT                   /translation="MHEVRVLAFQKIYSIDINQSAMDDIFDIFSIEDKGLDIENESIKS
FT                   FYSSLVNGTFNNLEYIDSLIKDISWNWSLDRMDKVDLAILRMGVYSLKFQNFENSKRAL
FT                   IDEAILIAKKYGSKNSDKFINGILDALLKNMENCIEKK"
FT   gene            complement(105704..106714)
FT                   /locus_tag="BG0109"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(105704..106714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0109"
FT                   /product="basic membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0108"
FT                   /db_xref="EnsemblGenomes-Gn:BG0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06967"
FT                   /db_xref="GOA:Q662Q4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q4"
FT                   /protein_id="AAU06967.1"
FT                   /translation="MKSFLFLVILGIMGINSFAQNTPVAIINLYKNEIITKTGFDSKVD
FT                   IFKKTQGRDLTAAEKKQVLQVLIADVLFSQEASKQGIKISDDEVMQTIRTQFGLVNLTD
FT                   EQIKQMIEKQGTNWGELLASMKRSLSSQKLVLKQSQPRFSEVKTPSEKEIVEYYEANKT
FT                   KFVNPDISRVSHVFFSTKDKKRSDVLDQAKNILSQIRSKKITFEEAVRKYSNDESSKAK
FT                   NGDLGFLSRGDQNAQNLLGADFIKEVFNFNKGDISSPIASKEGFHIIKVTEKYAQRFLG
FT                   LNDKVSPTTDLIVKDAIRNNMINIQQQQIVVEVQQDVYSKLNKSANIQILDSSLK"
FT   gene            complement(106794..107987)
FT                   /gene="fadA"
FT                   /locus_tag="BG0110"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(106794..107987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="BG0110"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0109"
FT                   /db_xref="EnsemblGenomes-Gn:BG0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06968"
FT                   /db_xref="GOA:Q662Q3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q3"
FT                   /protein_id="AAU06968.1"
FT                   /translation="MKKVAIIDGLRMPNTKFGGSFKGLDIIDESSKVVKALLKRNNLCE
FT                   VDEVIVGNVISSGLGQNIARQIALKSSLGDNVPAFSVNKVCGSGLKALELAFNSIVLGN
FT                   NDIVLAGGMEDLTNSPYLLPRKVRFDGLKFGNFGIEDSIQKDALIDSLNFISMGLTAEN
FT                   LSEKYKITREMQDEFAYNSHVKALKARELGYFEDEIHPLTILDKKTNSSRIVSSDEEIR
FT                   DNLTLNKLASLNPVFKESGTVTAGNSSSLNDGACFLILASEERVKSLGVMPLAYIGGFE
FT                   SVGLSPLYMGFGAYMAIEGIISKLSLNPSEIDLIEVNEAFAAQALSIEKALFKKYNIAS
FT                   DIINVNGGAIALGHPFAVSGSRILLTLARSMKMKNKTKGIASVCVGGGQGISSFLYR"
FT   gene            108130..109494
FT                   /locus_tag="BG0111"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        108130..109494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0111"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0110"
FT                   /db_xref="EnsemblGenomes-Gn:BG0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06969"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06969.1"
FT                   /translation="MHFKKILLIIFIISTLKAYSYNYAIQFKNEGIDKYYFEILNDGFG
FT                   FSLSNFFDDLRSGSLIFTYASKYNFIINLEAHMLTFRGYKDYPKSLISRTDLIEIGFMY
FT                   YFPILLLINGKNFGEIDLGIGIKNLLFGDWGGHLMQSIIHIILNQHRPIPSIRSYDGYN
FT                   YRGFLSFALNYSYMNFFNLENYIDLSYFADYFIKNSIGITLKNENIGFDIKLYTQIQNQ
FT                   IKNLKTYSKIQEAETGIGINYQFYSKNFFIRNDLNIKNFSTKENFLSVGGFGIIIAPEE
FT                   HTKISESKNEFNIMSNNFYFGFDIMIPFKIRNSIFYKINENINHYFSISTNYYTNYNEN
FT                   NSFTNQLSSGIMYEFLPQKTFNPYIISGLFLAYNQNNKDIKSIFRPIRIKNVIQAGIEN
FT                   ELGFLFKMFKYHNTDYIFKIYSKVSYVPLAYNLDEKKLEKHSINFNYLGIGVVVK"
FT   gene            complement(109505..110872)
FT                   /gene="dnaB"
FT                   /locus_tag="BG0112"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(109505..110872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BG0112"
FT                   /product="replicative DNA helicase"
FT                   /note="ortholog to Borrelia burgdorferi BB0111"
FT                   /db_xref="EnsemblGenomes-Gn:BG0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06970"
FT                   /db_xref="GOA:Q662Q1"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q662Q1"
FT                   /protein_id="AAU06970.1"
FT                   /translation="MALAAFSNSALLFNDGAEKAVISSIFYNSDKLEQIAFHVRADDFY
FT                   NETHKLIFKAMVSLYEKRENIDPITVFEEVSKHVSKTQLLIKKDLINLPDYLDSLSVYL
FT                   PTDRTINVYAKIVKEQSVRRSILNVSKELNDYINDSTKTINEIVEESQQKILSIELDYS
FT                   SKNLYHAKIIAERVHNEIYERSMKKKEANFGIPSGFRKVDSLIGGFRNSDFIIVGARPS
FT                   IGKTAFALNIASAIALRKEGKKKVGFFSLEMTADALIKRIISSQSCIDSFKVQNSILSG
FT                   QEIKSLNDIVNEISDSELYIEDTPNISLLTLATQARKLKRFYGIDIIFVDYISLISFET
FT                   KNLPRHEQVASISKSLKELARELEIPIIALSQLTRDTEGREPNLASLRESGALEQDADI
FT                   VILLHRDKDFKFESSDEIEPIETKVIVAKHRNGPTGRADILFLPHITKFVNKDHQY"
FT   gene            complement(110897..111397)
FT                   /gene="rplI"
FT                   /locus_tag="BG0113"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(110897..111397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BG0113"
FT                   /product="ribosomal protein L9"
FT                   /note="ortholog to Borrelia burgdorferi BB0112"
FT                   /db_xref="EnsemblGenomes-Gn:BG0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06971"
FT                   /db_xref="GOA:Q662Q0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662Q0"
FT                   /protein_id="AAU06971.1"
FT                   /translation="MKVILKEDFTNLGREGDTVEVKDGFARNYLLPKGFAVFSNKHNVE
FT                   IFNQKKRSILKKQETKKQIANDLKSKLDLVKLEFFMKSNDSGKLFHSINSLNIAEELLK
FT                   LGFDIERKKIDIHHGTLKAFGTYDVTVKLYEGISAIIKVEIKKEKKQEDKKSLNKKLNK
FT                   VDE"
FT   gene            complement(111414..111704)
FT                   /gene="rpsR"
FT                   /locus_tag="BG0114"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(111414..111704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BG0114"
FT                   /product="ribosomal protein S18"
FT                   /note="ortholog to Borrelia burgdorferi BB0113"
FT                   /db_xref="EnsemblGenomes-Gn:BG0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06972"
FT                   /db_xref="GOA:Q662P9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662P9"
FT                   /protein_id="AAU06972.1"
FT                   /translation="MYKDRDVNQRDSRFENQQDGFKKNSNFRFFKRKSCKFCDSGKHPD
FT                   YKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEVKRARYMALLPFVKK"
FT   gene            complement(111719..112168)
FT                   /gene="ssb"
FT                   /locus_tag="BG0115"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(111719..112168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BG0115"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0114"
FT                   /db_xref="EnsemblGenomes-Gn:BG0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06973"
FT                   /db_xref="GOA:Q662P8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P8"
FT                   /protein_id="AAU06973.1"
FT                   /translation="MADINSLVLSGRLTRDSELSYTESGMAILRFSLANNRRMKKNDEW
FT                   IDYPQYFDCVIFSKRAESLNEYLKKGKQVVVSGSLKYESWQDKNTGDKRSKINIFVDNL
FT                   QMFSSGSNAFQMQDSDVNNLASHKREDAIKNIDIVDDKFNEDIPF"
FT   gene            complement(112180..112599)
FT                   /gene="rpsF"
FT                   /locus_tag="BG0116"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(112180..112599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BG0116"
FT                   /product="ribosomal protein S6"
FT                   /note="ortholog to Borrelia burgdorferi BB0115"
FT                   /db_xref="EnsemblGenomes-Gn:BG0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06974"
FT                   /db_xref="GOA:Q662P7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662P7"
FT                   /protein_id="AAU06974.1"
FT                   /translation="MIKRYEACFLFKSEEIEYKCSLEEVRKSLEFFGAIDIVSNFIGER
FT                   ALEYPIKKQARGRYEIIEFSMEGNNLKELESRLKLIKNLLRYMILVKIVRKINTKKIKR
FT                   RNFREFRDNVDKESFKGGSKIETPTGSESTDIQEK"
FT   gene            complement(112743..114437)
FT                   /gene="malX"
FT                   /locus_tag="BG0117"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(112743..114437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malX"
FT                   /locus_tag="BG0117"
FT                   /product="PTS system, maltose and glucose-specific IIABC
FT                   component"
FT                   /note="ortholog to Borrelia burgdorferi BB0116"
FT                   /db_xref="EnsemblGenomes-Gn:BG0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06975"
FT                   /db_xref="GOA:Q662P6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P6"
FT                   /protein_id="AAU06975.1"
FT                   /translation="MINFIKIINFSSLQKFSKALRVPISILPVSCLLIGIGSVFSNPSN
FT                   IVYVDKFFFQDVLGLMKAIGNAILLNMPLIFSVGISIGVARIGQGTAALGGLVGYLTFN
FT                   ITGNYFIETFSGLVEAEAMSSVGRINFLGVQTLNTGIAGSLAVGLLVGYLHNKFYNMKL
FT                   PKAFVFFSECHFAPIVIVLPFCVILAICFCLIWSSVDKLIASLGLFVFRFEHFGSFLYG
FT                   FLNRLLLPLGLHSILSFPFEFTSLGGVETINGNTFRGIKNIFHAQLLDPSLAKFSPGLA
FT                   KISSGFYLSIMFGLPGAALGVYKGIVHEDKSKVAALLFSGALTAFLTGITEPLEFLFIF
FT                   TAPLLYFVHAIYSGFALLFANFFDVRIGNTFSTGFLDFFMFGILQGNSRTNWISIVPLG
FT                   VIFFALYYFTFSWLYRYFDFQIFVADDPFFEGQEGKLESLGIAHLLIQGLGGFDNIKKI
FT                   DVCSTRLHVDVVNTELIDNDLLKEAGVLKIGLVNGKVQLFYGSNSYYIKKAIDTYSPKS
FT                   LFEASVMVAVDNVKKGLKTYIEMKEDKKLEKQGKSGKTYKLSELEED"
FT   gene            114639..115340
FT                   /gene="yplQ"
FT                   /locus_tag="BG0118"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        114639..115340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yplQ"
FT                   /locus_tag="BG0118"
FT                   /product="hemolysin III"
FT                   /note="ortholog to Borrelia burgdorferi BB0117"
FT                   /db_xref="EnsemblGenomes-Gn:BG0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06976"
FT                   /db_xref="GOA:Q662P5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P5"
FT                   /protein_id="AAU06976.1"
FT                   /translation="MLTENKLKKYLLGNINTSKIPKNELFSSISHLFGIILSIIGTTIL
FT                   ITISALKKKDLHILVFFIYGFSMTLLYSMSTLYHIFPKGSKIKKIFRKFDHISIFILIA
FT                   GTYTPACAILVPNESGLIILCIVWSLAIIGVIFKAIFTNSPGWFNGFIFIIMGWLILFK
FT                   IKPIYKALSGKGFFWLVFGGIVYTIGGIVYILSKKFNPIINMKMHDVFHILIIIASASH
FT                   FWLMLKYISNF"
FT   gene            complement(115337..116638)
FT                   /locus_tag="BG0119"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(115337..116638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0119"
FT                   /product="zinc protease, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0118"
FT                   /db_xref="EnsemblGenomes-Gn:BG0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06977"
FT                   /db_xref="GOA:Q662P4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P4"
FT                   /protein_id="AAU06977.1"
FT                   /translation="MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILK
FT                   FKINNTEYRLSPILLGGYCKLKGFDHLEKELKANKELEADKDSLFGISHFKKILIYFAG
FT                   PLFNLIFSFIVFIFISMMGVIYFDYSSKISILNKNSFLKDKFRDGDIILKVNNKKIEYF
FT                   SDLRNSIPEGKSTATFDVLRGKENITFEETVSSKDFLKEIGPWVDLVIADVVLNSPAKI
FT                   AGMKSGDKIISVDNILLKNKRDLDDLLKNLNSDVVEIEFARNGEIFSSKLLFQDKNKMI
FT                   GIYFSPPLKRIIKEDNVLNAVKNSFFKVVNALQDILYSIFLLITNFLNTSKSVSGPVGI
FT                   VGILSSSYSLGLLYWINSISVLSLILAGMNLFFIVIPVFDGGQIFISFIELLRGKRFKA
FT                   KTIYSFYSFGIFLALFLFGLGLFNDLKGVLHILN"
FT   gene            complement(116660..117517)
FT                   /locus_tag="BG0120"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(116660..117517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0120"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0119"
FT                   /db_xref="EnsemblGenomes-Gn:BG0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06978"
FT                   /db_xref="GOA:Q662P3"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P3"
FT                   /protein_id="AAU06978.1"
FT                   /translation="MGDDLLSKGKRFAFFARLGTFLFFVPLILFLIFLDFKNYLFLNIL
FT                   IFIFSGFAAKEVNDLLKFKSSGLSGILSFFLGFVPPILTYIHFNVFYLGMNVVYYLVIA
FT                   LVFSNWIVNLVFIKEHEIGNFLSQATSILFILIYPGVLMSFIVSITTLPKAPFLMLILF
FT                   AMVSGNDTFAYLFGYFFGKNSYRPTIISPNKTLMGFFGGILFSVLTAIFAVIFKLISLS
FT                   YGESIIFGILIGVFTIIGDLFESGLKRSAGVKDSGKIIPGRGGALDSIDSFLLTGPIFY
FT                   LYLS"
FT   gene            complement(117507..118199)
FT                   /locus_tag="BG0121"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(117507..118199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0121"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /note="ortholog to Borrelia burgdorferi BB0120"
FT                   /db_xref="EnsemblGenomes-Gn:BG0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06979"
FT                   /db_xref="GOA:Q662P2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q662P2"
FT                   /protein_id="AAU06979.1"
FT                   /translation="MNKRSLPSHVGIIMDGNRRWALGKGLSSLEGYEEGLKRAKEIVKH
FT                   SLKVGIKYLSFYVFSTENWKRDDCEIEKLMFLITHYLRAEFNFYKKNGIKIIVSGDVES
FT                   LGEEVRSSIKDSVSFSKNFNNLVLNLAINYGGRNEILRAVKKFVSSNFDLESLNENAFS
FT                   NFLDNPELPDIDLLIRTGGNIRISNFFLWRIAYSELIFSNVLWPEYYDNRYSKDLECFQ
FT                   LRGRNFGR"
FT   gene            complement(118204..118758)
FT                   /gene="frr"
FT                   /locus_tag="BG0122"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(118204..118758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="BG0122"
FT                   /product="ribosome releasing factor"
FT                   /note="ortholog to Borrelia burgdorferi BB0121"
FT                   /db_xref="EnsemblGenomes-Gn:BG0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06980"
FT                   /db_xref="GOA:Q662P1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662P1"
FT                   /protein_id="AAU06980.1"
FT                   /translation="MEDYKAFLDEKMSKVLLSLDNEYKTLRTGRISSNVFDKIFIQYHG
FT                   QKTPITQVSSIRIPEARLVVIQPWDKTILNKIEQAILNSDLSMNPSSDGSVIRIKVPAL
FT                   TSERRQDIVKHAKKIAEEHKVSTRNIRQDLNNKVKKQEKESEITEDSLKRILDDIQKSI
FT                   DIYIKRIDTILESKIQEIMEV"
FT   gene            complement(118796..119635)
FT                   /gene="tsf"
FT                   /locus_tag="BG0123"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(118796..119635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BG0123"
FT                   /product="translation elongation factor TS"
FT                   /note="ortholog to Borrelia burgdorferi BB0122"
FT                   /db_xref="EnsemblGenomes-Gn:BG0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06981"
FT                   /db_xref="GOA:Q662P0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662P0"
FT                   /protein_id="AAU06981.1"
FT                   /translation="MSIISPQDVKRLREETNAGFGDCKKALSAASGDFELAKKKLREMG
FT                   IASAEKRLDRDAKEGRVFSYSNNIHAGLLLVSCETDFVALNHNFVNLGNSLIKELVESG
FT                   RSFPTASQELELKNLAATIKENIQVKKIFITEIQSNEFVKIYLHGEQSKIGVLVKLKVD
FT                   DFSKTEDKMFQNFAMDLALHVAAFAPIYLGNDDVCPNYIKEQEEIFAKQLEFSGKSESI
FT                   LKGIVAGKIKKHLAEISLLEQSFVKNDKVTVREMLEEISKAISSKIEIVEFKYLRIG"
FT   gene            complement(119632..120420)
FT                   /gene="rpsB"
FT                   /locus_tag="BG0124"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(119632..120420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BG0124"
FT                   /product="ribosomal protein S2"
FT                   /note="ortholog to Borrelia burgdorferi BB0123"
FT                   /db_xref="EnsemblGenomes-Gn:BG0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06982"
FT                   /db_xref="GOA:Q662N9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662N9"
FT                   /protein_id="AAU06982.1"
FT                   /translation="MAIITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQK
FT                   TLQGIKDSYELVQRVIKDGKKVLFVGTKKQASEIIEQEARRSDMPYVNNRWLGGMLSNF
FT                   NTIRKSVQKLKKLEKMEVDGTFDMISKKEISQLNREKFKLAKNLTGIKDMETLPGAIFI
FT                   IDPKREQIAINEARKLKIPIISVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIISDAIL
FT                   ESDKEVGIQIIENLNEEDLMKEIEIKNDKSDSIEEGRSNL"
FT   gene            complement(120640..120918)
FT                   /locus_tag="BG0125"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(120640..120918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0125"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0124"
FT                   /db_xref="EnsemblGenomes-Gn:BG0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06983"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06983.1"
FT                   /translation="MIVFFSHLILTNIIISFLVSFFVMFLNILNFKFLVVYLISFLGGI
FT                   LFLFFIPFFYSDYYERRIDLILYLFPILGSVILIGLIKFSERNRNDL"
FT   gene            complement(120824..120937)
FT                   /locus_tag="BG0126"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(120824..120937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06984"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06984.1"
FT                   /translation="MDLRGKYDSIFFSFDFNKHYYFFFGKLFCYVFKHIEF"
FT   gene            complement(120938..121720)
FT                   /locus_tag="BG0127"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(120938..121720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0127"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0125"
FT                   /db_xref="EnsemblGenomes-Gn:BG0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06985"
FT                   /db_xref="GOA:Q662N6"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06985.1"
FT                   /translation="MYFFGGGFIIFFILCFVFCLGFFGCGLDNILILPSPEKIDNRISR
FT                   DSVAFFLPAGYFSDQAAEKLRGFDIYYKFYPEGSNYHISSFRKSVEKDFEALKGVFDNV
FT                   SEFNNRGFYKINLNPTAYSGKPVFKLNKEWVDSKLPLYFEINFGELRKDVPGEAFIIVR
FT                   NGNTSSSPVILEKQNIYRSYIDKGEYIGFSKSIKKSNLLDKEKRPIDLKHINDDFFTKD
FT                   ISPKYNLAIFVMGVGSIVDDAYSVLIDLGDLSGFSLSS"
FT   gene            complement(121722..122333)
FT                   /locus_tag="BG0128"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(121722..122333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0128"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0126"
FT                   /db_xref="EnsemblGenomes-Gn:BG0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06986"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06986.1"
FT                   /translation="MTKNNLLVFFIAIIFVFVSVIVVFYNSLGKDYVKSGGEIVENLEK
FT                   DLNDYLKENDTKEKEKISLRIKELISKEKEISSYFISRFYLARAFYLQSQVQYDEAIKD
FT                   LDIVIKAKGIESEIAFINKAAVYEKMGLKEDALLVYEELINSTSLGFLKVRALLSKAIL
FT                   IEEKDKDLAVKVYEEIVKFPYENNLYINIANNKILELKQN"
FT   gene            complement(122333..123988)
FT                   /gene="rpsA"
FT                   /locus_tag="BG0129"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(122333..123988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BG0129"
FT                   /product="ribosomal protein S1"
FT                   /note="ortholog to Borrelia burgdorferi BB0127"
FT                   /db_xref="EnsemblGenomes-Gn:BG0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06987"
FT                   /db_xref="GOA:Q662N4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N4"
FT                   /protein_id="AAU06987.1"
FT                   /translation="MENQKDLQENYLKVLERVELGSRVSGTVINIMKDYVLVDIGYKSE
FT                   GFIKIEEFENVPKIGDKLEAIVVRIGGELGLILSVEKLDSLNFQDKVDEYIQNKKVIKG
FT                   KVLAELANGYKIQINENVSGFMPFYLSSKSKDEKLKRGLIVEFYILEASESDGLRLILD
FT                   RRTLERERDLAKRIELVSSYNEEDVVDGVVDRITEYGAIVKIKNFVTGILHKRNIAFNQ
FT                   VENIEDFVRVGDKLKLKIIKINLQTGKMELSLKALKANPWDSVDIKYKIDSIVKGKVVK
FT                   ILPFGAVIELDSELSGFLHISNFSWIRVIKSPQELIKLGQMVEVKILEVDKENQKISLG
FT                   IKQINENPWERLTEKYPIGKVIQGVVTNITKTGAFVNIEEGIDAYVSKFDISWLEEIDP
FT                   EEYFKIGDLVNGKVLEVDRRKRNVRLGIKQLEESPWEDFSKSYKKGDAIEVEIVEKKSK
FT                   GFQVRVYNKIMGFISKIQLGDTKESSLETFEKLNIGDKLKVVITSIDSKDRSVLLSYRE
FT                   YENQKSREEISSYLFKGNDEESYKPFESLLKRDE"
FT   gene            complement(123991..124656)
FT                   /gene="cmk"
FT                   /locus_tag="BG0130"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(123991..124656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BG0130"
FT                   /product="cytidylate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0128"
FT                   /db_xref="EnsemblGenomes-Gn:BG0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06988"
FT                   /db_xref="GOA:Q662N3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662N3"
FT                   /protein_id="AAU06988.1"
FT                   /translation="MIIAIDGPSASGKSSIARELGVKLGYKFISSGYLYRIITLIAQKF
FT                   LMSSCDFISEDRLLNLILENDISFNDSSFFLNGENVESQILNDKIDFQVSFYSSYVGIR
FT                   NIVNKKLREVVKFSNDNYIIEGRDITTIVFPESEFKIYLDASVKVRALRRYKQRNGNET
FT                   LEELERTLKIRDDVDKRKQYGKLKLSKGVFYLDTSYKGLDDVCNIIIEKFNLKKVRER"
FT   gene            complement(124640..125389)
FT                   /locus_tag="BG0131"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(124640..125389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0129"
FT                   /db_xref="EnsemblGenomes-Gn:BG0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06989"
FT                   /db_xref="GOA:Q662N2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06989.1"
FT                   /translation="MIALKSPRVQVFLAEKGVGSRRFCEELIRKKLIRVNGSIAKLGDK
FT                   VSPGDRIIYKKQIYVFKDFQSKNKIYLALNKPKNYLCSNFDVNGRKLAISLVQPLFKER
FT                   IFSIGRLDFKSSGLLLFTNDGEFANDIIHPRRKVEREYIIESKKDIDENLLISFKSGIK
FT                   VKKEFFKLKSYEILNKNSARLILDEGKNREIRKVFLSKNIFLKKIHRIRIGNINLDNLK
FT                   EGQVKIIPLVKINRLKSRLEKSNDNSN"
FT   gene            complement(125376..126125)
FT                   /locus_tag="BG0132"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(125376..126125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0132"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0130"
FT                   /db_xref="EnsemblGenomes-Gn:BG0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06990"
FT                   /db_xref="UniProtKB/TrEMBL:Q662N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06990.1"
FT                   /translation="MSELSSYSISLDNFTGGIELFFEYVSMNRHVLRTLSLNQIIEEFI
FT                   VVSSDLNISIRGLIDFFYLANNLFYWKTQILFPLKLEYKDKAERKVVERLIDHSKNREN
FT                   GKLQLNQIKNFKFYDSKMIEDFIFGNSDNFVKNINAISNDNNKKKNLKKKSSVLKEKVI
FT                   NKKFKVVFNKYELKIFEKKMKIISILNKESSVIFDSLLDFNADNYSFERFSYFLVSLEC
FT                   KMLNIINLGYLDTKLVLYRGCKINDCT"
FT   gene            complement(126149..127237)
FT                   /gene="recA"
FT                   /locus_tag="BG0133"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(126149..127237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="BG0133"
FT                   /product="recA protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0131"
FT                   /db_xref="EnsemblGenomes-Gn:BG0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06991"
FT                   /db_xref="GOA:Q662N0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662N0"
FT                   /protein_id="AAU06991.1"
FT                   /translation="MSKLKEKRGKIVVSMERVKKEEAIELARVQIEKTFGKGSLIKIGE
FT                   SSVGKGIKSISSGSIVLDEALGIGGYPRGRIIEIFGPESSGKTTLTLQAIAEVQKEGGI
FT                   AAFIDAEHALNPVYAKALGVNVSELWLSQPDTGEQALEIAEHLIRSGGIDLIVVDSVAA
FT                   LTPKLEIDGEMGDSQIGLQARLMSKSLRKITGILSKSNTCIMFINQIRMRIGIMFGNPE
FT                   TTAGGNALKFYSSLRLEVRKIEQITRSGSSDDVIGNKIRVKIVKNKVAPPFRKVELVIY
FT                   FGKGISREAGILDAALKHNLIQKTGSWYSLGNNKLGQGRESVVEYLNKEVELANDLDKR
FT                   LRKIIFNNFDQEDVNFIKLKED"
FT   gene            complement(127251..129953)
FT                   /gene="greA"
FT                   /locus_tag="BG0134"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(127251..129953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BG0134"
FT                   /product="transcription elongation factor"
FT                   /note="ortholog to Borrelia burgdorferi BB0132"
FT                   /db_xref="EnsemblGenomes-Gn:BG0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06992"
FT                   /db_xref="GOA:Q662M9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M9"
FT                   /protein_id="AAU06992.1"
FT                   /translation="MSNVTIEKLDSILQEDKWTRIVVNNYSLAKIKELDDLIDNIIDEG
FT                   LTEDVLDICGRHLKDVKKSIAGLYISGMLIYSRRPLNDMNLLAVIDLFSQNLKWALVEH
FT                   ICNEMLSISENKHALYTLAKIYAQNNENDKLPSIWTRIVEADIDDTVFVRQLATYYETI
FT                   DLQKSIFYFRKAIYRFIDKKQMSGIREVWAKLIHYVSDDFDSFLLILQKIEKDLGFKKA
FT                   IVLYEDLFDHYSLTDNVDETIEILKGILKLDNKNHKARENLVKFLRERYKDVNNIEDYL
FT                   AKSDIENLDKNFVDVYSDFEKYLFFAKGNFVYHQTWSVGIVRDVNDHGITVDFVSKRGH
FT                   FIGFDMAMSALSPLSREDIRVLKAVTPKEELADRVKKDIEWAIKVIIKSYKAIDLKGIK
FT                   KELVPSLMTQSSWNSWSLKAKQILKDNPHFVMDSGKLDCYIYNERSSNLNEKMYDKFKI
FT                   EKDFYKRYEIFINYCNVKGIVKDLHIEEEMLNYFLIYVNNFTKVDHHVISSYVILKSLS
FT                   NFSEELSLKVNIEKNVNLESLLKEYSKGIVDLFDSILNAEIKKELIVLIKKELSNWILY
FT                   YKELFPHSVNKKLVESLYKEDPREVEKLFNYVIKNYKIYKDAYIWILKHCKTYSIKLSY
FT                   SDSELLANLIKILTDSVIKINNKNNSVASKRIYKMVINLLVKDRYLKSVLECLRDEELA
FT                   KRVYMTCFYVKDFPPKDLLEIKSIIRQLFDSVEFEDEKMQLTGDRMEIGFLTILSSLNK
FT                   KQKELKHLKEVEIPENSKEIGKARELGDLKENAEYHSAKEKQQFLTKRLNSLMLEIENA
FT                   KVIDTKDLQSSVVGFGTKVVILNEVTGKDESYLILGPWESNPDEGIISYKSPFGENLLD
FT                   SKEGDSLDFIINNTNFRYFVKKIEPIKFS"
FT   gene            complement(129990..130934)
FT                   /locus_tag="BG0135"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(129990..130934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0135"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0133"
FT                   /db_xref="EnsemblGenomes-Gn:BG0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06993"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06993.1"
FT                   /translation="MSSERIVELIKEIYLDFRKGNFKEALLKSEEAHSLDFDNIEILTA
FT                   LKSSVYWNGQVESLDRIGQDYEKAEFLIREWNNFAGRYLKKMGCSFLQGRNSIKYFVFQ
FT                   TCLYIYKNIYKFHPENLDLLIKIAKSYKGMGNYERAINVFLQILGDAKENSDVVAELAD
FT                   SYALVDEIKEAKVLFREAFFINPQKIDIYSLESDMILRLIDLIKSDRNISDDLIKEWIP
FT                   VYGSLNGVFNVKRELRPIELGQLKQSVYSLRNELKEKSYRSINESMLLPRLINKYFWLI
FT                   DHYVSIKEDRARIDEILLYIKEIDLGIYQQYVN"
FT   gene            131119..132246
FT                   /locus_tag="BG0136"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        131119..132246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0136"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0134"
FT                   /db_xref="EnsemblGenomes-Gn:BG0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06994"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06994.1"
FT                   /translation="MKPNKIINKAIYHYNSKKYSQAIKLLEKEIFFYKNYYLYHYVLGM
FT                   SYLRIGNLGNAQTYLKKAYTLNPGESNIKQAIAILLVSQGKEEKAIQIWLKMIEENQEV
FT                   DRSELSLEIIRKNPVEGSVFLKNNNLYEKLFPIIKAIPDKNLTKLIITIAIGGIVFIPI
FT                   LAIYFIFYEQKITTSINRKAEIKKKLNNITAYIDDIKINNKEKIKNEEGQFILILTSDE
FT                   IKNSFEKIKIYLKTGKDNFARVEINKILNSNASESIKLKAKNLASFISRPDFISFNEYL
FT                   NLQDIKKDPSIYANVYVKWEGVVNNVEKKDNIIQFDFYVGYNKNVLSGIIPTKTTFDID
FT                   IDFKDNVEILGQIEYKKNKLILNAITIRKIDKNAN"
FT   gene            complement(132293..133663)
FT                   /gene="hisS"
FT                   /locus_tag="BG0137"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(132293..133663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BG0137"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0135"
FT                   /db_xref="EnsemblGenomes-Gn:BG0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06995"
FT                   /db_xref="GOA:Q662M6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662M6"
FT                   /protein_id="AAU06995.1"
FT                   /translation="MDVKTLKGFKDYLPKDSLIRIHIVKQIFSVLNSYNFDLIDTPVLE
FT                   YSELLLKKSGDESEKQIYRFKDHGGRDVSMRFDLTIPFARFVATNISDLKFPFRRSQFG
FT                   KVFRGENSQKGRYREFMQFDFDIVGEDGFRADAEILSVVYYGLEEIFLNFIEGINKKFI
FT                   IHYSHLGILNSFFEKLGIKEESIFILRNIDKIDKIGIDKVKEALLLKIEKEAVDSILSL
FT                   VNLQGAFKDKIQALKSILGDNESVKRVEDVYRHLSLLKIQDSFNLNLKISGGLDYYTGI
FT                   VFESEVFGSNMGSVCSGGRYDNLVSSYSSSIQKVSGVGGSFGVDRIKDIIDLEQFSYIK
FT                   IFVTKARSKVLIVNLDSALQNYYYELATRFRNHDYSKVKNISCEVYFKNKNGKNIKEQI
FT                   EYALNKEIRFLVFVGQEEYKENKIKVRDLTKKEELLLSFEEVINVIKCNEKLLCTPF"
FT   gene            133796..135685
FT                   /gene="pbp-1"
FT                   /locus_tag="BG0138"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        133796..135685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp-1"
FT                   /locus_tag="BG0138"
FT                   /product="penicillin-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0136"
FT                   /db_xref="EnsemblGenomes-Gn:BG0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06996"
FT                   /db_xref="GOA:Q662M5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M5"
FT                   /protein_id="AAU06996.1"
FT                   /translation="MTKKILNNKYRIKTILIISLGITLLTIYKYFTLMVLNNSPDNIIS
FT                   LKSNDIVRRGTIYDRNGKPIAFSSKSYSIGTNPQKIENIVNTSETLGAILQIDSRILKE
FT                   KLSSNKGFLYIKRKIKREESDLIKRIQAEGRLSNIALYPDYTRIYPFRHVTSNITGFVG
FT                   TDNLGLEGIEFSLNSILVKDKTKQQFLNEELETNNIYLTIDMNIQQGVSKIAKKYFKEN
FT                   NPESLITLVMDSQNGEILSMVQFPQYDANFYSEYPEEIRKNLSSSLTYEPGSINKIFTV
FT                   AIILESGKLNLEEKFLDNGIYQKQFPSGEKITIKTLNPPYKYIDSTEILIYSSNVGIAY
FT                   ITDKVSNEYFYKKLLDFGFGKKVGFPFPGETKGLLNHYSKWSGRSKATIGFGQEIGVSA
FT                   VQILQAASILGNNGIMLKPRIIKKISNDKEESIKEFDKEEIKRAISKSSAQKVLKMMRE
FT                   VVNKGGIPNLKIKNLDISAKSGTSQAIDRKTGKYSEEDYTSSILAIYPTEQPKYIIYIV
FT                   YRYPKKIIYGTRIAAPMAKEIIEFIEYQQNTSAYKKIKMPSKIKIPKTAANYKNKAYLP
FT                   NFINLSKREAIDILKYYKNTIKIKINGAGFVYKQSIPPNTKLEDIVELELYLK"
FT   gene            complement(135686..137578)
FT                   /locus_tag="BG0139"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(135686..137578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0139"
FT                   /product="long-chain-fatty-acid CoA ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0137"
FT                   /db_xref="EnsemblGenomes-Gn:BG0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06997"
FT                   /db_xref="GOA:Q662M4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M4"
FT                   /protein_id="AAU06997.1"
FT                   /translation="MSIAKAFFEVADQQKDKIAQIYKVCNGYTHVTYGDLKNNVLKLAS
FT                   FLKSINVKHQDKIFICSENRAEWAVIDFAILSLGAVDIPKGSDVTLFEAEIIFNSVLPS
FT                   VVVLENLNLLNMFVQIQFAVKPIFIIIENLNKEDRLKYSDFEIYTYGDCISFGDNLRKD
FT                   SEIIDIASKVDSNDMATIIYTSGTTGNPKGVMLSHANLLYQVSSFSLMVDTQVGQIFMC
FT                   ILPIWHSFQRSFSYNIFLKGMVCLFSTIVPRAMLDDIKNINPHYIAAVPRLWIAIRQNI
FT                   NKEVSKKPFISRIIFHFFIKLAFLSDICYRIVMGLYPDNGFNLFFPIKKILGIFGLISL
FT                   FPFKALGNILIFNKINKILGNNFVVGITGGGSMPLSVSRFFNSIGIELANAYGLTETSP
FT                   GVASNKHKKVIIGTCGKILPGTVAEIRDADGNKLKKPGKGILFVKGPQVMLGYYKDREA
FT                   TCRIIGPDSFLNTGDIAKLSKDNVVQIIGREKDTIVLNNGENVEPAPIEIKLEESILIE
FT                   KAVVVGQDQKFLGALILPNFEEINKYLESVGQKIFDANNRRQVISNNIVLKAINDEIKK
FT                   LINRTNGFKPFEQILKFTLLEKPFEVGKEISIKMDIKRSYILNFYKNEIKNLFI"
FT   gene            complement(138021..138329)
FT                   /locus_tag="BG0140"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(138021..138329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0140"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0139"
FT                   /db_xref="EnsemblGenomes-Gn:BG0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06998"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU06998.1"
FT                   /translation="MTKFHRYRIEIISNLSLELDILECMEKIEQELGEPIYYSKIENVY
FT                   GKGKKGEKHGNGVWPEENFILIIYTSNKSIVNRLKNIVDDLNRSYPTEGINFFILEN"
FT   gene            complement(138331..141543)
FT                   /gene="acrB"
FT                   /locus_tag="BG0141"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(138331..141543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="BG0141"
FT                   /product="acriflavine resistance protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0140"
FT                   /db_xref="EnsemblGenomes-Gn:BG0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU06999"
FT                   /db_xref="GOA:Q662M2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M2"
FT                   /protein_id="AAU06999.1"
FT                   /translation="MLVKRIVGKPITMLILFSLVMMISLYTFSRLKIDLLPGIDIPQIS
FT                   IHTAYPGASPREVEESVSRVLESGLSSVKNLKNIYSTSSKESSTVSLEFYHGTDWDLVL
FT                   NEIRDALELVKSLLPSKSQAPRIFRYNLKNIPVMEITINSVRPVSELKRYADEVIKPGL
FT                   ERLDGVAIVTVNGGSKKRVLIEVSQNRLESYGLSLSRISSIIASQNLELSAGNIIENNL
FT                   EYLVQVSGKFKSIEEIGNVVIAYKIPAISSGINSSAIEIKLKDIANIKTDFEDLSEYVE
FT                   YNGLPSISLSVQKRSDANSIAVSNVVVREIEKLKLSMPKDMKLEIASDSTNFIKASIST
FT                   VVNSAYFGAILAIFVIFFFLRSFRATIIIGISIPIAIILTFCLMYFLNISINIMSLAGL
FT                   ALGIGMVVDCSIVVIDNIYKYRQKGAKLISSSILGAQEMMLPITSSTFTSICVFGPFLI
FT                   FKSELGVYGDFFKDFSFTIVISLGVSLLVAIFLVPVLSSHYVGLYTSFQKNIKNAFIRK
FT                   IDTFFARIYYFLEFLYINLLNIVLNHKLIFGLIVFFSFIGSLFLGLLLDVTTFARGKEN
FT                   SIVINLNFPNKTNLEYAKFYSNKFLEIVKSEAKGYKSIISTLNADRITFNILFPLKEES
FT                   RGKLIQSIDYDAIKYKIMNRIGNLYPEFNIEPSSGNALGGGDAIKIKISGNDFEYIKDY
FT                   GKILVSMFKKEIPELVNPRLSINDLQLQIGVEIDRALAYNYGIDMNTILSELKANVNGV
FT                   VAGQYVENGLNYDIVLKLDRMDVKNLKDLGKIFITSPSGVKIPFSSIATFEKTNKAESI
FT                   YRENQALTIYLNASISPNDNLTQVTAKVIDFINNKVPHKEGTVLKVEGEYDEFSNIMNQ
FT                   FKIIITMAVIVVFGIMASQFESFLKPFIIIFTIPLTAIGVVLIHFLAGEKLSIFAAIGM
FT                   LMLVGVVVNTGIVLIDYTGLLIKRGFGLRESIIESCRSRLRPILMSSLTSIIGLIPMAF
FT                   SSGSGNELLKPIAFTFIGGMTASTFLTLFFIPMLFEVFSNIVSSFKSRLKRVVPNLDVE
FT                   KSFKINNSTKSSYDNLFEEDGD"
FT   gene            complement(141562..142515)
FT                   /gene="mtrC"
FT                   /locus_tag="BG0142"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(141562..142515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrC"
FT                   /locus_tag="BG0142"
FT                   /product="membrane fusion protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0141"
FT                   /db_xref="EnsemblGenomes-Gn:BG0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07000"
FT                   /db_xref="GOA:Q662M1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M1"
FT                   /protein_id="AAU07000.1"
FT                   /translation="MNLIFNINLYFKKYFLVLVLVLVACVSKNKLDDKNINKYKESAYR
FT                   FPVIAIKIKKGTLSDYLSLNGDIDTKVKADIFPDAAGKITSLRVKLGTYVKKEQVIATL
FT                   DPSRPGSVYLNSPVRAPISGYILNIRKKIGETVNPQSSIAVVGRTDAKQILTYVSEKYI
FT                   SNIKVGNDAIIEVGAYPNEKFKAKVSEISPVLDSKSRTIEVYLTPIGSNLDKLIIGMFS
FT                   KIKLITKSFRDVIKIPREAVVEREGKQFVFKLDLEGKSVQMLPVTVLFEIDGIVALSGE
FT                   VKENDLIVVEGMSTLSNGTPINLVDTKKSLSAESNI"
FT   gene            complement(142527..143762)
FT                   /locus_tag="BG0143"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(142527..143762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0143"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0142"
FT                   /db_xref="EnsemblGenomes-Gn:BG0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07001"
FT                   /db_xref="GOA:Q662M0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q662M0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07001.1"
FT                   /translation="MTVSFSFAEIIQISPKQAVNMALENSLDSENAQYKENIKKLYKNN
FT                   AWNVFIPNVNLSSTLSRNSSVLSELERDYWGLGFGVAINLSLSPSVLKRMELVMLEYEN
FT                   AKIERESAVRNIKLNVLKAYNQLIALKSILKVFESQIQNSKLKFEQARIAYNNGLISEI
FT                   DFLDAQLKHKKSQPDLDGQIINFEKSKEIYKLLIGLDPDQDFEIVGELPDDTIDFSLFN
FT                   EALNFNESLEIKELNMRLKMTEQLIDSLWLDTFLPSLSLSFSYSPYRSFNENSKGFSSG
FT                   FSASFSLNYGLTEIFPFSKSFTKIQDSNYQLKILQNNIEGKIRNLKSSIVQKRKDIRKY
FT                   KTILDASKINVELASKNYQMAFNAFNSGIIDLSKLNDIEIAYKQSDLKLIEDKLNYSNS
FT                   ILEYKDLINSLD"
FT   gene            complement(144170..145054)
FT                   /gene="proX"
FT                   /locus_tag="BG0144"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(144170..145054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proX"
FT                   /locus_tag="BG0144"
FT                   /product="glycine betaine, L-proline ABC transporter,
FT                   binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0144"
FT                   /db_xref="EnsemblGenomes-Gn:BG0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07002"
FT                   /db_xref="GOA:Q662L9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L9"
FT                   /protein_id="AAU07002.1"
FT                   /translation="MNFIYKLFIGFFIFLIFLSCDEKKSSKNLKSVKIGYVNWGGETAA
FT                   TNVLKVVFEKMGYNAEIFSVTTSVMYQYLATGKVDGTVSSWIPTADKFYYEKLKTKFVD
FT                   LGSNYEGTIQGFVVPSYVPISSISELKGKGDKFKNKMIGIDAGAGTQIVTEQALDYYGL
FT                   SKEYELVPSSESVMLASLDSAIKRNEWVLVPLWKPHWAFSRYDIKLLDDPDLIMGGIES
FT                   VHTLVRLGLENDDLDAYYVFDHFYWNDDLILPLMDRNDKEPGKEYRNAVEFVEKNKEIV
FT                   KMWVPEKYKTLFD"
FT   gene            complement(145069..145968)
FT                   /gene="proW"
FT                   /locus_tag="BG0145"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(145069..145968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proW"
FT                   /locus_tag="BG0145"
FT                   /product="glycine betaine, L-proline ABC transporter,
FT                   permease protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0145"
FT                   /db_xref="EnsemblGenomes-Gn:BG0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07003"
FT                   /db_xref="GOA:Q662L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L8"
FT                   /protein_id="AAU07003.1"
FT                   /translation="MSKDFFILKIDNFFDFLVDNFSTSDGVGFSKSIIFLYESLKNLFL
FT                   FVNPIIFILTACLLSLVFLKKRLVFLILPGFFFILYFDLWEASMDTIAIIFVSVFVSVI
FT                   LGIPIGILGGYFPRFYVFLKPILDLMQAMPPFIYLIPAIPFFGMGTASAIFATIIFAMP
FT                   PVIRYTRLGIVQVSDEVIEAAKSFGSSNLRILLQVQLPLSLQSIIEGINQSIMMAISMI
FT                   VIAAMVGSSGLGRTVIYSIERLNFGEGLISGLAVVIIAIILDRVMQSIFIKFSYLNTDH
FT                   YGGKKENKFKRFLEIYNK"
FT   gene            complement(145975..147093)
FT                   /gene="proV"
FT                   /locus_tag="BG0146"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(145975..147093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proV"
FT                   /locus_tag="BG0146"
FT                   /product="glycine betaine, L-proline ABC transporter,
FT                   ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0146"
FT                   /db_xref="EnsemblGenomes-Gn:BG0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07004"
FT                   /db_xref="GOA:Q662L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L7"
FT                   /protein_id="AAU07004.1"
FT                   /translation="MSRVTVKIKDCYKVFSYYVGKKQIIQAIKDYEDGKDRMQIYKESS
FT                   IFIANANINLDVYENEILVIMGMSGCGKSTLVRCLNGIYKIDSGSILVNNMEMNAINRK
FT                   DLSNLRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKHIPRKIREERAIEVLNLVGLEDS
FT                   KYKYINELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIKGEMQEELLRLVAKLKK
FT                   TVVFITHDLIEAFKLGHRIAFMRDGKIIQVGKPLEILANPSTDFISHFIKNLPVLNILK
FT                   IKDILKDDFDLNSGSDNGLNVVIKYQGENFSLYDKVLNKKYENLVSLDLELNDEIKKIV
FT                   EYLNKQDYLIIKEKGAIVGYINLNEISDLLSR"
FT   gene            complement(147245..148255)
FT                   /gene="flaB"
FT                   /locus_tag="BG0147"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(147245..148255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaB"
FT                   /locus_tag="BG0147"
FT                   /product="flagellar filament 41 kDa core protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0147"
FT                   /db_xref="EnsemblGenomes-Gn:BG0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07005"
FT                   /db_xref="GOA:Q662L6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L6"
FT                   /protein_id="AAU07005.1"
FT                   /translation="MIINHNTSAINASRNNSINAANLSKTQEKLSSGYRINRASDDAAG
FT                   MGVSGKINAQIRGLSQASRNTSKAINFIQTTEGNLNEVEKVLVRMKELAVQSGNGTYSD
FT                   ADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKSASQNVRTAEELGMQPAKINTPAS
FT                   LSGSQASWTLRVHVGANQDEAIAVNIYAANVANLFSGEGSQAAQTAPVQEGAQQEGAQQ
FT                   PAPATAPSQGGVNSPVNVTTTVDANTSLAKIENAIRMISDQRANLGAFQNRLESIKDST
FT                   EYAIENLKASYAQIKDATMTDEVVASTTNSILTQSAMAMIAQANQVPQYVLSLLR"
FT   gene            complement(148382..150379)
FT                   /gene="fliD"
FT                   /locus_tag="BG0148"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(148382..150379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="BG0148"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="ortholog to Borrelia burgdorferi BB0149"
FT                   /db_xref="EnsemblGenomes-Gn:BG0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07006"
FT                   /db_xref="GOA:Q662L5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L5"
FT                   /protein_id="AAU07006.1"
FT                   /translation="MASGFFVPGLESKYNTKEIRESMLKPDRAKIDSSFKKLESLEQEK
FT                   SAWQLINRKISALNSLAKEITSLNSPFNLMSGNSSNSEVLTLSTRYGSKNETHKLIVDQ
FT                   IASADVFLSSNFDPKKVTIPEGDYIFLVGKKEINVKSNGNIDLLVKDINNKGKGFLSAK
FT                   IVKSDKNGNSRFILQSLKEGKENKLVIKGEGLSFAKQIGILSELKTNFNPTFSDIVVNQ
FT                   SSSNNRLVFENNSLVLNPLSEVSIEIPEDIEITSRSKIKFKVKYFDTGLEEPDSKIIFN
FT                   PGEATFKDAKVDSEYSVVDLGSDLKTPLEKKYIQMNMVKICNIEGSLELPSINISNNFE
FT                   EVEADVGAFSNLQEINIEITANNKVIVISNVEVFDPKNRDGHLPINAKSFAENAKIIFD
FT                   GVHVERDLNVINDLIPNVTLSLKKASSDMVEAKVEPDYEGIKRVLLDFIGAYNEVIAEI
FT                   NIVSSNEDQLGNQKSNIVEELTYLSESQKEEAYKNLGVLRSEFLLKNLKSRLESIIFKP
FT                   YVTSDPNFSIINQMGVFTNSISSSGGLSRYLRLDEKKFDESIRNNIDNVRELFLFDLNG
FT                   DRVYDNGIAKMLGDCLAPLVTSGGVIYNKIKNYDLKIVNQKNKVEDYKKKYDDRERKVE
FT                   GELNILDFTVKRMKDQENTLKAFDFNQRNR"
FT   gene            150550..151755
FT                   /gene="nagA"
FT                   /locus_tag="BG0149"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        150550..151755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="BG0149"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="ortholog to Borrelia burgdorferi BB0151"
FT                   /db_xref="EnsemblGenomes-Gn:BG0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07007"
FT                   /db_xref="GOA:Q662L4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L4"
FT                   /protein_id="AAU07007.1"
FT                   /translation="MPNFCLFNSKSVLTGNDKLDNSAVLIKDNEIFDIVTSDRLKKMDL
FT                   REYQMIDAKCNYITPGLYDSHIHGFHGYGTDQCSTESILKMSEHLAQYGVVGFLPTLYP
FT                   RPIDEMIQTIKACTAAIGKEKGAKILGLHLEGPFFSPEKRGAHPVSYLHEPSIKVMQKL
FT                   IDAAGGIFTGSNGQKKTHISTMTVAPELKGMRELAMFCLENNINLQAGHTNATYENMIE
FT                   GFQVGILHTTHFFNAMSKLDHRNPNAIGAVLIHGDVSCEIIADGHHIHPKLVLMMRKLK
FT                   DISKIVLVTDGLTPNFQTSGKLIANGDEVYIAEDGLFHSVKSNTIAGSTLTMIQGLKNL
FT                   VEFGYSLSDAVQASSYNPTRILNIDKKGLICHGYDANINVLDKDFNLKLTMIESKIIFN
FT                   NL"
FT   gene            151782..152588
FT                   /gene="nagB"
FT                   /locus_tag="BG0150"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        151782..152588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="BG0150"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0152"
FT                   /db_xref="EnsemblGenomes-Gn:BG0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07008"
FT                   /db_xref="GOA:Q662L3"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662L3"
FT                   /protein_id="AAU07008.1"
FT                   /translation="MRLIIRPTYEDISKWAANHVAQKIKEFSPTREKPFILGLPTGSSP
FT                   IGMYKNLIKLYKDEKISFQNVITFNMDEYIGIEKNHPESYHSFMWKNFFSHIDIKKENI
FT                   NILNGNALNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLT
FT                   QDTIIANSRFFEGNVNKVPKSALTVGVGTIMDSQEILIIVNGHNKARALKHAIEKGVNH
FT                   MWTISALQLHKNTIIVSDKKATYELKIGTVEYFNDIERENFNNDLK"
FT   gene            complement(152655..153266)
FT                   /gene="sodA"
FT                   /locus_tag="BG0151"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(152655..153266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="BG0151"
FT                   /product="superoxide dismutase"
FT                   /note="ortholog to Borrelia burgdorferi BB0153"
FT                   /db_xref="EnsemblGenomes-Gn:BG0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07009"
FT                   /db_xref="GOA:Q662L2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L2"
FT                   /protein_id="AAU07009.1"
FT                   /translation="MFKLPELGYNYDAVEPYIDAKTMEIHHSKHHNGFVMNLNSIFEKM
FT                   GKSYLKDVSSILKNIHDFPDEFQTPIRNNAGGYSNHTLYFRSLKPGNKSNLLEKFENDV
FT                   NTAFGSPDVLKASLKDTAMKIFGSGWAWLVLCPDSGLKVISMPNQDSPLMKSYKPILGI
FT                   DVWEHAYYLKYQNRRIEYVDAFLKALNWEEVSKIYNEANN"
FT   gene            complement(153281..155980)
FT                   /gene="secA"
FT                   /locus_tag="BG0152"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(153281..155980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BG0152"
FT                   /product="preprotein translocase subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0154"
FT                   /db_xref="EnsemblGenomes-Gn:BG0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07010"
FT                   /db_xref="GOA:Q662L1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662L1"
FT                   /protein_id="AAU07010.1"
FT                   /translation="MLKAVLEPAIGSKSKRDLKDYLPTLRNINKLERWALLLADEDFSK
FT                   ETQKLKYELKSGNSLENILERAFTLSREAARRRLKERPYDVQIIAGLALHEGKIIEMKT
FT                   GEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFDLLGVTVGVVLSNMDY
FT                   ERRKDQYAKDITYVTNNELGFDYLRDNMRYDLNEKCLRKFNYCIIDEIDSILIDEARTP
FT                   LIISGPTEGNTNAYLEVNSLVSFLKECSKDSKSGDYPLEIDDLDGDYTIDEKAKRISFT
FT                   AKGLNNLEQLLVSKGIISGSLYTDSNFNYVHYMTQALKAHLLFFKNREYIVGDSGVEIV
FT                   DEFTGRVLTGRRYSDGLHQAIEAKEEVRVANENKTMATITFQNLFRMFDKISGMTGTAD
FT                   TEAKEFHKIYNLDVVVVPTNRLLARIDEEDTIYYTEEFKFHAITDEVYKTYKKGQPVLV
FT                   GTASIEKSEILSAMFKNRGIKHEVLNAKNHSREAFIIAEAGAKHAVTIATNMAGRGTDI
FT                   KLGGNIEHRVRKKIGTNVSLEEFQEAVKNERENYLKDYNEVKSLGGLYVIGSERHESRR
FT                   IDNQLRGRSGRQGDPGRSRFYVSLEDDLMRLFAGDSLRSLMGKLGMATGEPITHSLLTK
FT                   SLINAQKRVEDRNFEIRKHLLEYDDVITKQRDFIYAQRNSILEDTAIKDRILIALEEYL
FT                   SFLLEGTKGGSVSSVFLNEINLIFAYMLESLGSIENINSLDLKAKLMQIARANLDEKEN
FT                   LIGRDLFNGFLRYEYLKNIDFKFQEHLANLDSLREAVYLRSYANKNPITEYKEEGFLIF
FT                   SELIKDIKVSTIRRVLQLKLDSNSSDFKSVKKSKNVNSIHKELSGILINENKNVSNVQV
FT                   VRSSPKIGRNEPCYCGSGKKYKNCHGKS"
FT   gene            156049..157182
FT                   /locus_tag="BG0153"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        156049..157182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0153"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0155"
FT                   /db_xref="EnsemblGenomes-Gn:BG0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07011"
FT                   /db_xref="UniProtKB/TrEMBL:Q662L0"
FT                   /protein_id="AAU07011.1"
FT                   /translation="MKKYYNSLTLSLLFTIISCNTKTLNELGEEQFKIPFGTLPGAIMP
FT                   LDNKFTNSKFDIKTYNGLVYIAEIKTNKLMIFNSYGKLIQTYQNGIFKTNPDLKIKKID
FT                   FEGIEAIYPLNDFIIVADKLNNKKSKFNQKENIAYFMRILILNKNSSVEILGQEGLNGT
FT                   PFPQIYDVNVDENGNIAIISIYSEGYIIYSYNKELSPLYKIYVNENLLKTIDNQKKKYN
FT                   ISIDKVFFEVNKKTLYVKITYYENIGDNENINDLGIKIKDQYIYKMSFKKNKEFEVISK
FT                   IALPKNLLDDKQESFINIIKIQKDKIIASTNMKNLSNNLIWKLDNKGSIKNQIALIEPP
FT                   NLIFLSESLSKDGILSILYGGKTGVSVYWWNLNTLLK"
FT   gene            157214..157642
FT                   /locus_tag="BG0154"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        157214..157642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0154"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0156"
FT                   /db_xref="EnsemblGenomes-Gn:BG0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07012"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07012.1"
FT                   /translation="MKKINCNQQLEIEYQKKMKKHIIVGLIFVIILLFFKILLIPRIQN
FT                   LENNKNNIKMTISYKQDKSKLSLKINIKTQKISNLGKAKLDIYLDNRLIESNMLYISSK
FT                   NFTTYANIIYQNESLLSIILKSNSNKNIFYNKRIKPRG"
FT   gene            157646..158062
FT                   /locus_tag="BG0155"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        157646..158062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0155"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0157"
FT                   /db_xref="EnsemblGenomes-Gn:BG0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07013"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07013.1"
FT                   /translation="MMQIYFISVLLNILGGIILAFPMLIEKIKFFKIFEDFVNLINDNK
FT                   KVKSIFGLLFLITSALEIIKPYKLPIIGNLIPAISLFLIGFILFLKQKLPTEVQNNNKY
FT                   GKFQSILENNQQLIGIISIIIGIIHFLAAEIPLL"
FT   gene            158208..158945
FT                   /locus_tag="BG0156"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        158208..158945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0156"
FT                   /product="antigen, S2, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0158"
FT                   /db_xref="EnsemblGenomes-Gn:BG0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07014"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K7"
FT                   /protein_id="AAU07014.1"
FT                   /translation="MTFRINKRLKLMAVLMLMLSCAFFKKPQPVQQDGEIGKQISDEKL
FT                   PLNDGKLHLLSGKILNKKLPVVNENHDVTWIKTKAMTILDEYGQAMPEFKNKFGYSYIL
FT                   SPIKMNDEYSSFTSLLILFETTENGDKEYEIEDIKLITAGSNLELKNPLLVVENSQEEG
FT                   YVTAYPFGILMDEELRKAFQLTYQNGHWNYMLANLTVKNKITQKTEIYKISLNSKLIID
FT                   FVKEVLKENPILKETNGDLFEDI"
FT   gene            158969..159643
FT                   /locus_tag="BG0157"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        158969..159643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0157"
FT                   /product="antigen S2-related protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0159"
FT                   /db_xref="EnsemblGenomes-Gn:BG0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07015"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K6"
FT                   /protein_id="AAU07015.1"
FT                   /translation="MIIKKFILTVIILSLAKNIFSQNEINIFENENYIVKENIKPRIKK
FT                   LKQSFLLASVDIAVSQPYMELVDLNGAPIKELIGVSYSFINAFSKIGSSAIISFDLSNE
FT                   ASRKYKITKLKFLSPDKGNFINYLSSLTSGKQQSKKELAKDAYSFGTLRTESLSKTIAE
FT                   YYKNNNWYYILAAITVENNINKETKIYEIRINPKIYNDFQKQLRLHFKGTQIKKFPIPI
FT                   IE"
FT   gene            159709..160809
FT                   /gene="alr"
FT                   /locus_tag="BG0158"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        159709..160809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BG0158"
FT                   /product="alanine racemase"
FT                   /note="ortholog to Borrelia burgdorferi BB0160"
FT                   /db_xref="EnsemblGenomes-Gn:BG0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07016"
FT                   /db_xref="GOA:Q662K5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K5"
FT                   /protein_id="AAU07016.1"
FT                   /translation="MSSNKTIIINLNNLEHNLNLIKNKIGEKEIVATLKGDAYGHGLIN
FT                   IFKFFKEKKINYFGLSNIEDAKTLKKIDKNIKILMYIKVDKKEIKNLIKLELLPFVADF
FT                   EYLFLIEKECAFQKKKIKVHLKIDIGMNRYGIRIDSALEIATYIQNSQFLELEGICSHL
FT                   PATENFKTTQKQIEKFLLVLETLKQKNINPKFIHISNSGHIINYKLNPQFNMVRPGLIL
FT                   YGYCQSLKNKKTTLNFKPVLNLFSKVIFIKNVKKGEKISYSGIFQAKEDMKIGIIPIGY
FT                   FDGIPQNINNNFYFLINNQKCKIKGKVCMNLTIVEIPKNLKVRIGSKVEIVSEKLSIDK
FT                   MSKFSKRSHYELLCNIGKYEKRKYLD"
FT   gene            complement(160801..162402)
FT                   /locus_tag="BG0159"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(160801..162402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0159"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0161"
FT                   /db_xref="EnsemblGenomes-Gn:BG0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07017"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07017.1"
FT                   /translation="MLFIIFFISSSLFAKEVYYRFADYSINYNIVGKYKITKEESEEEF
FT                   GYKFTYDRNNNLILVDYIGKLSILMPSFFNANQIKIERSKNSEKRIFLNRGLAFKNNNG
FT                   VYIEHIEYMNDGRIKNIFNYNRSNEMVRDRYDVSYYHFLYDNEREFSVYRFNESGIQIK
FT                   DLNNVYFTKISYDHSKLVKTALYYDENGYIARSKNGTCGFRLTYDANHNLIKEEYLDKS
FT                   AYTVSNPFSVATKIYHYDVDGKVIEILNYDINNNLTPDENNVAIYRYEYYFKNKDCYYK
FT                   EYNYDNNNNLTISQNGYAMKKTIFYIQNNEKRIINYSNKINKNYNRDIPTVYEEKYEIM
FT                   DNFKGIAIYSYKYDDKFYLIENIFFDKNFNLIADLKGVMIYRYSYDKEGFLIAQEHFGG
FT                   DFINPIDDFEGVSKYKFSYDSNGNMISKKNYSKDGALVADCNFVFEYLYEYDKQNRLIS
FT                   QKNFGSLGQLQDDIHGVSVYKYEYNKFGKISKQSNHGPDLRLRDDVGGFSIYKWIYDTR
FT                   GNLIDFQKFDSLGNLI"
FT   gene            162479..162646
FT                   /locus_tag="BG0160"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        162479..162646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0160"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0162"
FT                   /db_xref="EnsemblGenomes-Gn:BG0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07018"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07018.1"
FT                   /translation="MAKISKNAQRVGSKELISRWGGKIVMKSKFENGKIRHYAECQTSK
FT                   NTARKPKDLF"
FT   gene            complement(162673..164421)
FT                   /locus_tag="BG0161"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(162673..164421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0161"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0163"
FT                   /db_xref="EnsemblGenomes-Gn:BG0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07019"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07019.1"
FT                   /translation="MKKLPEIFYMSGKEVDILISQLGISSDTQKSILKTILSYKKDAID
FT                   YFSFIEEHSVRIRGLKGELDFLFRKLYEVKRGIVTNKIVADGEFLPDSIILTDEASYDF
FT                   YYYSIDDLFLKTYVGIELFSFLLTVKNIESSLLVFQNEFITIIDSDINYKFFETKSQFK
FT                   EILVWRSLIIPSSRALYFIEFVKKIFFNIASNNIVKDVFVRIKGLKLGDYERALEEGKN
FT                   IIGAIAKILSGIIEIKDEVLGKKGITFSKNYFIFLEFLNLFIKNEKDLEELKTVEAIKI
FT                   DESLKAIEKTLEFKKGPIDREEFSSILKVYSEGLNDPENFLLVANMYFFESKIHDILPK
FT                   IFQVKENFYLYKPFAYEFFLEEYEKVLQFLNSELRTSIFKILSFGDDPSSIFTEEGLEE
FT                   VISRLVSRYIMNEYCLKNKVKFLDLIVSHYRRIYKTQNVQVHLKDLIKVEAAKYFKNSN
FT                   ELLPLYKIYKLDLYSLLNAAYKDLSLFKRIVLFLTGKHQSYKEALSRLDFRAGLNKNGS
FT                   GLFDSNERVKRQLEKIRKQREEIKAQVRNSFPKKGATSKQAVNKNYTKQEQDEAWVKFS
FT                   DRIQKK"
FT   gene            complement(164502..165488)
FT                   /locus_tag="BG0162"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(164502..165488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0162"
FT                   /product="Na+/Ca+ exchange protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0164"
FT                   /db_xref="EnsemblGenomes-Gn:BG0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07020"
FT                   /db_xref="GOA:Q662K1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K1"
FT                   /protein_id="AAU07020.1"
FT                   /translation="MEHLIHFFYVGFGIFLLYLGGNLLLKSSVSIATYLKVPTLLIGVT
FT                   IVSFSTSAPELFTSLVAAFKGKNEIVVSNVIGSNIINMLLALPLAGLFLRIKADFKRLK
FT                   LSFMFLFLLMLLLLLLSFDFRSYSFFAAPYNRLSSLSILILFLSYLLFFYKEEKAHFSL
FT                   ENPSQEGASNLNQSLNFIFFNTLSFFISMYFLYLGSKLLVDGALYIANNVFNVSEKLIG
FT                   IIVVAFGTSVPELVVSLFAIIRKESDIAFGNIIGSNIFNIGFILASSSFFKPILLQDIY
FT                   ILDFSIMVFITLVLFLVVKFKGVFSRGISLIFLLLYVFYNLMLFNFY"
FT   gene            complement(165516..167360)
FT                   /locus_tag="BG0163"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(165516..167360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0163"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0165"
FT                   /db_xref="EnsemblGenomes-Gn:BG0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07021"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:Q662K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07021.1"
FT                   /translation="MYMKIFIYWIVIFFFFIYKVFSIYSLTDEEFFKKYSLFFVHKGFL
FT                   SKNINGKITKVQVNGIDSRWVYPFRKLVPSRITSIYEDIYSSSSFLTTSDNLYVSYDYS
FT                   KNFRKLVGINKFNSSAYITSSAFSQGEYKRIAIGTAIHGIYLSVNGAASFKNLNHLIPQ
FT                   IYLGAGYYDIISAVEFSREDTNNLYFSSGVYGDIFLISQESGFIKKISFPFKKQIVRIL
FT                   DLSSKNVKKILVRTYDNHFYSYFNEQWLFIGKLSLQDQDFVEKSQRMQLAKNKGSIYLT
FT                   AHTLSNNRAVDERFKFIKDTGMNAVVIDFKDDNGNLTYSSKLSLPNRLGSIKNLIDVSY
FT                   ILKKARELGIYVIARCVVFKDAKLYYYNNFKHALWNKRTNKPWAHFIKKVDSSGLVKYM
FT                   QVEHWVDIFSPAIWEYNLSIAKEIQSFGVDEIQFDYIRFPSDGPIYFATSKMNKYEMRP
FT                   VDALESFLIMAREQLYIPISVDIYGYNGWFPTNSIGQNIAMLSDYVDVISPMFYPSHYT
FT                   NDFLPSNFYYTKRAYKIYKEGSDRTFMFSLDGVVIRPYVQAFLLGKERFVDDEVYLKYL
FT                   KFQLKGVKESLGSGFSLWNASNVYYMVKGNLKEYLNSF"
FT   gene            complement(167472..168992)
FT                   /gene="malQ"
FT                   /locus_tag="BG0164"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(167472..168992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="BG0164"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0166"
FT                   /db_xref="EnsemblGenomes-Gn:BG0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07022"
FT                   /db_xref="GOA:Q662J9"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J9"
FT                   /protein_id="AAU07022.1"
FT                   /translation="MKYKKIRINLNLKRKSGILLNISSLPSKYGIGDLGKGAYKFIDFL
FT                   FASSQSYWQMFAYSPIDFTRSPPYSIFSAFAGNVYYIDLEALDKFIDSDLNLLKENETR
FT                   YSDLKKLSFKDKFLKEAALNFINRASVDEVRSFEKFKKKSSYWLLDFASFVAFKEYFLK
FT                   DSRDAFNVLFDRGILIRNEKDLFKLRNILSKEIKVQEVLQYFFFSQFQALKRYANDKGI
FT                   ELVMNLPLFIAYDSADVWAHQKYFKLRFDASKDKVAGISPDYFLEQEQAWDSPAYSWNV
FT                   LKNVKYEWWAKRIGILRKYIDVIKIDHFRGFVSTWEVGVGEAYAFNGLWVKSPGRDFFN
FT                   FILNEIKDLKIWVEDFENDLEDVSRLRDFFNFPGMRIMKLAFDFDSDNQNLPHNYIKNC
FT                   IVYTGIGDNSTIREFVNSLDDLHKKYIFDYLNTNEDFVVWDMIRSAMSSVSDSVIIPMQ
FT                   DYINLGNEFRANIPKNTLNNWIFRLLESDLDATLSKNISFITRLYGRT"
FT   gene            169134..170303
FT                   /gene="tpn50"
FT                   /locus_tag="BG0165"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        169134..170303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn50"
FT                   /locus_tag="BG0165"
FT                   /product="outer membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0167"
FT                   /db_xref="EnsemblGenomes-Gn:BG0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07023"
FT                   /db_xref="GOA:Q662J8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J8"
FT                   /protein_id="AAU07023.1"
FT                   /translation="MNIKAAMLLLLLFLVQSLALSSEIFEFKYIKGTKFRLEGKDNQKV
FT                   YFNGHYNSSSTTNIQISSEIKDTKEKFANIKAFFRILKRENINEPYLLNEEFEETFGVN
FT                   KQGEYIIGANQKRPSVRGIPRFPKTPIKINEKWTYPAEEYIEASKIDNSIKDFVVKFNV
FT                   NYEYKGKEENNGKHYHIILSNYESQYDIKNISFYQKVEQKIYFDNEIGNTYKYNDEYIF
FT                   EIKQNNNQHFKMIGNSLGRIVSIELPNDNFIETEVENYIQEKKIKDIGVEKNNKGINLS
FT                   FDIEFYPDSFQILQKEYKKLDLIAKLLEKFKKNNILIEGHTEQFGLEEEMYELSEKRAR
FT                   TIGNYLIKMKVKNKDQILFKGWGSQKPKYPKSSPLKAKNRRVEITILNN"
FT   gene            complement(170305..170370)
FT                   /locus_tag="BG0166"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(170305..170370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07024"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07024.1"
FT                   /translation="MLFYVLVARQKKKKRAKDDTS"
FT   gene            complement(170315..170692)
FT                   /locus_tag="BG0167"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(170315..170692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0167"
FT                   /product="dnaK suppressor, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0168"
FT                   /db_xref="EnsemblGenomes-Gn:BG0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07025"
FT                   /db_xref="GOA:Q662J6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J6"
FT                   /protein_id="AAU07025.1"
FT                   /translation="MQKASSEHEFIEEIKKFLSAEKREILDSIKSVENSKKEIINNDMY
FT                   PKDVVDIAFDNMDGNNLEALGFVEKRKLNLINQALYRISQNSYGKCLACEKEIARERLL
FT                   AIPYAFLCISCQTKKEKKSKR"
FT   gene            170858..171079
FT                   /gene="infA"
FT                   /locus_tag="BG0168"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        170858..171079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BG0168"
FT                   /product="translation initiation factor 1"
FT                   /note="ortholog to Borrelia burgdorferi BB0169"
FT                   /db_xref="EnsemblGenomes-Gn:BG0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07026"
FT                   /db_xref="GOA:Q662J5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662J5"
FT                   /protein_id="AAU07026.1"
FT                   /translation="MNIKEEAIETEGIVKESLPNTMFRVELKNKHIVLAHLSGKMRKHF
FT                   IKIVPGDKVKVELSPYDLTKGRIVYREK"
FT   gene            complement(171126..173177)
FT                   /locus_tag="BG0169"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(171126..173177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0169"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0170"
FT                   /db_xref="EnsemblGenomes-Gn:BG0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07027"
FT                   /db_xref="GOA:Q662J4"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07027.1"
FT                   /translation="MVEKNRREFGCSKRRLVIFFIYFFSIARLYSLTGIDFVKNIKVLK
FT                   GDKFIQIVRLNNPLQDIDTSLLKVEINKEVKSNSNVLSISRTTDNNNFSFIEIKVEYLF
FT                   DGLGFIKIPPLKVIYKGDSYVSSEAEVSVLRADEINSFGLPVDLYWDLDKREVYEYQSI
FT                   GLVLRSNWLLDSNSNKISGFLPAIKDAMIEKMPIFGDIKYRTFNNKEILDVPFYNFVLT
FT                   PLKGSKNVLIPSFSFNIDSGLVREAPELLLKVKPIPKEVKSLAVGIFRIDYETPTYSAI
FT                   EQDIFTILIKITGQGNFPHFYFPEIETYNSKILNKRKNYSFKPSKDGYKGSISQIYTVK
FT                   PGTKGSVFLNIGDFSYLNPDNGTVYTLKGKKLKYEYSGEFDSINKIHNNVDSDFKLLSY
FT                   TDILNYKNKTFLFFVPYYYLLLIPGFLLSLAILINYKKFFAASSFGLVILILAVGISLN
FT                   AVNDSLLSEKNINDLIENYNAKNYDAALIKIDNILKKYPNYSGLWLNRALVLSKMDRDF
FT                   DAIYSAYKAFLASPNNDAPYKVIGLIEAKNGVTDNIRNNSFIFANIFFIISLFLINFLV
FT                   ISISYKFLAKNLKKIIIFLLFSAICFTMFETYYFYSEQQSEVGIIKGDLVSLYKVPDNF
FT                   SRSWRFLKGNASVYILDSKDDFVLIETSYGLQGWIHKNFVVSLKDNLI"
FT   gene            complement(173126..173713)
FT                   /locus_tag="BG0170"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(173126..173713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0170"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0171"
FT                   /db_xref="EnsemblGenomes-Gn:BG0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07028"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07028.1"
FT                   /translation="MGRNFLAFLYACFFCLGFLSCSNVKSMSLMAIGNYEYVRGNYQNA
FT                   ISNYYNLVEDKKYSAWGYYNLGIVYYSLGEYESSLRIFSYAKKTNDIFLNFNVNYNEGI
FT                   IYYNQGLYHKAEMAFKEALKINPSSYNAKYNLELAIIKKRTVRDSLNSLSVEKSKNFVE
FT                   SNENFLRYIENLERVVWLRKIDESLVAPKEDW"
FT   gene            complement(173695..174681)
FT                   /locus_tag="BG0171"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(173695..174681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0171"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0172"
FT                   /db_xref="EnsemblGenomes-Gn:BG0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07029"
FT                   /db_xref="GOA:Q662J2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07029.1"
FT                   /translation="MSINNYSALYFFLILICIFFVCVLDFRRNIPFFKTLSFMYGDNSY
FT                   IQNYYIKKVLMTMFFIFSLIFLILSILDISWGQRAVEDERNKLRISFIFDISRSMLSVD
FT                   EGKIINRLESAKNMISLILSNFENAEYSLTIFKGKSILVLPFSKDKNSLNKMLNYIEPN
FT                   LISSPGSFLGDAVFSVISSLQDDSYYNFLVILTDGDDWGENNYYRFSKFVNNLKLESFV
FT                   VGIGGNNPVLFDNNSIIKDKDGNFVKAVINEENLLLLASSLKGSYYNLYLKGINLVVND
FT                   IRNGIIRRTSNDIILVDVSRYKIFLVISLLFIFMYLFVRMVKWDETF"
FT   gene            complement(174678..175679)
FT                   /locus_tag="BG0172"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(174678..175679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0172"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0173"
FT                   /db_xref="EnsemblGenomes-Gn:BG0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07030"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07030.1"
FT                   /translation="MLTFNEPLYLFLLVIFPLIIYFNHFFKNRGGKIKFPISLYGNFNS
FT                   LKLKDYRLNLIYFFTYSFLYLAAMVMVFALAGPSVSKKKMIHLSAGADIVIVLDISPSM
FT                   GAVEFSSKNRLEFSKELIRRFISQRENDNIGLVAFAKDASIVVPITTDRDFFNKKLDDI
FT                   YIMDLGNGSALGLGISIALSHLKHSEALKRSIVVLTDGVVNSDEIYKDQVINLAQGLNV
FT                   KIYSIGIGSSEEFSVEFKLRSGKFYQGSLKEIYDPSMLVEISHKTGGLFYSVNDDFSFQ
FT                   FAIQDFSKKENLERKIKIAVDNKDIYKEFLVLAFFLLFIYFIFSKIFLKEIL"
FT   gene            complement(175666..176565)
FT                   /locus_tag="BG0173"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(175666..176565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0173"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0174"
FT                   /db_xref="EnsemblGenomes-Gn:BG0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07031"
FT                   /db_xref="UniProtKB/TrEMBL:Q662J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07031.1"
FT                   /translation="MKGVVSSLFLFLALFSHSYEIKNEIFMPTRYYVGDSVDFKVSLIL
FT                   NDDEEFFPADFKEIKDEFVEVNSISFNDVTNEIIVNFVSFYIGSSSLPSIYIGDVINNG
FT                   KKSKVFLENIKINTDKLVSNNSDFKIKNIEGVLFIPGTSAYLFLFILALFLIPYLILKL
FT                   LKLLNRLLIYLIVKHGLKKPYKVLQRQFVILSKYVREGGDQSTFYNLINSSLRVYLSKK
FT                   TGFDFNAITTTEISIILQDLKVPYEIRSTFINTLRLSDFSKFSGVDLVFESLSFVLEDL
FT                   RTAASNFEDFNRGANVNI"
FT   gene            complement(176572..177444)
FT                   /locus_tag="BG0174"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(176572..177444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0175"
FT                   /db_xref="EnsemblGenomes-Gn:BG0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07032"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q662I9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07032.1"
FT                   /translation="MIQDNEISSSTKTRIKALKFFSRKMLSELNFGGYRSIFKGLGLEF
FT                   HEFRPYEDSDDARFIDWNVSSKADSIFSKVFKEDRGMNLHLLVDNSLSMSLGDKVNKKD
FT                   VQDLLVSIFAHMAFFNNDKIGVTFFSSGTDKFIPSSKGHSHLGLILSETINRNLKPGSS
FT                   LAYIFKNTAEYYKKRSLVIIISDFKANAYFKSLNVLSKRHNGIAIRISDFFDENFPKIG
FT                   TLICEDIETGENFLVSGFSKLTLSDYKNYWTLDKIKWKKECIKKNISFIEIDTKEDVFK
FT                   KLKILLKKG"
FT   gene            complement(177462..178454)
FT                   /locus_tag="BG0175"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(177462..178454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0175"
FT                   /product="MoxR-related protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0176"
FT                   /db_xref="EnsemblGenomes-Gn:BG0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07033"
FT                   /db_xref="GOA:Q662I8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q662I8"
FT                   /protein_id="AAU07033.1"
FT                   /translation="MKSSFQIDSEVENALHLINKFRREVASRILGQKEMIDAILMGLLT
FT                   EGHVLLEGVPGLAKTLAIQTVSDVLDLEFKRIQFTPDLLPSDLTGNMVYKSATGTFKVR
FT                   KGPVFSNVILADEINRAPAKVQSALLEAMGERQVTLGDETHRLPDPFFVLATQNPIEQE
FT                   GTYNLPESQLDRFLLKVNVNYPSVQDEVRLLKIFSVDGRLENIKVAKVMNAYSLADIKR
FT                   TVGRVKVDDKIMLYIVTLISASRERDKKTYPFAKYIEFGASPRASLSLLKCARVNALYE
FT                   GRIFVLPEDVKAVAYSVLRHRITPSYEAEVEEMSIDDIIRMLLSAVALP"
FT   gene            complement(178511..179137)
FT                   /gene="gidB"
FT                   /locus_tag="BG0176"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(178511..179137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BG0176"
FT                   /product="glucose inhibited division protein B"
FT                   /note="ortholog to Borrelia burgdorferi BB0177"
FT                   /db_xref="EnsemblGenomes-Gn:BG0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07034"
FT                   /db_xref="GOA:Q662I7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662I7"
FT                   /protein_id="AAU07034.1"
FT                   /translation="MISDIEFAFSECNFQFAYKDLQKINLYIKRILLLNTRFNLISNSN
FT                   SNFNSILNLHVIDSLLGLPTIKEINPSEILDVGSGSGFPGIVLAIFDTSRKYYLLERSK
FT                   KKSTFLKMIKLELDLENVKILEYEIEREKKKYEFITIRAFRSMNEYALVLKNLLKNGGL
FT                   IMAYKGKFDKINLEVNQIKDLFSKIEVKSLNSKLSLDRNLVLLYR"
FT   gene            complement(179134..180999)
FT                   /gene="gidA"
FT                   /locus_tag="BG0177"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(179134..180999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BG0177"
FT                   /product="glucose inhibited division protein A"
FT                   /note="ortholog to Borrelia burgdorferi BB0178"
FT                   /db_xref="EnsemblGenomes-Gn:BG0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07035"
FT                   /db_xref="GOA:Q662I6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662I6"
FT                   /protein_id="AAU07035.1"
FT                   /translation="MDFDAIVIGGGHAGIEAALALSRLDFKTLMITQNLDTIGKLSCNP
FT                   AIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKA
FT                   KETLERQDNLDLFQDTVVDFLLNSMRNEIKGVVTERGNKFRSNVVVLTTGTFLRGKIFI
FT                   GEYRANMGRLAEFSAYGLDKTLLSLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDI
FT                   IPFSFSNGNLDKSQLSCYVTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKI
FT                   VKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKFINSIEGLEHAIITRPGYAV
FT                   EYDYINPIELYPNLESKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMI
FT                   LTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEE
FT                   RYSKYLFKKRRVEEIKELLKQRRLSLKDVADEQLKKHVSKDFYHILKDPSISLDNLIKI
FT                   DPSLSDSKVILEQVELDVKYEGYINRQKDLIKKLNNLELVKLPFDFNYEIIEGLSREAR
FT                   EKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNKVVLNFSL"
FT   gene            complement(181002..182396)
FT                   /gene="thdF"
FT                   /locus_tag="BG0178"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(181002..182396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="BG0178"
FT                   /product="thiophene and furan oxidation protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0179"
FT                   /db_xref="EnsemblGenomes-Gn:BG0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07036"
FT                   /db_xref="GOA:Q662I5"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662I5"
FT                   /protein_id="AAU07036.1"
FT                   /translation="MSNLFQRDDDIVALATPFLSSALCVIRSSGASSIPKFSKIFSNHS
FT                   ALNSAPGNTIHYGYILDNENNCKVDEVVVCLYRAPKSFTGQDSIEVIAHGSVIGIKKII
FT                   DLFLKSGFRMAEPGEFTLRSFLAKKIALTKAEALHEIIFATTNKTYSLAVTPLSGALFA
FT                   NLDAIQRCLLNILSAVSAYLDYEVDDHEISIPFDLILNSKAELKKLINSYKVYEKIDHG
FT                   VTLVLAGSVNAGKSSLFNMFLKKDRSIVSSYPGTTRDYIEATFELDGILFNLFDTAGLK
FT                   DADNFVERLGIEKSNSLIKEASLVIYVIDVSSNLPREDFLFIDSNKSNSKILFVLNKID
FT                   LNINKSTEEFVRSSVLNSSNLIMISTKNLEGIDILYDKIKTLISYERVEIGLDDIIISS
FT                   SRQMQLLEKAYALVLDLLNKIDRQVSYDMLAFDAYEIINCLGEITGEVSSEDVLDNMFK
FT                   NFCLGK"
FT   gene            182479..182973
FT                   /locus_tag="BG0179"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        182479..182973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0179"
FT                   /product="flagellar protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0180"
FT                   /db_xref="EnsemblGenomes-Gn:BG0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07037"
FT                   /db_xref="UniProtKB/TrEMBL:Q662I4"
FT                   /protein_id="AAU07037.1"
FT                   /translation="MKAKLEIELKEVLKEELLLVEEIYKSYLKIKENVDNKNEIGLKEI
FT                   ANKTKILLENFQEIESKRDEIWKKFTQNKNFESTYEAVEKLTTIHKKEIYDYLHKLKIG
FT                   ILNIKNLNYMIQNYVNTSLDMLAIIFQDIQESVENVTYKNPYGPKIGGSKEASVLINKK
FT                   L"
FT   gene            182985..184868
FT                   /gene="flgK"
FT                   /locus_tag="BG0180"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        182985..184868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BG0180"
FT                   /product="flagellar hook-associated protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0181"
FT                   /db_xref="EnsemblGenomes-Gn:BG0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07038"
FT                   /db_xref="GOA:Q662I3"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q662I3"
FT                   /protein_id="AAU07038.1"
FT                   /translation="MDSTFSGIEIGKRSLFAHKDAMNTVGHNLSNATKPGYSRQRVTMK
FT                   TEIPLYAPQLNRAKKQGQLGQGIVVQSIDRVKDELLNTRIVEESHRLGYWTSQDKFISM
FT                   LEDVYNEPEDQSIRKRLNDFWESWQDLANQPQGLAERKIILERGKSFCELIRSRFHSLE
FT                   RIYIMANDEIKITTDEANNYIKNIANLNKQISKSQAMKDNPNDLMDARDLMVEKLGNLI
FT                   SVSIENKQDPNEFLIHSEGRHLVQGSIANEFKLEATNGPTRTKWNIFWANNDKANLETG
FT                   KLGSLLNIRDEEIKNEINELNNLAANIIELVNEIHETGHGMDKKSGRSFFSQELKLTDE
FT                   RGRYDTNGNGQFDSVHIFKINSTNEIFPEEKLGFYGILKFEATNSNEIIEIPYNAPDTV
FT                   QDLITRINNSNAQVTARINSEGKFEIKAVKEQENENITFRIKHIEDSGLFLTKYTGILN
FT                   ESGPEGAYDYRNIDTIDKLTPKSTYSISPLKNPAAWIKVADIIDLDPSKIAAGINSPTN
FT                   EISIGDNQAALRISSFGNSQIMIGKNLTLNDYFANTASNIAIKGQISEITKESQSQILK
FT                   DLTDLRMSISGVNKDEELANMIEFQQAFIAASKFITVSAELIDTIINKMGV"
FT   gene            184871..186145
FT                   /gene="flgL"
FT                   /locus_tag="BG0181"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        184871..186145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BG0181"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="ortholog to Borrelia burgdorferi BB0182"
FT                   /db_xref="EnsemblGenomes-Gn:BG0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07039"
FT                   /db_xref="GOA:Q662I2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q662I2"
FT                   /protein_id="AAU07039.1"
FT                   /translation="MINRVSHPLTYENLKTSAAEQESKITKLLENLYKGGKRIVKLRND
FT                   PTGVTHAIRLDSDIFKLNVYIKNIGTSKGNLRYTEGYLQSLTNILTRAKEIAIQGASGT
FT                   YEADDKKMISKEVNALLEDAIAIANAKGPDGYSIFSGTKIDSEAFKVTRENKISKISKD
FT                   GEGPQIIKVEYTGNQAEKKTEVYNDVHISNNYSGNKIFFLQNQNIISSINTNGFTVKEN
FT                   TKIYIDNVEIGLTTGDTALDIVAKINESSAPVEASIDPVLNSLSIKTTTPHQIWITEAK
FT                   ESNVLQTLGILTKNNDTKLPPYNLSSSTEVRSRSIFDALIELRDTLYNNKEELVGSRSL
FT                   AEIDESLKRLLISVADLGAKENRLDRSYERISKEAADMKEDMVQYTDLDVTKAITNLNM
FT                   ASLAYQVSLGISAKIMQTTLLDFIK"
FT   gene            186147..186539
FT                   /locus_tag="BG0182"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        186147..186539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0183"
FT                   /db_xref="EnsemblGenomes-Gn:BG0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07040"
FT                   /db_xref="GOA:Q662I1"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662I1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07040.1"
FT                   /translation="MINEKSIGFDFPEGILGFENIKKFIIKDSKYKPFSIMQSINKEVS
FT                   FLVTSPFNFLSEYLPNIQEKDWSDIKAKEEDERVILCIINMHVNDYKDITANLKAPIII
FT                   NKKKLLGKQAICTNEKYSLHHKVFKE"
FT   gene            186542..186787
FT                   /gene="csrA"
FT                   /locus_tag="BG0183"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        186542..186787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="BG0183"
FT                   /product="carbon storage regulator"
FT                   /note="ortholog to Borrelia burgdorferi BB0184"
FT                   /db_xref="EnsemblGenomes-Gn:BG0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07041"
FT                   /db_xref="GOA:Q662I0"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662I0"
FT                   /protein_id="AAU07041.1"
FT                   /translation="MLVLSRKVNESIKINSDIEVLILEIKKDTVKIAIKAPENIKIFRS
FT                   EIYKFIIEENKKSILKDKHNISKIKSLFNHYFKNEN"
FT   gene            complement(186771..187424)
FT                   /locus_tag="BG0184"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(186771..187424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0185"
FT                   /db_xref="EnsemblGenomes-Gn:BG0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07042"
FT                   /db_xref="GOA:Q662H9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07042.1"
FT                   /translation="MVNALSFEYSYKALIVYCRINNKDFSLFKLKSNFNFSIPKIFNDF
FT                   VITNNIDLNQIKLIVNSCGPGSFTGLRISLSFVKGLALGLSIPFVNISTFDVFANLVKN
FT                   SSSVIVLAFTAGKYFLGHYKNCELIGKILCFSKEDLFEYLNQIDPNSVLIGNNLENISE
FT                   KFNYKFEIIENLSSFGRILTELGIAKYLKNRKSDDILSGPLYIRQSDAEINFHS"
FT   gene            complement(187417..187830)
FT                   /locus_tag="BG0185"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(187417..187830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0186"
FT                   /db_xref="EnsemblGenomes-Gn:BG0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07043"
FT                   /db_xref="GOA:Q662H8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07043.1"
FT                   /translation="MILEFKSEKKMINFSKSFFYPLPIGKIFVLSGDMGSGKTSFLKGL
FT                   ALNLGISYFTSPTYNIVNVYDFIDFKFYHIDLYRVFSLEEFELIGGLEMLLDLDSIIAI
FT                   EWPQIALSIVPKDRLFSLTFKIVGSGRAIELNG"
FT   gene            complement(187827..188087)
FT                   /locus_tag="BG0186"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(187827..188087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0186"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0187"
FT                   /db_xref="EnsemblGenomes-Gn:BG0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07044"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07044.1"
FT                   /translation="MQLISLNNIEKQESYIYYRNVYFADVVYKYNDTLEVKKVKFVIEA
FT                   TPLGEKHVTIDFVDLLNYPVLKLMVAIKRCVIDLEFKGMLP"
FT   gene            complement(188301..188648)
FT                   /gene="rplT"
FT                   /locus_tag="BG0187"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(188301..188648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BG0187"
FT                   /product="ribosomal protein L20"
FT                   /note="ortholog to Borrelia burgdorferi BB0188"
FT                   /db_xref="EnsemblGenomes-Gn:BG0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07045"
FT                   /db_xref="GOA:Q662H6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662H6"
FT                   /protein_id="AAU07045.1"
FT                   /translation="MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMY
FT                   ATRDRKARKRDFRRLWISRISAALSDTGISYSRFIEGLLKSNIKINRKILSNLAIEDAE
FT                   AFKKIVLEIRR"
FT   gene            complement(188669..188869)
FT                   /gene="rpmI"
FT                   /locus_tag="BG0188"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(188669..188869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BG0188"
FT                   /product="ribosomal protein L35"
FT                   /note="ortholog to Borrelia burgdorferi BB0189"
FT                   /db_xref="EnsemblGenomes-Gn:BG0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07046"
FT                   /db_xref="GOA:Q662H5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662H5"
FT                   /protein_id="AAU07046.1"
FT                   /translation="MASKMKTRKSAKKRYSFTVNGKVKYKKQNLRHILTKKSSKRKRNL
FT                   RKSGNLSCFEVKRIKTLLPYG"
FT   gene            complement(188892..189452)
FT                   /gene="infC"
FT                   /locus_tag="BG0189"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(188892..189452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BG0189"
FT                   /product="translation initiation factor 3"
FT                   /note="ortholog to Borrelia burgdorferi BB0190"
FT                   /db_xref="EnsemblGenomes-Gn:BG0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07047"
FT                   /db_xref="GOA:Q662H4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662H4"
FT                   /protein_id="AAU07047.1"
FT                   /translation="MINRNANRDRDRSRSNDKELKINYRIKAREVRVIFENGIQEVLSI
FT                   EDAIKKAKEAGLDLVEVSPNVSPPVCKIIDYGKYKFHQEKRQKEQKKNQKVIKLKEVRM
FT                   QPKIDTHDLDFKSKNILSFLKDGNKVKVTIRFRGRELAHTYLGYDILNSILEKVGEVNY
FT                   VLESAAKMEGKTMFLIVAPKFKK"
FT   gene            complement(190055..190297)
FT                   /locus_tag="BG0190"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(190055..190297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07048"
FT                   /db_xref="GOA:Q662H3"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07048.1"
FT                   /translation="MLVAINIKTNATSIINAYILILVRINVFKVAINNPKNRIGERMIL
FT                   YSFSEYFWHFLIFFSKIIAENINSIALSIGNSIYS"
FT   gene            190318..191058
FT                   /locus_tag="BG0191"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        190318..191058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0191"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0193"
FT                   /db_xref="EnsemblGenomes-Gn:BG0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07049"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H2"
FT                   /protein_id="AAU07049.1"
FT                   /translation="MSSPKILTIIVLLAILAQGCKEPSIIEKQFNYTIVFSDATEYFFQ
FT                   IQKTPFIKNKILFINDKSLEIIKDKLKTIKKILLTHKSNNEILNNEILKEKIFNLSKIK
FT                   FSLKKSIDFLLNGKSIDFQKTLLFRDKSLNNEDLEYLEKKGKEKNVNITLINEKNISYI
FT                   KTFITPQIKTIILFSFRDNNIILKKISNSPFFKNIQFVLIGNTRKDLKIIKLKYVITLK
FT                   ESDLMEIVKDIETDFQYEFNIYKQ"
FT   gene            complement(191111..191920)
FT                   /locus_tag="BG0192"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(191111..191920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0194"
FT                   /db_xref="EnsemblGenomes-Gn:BG0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07050"
FT                   /db_xref="GOA:Q662H1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07050.1"
FT                   /translation="MMDCLFETKKSIFFDKLIDTHVHFYELKKRSLDVNYIINECFKNG
FT                   FSYFLDVGLHPSDFNDRKNLLTPYSNVFLTVGIHPLNLGDNFKDDIKQLEKILISENVV
FT                   AVGEMGLDYFKADNKRSQIKAFEEQLYLASRYKKPVILHIRDAYDDAYDIIRSLNFLNR
FT                   GILHCYSGNYEHAKKFIDLGFKVSFSGNITFKNAEPLRIVVSKLNSNDLLIETDSPFLA
FT                   PVPLRGKINSPLFLGYVCLEIARIKNCSVDDIAIATYNSFKDLLLLH"
FT   gene            complement(191917..193056)
FT                   /locus_tag="BG0193"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(191917..193056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0195"
FT                   /db_xref="EnsemblGenomes-Gn:BG0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07051"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662H0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07051.1"
FT                   /translation="MLNEKILDALEDLSSIADDQLLDVTEKSKRGYQLIKEERLSEAES
FT                   LFSDILEKDNENNYALVGLGDIERKKNNYDKAIVYYQRCLVKHPNNNYALFGLGDCYRN
FT                   LDDYKKATDIWEEYLKYDPENITVLTRVAASYRKLKNFQKSKQTYLKVMELIPENDYAL
FT                   VGIGHLYYDFKEYKEALKYWLKMYELNQSKVDVRVLTSIGNCYRKLREFTRGIYFFKKA
FT                   LEISPSNFYAVFGLADCYRGNKDYKEALKYWLDIVEKDPKNNLVLTRVGDAYRYLNDYE
FT                   NSQIYYKKALDVDFDMFAILGLALLQKEQGRYEEALIAIKSLIKNNPKNSALYVSAAEC
FT                   YEALGQIESAVDILSSFLHLGMKNIVVIDYLAALRKKME"
FT   gene            193392..194465
FT                   /gene="prfA"
FT                   /locus_tag="BG0194"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        193392..194465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BG0194"
FT                   /product="peptide chain release factor 1"
FT                   /note="ortholog to Borrelia burgdorferi BB0196"
FT                   /db_xref="EnsemblGenomes-Gn:BG0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07052"
FT                   /db_xref="GOA:Q662G9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662G9"
FT                   /protein_id="AAU07052.1"
FT                   /translation="MFLEKLNSATSKIKLIEEKLQDINLIKNQKKYSKIIKEYTYLEKI
FT                   NTKKIEYEKILSQINDNKTILEKEDQQEMKELIKQELIDLDKKKEDLEHQIKILLLPQD
FT                   ENDSKNIIIEIRAGTGGEEAALFANNLYSMYIKYSERKKWKTEIINFNETELGGFKEIV
FT                   FEIKGKDVFKKLKYESGVHRVQRIPITESNGRLQTSAATVAVLPNIEETEIDINEKDLR
FT                   IDVYRSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRARLYEFE
FT                   DSKKQEQRSSNRKQQVGSGDRSERIRTYNFPQNRITDHRANITLYKLEEFMQGELDPLL
FT                   DPLTIELQEQKFKSNNI"
FT   gene            194468..195289
FT                   /locus_tag="BG0195"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        194468..195289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0195"
FT                   /product="HemK family methylase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0197"
FT                   /db_xref="EnsemblGenomes-Gn:BG0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07053"
FT                   /db_xref="GOA:Q662G8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G8"
FT                   /protein_id="AAU07053.1"
FT                   /translation="MNVAEIINYAKSKNLDTIEALLILELILKTRKELIIANIKKSLTK
FT                   REKKLFFDQIDKMKKGTPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLVEEALIQIQQ
FT                   NGFKKILDLCCGSGCIGLSIAYYTKKKVTLSDISIKALKIVEKNTKKLKLEKFIEIIHS
FT                   NLLKFIKERFDIIITNPPYLNKEELEIKNKIKKEPAKALLGFGKDGLNISRKILSQAKE
FT                   KLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVLGQIT"
FT   gene            195286..197289
FT                   /gene="spoT"
FT                   /locus_tag="BG0196"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        195286..197289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="BG0196"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase"
FT                   /note="ortholog to Borrelia burgdorferi BB0198"
FT                   /db_xref="EnsemblGenomes-Gn:BG0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07054"
FT                   /db_xref="GOA:Q662G7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G7"
FT                   /protein_id="AAU07054.1"
FT                   /translation="MIQAYEIAHLIKINDLEKAKNIFKKTVENTYKDEFERKSIFKALE
FT                   IAEQLHYGQYRESGEPYIIHPIMVSLFLAKFQLDFKATIAGLLHDVLEDTNIEKEEIVK
FT                   EFDEEILSLIDGVTKIHDLHNKTRSIKEANTISKMFFAMTHDIRIIIIKLADKLHNMTT
FT                   LSYLPKNRQDRIAKDCLSTYVPIAERLGISSLKTYLEDLSFKHLYPKDYKEIKNFLSET
FT                   KIEREKKLYKGKLSIEKELQKSGIEAEITVRSKHFYSIFRKMQTRTNKLTQIFDTLGIR
FT                   IICKKQKECYEILEIVHRVWKPIPGRLKDYIASPKENKYQSLHTTVRIPEDNQLIEIQI
FT                   RTEEMDRIANYGVAAHWIYKEQIALKADDLSFINRIKKWQQESANKSQYSMNDIHKELL
FT                   NTFIYVYTPEGEVVELPFGSNSIDFAYIIHTDIGDQALYAKINGKISSITKPLKNEQIV
FT                   EIFTSKDSKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLVGANKEQRKLF
FT                   SLFKAYTKTKIKRIAIDSECNPTTGEDIVGIIHKDEIIVHNENCQKLKYYKKNQLIEVE
FT                   WEATPTRKVHHIILLLKELKGIFSYLENIFTINDVRLISEKIEDCGNGHGITNIIVSSN
FT                   AKNIAKIISSLKENPNILQIMQVEEDIKNYDN"
FT   gene            197279..199543
FT                   /locus_tag="BG0197"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        197279..199543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0197"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0199"
FT                   /db_xref="EnsemblGenomes-Gn:BG0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07055"
FT                   /db_xref="GOA:Q662G6"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07055.1"
FT                   /translation="MIIKILLALLFINLTSIPLVPKKMKKNVSNLNNKIANIETEKNIK
FT                   AHIEKIHQLSNKQEKIINTFNYIKKYFNTNEIKYMEYSLQEIGFIGYSQKILHSKIKGK
FT                   GLAIYNIIIPIEIQNNLKNNLAIGIAIELLSKLKNTNPENNINFFFIENDSLEENTIIS
FT                   SRILLSNNYLGKNTNTIYLMLNENRIKNKIYLENESFITNSKTNLEFLKAIIKTFEKNK
FT                   LDFNTTKITEKKSNNLYNLYWDESIPFLIINNNLNSILTQNKNTIFEIYRSIEETLTNQ
FT                   YKGKNTNEIHYIVINTPFKKIIINEIALIALIYICYNLIIIVFIRKFKEAGLVMKKVKN
FT                   NYYKLVRLFFTLFLSTYLSLLITNKIFVGYENITAYSITNSKYLVTFFTILIIHNLLSL
FT                   FTYNFTIYLNYRQLKYLAISTSIIELIILMFIKIEFILIVIIKSILLLIKPNKITTIQK
FT                   IIVIIIWIINFILITLIQNTTSITNTLTLSYLISICLFSTIFINISEYLKSKLSQIKQN
FT                   FKKAEKLGLATFFLITTIIISSNIDKKEHVIQINQTVSFPEKINKIKIEYLKSNKNPIQ
FT                   IISNDFNLTLQANEKTLETSIKVNDELMNIDFKKIDIAERAVYSIDLVTQKIANQIELH
FT                   FKNASKLIIYQSNTPYKILANNIIFSLKNINSKKTTIAFTLKSQDDIAYEAFANLHVKK
FT                   NQVKIYNKINNKEEKKIKINYSYKIKYSGILPKAEKYKNLEYFKLKNDKEIENLKTLKL
FT                   N"
FT   gene            complement(199488..199592)
FT                   /locus_tag="BG0198"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(199488..199592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07056"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07056.1"
FT                   /translation="MLFKVTLIEKKELILKINLILKFLNFQSLYHFLV"
FT   gene            complement(199540..200625)
FT                   /gene="ddlA"
FT                   /locus_tag="BG0199"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(199540..200625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BG0199"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0200"
FT                   /db_xref="EnsemblGenomes-Gn:BG0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07057"
FT                   /db_xref="GOA:Q662G4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662G4"
FT                   /protein_id="AAU07057.1"
FT                   /translation="MKKNLMLIFGGVSFEHEISCKSAYSIYLALLDLNKYNIYPVYIDK
FT                   CTGIWYLLDSVSDPPKLIDIDVLPIVSLLPGIGIFSNNKNLDIDVVFPVVHGRTGEDGA
FT                   IQGVLKVMDIPCIGAGIIGSAISSNKYFCKLLLKSFNIPLVPFIGFRQYDYFLDKEEVK
FT                   RNVREALGYPVIVKPAVLGSSIGINVAYSENQIEFFIEEALKYDLTILIEKFIEAREIE
FT                   CSIIGNEKIKIFSPGEVIVQDFIFYDYDAKYSVIPGNSIIFNIPAQLETNQLLSIKEYA
FT                   FLVYKNLELRGMARVDFFVEKKSGKIYLNEINTIPGFTDISMFAKMCSHDGLQFKDLVD
FT                   NLINYAFQSYINRKKRINFED"
FT   gene            complement(200627..202153)
FT                   /gene="murE"
FT                   /locus_tag="BG0200"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(200627..202153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="BG0200"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0201"
FT                   /db_xref="EnsemblGenomes-Gn:BG0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07058"
FT                   /db_xref="GOA:Q662G3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662G3"
FT                   /protein_id="AAU07058.1"
FT                   /translation="MNKKLKDVLLKLDQDLIKHVKGSLDLEISGVTYSSKLVLPRYVFF
FT                   ALPGIRFDGHDFIETAIQKGSNVIVCSRDMDFYSPNVTYIKVDDFNIRKFMSNFSNIFY
FT                   DEPSKKLKVIGVTGTDGKSSVCYYIYLLLKKKGVKVGFISTVFFDDGNGSLIKNPYRQS
FT                   TPESTEIHLFLSNMVKNNVQYAILESTSHGLDLKTARLIDVNYFAVVFTNIGHEHLEFH
FT                   GTIQNYLNAKLGLFRSVSDDAGFGVINFDDPYYSDFKNAVKKSFTYSLKSSKADFFVSF
FT                   IDEKIDSTRFEFYHKGVKYFANVSLLGSFNVENIMAALILVSQILNSDIQDIVDKLICI
FT                   KSLDGRMDSVNLGQNFSVIIDYAHTPGAFSKLFPIFKRFATNRLISVFGSAGERDVAKR
FT                   FLQGQIADIYSDLIVLCDEDPRGENSMYIIKDIAKGIVNKVVNQDLFFIPDRRLAIEKA
FT                   ISLARAGDLVVALGKGHENSIIYKNKELFWNEQEAVKNAILSLEESEKDR"
FT   gene            202268..202340
FT                   /gene="trnC"
FT                   /locus_tag="BG0201"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            202268..202340
FT                   /gene="trnC"
FT                   /locus_tag="BG0201"
FT                   /product="tRNA-Cys"
FT   gene            202426..203664
FT                   /locus_tag="BG0202"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        202426..203664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0202"
FT                   /product="hemolysin, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0202"
FT                   /db_xref="EnsemblGenomes-Gn:BG0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07059"
FT                   /db_xref="GOA:Q662G2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G2"
FT                   /protein_id="AAU07059.1"
FT                   /translation="MLELIVILLFIILSAIFSASETAYTSLSMIQIQDIRKKGKSGISV
FT                   YNLVQSPSKLITTILIGNNISNIIASTLTTKFVLEKYGNSALAISTGLITIIVLIFAEI
FT                   LPKQIAILNNEIIALSTSFFLKPLIFIFTPLIYIINKIIKKILNLLKIKTSYKMTKESI
FT                   KNILSLAGNLGILKNDSRIFMQKMLDIDQVRASEIMTHRTEVFSLSSSSKLKDVIKLIK
FT                   EEGYYRIPIYKGQSREQIIGILIAKDLIEVNKKDMNKNVSQFIKPAVFVQQNKRIKDIL
FT                   DIMRKKQKIMAIVIDEYGGFSGILTIEDIVEKIFGAISDEYDIKEEKPLITQINNNTYS
FT                   ILGETTFDEIEEIIGISIEHKEYTNTIGGYLIDLLDKIPTKDETVKTADGEYFINKIQN
FT                   NKIEIITFIKSKN"
FT   gene            203717..204652
FT                   /gene="hflK"
FT                   /locus_tag="BG0203"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        203717..204652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="BG0203"
FT                   /product="Lambda CII stability-governing protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0203"
FT                   /db_xref="EnsemblGenomes-Gn:BG0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07060"
FT                   /db_xref="GOA:Q662G1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G1"
FT                   /protein_id="AAU07060.1"
FT                   /translation="MFDIKQIFNKTYEYLVIIITLLLILIIIIANIFIVGPSEEAIVLR
FT                   LGKLNRTLDSGIHVKIPLIEEKFIVPVKIVQEIKFGFLMSPNDFRKNDNSDNEGMIITG
FT                   DLNIINIEWLVQYKIRDPYSFKFKVEDPETTIKDIAKSSMNRLIGDNTIFEIINDNRVG
FT                   VTEGVKSSMNEIIDNYNLGIDVVQVQIRNALPPKGKVYEAFEDVNIAIQDKNKYINEGK
FT                   KEFNQIVPKIKGEALKVIEEARGYKESRINNALADTEIFNAILDAYLKNPDITKERLYN
FT                   ETMKEILENKDNIELIDKNLKNFLPFKEVK"
FT   gene            204653..205624
FT                   /gene="hflC"
FT                   /locus_tag="BG0204"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        204653..205624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="BG0204"
FT                   /product="Lambda CII stability-governing protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0204"
FT                   /db_xref="EnsemblGenomes-Gn:BG0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07061"
FT                   /db_xref="GOA:Q662G0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q662G0"
FT                   /protein_id="AAU07061.1"
FT                   /translation="MKFIINLLLSTVKITTFAIIVCLTILSIFQPIYILKENEISITTR
FT                   LGKIQRTESLAGLKYKIPLIENVQIFPKIILRWDGEPQRIPTGGEEKQLIWIDTTARWK
FT                   IADINKFYTTIKTMNRAYVRIDAAIEPAVRGVIAKYPLLEIIRSSNDPIQRLSNGVLTP
FT                   QETKINGIYKITKGRKIIEKEIINIANNNTKDIGIEIVDVLIRKVTYDPSLIESVNNRM
FT                   ISERQQIAEEQRSIGLAEKTEILGSIEKEKLSLLSEAKATAAKIKAEGDREAAKIYSNT
FT                   YGKNIEFYKFWQALESYKAVLKDKRKIFSTDMDFFKYLHKRN"
FT   gene            205930..206002
FT                   /gene="trnF"
FT                   /locus_tag="BG0205"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            205930..206002
FT                   /gene="trnF"
FT                   /locus_tag="BG0205"
FT                   /product="tRNA-Phe"
FT   gene            206023..206095
FT                   /gene="trnF"
FT                   /locus_tag="BG0206"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            206023..206095
FT                   /gene="trnF"
FT                   /locus_tag="BG0206"
FT                   /product="tRNA-Phe"
FT   gene            206124..207701
FT                   /locus_tag="BG0207"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        206124..207701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0207"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0205"
FT                   /db_xref="EnsemblGenomes-Gn:BG0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07062"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07062.1"
FT                   /translation="MILKKIKQIKDLNQQDVIFARIGNLSKLGTRVNEKIIKILDKGNT
FT                   PYIPVLKKEEDMSYEDLIKKINEEILNDDLSYLREKLIDNLKDVYKPFKEDDPIFFTKG
FT                   KKPLMKINTLMEVEPNQIYWKEILEGSFKILPRHKITSLQKILLEIYHYFDVQKLRTKE
FT                   NLKDKKTLKKLYLYSARRDYEFFKGKVKTEGDSILLHSVDTTIYFLITIANLNKIRSLK
FT                   NAPRSTMKFFLDKTEYTEFTEFFYAEDMILQAALGSLLHSIGLMHITILENIGNKISLK
FT                   DKNLKEQHKLKIEYLEKNINIAKNLFRIREDISAITKMIINGQKDYLDATGYPQLKINK
FT                   FIHELVRIFCIIDTYDELVNPIIIKESANPLETIKFLIENSGKYYWNRKEPNEQAKNKK
FT                   FDINMLENFLTILAPFDYGQIVSVNKKNNDENLFEAAVIEYKMSIMPNISIINKKNQTY
FT                   KLEEIILDLENKEILIKDTDGNYKKNPLKNVDDFIIKNNIPELNKNEIQLILFSYDRKS
FT                   KPTTFSKK"
FT   gene            complement(207679..208218)
FT                   /locus_tag="BG0208"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(207679..208218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0206"
FT                   /db_xref="EnsemblGenomes-Gn:BG0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07063"
FT                   /db_xref="GOA:Q662F8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07063.1"
FT                   /translation="MYVSSGKYKGRKILFPNKTGAVRPVMSLVREAFFSIIFKDIINSK
FT                   FLDVFAGTGIMSVEALSRGASLAHLVECNKKTKITLVKNFSFVEEFYKFFFQRAEDFLG
FT                   KKDLFYDFIYLDPPFNYKNKINLLEIISKGKILNDKVNIIMHCPFGEDLDINTSKFSVY
FT                   NLKRYGGSKLIFLRML"
FT   gene            208304..209140
FT                   /gene="gtaB"
FT                   /locus_tag="BG0209"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        208304..209140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtaB"
FT                   /locus_tag="BG0209"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0207"
FT                   /db_xref="EnsemblGenomes-Gn:BG0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07064"
FT                   /db_xref="GOA:Q662F7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F7"
FT                   /protein_id="AAU07064.1"
FT                   /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSG
FT                   IKDILLISSRRKKVLEDYFDREIELENIFLKENKKNELEKIKNKKINISFIRQKEMLGT
FT                   GNALLYAKPWINREPVIVAYPDDLHIGNPALSLQLIKLYEKTGKNIISIIENPENINRY
FT                   GVIDLYEDKIHVKNIVEKPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHI
FT                   YALKKLMDQKKVLYKNIKGKRIDIGTLEGYLDAIINFAKKNKNLMEIIKKGINEND"
FT   gene            209127..210875
FT                   /locus_tag="BG0210"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        209127..210875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0210"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0208"
FT                   /db_xref="EnsemblGenomes-Gn:BG0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07065"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07065.1"
FT                   /translation="MKTIKKDPEFYDSLAKLKKYIIKYIEAKVLKYSISSQLYKLEKPE
FT                   IIELIKISNDYEKEKNVLNISLEEYYYKKTKNEIIKKWILEIVKNKNFTQISEEANFIT
FT                   KKLGITYKLKSNIFLKLIEIQNNPYYSQEKKDIYKQIILNFSSNINIDSLEQTIDILVA
FT                   VRNKNKIKILNILNKNLKNQSENQKVFKSSLINKENRLIKLKRMLILTYWPVGCLSKNI
FT                   FIKILIKYYKYLEEEILALKYNEILNYLRAIKTLSLNEIFYKGSSKNINFNYFFSDFTQ
FT                   YNPKDFQDTLKRYLYVVGKTITKKYLTWFFKDKISNNWESFIYALEYIQKHKLINIKEK
FT                   IKEIITAKFQTEDFFISFDKTNFNPYEGSIIFKEKYIKNAFIKSIINYVEKNSQNIETY
FT                   GWIAFYIYADNEDKKFFCQNMKEFFKTKPFEIQNQIFIYFLSFYPNIENKHFKFISDIL
FT                   LYLDENKITIPKKIIKMQKINPNQLDYQKSYLLIKSLKTRSRILKIILKNIRFNLIEKL
FT                   EDENEKKLLPAICYLIYCENLVKLKNNRKIKSNEKSSLLEFISFFKTKLKQKINFKKEL
FT                   MKSKGI"
FT   gene            210902..211657
FT                   /locus_tag="BG0211"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        210902..211657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0211"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0209"
FT                   /db_xref="EnsemblGenomes-Gn:BG0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07066"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07066.1"
FT                   /translation="MKIYLLLNKNCKIFILFLILIFNSKLAYSQRLIRIGKEEMKNKNY
FT                   IQAIETLSDAIKKYPKVQLGYYFLSIAYRENNQLTEAEGALLDGIAVGGEIDYILYYEL
FT                   GNIMFNRGEGYYPLAIKYYSNSIKSKPNYDSALLNRANAYVQQGKITSKEKEYQKAWDS
FT                   YTMAIHDYSQFITLRSKTEKKDSILLIISYLRNEKINLEKLDKSLKGRTEHIVYAKEDK
FT                   NQILKDNLETNSLIELEKLNWQEELYIDE"
FT   gene            211650..214370
FT                   /gene="lmp1"
FT                   /locus_tag="BG0212"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        211650..214370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmp1"
FT                   /locus_tag="BG0212"
FT                   /product="surface-located membrane protein 1"
FT                   /note="similar to Borrelia burgdorferi BB0210"
FT                   /db_xref="EnsemblGenomes-Gn:BG0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07067"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F4"
FT                   /protein_id="AAU07067.1"
FT                   /translation="MNKKRTNFSVLLLLIFLLILSFGGFGYYIYQSKLNDKNREIMLNE
FT                   VKNSIIDRNYKKAYSVAKLLQDKYPKNEDIAMLTNTLAEIANSSPFESNELQRDSANQI
FT                   LDKIKGQENAKTNINENFDIAFNNRYIKDSAITENYADRNDDIGIEDEDISEFKKSKIP
FT                   EKVNQNAKQKEEDQAIQSPNPKLNVNDQKNSFNLEKLKKKLSEKSNSENILKNPQNIEN
FT                   DKQSSNFSKEKNSEHILRNPDNSKYSKNDNATFLKDVPLNSKKESDFSLPSQTIIGKIH
FT                   RPYSYLIKKELYEILDDINTGRVALGKNRLKKLIKKGLSNKFQKVNELIESLKNKDASN
FT                   LLLTLIKKDIEPNLINVPNIPKDPYKKDIFQLNKEDKKTQQSEDLKSKIYSIKPTDLEN
FT                   PKNRQQAIKDLNEFLKINPNDTYASKTLAQANKIQQSENLKSKIYSIKPTDLENPKNRQ
FT                   QAIKDLNEFLKINPNDTYASKTLAQANKIQQSENLKSKIYSIKPTDLENPKNRQQAIKD
FT                   LNEFLKINPNDTYAYKTLAQTYENNGDLLKAENVYEKIAKLTNAQEDYYKLGIIRFKLK
FT                   KYEHSIGSFDQTIRLDPKHKKAHNNKGIALMMLNKNKKAVESFEKAIQIDKNYDTAYYQ
FT                   KGIAEEKNGDMQQAFTSFKNAYNIDKKLNYALKAGIVSNNLGNFKKSEEYLSFFNDNAK
FT                   KPNEIAIYNLSIAKFENNKLEESLEIINKALNLNPEKSEYLYLKASINLKNENYQNAIS
FT                   LYSSVIEKNPENTSAYINLAKAYEKLGNKAQAISTLEKIINKNNKLALNNLGILYKKQK
FT                   NYQKAIEIFEKAIKNSDIEAKYNLATTLIEINDNIRAKDLLKEYTKLKPNNPEALHALG
FT                   IIEYNENNNDQILRELVKKFPNYKKNENIRKIIGI"
FT   gene            214377..216212
FT                   /gene="mutL"
FT                   /locus_tag="BG0213"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        214377..216212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BG0213"
FT                   /product="DNA mismatch repair protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0211"
FT                   /db_xref="EnsemblGenomes-Gn:BG0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07068"
FT                   /db_xref="GOA:Q662F3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662F3"
FT                   /protein_id="AAU07068.1"
FT                   /translation="MNKIRFLDKYLVQKIAAGESIDRPCSILRELLDNSIDSGATKIEV
FT                   FLEEGGIHKILIIDNGIGIGKEDLKICYLPHTTSKISSEEDLRKIETLGFRGEALSSIA
FT                   ICSNISITSSTTGNESYQIEVENGIEKCFKKQPAINGTIVNVTKIFHNFPARKRFLKQE
FT                   PIETKMCLKVLEEKIITHPEINFEINLNQKLRKIYFKESLIDRVQNVYGNVIENNKFKV
FT                   LKKEHENIKIELFLAPANFSKKSKRHIKTFVNRRPIDQKDLLEAITNGHSRIISPGNFP
FT                   ICYLFLEINPEYIDFNVHPQKKEVRFFNLPFLFKLISDNINNFFDKDINSYNEIVIKRQ
FT                   LTDDDNLIEMINQPKNLNKTNTYDIIQNKNLETEHTVNDLSKNIIQNDIGLRRYNSIIQ
FT                   NRPSFKENITNIFSDKFLEFEEPPNKNEKEEIKFNYIGQIFSEFLIVEKVNEIYFIDQH
FT                   AVHEKIIYEKLRNSKKTVQKLLIPIEFTIVDKNIEEIIDSEIEEYKKMDIIISKIGPKK
FT                   YQLESIPNICNQYENTLINFFQSRKSRTINSLESDLYANIACRKAVKTNDILSLEFSKF
FT                   LIDEFFKLEIKHCPHGRKIYYKISKFELEKKVARA"
FT   gene            216231..217262
FT                   /locus_tag="BG0214"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        216231..217262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0214"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0212"
FT                   /db_xref="EnsemblGenomes-Gn:BG0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07069"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07069.1"
FT                   /translation="MIKKIKSEISLIKVEKEKSLIELGKILKNNNIVELKNLNHYPNLK
FT                   LAEKELCQMKSNLSKSEENENILKNLNKKIYILKTEYKSFNKSYKKKLKEIVKTIIEIY
FT                   PQNLELISKYNMDFSKLKLEKYKKIELVSDKTKNPLKRIILKINSAINNIINMINVCKI
FT                   SKEFEKQVFIKYYLSENFESIINEFSLNKKLNNVIIKEFKIINEIKTNIKNIKEEIKQI
FT                   IYRSKKEKIYKKNQIKNEINAIVKNKENILKKIAEEFIETTKKEKIQAKTNTISTAIQK
FT                   IEKTNQKILNLSNDLIKITKQEEIKNIQKKMQVLTKEKDKINNKLDVLTSKIEVIQNEL
FT                   DNE"
FT   gene            217290..217363
FT                   /gene="trnM"
FT                   /locus_tag="BG0215"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            217290..217363
FT                   /gene="trnM"
FT                   /locus_tag="BG0215"
FT                   /product="tRNA-Met"
FT   gene            complement(217345..217998)
FT                   /locus_tag="BG0216"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(217345..217998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0216"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0213"
FT                   /db_xref="EnsemblGenomes-Gn:BG0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07070"
FT                   /db_xref="UniProtKB/TrEMBL:Q662F1"
FT                   /protein_id="AAU07070.1"
FT                   /translation="MVFCWVGWSCEINYPEIKEVDYKVNYYFTENRLDYSMSFDFAIKV
FT                   LKSKDVFKLSIENKNTREFIQVINSNHSSFFIDSILGKDILYCRDLRFIFFDETFEDFT
FT                   SCIRLFDKGMRVYSRELVISLGMSKYDLDDVPNYVYKFKDMAMLNKLTNSKVFFVKTFK
FT                   DKVYSVSSVVRIDSIDALEVDKTLDNYISFYYVEKNSNLFFKVNLKDQIGPTRT"
FT   gene            complement(218006..218584)
FT                   /gene="efp"
FT                   /locus_tag="BG0217"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(218006..218584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="BG0217"
FT                   /product="translation elongation factor P"
FT                   /note="ortholog to Borrelia burgdorferi BB0214"
FT                   /db_xref="EnsemblGenomes-Gn:BG0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07071"
FT                   /db_xref="GOA:Q662F0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662F0"
FT                   /protein_id="AAU07071.1"
FT                   /translation="MAVVKSSEIEKGSFLLIKGTPHIVLEREFSKTGRGGAIVRLKLKN
FT                   LKNKFVIRETLKGADTAEAIEIYEVSAQYLYKDKDVLVFMDLETYDQVSLDLKESANFQ
FT                   DKVPFLQESETYALIMFDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGL
FT                   VVKAPLFINVGDKVLVNSETKEYAERIKS"
FT   gene            218750..219586
FT                   /gene="pstS"
FT                   /locus_tag="BG0218"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        218750..219586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BG0218"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0215"
FT                   /db_xref="EnsemblGenomes-Gn:BG0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07072"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E9"
FT                   /protein_id="AAU07072.1"
FT                   /translation="MKKFVILIFMLSVSLLCNCKNQDNEKIVSIGGSTTVSPILDEMIL
FT                   KYNKINNTKVTYDAQGSSVGINGLFNKIYKIAISSRDLTKEEIEQGAKETVFAYDALIF
FT                   ITSPEIKITNITEENLAKILNGKIQNWKQVGGPDAKINFINRDSSSGSYSSIKDLLLNK
FT                   IFKTHEESQFRQDGIVVKSNGEVIEKTSLTPYSIGYIGLGYAKNSIEKGLNILSVNSTY
FT                   PTKETINNNKYTIKRNLIIVTNNKYEDKSITQFIDFMTSSTGQDIVEEQGFLGIKT"
FT   gene            219676..220584
FT                   /gene="pstC"
FT                   /locus_tag="BG0219"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        219676..220584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BG0219"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0216"
FT                   /db_xref="EnsemblGenomes-Gn:BG0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07073"
FT                   /db_xref="GOA:Q662E8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E8"
FT                   /protein_id="AAU07073.1"
FT                   /translation="MHLSLKAKRKIVGIIFKSFILISAIISSLSIFFLGVFILKTGIAP
FT                   FINSKIKIFNFLFSTNWDPTNNLQKSYGILAFIINSFLTTLFSILIALPIGLGFAIYLL
FT                   EKAKGFYRQFLQTVIELLAGIPSVVYGFFGSTFIATLIKNIFQREDNLGYNLISSSLIL
FT                   SIMIVPTIISVCYSSLKAVPKSYKFASLALAATDWQTIYKIIIPSASRGILAGTILSIG
FT                   RAIGETVAVLMVGGGSPLFIKNVFSPIRTLTVNIAMDMGYASGTHREALFSTALVLLLF
FT                   SIITNLLKNFILSSNKGLKKK"
FT   gene            220755..222125
FT                   /gene="pstA"
FT                   /locus_tag="BG0220"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        220755..222125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BG0220"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0217"
FT                   /db_xref="EnsemblGenomes-Gn:BG0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07074"
FT                   /db_xref="GOA:Q662E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E7"
FT                   /protein_id="AAU07074.1"
FT                   /translation="MPFKTEDNKEIQIAFIINKNINIDKISTEDIYNIYNNKISHWGSI
FT                   SDQGIDIIPIANSLNSPSNKAILRTLIKNNEFNKRYIKIEPSIKKVIKTINSTIGSISY
FT                   LTKEEFESLDFKLYPNIKALKIKIMSVLISKKTLTKNENEIINTLGVDEVEKLIKGKET
FT                   WVNLISKDIKLKIIKYLDQKEKIIQTIEKIEGALAIVPWHYFQNIKAPFIKMHYFDKSS
FT                   PLNLNFILSIPRDSGAYGGISYLILNTFYVILLTTAISICIGIGTGIMLAEYTSNKIFY
FT                   KILSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIVKTTEETFKT
FT                   IPKSYKYASFALGANKTETIIKIMVPAAIPGILTGIVLAIGRALGETAVLLFTMGTNLG
FT                   LATNLNEPSRTLTVHLLMLFQEGHLDKGFGTASILVIMVLIINLTSKFLINKLYRIK"
FT   gene            222126..222908
FT                   /gene="pstB"
FT                   /locus_tag="BG0221"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        222126..222908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BG0221"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0218"
FT                   /db_xref="EnsemblGenomes-Gn:BG0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07075"
FT                   /db_xref="GOA:Q662E6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662E6"
FT                   /protein_id="AAU07075.1"
FT                   /translation="MVKEKEKPKNEIIIETENLSLFYTDFKALNEINIKILKNSITALI
FT                   GPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGKNIYSNNFDILELRRKIGMVFQTPN
FT                   PFLMSIYDNISYGPKIHGTKDKKKLDEIVEQSLKKSALWDEVKDKLNTNALSLSGGQQQ
FT                   RLCIARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRIS
FT                   DKTAFFLNGCIEEESPTDELFFNPKNTKTEEYISGKFG"
FT   gene            complement(222911..223732)
FT                   /locus_tag="BG0222"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(222911..223732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0222"
FT                   /product="gufA protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0219"
FT                   /db_xref="EnsemblGenomes-Gn:BG0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07076"
FT                   /db_xref="GOA:Q662E5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E5"
FT                   /protein_id="AAU07076.1"
FT                   /translation="MIKSILDYLLTLHPVLLGLLGSTFTWFTTAFGAGAVFFFRKVDNK
FT                   IMDAMLGFSAGIMIAASFFSLIQPAIERAEELGYITWIPAVFGFLVGAFFIYIVDVFVP
FT                   DLDKLTFIDEDLTKHGKKDFLLFTAVTLHNFPEGLAVGVAFGALASNPDIQTLVGAMLL
FT                   TLGIGIQNIPEGAAISLPLRRGNVALIKCFNYGQMSGLVEIVGGLMGAYAVYSFTRILP
FT                   FALAFSAGAMIYVSIEQLIPEAKRKDIDNKVPSIFGVIGFTLMMFLDVSLG"
FT   gene            complement(223767..225551)
FT                   /gene="alaS"
FT                   /locus_tag="BG0223"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(223767..225551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="BG0223"
FT                   /product="alanyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0220"
FT                   /db_xref="EnsemblGenomes-Gn:BG0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07077"
FT                   /db_xref="GOA:Q662E4"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662E4"
FT                   /protein_id="AAU07077.1"
FT                   /translation="MTLDKLRKKYIDFFKSKKHFEIMGKSLVPENDPTVLFNTAGMQPL
FT                   IPYLLGEVHPSGDMLVNVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKEYSVKCS
FT                   FEFLTSSDYLNIPKDSLYVSVFEGDQKIPCDTETAKVWESLGIPKDRIYYLSKAHNFWG
FT                   PVGSKGPCGPDTEIYVDTGKIKCSLDCNITCSCGKYFEIWNNVFMQYNKDENGNYIELD
FT                   RKCVDTGMGLERTIAFLQGKSSVYDTDAFIPIIKRIEVISGKIYGQKEDDDRCIRIISD
FT                   HVKAACFILADSSVVSPSNLGQGYVLRRLIRRSIRYAKKLGIKSHFLADLVDSIETIYG
FT                   SFYNELTEKKDFIKKELSTEEEKFFKTLFQGEQEFIKITRNLPSKTIPGDIAFKLYDTY
FT                   GFPYEVTEELAFEYGFNIDKVGFDEYFKKHQKTSKKGGDKVFKGGLADYTYETTRLHTA
FT                   THLLHKALQLVLGDHVRQKGSNITAERLRFDFVHSEKMTDDEIKKVEEIVNLQIKNSLS
FT                   VKKSIMELSEAQKKGAMALFGEKYDNLVSVYEIDGFSLEVCGGPHVENTNELGTFKIQK
FT                   EQSSSSGIRRIKAILIDK"
FT   gene            complement(225551..226768)
FT                   /gene="fliG-1"
FT                   /locus_tag="BG0224"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(225551..226768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG-1"
FT                   /locus_tag="BG0224"
FT                   /product="flagellar motor switch protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0221"
FT                   /db_xref="EnsemblGenomes-Gn:BG0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07078"
FT                   /db_xref="GOA:Q662E3"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E3"
FT                   /protein_id="AAU07078.1"
FT                   /translation="MQDPRLSKYKNTKNLSKKTVEEIDTLSLNKNFSDSEIQGSMLRSW
FT                   ISLIKGNKNKAPVESKSDNINNLKPGFIRKESKVIKIAKYFLAIGLEKSAKIMSELDDS
FT                   DIILITREISKISYIAPEEKDHIIKEFEELIRNEKRYVKVDDNFAYELLNKTLGKSKAK
FT                   LIYKKVTGNDIFIPFDYLSQIEHEQLWALVKDENIKTLVILYNYLNKDQKKYVFSMLEE
FT                   EGRREFVKDLAKPRQLSMETIEAISNKLKDRFKMQGRLKTDKLDGSKILVDILSYMDSN
FT                   EEKSLLNKINMRDLNPVVDSEIREKIFDINVILRIMDNDLHNILREFTDKEIAIIIKDK
FT                   TDEVRDKMLSNVSKRRKEIILDEEAFLGKISKKDLKAMTSSFVNYIKSLTLKGDLVIYR
FT                   KNEEFI"
FT   gene            complement(226755..227462)
FT                   /gene="pgl"
FT                   /locus_tag="BG0225"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(226755..227462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="BG0225"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="ortholog to Borrelia burgdorferi BB0222"
FT                   /db_xref="EnsemblGenomes-Gn:BG0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07079"
FT                   /db_xref="GOA:Q662E2"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E2"
FT                   /protein_id="AAU07079.1"
FT                   /translation="MEFLYSDEENYLKNRFFDFFNMNIDKDKYTSIGICGGRSIGTFLS
FT                   VFLEQNSSFRRSHFFLVDERCVPLNNENSNYNLLNKIFFSKMVDKNLISISKFHAFVYN
FT                   EIDETTAIYDYNIEFNSRFNIFDFILVSVGEDGHIASLFPSRKLLFSDLEGYQYEYNSP
FT                   KFPSKRISLTPKSLFNAKAIVLLFMGVDKKRALENFLGFNSSINECPARLLKEHPNLLV
FT                   LTNIKRDENYAGS"
FT   gene            complement(227601..227747)
FT                   /locus_tag="BG0226"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(227601..227747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07080"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07080.1"
FT                   /translation="MYVSLIANTIDFDKINYINSKMLLDLIRNVELLVLEFAKYSDFKL
FT                   GKI"
FT   gene            complement(227865..228092)
FT                   /locus_tag="BG0227"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(227865..228092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0227"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0224"
FT                   /db_xref="EnsemblGenomes-Gn:BG0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07081"
FT                   /db_xref="UniProtKB/TrEMBL:Q662E0"
FT                   /protein_id="AAU07081.1"
FT                   /translation="MVGRKDLFCLHLFLALSIIISYRIKNVSTKNGSYITFKGISKKEI
FT                   LLTSSSWNLQYDLNGDMGNGSIKVNNFYLR"
FT   gene            228169..229170
FT                   /locus_tag="BG0228"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        228169..229170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0225"
FT                   /db_xref="EnsemblGenomes-Gn:BG0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07082"
FT                   /db_xref="GOA:Q662D9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07082.1"
FT                   /translation="MNRKISIAPMVNITDEHFRYLIRLLSKKVTLYTPMISAKSIIMGD
FT                   VKKVVKQTPLESPIAIQIATNCKFDALKAIQILEKHFNFDEYNLNVGCPSLKIQNANCG
FT                   ACLMSNANQVGEILKTMKENTNKPISIKHRLGIRLLNSDYKNESYSEVKNFIKIISDFG
FT                   IKNFIVHARVAILKGFSPKNNRNIPKLRHEFVYNLKKENKNLFIETNGGINNSEQIKKH
FT                   LSFVDSVMIGRSAFENPYFIANASREFLGETDKIPTRKDILMKMVEYIKEYENYLSINI
FT                   LCKHLMGITFSKEGARKFRQNLTAPFPKNLKKHEILLKAMETLPEKILNSNS"
FT   gene            complement(229160..230437)
FT                   /gene="serS"
FT                   /locus_tag="BG0229"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(229160..230437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BG0229"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0226"
FT                   /db_xref="EnsemblGenomes-Gn:BG0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07083"
FT                   /db_xref="GOA:Q662D8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662D8"
FT                   /protein_id="AAU07083.1"
FT                   /translation="MLDLKFIRDNLDLVKKSIKARGLVLDIDKLVYLDDKRKKIITQIG
FT                   ELNAKRNENSSKMRENLDNVFKSSLMETGKILKKQLIDLEEELKKISFDFDLENKRVPN
FT                   ILSPDVPIGNSEEDNFEIKKVGVVPKFDFKPKDHLELGRDLDLLDFDRAREVSGSKFYY
FT                   LKNEAVFLEIALINFSLNKLREKGFDVFITPDVAREFIVDGIGFNPRGDESNIYKIEST
FT                   DKYLVGTSEITLGGYYYNKIIDLTLPIKMAGFSHCFRKEAGAYGQLSKGLYRVHQFSKV
FT                   EMFCFCKAEESQVIHDEFLSIQEQIFTELEIPYRVLNICSFDLGSPAYKKYDIEAWMPG
FT                   RDGKGSYGEVTSTSNCTDYQSRRLKIRYKDQDGQNKFAHMVNGTAIATTRVIISILENF
FT                   QDEKGGVRIPKSLVKYTGFGYIPFKN"
FT   gene            230567..231268
FT                   /locus_tag="BG0230"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        230567..231268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0230"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0227"
FT                   /db_xref="EnsemblGenomes-Gn:BG0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07084"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07084.1"
FT                   /translation="MLNPRTIKSTFVLISTLMIFNGCTKKLTKINFKDISSNSHKMNSL
FT                   TITSMSSKEESKFYEYSIRIPKLIIEGKEKGNLEELNTELNEYVSQSVARLDIVSKELK
FT                   PEDKKFSLKIDYEIYHGYNTYTIILIATQEIHDSPITNYRSYYIQDKGNYIYNIDDIIK
FT                   TDEAFPFFIKKIKEKILPNELLFDLQQAVIYFENKKIIIKFPEYTFKLDDTEELQNIFE
FT                   FNENEIAQFVK"
FT   gene            231284..234202
FT                   /locus_tag="BG0231"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        231284..234202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0228"
FT                   /db_xref="EnsemblGenomes-Gn:BG0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07085"
FT                   /db_xref="GOA:Q662D6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07085.1"
FT                   /translation="MKKKKIFKLISKTYLEEYNAEGFYFKHDSGLEVFHLKSDSFKEHA
FT                   FCIAFKTIPSNNTGVAHVLEHTIFCGSNKYKIKDPFLYLLKGSLNTFLNAMTFPDKTIY
FT                   PAASTIEKDYFNLFNIYADSIFHPLLKKESFMQEGYNINPKDFKVSGIVFNEMKGSYSN
FT                   KNSLINEIASSSLFEEGAYKYDSGGIPTNIIDLTYESFLDFYKKYYTLENCKIFLCGNT
FT                   QTEKNLNFIEKYIIRSYKKEKNNVNIDIEKVKRWEKGKKLTYKIPKENDNTLGVYTINW
FT                   LCTEINNIEDSIGLEILSEILLDDSCPFIINILKSGLGEDIAHISGINTDLKESIFSFG
FT                   LQNVVEKKEKEFKNLIFSELKNLVKNKIPKELIKGILFGYEFALKEEKGQNHPIALMIK
FT                   SFKGWLNGMHPIKTLETSYYINEITNKLEKGIYYFENLIEKYLICNNHYTLISFIPSYD
FT                   TEKEMEEEIEKKLMTKEIAIKQNPEEFLQFKKDYNQFKKYQNKKDSKADIAKLPLLKIE
FT                   DLPKQIEKSLDLNEIKELNLHSFKFKNNNIFNVNLFFKLNFLEKEDYIYLSLFKRALQD
FT                   LSTKNYSYIDINNQIQNTLGQINISESYDEDINGNILNSFNISFKSFNHKVKDSFELIK
FT                   EILININFHDYERLKEITLSLKNDFKSLLIPKGHLLAILRSKSKLKLNEYLKELQNGIT
FT                   GREFWQKIKTDTESLKEIANKLDNLKNKIILKNNLSALIMGNADDILKSLENEMSHLKE
FT                   SLKENNNYCDELLNIETNNKTLKEIIIIQSKVAFNAICFPSYKINDENYPKANFLEHIL
FT                   RSGIFWEKIRVIGGAYGASASIANGIFSFASYRDPNFIKTYQAFENSLEELANNKMTNE
FT                   EIYTYLVGLIGTNIYVKTKATEALQSYRRKMLNISDSLRQDIRNAYFTITPQDIKEISE
FT                   KILIQIRQHNSVASLVNNQKYEEEKNNLERLIGKEYKVKKIY"
FT   gene            complement(234238..234483)
FT                   /gene="rpmE"
FT                   /locus_tag="BG0232"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(234238..234483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BG0232"
FT                   /product="ribosomal protein L31"
FT                   /note="ortholog to Borrelia burgdorferi BB0229"
FT                   /db_xref="EnsemblGenomes-Gn:BG0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07086"
FT                   /db_xref="GOA:Q662D5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662D5"
FT                   /protein_id="AAU07086.1"
FT                   /translation="MRKGVHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYTDGKEYPL
FT                   ITVEITSRSHPFYTGQQKFVDAAGRIDKFNKRYKKS"
FT   gene            complement(234544..236091)
FT                   /gene="rho"
FT                   /locus_tag="BG0233"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(234544..236091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BG0233"
FT                   /product="transcription termination factor Rho"
FT                   /note="ortholog to Borrelia burgdorferi BB0230"
FT                   /db_xref="EnsemblGenomes-Gn:BG0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07087"
FT                   /db_xref="GOA:Q662D4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D4"
FT                   /protein_id="AAU07087.1"
FT                   /translation="MDKKNVGFDLESEIRRLDVSKEFKIEDNLKKKVVKVVAKKDSASN
FT                   VTKSADLSSAKDSNGVLFSEFDYDIPASGLENNIKTLEQSNIIKFFNGKDYVEIEKLYD
FT                   KPITEVRKIVEGLGTNHTIAVTMKKTELIFLLVKILSENNINVLFTGVLDVLSDGYGFL
FT                   RTASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPRDGERFFAMVKIKSINNQDP
FT                   TFAQNRIPFDNLTPLYPNIKLNLEYENCNISTRLINLFSPIGKGQRALIVSPPKAGKTT
FT                   LLQKIANAITTNYSDVILMILLIDERPEEVTDMIRSVKGEVIASNFDEQASRHVQVAEM
FT                   VIEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPKRFFGSA
FT                   RNIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFPAINIKKS
FT                   GTRKEELLLSEEERSKILLIRRILGGVDDYEGVEVLIEKMKKSKNNEIFLKTMSNGN"
FT   gene            complement(236171..236578)
FT                   /locus_tag="BG0234"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(236171..236578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0231"
FT                   /db_xref="EnsemblGenomes-Gn:BG0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07088"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07088.1"
FT                   /translation="MPVNMVDSYKWDCKLDASLTFRGKLKFEGTLYLDSSFEGEISSKG
FT                   GVLFIGKNSKVITNVVICDTLIVEGILKGNVNAASKVYLNSGCKIYGDVKTKKIFINDN
FT                   IIFDGKCEMIKSNEIVDLFSFTVSQIKDTLQ"
FT   gene            complement(236579..236905)
FT                   /locus_tag="BG0235"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(236579..236905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0235"
FT                   /product="hbbU protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0232"
FT                   /db_xref="EnsemblGenomes-Gn:BG0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07089"
FT                   /db_xref="GOA:Q57153"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q57153"
FT                   /protein_id="AAU07089.1"
FT                   /translation="MSFSRRPKITKSDIVDQISLNIRNNNLKLEKKYIRLVIDAFFEEL
FT                   KGNLCLNNVIEFRSFGTFEVRKRKGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVW
FT                   GIKG"
FT   gene            complement(236918..237175)
FT                   /gene="rpsT"
FT                   /locus_tag="BG0236"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(236918..237175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BG0236"
FT                   /product="ribosomal protein S20"
FT                   /note="ortholog to Borrelia burgdorferi BB0233"
FT                   /db_xref="EnsemblGenomes-Gn:BG0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07090"
FT                   /db_xref="GOA:Q662D1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662D1"
FT                   /protein_id="AAU07090.1"
FT                   /translation="MRKNASALKRSRQNLKRKIRNVSVESELKTIEKRCINMIKAGRKD
FT                   EAIEFFKFVAKKLDTAARKRIIHKNKAARKKSRLNILLLK"
FT   gene            complement(237246..238073)
FT                   /locus_tag="BG0237"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(237246..238073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0237"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0234"
FT                   /db_xref="EnsemblGenomes-Gn:BG0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07091"
FT                   /db_xref="UniProtKB/TrEMBL:Q662D0"
FT                   /protein_id="AAU07091.1"
FT                   /translation="MGNLFFNNIRLISLFVFNIALCFLYLFFYDKSFFYFVLVPLLVNF
FT                   FLILFYLKYFCSISFKGTRIYYKGIFLSYNFYFDDIISFEKRLSDNVLVLKLKNKKKIK
FT                   ICFLTSNGSNELFKELKFKRKDLFIPKLENFPIRYYLSYSYLFMFLARIMISLFVYYIS
FT                   LSNIFIFLFICFIDIKVLLGDFSVISNVVLFYEFRKDSIYERKIFKSEIYFYEFFEKIF
FT                   ISREFEFNNKNYLCFSYKGNHPTKKVYILNKKIAYSMQKVFEYINQNYCAELT"
FT   gene            complement(238088..239194)
FT                   /locus_tag="BG0238"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(238088..239194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0238"
FT                   /product="conserved hypothetical GTP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0235"
FT                   /db_xref="EnsemblGenomes-Gn:BG0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07092"
FT                   /db_xref="GOA:Q662C9"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C9"
FT                   /protein_id="AAU07092.1"
FT                   /translation="MKLNAGIVGLPNVGKSTLFSSLTSSKVEIANYPFCTIEPNLGIVE
FT                   IPDERLLKISGCIVPQKIIPAVMEFVDIAGLVKGASTGEGLGNKFLANIREVSLIVHVV
FT                   RCFEEKEVIHINDDINPEKDITTINVELCLSDLETIQKSLQKQEKNVKSTDKKISESSK
FT                   AIVSMLKRLEDHLSNMNPAIEFKFDDFEYSFIRSLNLLTFKKVLYVCNVDENSLSGNKY
FT                   TDIVKNIALKEGSDFLILCAKIEAELAEIKDISYKNEMLESFGINDSGLSNLIKKAYYT
FT                   LGLRTYFTAGLQEVRAWTFKQGMKAPKAAGIIHSDFERGFIKAEVYSCEDLFKFQSVQK
FT                   LKEKGLIRIEGKEYLVRDGDVIFFKFNV"
FT   gene            complement(239224..241230)
FT                   /locus_tag="BG0239"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(239224..241230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0239"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0236"
FT                   /db_xref="EnsemblGenomes-Gn:BG0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07093"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07093.1"
FT                   /translation="MLIFGFIGLFFLNLFSLNAQGIVTNKDAQEEFKWALNSYNNGIYD
FT                   DALLSFKKILSFDPNNLDYHFWTGNVYYRLGYVEEALMEWRNLKDQGYKVPYLRHLIST
FT                   IEQRRGIFSNYELNFKKLVKVASLDNSIYKRPHGYQITSLRADKYGGYYAANFVGNEIL
FT                   YFDVNNNVNALVKDGFSYVKSPYDVVEANNLLYVTLYSSDEIGVYDKVLGVKKRSIGKK
FT                   GTKDGELLAPQYMAIDKRNYIYVSEWGNKRVSKFGLEGDFILHFGYKTSGYNGLLGPTG
FT                   ITYLNENIYVADSLRNTIEVFDTSGNHLYSIFTSIEGIEGLSSDSAGNNVIISSKYGVY
FT                   KYNIAKKTITKILKADKVNSKISSSILDANNQMIVSDFNNAKVSVYKSDSSLYDSLNVD
FT                   VRRIVRLGGPKIYVELNVSSKSGLPVVGLKSENFSIANENYYIVNPKVVYNVNASKDIN
FT                   IAVVFDKSSYMKNYDLDQIVGLNALIESSKNKNFSFINATSVPIIDNIESLTSSIKNTS
FT                   SLGPYSTDTVKTDVSLKLAGSGLMSKSSRRAVVYFSGGVLNHKAFEKYSLDTIVSYYKN
FT                   NDIRFYLILFGNDPVNSKLEYLVNETGGAIIPFSSYEGVSKVYDLILEQKTGTYLLEYY
FT                   YPGPQEPNKYFNLSVEANINQQTGRGEFAYFIN"
FT   gene            241377..242942
FT                   /locus_tag="BG0240"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        241377..242942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0240"
FT                   /product="apolipoprotein N-acyltransferase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0237"
FT                   /db_xref="EnsemblGenomes-Gn:BG0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07094"
FT                   /db_xref="GOA:Q662C7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C7"
FT                   /protein_id="AAU07094.1"
FT                   /translation="MKTRCFCLAAFSGILTTLAIPNEIKETGYSILGFVAYVPLFIALN
FT                   KLEDKKTLIRLTVFYFIIANSLQNFWLGFFHAFGWITFIGVIIGYIPYSLTLGYFLYYS
FT                   LKSFKNKTIVIAMLFTFYDYSRSIGFLAYPWGLAAFTVNNFNDLIQVADIFGVFFVSFA
FT                   VYFLNSGIADFLIHKNKTNLLNTIFPILLITTSFTYGMLKKIELKNLLAKKIDSLNIAA
FT                   IQLNTDPWLPGNDKKGIRDSIAITEQALKENPEIEFVVWSEGVLTYPFSEKDQYFKNYD
FT                   LYNELKNFIKERKIPFAIGAPSNVDKTIGIQQNSIYMIEPNLNIANIYSKIFLVPFAEK
FT                   IPFYEYEFVRKFFKKNFRILGQLEGNKIEILKLKKFKFAPLICYDDAFPELSRFYKTQG
FT                   ANTLLNFSNDSWSKTNSAEWQHFVVAKFRSIENGIKTIRATNSGITAIINEYGESIKRL
FT                   ETFKKGYLLSTVKLSPTFTTIYEKIGDSFIHILMIMFLIITLRFHFMEDKNQLLSSSLV
FT                   KIKV"
FT   gene            complement(242882..243652)
FT                   /locus_tag="BG0241"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(242882..243652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0241"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0238"
FT                   /db_xref="EnsemblGenomes-Gn:BG0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07095"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07095.1"
FT                   /translation="MGRLFLLYFLCSFVFLNLFAQGSSSYTDKQKELAIFYYEVGQRYI
FT                   NVGKIKKGKLFQAKALKFYPDLKKGVDIKLVVKELDTRIKDDNSKVVMLENVKLEEIPG
FT                   IVHEKIEINDFTNAPKIGYLAERERSKNQDKIIKFQFGKFTRALISQKFDLFDSVVADK
FT                   VDVMGQFESKGDFISALSRASSKVDADELEYLSVDDYYDLKSLKISKSNDTAFAVNVNT
FT                   KKNDVTKNFPFWKEHQTLIFTKEDDNNWFLSSIK"
FT   gene            complement(243717..244319)
FT                   /gene="dck"
FT                   /locus_tag="BG0242"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(243717..244319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BG0242"
FT                   /product="deoxyguanosine/deoxyadenosine kinase(I) subunit
FT                   2"
FT                   /note="ortholog to Borrelia burgdorferi BB0239"
FT                   /db_xref="EnsemblGenomes-Gn:BG0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07096"
FT                   /db_xref="GOA:Q662C5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C5"
FT                   /protein_id="AAU07096.1"
FT                   /translation="MIVIEGLIGVGKTTLGNILSNELKVPFYSELNNDFTLAVLDKFYR
FT                   DKSRWAFPVQINFLNERFKLIKGVFRTKGGILDRSIYGDCVFASLLNCDGHISDEEYKI
FT                   YIDLLDNMLEHSQRPSLLIYLDCSIDEVERRIKNRNRSFEMNIPRDYLEGLNRKYLKWY
FT                   NEYSLSSKIKFSYDDINIFNEEDKNKVISLIRDKLVL"
FT   gene            244731..245495
FT                   /gene="glpF"
FT                   /locus_tag="BG0243"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        244731..245495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="BG0243"
FT                   /product="glycerol uptake facilitator"
FT                   /note="ortholog to Borrelia burgdorferi BB0240"
FT                   /db_xref="EnsemblGenomes-Gn:BG0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07097"
FT                   /db_xref="GOA:Q662C4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C4"
FT                   /protein_id="AAU07097.1"
FT                   /translation="MNYTKFQEFISEFLGTFILLALGTGSVAMTVLFPSSPEITGEIIK
FT                   GGYTNIVFGWGLGVTFGIYTSARISGAHLNPAVSIGLASVGKFPVSKLLHYIVAQILGA
FT                   FTGALMTLVVFYSKWMEIDPGLENTQGIMATFPAVPGFLPGFIDQVFGTFLLMFLISVV
FT                   GEFVKKHDDSPFIPFIIGAVVLAIGISFGGMNGYAINPARDLGPRILLLFAGFKNHGFN
FT                   NLSIFIVPIIGPIIGAILGATIYEFTLKNNKG"
FT   gene            245534..247039
FT                   /gene="glpK"
FT                   /locus_tag="BG0244"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        245534..247039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="BG0244"
FT                   /product="glycerol kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0241"
FT                   /db_xref="EnsemblGenomes-Gn:BG0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07098"
FT                   /db_xref="GOA:Q662C3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662C3"
FT                   /protein_id="AAU07098.1"
FT                   /translation="MKYILSIDQGTTSSRAIVFDKHANIKGLAQKEFTQIYPQPSWVEH
FT                   DPTEIWGSQLGVITEALANSRILPNEVDAIGITNQRETTVIWEKSTGKPIYNAIVWQDR
FT                   RTAKICDQLTKEGKDKIILEKTGLVLDSYFSGTKILWILDNVEGARQKAENGELCFGTI
FT                   DTWLLWNLTQKKVHATDYSNASRTLLLNIKTLEWDDELLKILNIPKAILPELKESSTIY
FT                   GETDKSIFGAEIPIAGIAGDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIINHE
FT                   RLLTSIAWGRKKTVTYVLEGSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVY
FT                   FVPAFVGLGAPHWDSYARGTIIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNF
FT                   EIKELRVDGGASQNNLLMQFQADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEI
FT                   ISLWQVDKIFEPSMPKNQKEKLLENWNRAIERSKSWIQNSNSL"
FT   gene            247316..248884
FT                   /gene="glpA"
FT                   /locus_tag="BG0245"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        247316..248884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="BG0245"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic"
FT                   /note="ortholog to Borrelia burgdorferi BB0243"
FT                   /db_xref="EnsemblGenomes-Gn:BG0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07099"
FT                   /db_xref="GOA:Q662C2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C2"
FT                   /protein_id="AAU07099.1"
FT                   /translation="MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILI
FT                   EKFDYAKGTSSRSSKLIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECAFITPI
FT                   YNILEIPYYYLGLTYYHNLMGKEKATKYKTKLLSKKSTIEKATNIKTKGLKCSVLYYDD
FT                   SFDDARMAITLLRTFTEKGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCI
FT                   INATGIFSDEIRRLDDEKALNIIKPSQGSHLIIKKDKFPQNYAILIPKTSDNRILFAIP
FT                   WYDGVVCGSTDIPIKEIEVEPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLI
FT                   MDPKVEGNTSKISRNEKIFISDSNLITIAGGKYITYRKMAEKTLLKAIEKNLLPNYPPT
FT                   TENLKLHGYLKKEEAVKIPESFRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEF
FT                   EQAKTIDDVLARRTRSLPLNPQAAIEAAPRVAEIMMKKLNKSEKWKNEQIKTFLEISKK
FT                   YLIKN"
FT   gene            complement(248971..249465)
FT                   /locus_tag="BG0246"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(248971..249465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0244"
FT                   /db_xref="EnsemblGenomes-Gn:BG0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07100"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07100.1"
FT                   /translation="MKVNNLIAGVLNLNSKDYKKGGKKVFFDKNNAFSSVFQIESVKED
FT                   KYFILLENGEFNLDLIKSMLDGINEIGERLLSEPSRQNVIFYKKVISEFMSIIISSSVC
FT                   LKEQKGGSFGDPKRPKYRIIKIINDKLDRLAYSVLQNQMTQIKLLDSIEEIQGLLVNLL
FT                   M"
FT   gene            complement(249452..250006)
FT                   /locus_tag="BG0247"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(249452..250006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0247"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0245"
FT                   /db_xref="EnsemblGenomes-Gn:BG0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07101"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q662C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07101.1"
FT                   /translation="MLNFLTVKKERKASSLFIFDEIKTIVGVGDFFKGDLVSNNFIRLD
FT                   GDFMGTISSTKRVIIGESGRVKSSIDANELVISGIVVGNIYAKSKIKIFASGCVIGNIS
FT                   CKSIEVEEGAIIDGYMDIGAEYLRAPEKNTFFYTGSYKVNEDLLIEINKEYQEEKKSSQ
FT                   PLEGEDDKYFTSVMSKIDESK"
FT   gene            complement(250007..251032)
FT                   /locus_tag="BG0248"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(250007..251032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0248"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0246"
FT                   /db_xref="EnsemblGenomes-Gn:BG0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07102"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07102.1"
FT                   /translation="MKKRIKFKIILGFKGILKFFWVIYNSLFITLKVIHSFFKQNISFM
FT                   IIPHVKGNVKNIKISFLTLFFFSTFFLGGFIGFVLLAVNYVTLSSIVKSTEKNYSLAES
FT                   EIEDFRNTVVEINSVAKNFSKILDELKTSLKINSNGADLNKNKLDGDLSDFIDLQILEA
FT                   NSIKELSDLKNIKSKIESSIPPLKSIVKVLHAQDKLLNDIPSLWPLAGGSGIITLHFGP
FT                   AIEPFTRQWYIHKGIDLGGVRIGTPIVATADGEVVRASYQSAGYGNFVQIKHKYGLATL
FT                   YAHMSRLNTSKGSYVKKGQVIGFMGQTGYATGPHVHYEVRVGSQVINPDMYLNLATGAS
FT                   K"
FT   gene            251229..251834
FT                   /locus_tag="BG0249"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        251229..251834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0247"
FT                   /db_xref="EnsemblGenomes-Gn:BG0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07103"
FT                   /db_xref="GOA:Q662B8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07103.1"
FT                   /translation="MKTLFFATTNENKINEVKNILDMPNLNLVVPKNFNIKETGTTFKE
FT                   NSLLKAKALFAILNKNQNVFGEDSGLCIEALNLEPGIYSKRYDTYKLCKKLSTNEKNQL
FT                   ILDLMKNEKNRKAYFICNISYISKDRQILNFEGIIKGEIALSLNDDKNYGFGYDSIFLT
FT                   KNNKKLSDLTLEEKNKISHRGIAFSKFKKFLLKSLFNN"
FT   gene            251955..253727
FT                   /gene="pepF"
FT                   /locus_tag="BG0250"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        251955..253727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="BG0250"
FT                   /product="oligoendopeptidase F"
FT                   /note="ortholog to Borrelia burgdorferi BB0248"
FT                   /db_xref="EnsemblGenomes-Gn:BG0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07104"
FT                   /db_xref="GOA:Q662B7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B7"
FT                   /protein_id="AAU07104.1"
FT                   /translation="MINRNEINENDKWDLSFLFANEEEYAKAINAIEIKTKEFKKYEKL
FT                   ELNFDLFKETLNKYYEIMEDLEKVSYYAMLQLETDVTNKDSNKIYSICVNIATKVSNAT
FT                   SFLMPKILKSDAKKIQAWINKPELKEKKIAIEKILREKNHILSEQEEEILANYTPLYSS
FT                   YQNIFSTLTNADMEFGEINGNPLTNSTYTLFLQNENQKIRKEAFFKFYQKYKNNENTLA
FT                   NLIISDFKKNHFIAKTRKFQNTFSMQLFSNNIDKKVYTNLIETVNENLSALNDYYEFRK
FT                   KILNQEYLYHYDVYVPLTKGITFKNSFEEACEKILKSLEILGNEYTEILKNGLLKERWV
FT                   DKYENTGKRSGAFSAGSYNGKPYILLNYKEESIRDMFTLAHEAGHSMHSYFSIKNNPFP
FT                   HYNYSIFEAEIASIINEQILAEYLLKNETDTKKIKYIKLTQIDDMISTFFRQTMFAEFE
FT                   YIIHEMISKEEPIVKETLTETYMNLLKKYFGPSLKFDELSSLECLRIPHFYSPFYVYQY
FT                   ATGIAAALSIYKDIKENKKDAVENYIKFLKTGGSKYPLDSLNITGVDLTKKATIENTIN
FT                   IFKCRLEEIKKIFQ"
FT   gene            253741..254445
FT                   /locus_tag="BG0251"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        253741..254445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0251"
FT                   /product="phosphatidyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0249"
FT                   /db_xref="EnsemblGenomes-Gn:BG0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07105"
FT                   /db_xref="GOA:Q662B6"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B6"
FT                   /protein_id="AAU07105.1"
FT                   /translation="MKNINLILAWLVHIFTASGLIVGLYSIISIVNGDYSLLLKLTVIG
FT                   LIIDGIDGTMARKLKVKELIPEIDGALLDNIIDYINYTFIPVIFFYWGEFIEEKYKVAI
FT                   CIGILLSSAYQFSRIDAKTNDNYFRGFPSIWNLFVILNIIFKIEQITNLVMISICIVIS
FT                   FVPIKFIYPSKTKELKKITIPITIISCVIFVVSIFLDLSTTALKISKTILILYFTYLTL
FT                   ASIYLTYKTRNR"
FT   gene            254442..255056
FT                   /gene="dedA"
FT                   /locus_tag="BG0252"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        254442..255056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="BG0252"
FT                   /product="dedA protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0250"
FT                   /db_xref="EnsemblGenomes-Gn:BG0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07106"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B5"
FT                   /protein_id="AAU07106.1"
FT                   /translation="MITMHINTIIESIDSNIAYSPIVFFSLLILAGLNVPISEDAIVLM
FT                   GGILSSRKNEYTVLIFLGIFWGAYLGDIISFYIGKLMGNKLFKNKKDNNLLDKINYYYG
FT                   QYGVLTLFIGRFIPFGVRNAIFISAGMGNMKSNLFIVSDFFATLLSIMVYFTLSFKLGQ
FT                   SFEIIFSKIKIIIFAIFITIISTTIIIWVIKKNKKVDKNLK"
FT   gene            255077..255160
FT                   /gene="trnL"
FT                   /locus_tag="BG0253"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            255077..255160
FT                   /gene="trnL"
FT                   /locus_tag="BG0253"
FT                   /product="tRNA-Leu"
FT   gene            255253..257775
FT                   /gene="leuS"
FT                   /locus_tag="BG0254"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        255253..257775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BG0254"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0251"
FT                   /db_xref="EnsemblGenomes-Gn:BG0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07107"
FT                   /db_xref="GOA:Q662B4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662B4"
FT                   /protein_id="AAU07107.1"
FT                   /translation="MSKYEFIKIEKKWQEFWDNNKTYKVKEDPNIPKEKRLYILDMFPY
FT                   PSANGLHVGHPEGYTATDIFGRYKLLNGFHVLHPIGFDSFGLPAENYAIQTGTHPQKST
FT                   EENINKFKKQIKALGFAYDWDREIRTHDENYYKWTQWIFLELYKKGLAYAKEMPVWYCP
FT                   ELGTVLANEEIIQTPDGPKSERGFHNVEKKYLRQWVLKITKYAERLLNDLEELEWPESV
FT                   KEMQRNWIGKSTGVEIDFEIEGHNDKIKVFTTRPDTIFGITYLVIAPESKLIEKITKNN
FT                   FKRNVLKYVKHEELKSDLKRTSLEKDKSGVFTGSYAFHPITNEKIPIWIGSYVLGTYGS
FT                   GAVMGVPAHDERDFQFAKKYKLKILPVISKSGKNEILEKAFIDDGISINSPNEFNNLKN
FT                   SEVKDKVIEWLIKNKKGKEKVTYKLRDWIFSRQRYWGEPIPILFDKLGNAVPLEKNDLP
FT                   LKLPKTANYKPSRTGESPLSRIKDWVNLKDTGFTRETNTMPQWAGSCWYYLRYLDPKNP
FT                   KEFASKKKIEYWMPVDLYIGGAEHTVLHLLYSRFWHKVLYDLGYVNTKEPFKKLINQGI
FT                   ITAFSYQKENGILIPNDQVIEKNSKFFDKRDNKEVIQVIAKMSKSLKNVINPDDIIKEF
FT                   GADSIRIYEMFMGPLTDSKPWNTKGIIGVFRFLNKIWNLREKELSKDNPPKEIISQLHK
FT                   AIKKVTEDTEKLSFNTAISAMMIFVNELIKYEKNYLNIFKPFIIILSPYAPHLAEELWE
FT                   YIGETPSLFKNSKWPEFDENLIIKDAKEIVLQINGKMKDKILLSKETDEEELKEIAMGN
FT                   SKIKANLLNKKIVKIIAIKNKLVNIVIK"
FT   gene            257790..260090
FT                   /locus_tag="BG0255"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        257790..260090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0255"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0252"
FT                   /db_xref="EnsemblGenomes-Gn:BG0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07108"
FT                   /db_xref="GOA:Q662B3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B3"
FT                   /protein_id="AAU07108.1"
FT                   /translation="MDFESLSIRYRKIIFTIFILITIFLGFFLKNLKFDANILKLIPKT
FT                   KETESLIDIDKSNSLLSTIVIFQDKKNIFNKKNFETINSVINEITKILKVSPNAVTSIF
FT                   SYFPQFKKEIYTDKDIEEIKNKIKSTPFVKNTFLGNSENLIYFIIIPSESDKINFSRNL
FT                   KNELDEMEETIKKYETDNLKLYLTGDLIVREKILNYMVEDFKILGPLAAFVVIISLYLI
FT                   IKNLMGALIPIFIALLSLIWTFGIKGLVNSPITVPETSMIVLLISIGCDNAVHIINGIF
FT                   KLIKKEQLSKESIKTTIKKLKTPILLTSLTTAFGFLSLTTSSINAYKTMGIFMSIGVII
FT                   SMAISLTVLPGIITLIPFTKKKSLEKQKENKPYRIFFLEKLAKLNTQITKSILKRKYIS
FT                   SIVVIIILGISIAGLLKIEINFDEKDYFKESTSVKKTLNLMQKEMGGISIFKIELEGKP
FT                   GEFKNAKAMQTLDLITDKLDEFSAKTQSSSINGILKFVNFKIKKESPLEYKLPESKTIL
FT                   NKLINLIDKSDWTKDNKKMYINDDWSLISIMVRIEDNSTEGIKKFEKYAIETINEHMRN
FT                   NKYHFSGVYDKVLIAKTMVREQVMNIVTTLGSITLLLMFFFKSIKTGIIIAIPVAWSVF
FT                   LNFAVMRLFGITLNPATATIASVSMGVGVDYSIHFFNTFILKYQKSQIYKNALLKSIPS
FT                   VFNGIFANSISVGIGFLTLTFSAYKIISTLGAIIAFTMLTTSLASLTLLPLLIYLFKPR
FT                   VRVKLALNNNLKN"
FT   gene            complement(260087..262507)
FT                   /gene="lon-1"
FT                   /locus_tag="BG0256"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(260087..262507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon-1"
FT                   /locus_tag="BG0256"
FT                   /product="ATP-dependent protease LA"
FT                   /note="ortholog to Borrelia burgdorferi BB0253"
FT                   /db_xref="EnsemblGenomes-Gn:BG0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07109"
FT                   /db_xref="GOA:Q662B2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B2"
FT                   /protein_id="AAU07109.1"
FT                   /translation="MDEFKKARLIDKKKEKTAAGILPHSNKPARVPLIAVPSHPVFPGM
FT                   FIPIVIISDSDMKAIDYAMKGNGIIALFVLNDKFLGKNNNNAQQKLIIDYSKDIYSVGV
FT                   TAKVIKKINLPDGGYNIFVSTFDRIKFVKVVLNEKFPIIEIDYLKQIPVRKDDIQSKAV
FT                   YSSILLRTKEIFSHRKMPEVQLNMVNIEDKGKLCDIVASTISSSKNDHQIVLETLSVKD
FT                   RLKKVLELIYEELNLIEIQNKIAKGIQERLEKQQKEFFLKEQLKAIKAELGIGDKKNSD
FT                   FEKLKTKLKTLELKGESLEVVEKELEKFSLLETSSAEYIVIRNYLELITELPWRDFKIN
FT                   FDKLDLQKSKKILDKTHYGMTEVKDRIIEYISVLKLRKTQKGAIILLVGPPGVGKTSIG
FT                   AAIAKVLRTKFFRFSVGGMRDESEIKGHRRTYVGALPGKIIQGLRITKTNSPVFLIDEV
FT                   DKISASNYGDPFSVLLEVLDPEQNVKFRDHYLDLPFDISNVFFILTANSVETIPRPLLN
FT                   RMEVIEVSGYVDNEKIEIARKYLIPKVLSENGVDKDSLKFQSSALVQIAQEYARDNGVR
FT                   NFEKYLNKIVRKVARKLIENTEVKSYQISNDNLEEYVGVPVFRKESMPNAMYSGMVMGL
FT                   AWTNYGGSTLIIETVKTESKVGGIKLTGRLGDVMKESANIAYTYVNSIKGDLSISKSFF
FT                   EKNIIHLHIPEGATPKDGPSAGITIASAFISLALNKVVRPHLAMTGELSLTGNVMMIGG
FT                   LREKIIAAKRSGVEHIIVPKANRVDLEEIPINIKSGINFYLVDNMCEVIKLLF"
FT   gene            262784..264910
FT                   /gene="recJ"
FT                   /locus_tag="BG0257"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        262784..264910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="BG0257"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /note="ortholog to Borrelia burgdorferi BB0254"
FT                   /db_xref="EnsemblGenomes-Gn:BG0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07110"
FT                   /db_xref="GOA:Q662B1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B1"
FT                   /protein_id="AAU07110.1"
FT                   /translation="MKIWKQKETNIQIQELTRIAKQYNINPFEATLLIKREIKEEDFIF
FT                   FLEDSTNLLHNPFLLKDIDKFINRINKAIKENENILIFGDKDADGITATIIMYETLKDF
FT                   GLNVSYKIPSNGEFYGLSKELINIALEKKISLIITVDNGISSIEEINYANSKGIEIIIT
FT                   DHHLPSEDFKTESIVINPHLKDDKYPFKEIAGCCVSFKTCLALSMSFTDLYSKNLVFLF
FT                   LEKTNNEIILNAIEIKNYILKQYLRLNNKNDPSINLNKLEKFIQNKYIVIFNKEDQGQL
FT                   LNKHFGISININTIDISENFIKKYPNFRKKTLKDLIQATKYFRYKEVEIKDKLYYIFYN
FT                   IIFETNKNLLQRCLKRLSFVAIGTIADNMPIINENRIILKAGLKEIALRERMSINYLLK
FT                   DANILTKPNITSMDIAYKIAPILNSTGRLEKADIAINFLLADDINQIENKFKEIKEINE
FT                   LRKYKEEKAWNSHNKNTIFKNDKFIVCYDKNTPKGISSRLATRLSAYYQKVAIFLTKQD
FT                   NIIKGSIRSNNKINSKALISTIPSHLIINSGGHKAAAGFTLNENLLEDFIKELEYATTK
FT                   VKYETTDENESILIDTIVPKNLTKDSLFKTIEIFEPYGYEFREPILMMENVYLQELKTI
FT                   DKNHNSKHINMRIKSQNDYYKAIFFNGTKKIEELNIKENQYLDIIFTINEDFYCPREKI
FT                   LKIIDIKKSAQINV"
FT   gene            264903..265847
FT                   /locus_tag="BG0258"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        264903..265847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0258"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0255"
FT                   /db_xref="EnsemblGenomes-Gn:BG0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07111"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q662B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07111.1"
FT                   /translation="MYRIQKTLLIFCILGIENINSEIINTIPKVQYKKEAFQGDYIYFA
FT                   SNENFKKLSLLSINKNPIISSSPFKFTVGSKTYYIAFIGITPMIKEGKRKIQIEFKNKS
FT                   YVKEVEIKKFNFKKTTISFNKEKAKLITQKKSIKQKEQALVLWNIIGNIGDTTIYHYDA
FT                   LVKPIKDQYIITSQYGDLRLYMQGSKKISNYTMHNGIDYAPFKRENTPIFAAGKGKVVF
FT                   AQNRELTGNTLIIQHLPGVFTIYLHLSKLGISENKVVSAGEYVGHTGNTGLSTGPHLHF
FT                   EVRINGIAINPDFLLNGMLIDKNKIINNIKRIE"
FT   gene            265862..266071
FT                   /gene="rpsU"
FT                   /locus_tag="BG0259"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        265862..266071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BG0259"
FT                   /product="ribosomal protein S21"
FT                   /note="ortholog to Borrelia burgdorferi BB0256"
FT                   /db_xref="EnsemblGenomes-Gn:BG0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07112"
FT                   /db_xref="GOA:Q662A9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662A9"
FT                   /protein_id="AAU07112.1"
FT                   /translation="MVTVTVDKNENLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIR
FT                   VKKEKAFKRKQAKKVRKLKQKTNR"
FT   gene            complement(266107..268458)
FT                   /locus_tag="BG0260"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(266107..268458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0260"
FT                   /product="cell division protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0257"
FT                   /db_xref="EnsemblGenomes-Gn:BG0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07113"
FT                   /db_xref="GOA:Q662A8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A8"
FT                   /protein_id="AAU07113.1"
FT                   /translation="MKDFYQYFQFLFFFMLTIISFSLFVALTPLSNIFVFFVFNLIGQI
FT                   LVNVFSFLSFYLIIYPLVNWYAYKKHIFTKRFIFNWNYTVILFFTLIFLIKINSNVEKS
FT                   YLIKIFLINFGTILGNFFVFILLILEFVVWIYLNYVFFKDVNFILDALKFLEFKIKILF
FT                   ENILSYLPFSNSLDVKKDIKIYGDFAEDIKDPQAFDDNKNIINDEEYQALWSFSAFLRN
FT                   NKKPSNVNLAKTVFEDSDSKDASSSNKEISNNSALNADEIDESCEYKSLDNLEDNKLII
FT                   SGKVKASEIRTKGIISQVAIPNAYNENVVLNKKSDSYVIDISVFDQREVKNDVEDIEYD
FT                   KEIQKQSIILQETLKEFNINAKLIDIIKGPVVTMYAIRPDKGIKLSKITSISDNIALRL
FT                   AAIRVRIIAPIPGREAVGIEIPNKRREFIVISEIIDSKEFRGDFRIPFALGKEISGENI
FT                   VFDLVNSPHLLIAGATGAGKSVCVNSLIASIIFSKSPDEVKLIMIDPKIVELKLFNDIP
FT                   HLLTPVITDVKRALEALRWCLDEMERRYVLLDNLLVRDISSYNKKIKDENLNLMILPYL
FT                   VIIIDEFADLILSARKDLENLISRLAAMARAVGIHLVLATQRPSVDVITGVIKANFPSR
FT                   ISFMVASSMDSRIILGSSGAEKLLGKGDMLYISSLNPFPQRIQGGFLKEREVYRLVEEV
FT                   KKFGSPNYIDDEIFIDSVKEQDLVALGPSDEPMFDEALEIVKTTRKASASYLQRRLKIG
FT                   YNRAARIIEIMEDMGYIGPVNGSKPREVLI"
FT   gene            complement(268455..269255)
FT                   /gene="bacA"
FT                   /locus_tag="BG0261"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(268455..269255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="BG0261"
FT                   /product="bacitracin resistance protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0258"
FT                   /db_xref="EnsemblGenomes-Gn:BG0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07114"
FT                   /db_xref="GOA:Q662A7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q662A7"
FT                   /protein_id="AAU07114.1"
FT                   /translation="MINILNAIILGIVQGITEFLPISSSGHLLLFRHFMHLKLPIIFDI
FT                   YLHLATVLVIIIYYRQRILELFLTFIRFSLRKTNKSDLTNLKLILLILIITIVTGVVGT
FT                   FISKYERMFILPFILINFIITGILILMLEFNFFKIDFKGNILLVGIFIGLMQGLGAFPG
FT                   ISRSGITIFSAVSLGFNRKSAFEISFLSLIPIVFGAILFKYKEFYDIFMVLNFFEINLG
FT                   ALVAFVVGIISINFFFKMLNNKKLYYFSIYLFALSITFCCFFRI"
FT   gene            complement(269270..271417)
FT                   /locus_tag="BG0262"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(269270..271417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0262"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0259"
FT                   /db_xref="EnsemblGenomes-Gn:BG0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07115"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07115.1"
FT                   /translation="MFNRNSCVLQNFLFLFLSLFSCVVKKEVSSSDFIKMHSKEFDLNN
FT                   LNWLWNFDYSKKNFDKHFNIDPSSYIYVAYLFKKIGFEEKFVEYMKKAIANGDNIASQF
FT                   AGIKLIEYFNSIKEYSESELIGESLYKKYENNKFIILGYFKSLYWQKKNDKALSLLNKL
FT                   NKMEFPDYQENENILLKAALYLNLSNVSESKIYFNELFENLPANYLHVRAYDYFIIENK
FT                   SKYFGTNFLNLVRFKYEVANGNFNSAINILNKNGLSGYYDNNIVLSDVYKAFISSGKIS
FT                   NALTFFSKIRSKYKNYYLGILNLRGKNNSGLLLLKEYLEGLNLKNEINRLDLLNTAFSN
FT                   LIFTQSARNYFAESVAKFYTESDKKNSTFIKILEDYILESIQLEDYGNLYKLYSNAQKV
FT                   ISDSILSKLAFINARLIYHKLIKSNVSGEYKSLLHSAINYDKWSYSSFMSRYLLDQNID
FT                   EFFTSGHDIKYEQSDYEIFLEGFLKFNLYHYVRGFISEDFRNGYKFSLDFYRRIYDELL
FT                   KSENYYDATLVINYLVNQDESALMENDYKRLYPYLYGSLVEYWAKRRGLESSIVFSLIK
FT                   AESSFEKNAVSKPGAVGLMQVMPSTANDISKELKYFDYNLKIPKDNIIIGTYYLKKRIS
FT                   TTGSLYKALASYNGGIGNVRKWKKSYGHCSKELFIEAIPFSQTRNYIKKILVYSVFYDA
FT                   LYEKKGIDSVIVKIMGEFPKN"
FT   gene            complement(271410..272426)
FT                   /locus_tag="BG0263"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(271410..272426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0263"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0260"
FT                   /db_xref="EnsemblGenomes-Gn:BG0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07116"
FT                   /db_xref="GOA:Q662A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07116.1"
FT                   /translation="MKGFLAIKLSNNEYYSVLNLDDSSVKRVILGKVAGDTSIKLNFYV
FT                   SEYEDFSDPFLVGSFFLDNLKRESLSVNVYFKVMDEILYVYSESNGIQDKSKFDLSLLD
FT                   FNQTFKGSNGGRLSNDLKSGIGNDLPVENLGSEFDLNFEEKDDFVKKDVFDLSIPAINS
FT                   LDLKTEEDQKDDSGDSDFEGFDDNDENYVDSKELNLENKKVEYINEESLNLNNFEFQKL
FT                   EESLEEDEEEDLHDLSVEDIIADIDKDLIDTSDEDVELDLREDFENDAVKNNFKLNSSE
FT                   GVVHSPMLDLSLISLFLLIFFSLFLVFSKILKPRDFISYYFECGKKRIERYENDQYV"
FT   gene            272630..274012
FT                   /locus_tag="BG0264"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        272630..274012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0264"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0261"
FT                   /db_xref="EnsemblGenomes-Gn:BG0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07117"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07117.1"
FT                   /translation="MLPLFIVISSFIVFILVFLFFKIALKLTIGKTRGKIKKDDERTQK
FT                   LIERAISLLKTNPNEIGALEILNNYYYKNQDHENGIKYAKKLCQLIEDNPISQEINTFK
FT                   AFLSYGFYNLKRNFNREALEFLKKAYLIKKTDEDANYYLGIAFLKNEMYKEALYYLTKV
FT                   YKFNKNNKDILKYIGITLFNLESYRKAAGIFNNIKKHIQGDIDALLAYAKSLSKMNQDH
FT                   LALEIANKIKQKDGMIYEALLITSEIHSKNKELDKLEQNIKEIIKVKPDLPKKIFLELF
FT                   YNLGELQISVENYQKATEAFTKVEDIDPNYKKIKEKLEFSKRLNENIALRIYLRSSKEN
FT                   FGKIANEIILKLYLNKFQVRDSKINEITSQFIDMNFHLANNQWEENLIVRFVRTEQDTF
FT                   GELFLKDFISKIKENKIKGLCIAPSKFSLKAKQMIEGRLIDLVEGKKLTQILKKINISK
FT                   YT"
FT   gene            complement(274019..275272)
FT                   /locus_tag="BG0265"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(274019..275272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0262"
FT                   /db_xref="EnsemblGenomes-Gn:BG0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07118"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07118.1"
FT                   /translation="MIIPKKKQRVEKRKKNFLFSSKKNINFELKDFADIRNIGKRRKKV
FT                   FKLKNFFKKIDFFLKKVSLFSYKLKIQNINHYEYKYYYNNFKEKVFDIFSLKFDYKLIF
FT                   KLNAIIFIFVLIFYINIFSYYGSYIFLNRLTLPKDYFIDTFLYYSDQDIAQISSYLPDS
FT                   NVSANVPEFKKNFVLKVLDHKIKPGETLSHVAARYQTTSETLISFNEIKDVRNIKPNSI
FT                   IKVPNMNGIVYVVKKNDSISSIASAYNIPKVDILDSNNLDNEVLFLGQKLFIPGGRLPK
FT                   DFLKEVLGEIFIYPVQGVITSGYGYRPDPFTRVISFHNGIDIANLANTPIKAAREGIVV
FT                   TVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGNHL
FT                   HFTIFKNGKTENPMKYLR"
FT   gene            275448..275840
FT                   /gene="lepB-3"
FT                   /locus_tag="BG0266"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        275448..275840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-3"
FT                   /locus_tag="BG0266"
FT                   /product="signal peptidase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0263"
FT                   /db_xref="EnsemblGenomes-Gn:BG0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07119"
FT                   /db_xref="GOA:Q662A2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A2"
FT                   /protein_id="AAU07119.1"
FT                   /translation="MIPIIFDKNWIVNHKFAYGLRLKSRQKYLLLWKTPKKNEMILIKD
FT                   PITNKIAVKRIFAIPGEKFKQIEKNKICIHNLNFKIDENILKKNNKKIPDNHYLVIGEN
FT                   KQTSLDSRDYGFIKIDNILGKIIYYF"
FT   gene            complement(275865..277334)
FT                   /gene="dnaK-1"
FT                   /locus_tag="BG0267"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(275865..277334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK-1"
FT                   /locus_tag="BG0267"
FT                   /product="heat shock protein 70"
FT                   /note="ortholog to Borrelia burgdorferi BB0264"
FT                   /db_xref="EnsemblGenomes-Gn:BG0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07120"
FT                   /db_xref="GOA:Q662A1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A1"
FT                   /protein_id="AAU07120.1"
FT                   /translation="MKKWIGIDLGTTNTVASYFDVSSKIILNERGERMTPSIVSFSDKD
FT                   VFVGSAAKNQILVNPQKTFYNFKTNIGSNTFYKVDGEFYRAEYISAHLLSSVKKNAEKF
FT                   LDEEIENVVITVPAYFSEIQRRGVVEAANFAGLNCKAILNEPTAAAIAYAFESQIDGIF
FT                   LIYDLGGGTFDVTLMEKQSDTYTVLSVKGQSRLGGNDFNKIIEKHVLDNFKNEYPDFNL
FT                   EDVFLLEQLREQIEEGKKNLSVMEEVDITLLFLDGNHLSYKLKRNEFNAMISEYVDKTI
FT                   HLSKECIVDAGVGISSISKIILSGGSTRIPLIQKVLKESFPSVLILDALNQDEVVAIGA
FT                   GIHAFSLSRNDSVIKFKDVTPYSLGLEIRDNKFFTLIERNTALPISRSKLFTTTNDYQD
FT                   EIEIHVLQGEYKKASLNYSIGRFSFGNIQKALKGIPKIEVLFTLNESGILSVNAKDLET
FT                   NSSNFIEIKITSSSDNVAKESLSNIFTSIIE"
FT   gene            complement(277312..277833)
FT                   /locus_tag="BG0268"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(277312..277833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0268"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0265"
FT                   /db_xref="EnsemblGenomes-Gn:BG0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07121"
FT                   /db_xref="UniProtKB/TrEMBL:Q662A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07121.1"
FT                   /translation="MFIVFYLILVIFIFIYFHVYINLKIKSNSILKKFKSEVDKTIIEI
FT                   NQATDRNINIIEIKIESLNRIIKEVDERIEILDQRLLGFNNSPIPGNSSSNFGSKSGGI
FT                   YKSNLDYSIPTIEKNIIKESYNVRNQIILLHEQGMSFEAIAKKFKLDLGEVELIVSIHR
FT                   GGIHEKMDRY"
FT   gene            complement(277853..278155)
FT                   /locus_tag="BG0269"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(277853..278155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0269"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0266"
FT                   /db_xref="EnsemblGenomes-Gn:BG0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07122"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07122.1"
FT                   /translation="MDTFEVFKMSFVSSFKARQILSEDEKLKRLKINQNTRLKFLRDSH
FT                   TDSEVSNVCAVSKVEDNFLLSLPVKKNKNEERIMLSLYSGKFEDPKIGKNVNIKR"
FT   gene            complement(278182..280086)
FT                   /locus_tag="BG0270"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(278182..280086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0267"
FT                   /db_xref="EnsemblGenomes-Gn:BG0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07123"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07123.1"
FT                   /translation="MDDAAINFSELCDKMRAYLERENHVDLMEIEADTLEEALNDASLE
FT                   LSVPYKELDYEILLKGSNGILGYGRKKWKIVAYRNSSSKPKVSLDSKNDSGEEKTISSD
FT                   GEFFIKKSSKGVFLKVISSKGQGVPINYQDVLSKLELHSNIENFNKDIVKGIVENASGY
FT                   YEKIADFESDPSENVTMMVHISENSMSVTIEFTTPGINGAEIFAQDIFNILRKYGVIDI
FT                   AILKDKVAKFVDYPVYGEPVELARGLEPVKGKDSYIDFIVDENNRLGEYEVSSIGFRNV
FT                   IEGEELARIIPFGKGVDGYTVFGKVLKSESGQDINFILGENTFRDGYKIRAKCNGYMSV
FT                   SDGIISVHNIYLVKGDVGPATGDIVNNGMVLVQGNVLDGYNIMAKSGIEVKGLVGRCNL
FT                   KTDGSIIFHSGVNGKGDSKIYARGNIRAKFLENVTLSCGGEVEVLRGIVNSSVSSKKRV
FT                   LCIGKKSKIVGSSVYAKEEVRAYSIGSDRSCETCIDVGYDPEIKDLLTRFTSHLEKIEK
FT                   RLEVLTKDIVALKKNIVLITDKSEKSLKIDSYNEFVNESKILRMEIKMIEAKRIDLQNE
FT                   LENTKIEGKVSVENIAYSGVKLYIKNAFYELSKDYSNVTFVEDDNYIKVMTYIPFKSR"
FT   gene            complement(280089..280568)
FT                   /locus_tag="BG0271"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(280089..280568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0268"
FT                   /db_xref="EnsemblGenomes-Gn:BG0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07124"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07124.1"
FT                   /translation="MFISRELKYILLASVSALFISAVLGLFCGLPFFTILVRSFLQFAF
FT                   FFAIGLLIELIYKKYLSNLFSAELSSDMENKLQDDKKVHKDLNDNLDSQNKNSLYESFQ
FT                   NNISSVDFIEEVKKYKFDTEDMSEGSGKIKKMSFIEDNDPKVVADAIKTLMSKKE"
FT   gene            complement(280578..281465)
FT                   /gene="ylxH-1"
FT                   /locus_tag="BG0272"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(280578..281465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylxH-1"
FT                   /locus_tag="BG0272"
FT                   /product="minD-related ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0269"
FT                   /db_xref="EnsemblGenomes-Gn:BG0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07125"
FT                   /db_xref="GOA:Q661Z6"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z6"
FT                   /protein_id="AAU07125.1"
FT                   /translation="MEDQAQSLRDMMKLNGKFNFSVDEKVQNSKTRFIAVSSGKGGVGK
FT                   SNIAIGLALKYSELGKKVLILDADIGMANVNILLGVIPKYSIYHMITQNRDIREVITKT
FT                   EYNIDLLAGASGTMELLDLSDVDVNKFIKELLKIYEYDIVVIDTSAGISRQVISFLLSS
FT                   DDVVIVTTPEPTSITDAYGIIKVLSYKMENLKNLRLIVNRVANVSEAKGVAKKVIDISG
FT                   QFLNLNIDYLGYIYEDQNVRSSVFKQKPFVLVNPNSKASYCLDSIVATLEEVSLDSRKR
FT                   RGVIGFILRFFGVE"
FT   gene            complement(281477..282643)
FT                   /gene="flhF"
FT                   /locus_tag="BG0273"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(281477..282643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BG0273"
FT                   /product="flagellar-associated GTP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0270"
FT                   /db_xref="EnsemblGenomes-Gn:BG0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07126"
FT                   /db_xref="GOA:Q661Z5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z5"
FT                   /protein_id="AAU07126.1"
FT                   /translation="MVQYFTEKGPTYNEVIEIIKKKYGKNARVMTYKTVPHGGILGLFS
FT                   KDWVEVSGYVRYDIGNQQINVEDEKRKILQSIKREENSSIEDVLKEVKSLKTELAHKKE
FT                   NINHPTITKIEDILRENDFSENYIKDINEFIKREFSLSDLDDYERVREDVVLYIAKTIK
FT                   CSGSIIDDLKKRVFILVGPTGVGKTTTIAKLAAIYGINGESKSLNIKIITIDNYRIGAK
FT                   KQIQTYGDIMGIPVRAIESFKDLKDEITDSKDFDLILVDTIGKSPKDFMKLAEMKELLN
FT                   ACGRDAEFHLAVSSTTKTSDVKEIFHQFSPFNYKTVIFTKVDETTCVGNLISLIYEMKK
FT                   VVSYVTDGQIVPHNISVAEPLTFIRRINGYRISDDAEFIKKIKSKSYY"
FT   gene            complement(282648..284738)
FT                   /gene="flhA"
FT                   /locus_tag="BG0274"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(282648..284738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BG0274"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0271"
FT                   /db_xref="EnsemblGenomes-Gn:BG0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07127"
FT                   /db_xref="GOA:Q661Z4"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z4"
FT                   /protein_id="AAU07127.1"
FT                   /translation="MDARKNSILGYLRLNNKSDLIISIGLIFIVAGFILPLPAVILDFL
FT                   ITINLVISLLIILIVLYSKRSLDFSVFPTLLLVMTIFGLVLNISSTRLILTKGINFDGQ
FT                   MIRTFGTFVVGSSGIQGLVIGFIIFIIIIAVQFIVITKGATRVAEVAARFALDALPGKQ
FT                   MAIDSAYSSGNLTEEEATRQKNDLQSEVNFYGAMDGASKFVSGNVKVGFLITLINILGG
FT                   LLVGTTLQGLNFSEALNNYVSLTVGDGLVSQLPALLISTATGLIVTRSISKNSFGGEIF
FT                   EQFTNHLGIYWIVSGFLCFLAFLPGFPTLILLFLSLLIAFLAYSLSGIKRKEEINEKIK
FT                   LEEEQAAIYSDKDVAPVVPLDPLALEIGYNLVPIVDDTKTSELLDRIVKIRREIAFEFG
FT                   IVVPKIRIVDNMRLQPNAYSFKLRGVEVGRGEIKLGKFLVINVGIDSGIDGDLVKDPSF
FT                   GLPSLWVNDDGRETAEKLGYTVVDPPSIIATHMTELIKRHSYEILTRQDVQNTLDLFKK
FT                   DYGAIVEEVLKNFSVGEIQRVLQGLLKEQVSIRNLVTIFETFADFTSITKDIFFLIEKC
FT                   RQSVGRQITSGYLNLNSELNVITLNPSFEQIIIDSRIESNHDLISSIDPNLKTKFIYEL
FT                   FKIVNEVQAEGFYPVILSSESSRPIIKVITSREIPELVVMSVLEVPQNIKVNVLKTVEV
FT                   EE"
FT   gene            complement(284750..285868)
FT                   /gene="flhB"
FT                   /locus_tag="BG0275"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(284750..285868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BG0275"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0272"
FT                   /db_xref="EnsemblGenomes-Gn:BG0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07128"
FT                   /db_xref="GOA:Q661Z3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z3"
FT                   /protein_id="AAU07128.1"
FT                   /translation="MLKDEFLIKSWYIPLDFFSADDEGRTELPTDQKKQKAREEGRVLK
FT                   STEINTAVSLLLLFSLFFFMLSYFALDLVAVFKEQASKLPEVMRMSVYSMGFAYIRAII
FT                   GYVVLFFIASLVVNFFVNIIQVGFFITFKSLEPRWDKVSFNFSRWAKNSFFSAGAFFNL
FT                   FKSLLKVVIICLIYYFIIENNIGKISKLSEYTLNSGISIVLVLAYKICFFSVMFLAIVG
FT                   VLDYLFQRSQYIESLKMTKEEVKQERKEMEGDPLLRSRIKDRMRVVLSTNLRVAIPQAD
FT                   VVIVNPEHFAVAIKWDSETMLAPRVLAKGQDEIALTIKKIARENNVPLMENKLLARALY
FT                   ANVKVNEEIPREYWEVVSKILVRVYSITKKFN"
FT   gene            complement(285868..286656)
FT                   /gene="fliR"
FT                   /locus_tag="BG0276"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(285868..286656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="BG0276"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0273"
FT                   /db_xref="EnsemblGenomes-Gn:BG0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07129"
FT                   /db_xref="GOA:Q661Z2"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z2"
FT                   /protein_id="AAU07129.1"
FT                   /translation="MNLSFLVLKSFTILPILVRIFMFLKFSPFFSTIKIGYFNFFFSLI
FT                   LSVIVVEKIRIIYPLDSMLSFMLILSGEAILGLIQAFFVSIIFNVFHLVGFFFSNQIGL
FT                   AYANIFDVFSEEDSMIISQIFAYLFLLLFLSSDFLLRFFVIGIHDSVLNIRVEHLVNMR
FT                   NLEFIKLLLMSFGFLFEKALLISFPILALLLLFYLVLGILSKSSPQINLLIISFSTSLF
FT                   LGLLILYIGFPSLAVSSKKVIELSLDSLASFLKLFSRVLK"
FT   gene            complement(286692..286955)
FT                   /gene="fliQ"
FT                   /locus_tag="BG0277"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(286692..286955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BG0277"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0274"
FT                   /db_xref="EnsemblGenomes-Gn:BG0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07130"
FT                   /db_xref="GOA:Q661Z1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z1"
FT                   /protein_id="AAU07130.1"
FT                   /translation="MTAGHILYLIRISIENIMILSAPMLIIALIVGLLISIFQAITSIQ
FT                   DQTLSFIPKIIVILLTIVIFGPWILNKLMQFTYMIFNQLQNV"
FT   gene            complement(286964..287728)
FT                   /gene="fliP"
FT                   /locus_tag="BG0278"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(286964..287728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BG0278"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0275"
FT                   /db_xref="EnsemblGenomes-Gn:BG0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07131"
FT                   /db_xref="GOA:Q661Z0"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Z0"
FT                   /protein_id="AAU07131.1"
FT                   /translation="MRKCFNFFLFFSVTSLSFAQTKSLQAAKGLNFPFLNFENIGGSEI
FT                   AFSLQLLILLTIITLSPAFLVLMTSFLRISIVLDFIRRALSLQQSPPTQIVMGLALFLT
FT                   IFTMWPTFNVIYKQAYLPLKESKINFDEFYNKGIAPLRIFMYKQMSDGRHEEIRLFMSI
FT                   SNYDRPKNFSEVPTHVLIAAFILHELKVAFKMGILIFLPFIVLDIIVASVLMAMGMIML
FT                   PPVMISLPFKLILFVMVDGWTLITSGLIKSFM"
FT   gene            complement(287739..288365)
FT                   /gene="fliZ"
FT                   /locus_tag="BG0279"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(287739..288365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliZ"
FT                   /locus_tag="BG0279"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0276"
FT                   /db_xref="EnsemblGenomes-Gn:BG0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07132"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y9"
FT                   /protein_id="AAU07132.1"
FT                   /translation="MNNKFLFLVFLAFSNFFTYANSQKQVNSVSVDLENESSLPIFEED
FT                   KANLANNVSAQPVSLFNILDLVKIVLFLLIAFFIFFLFKKLIFNSKKSKYEQSSNLIKE
FT                   LVFYEIDVKNSIRIINILDNVYIFLVSSNSSTLLKEIKSEEELEDLKLRLSKINNFAKK
FT                   DSFKSIFKKMLLKKEDIAFSGNDYVKLEKKIETSLKDKQDRLKKF"
FT   gene            complement(288358..288699)
FT                   /gene="fliN"
FT                   /locus_tag="BG0280"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(288358..288699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="BG0280"
FT                   /product="flagellar motor switch protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0277"
FT                   /db_xref="EnsemblGenomes-Gn:BG0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07133"
FT                   /db_xref="GOA:Q661Y8"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y8"
FT                   /protein_id="AAU07133.1"
FT                   /translation="MSVDEKSDGGEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSMQ
FT                   LTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKIVARGEVVVIDENFGVRI
FT                   TEIIKTKNE"
FT   gene            complement(288745..289803)
FT                   /gene="fliM"
FT                   /locus_tag="BG0281"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(288745..289803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BG0281"
FT                   /product="flagellar motor switch protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0278"
FT                   /db_xref="EnsemblGenomes-Gn:BG0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07134"
FT                   /db_xref="GOA:Q661Y7"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y7"
FT                   /protein_id="AAU07134.1"
FT                   /translation="MANNPGALSQDDIDSLLESINSSESLSLDESLSNVISSPTGKKQK
FT                   VKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFI
FT                   RSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIEQSV
FT                   MESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMIILVTLEVKIGKVEG
FT                   LMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDALREKLENTAMPLIAEIGEVKL
FT                   KVREILSLDKGDVLNLESSLINKDLTLKVGTKEKFKCRMGLMGNKVSVQITEKIGDIKG
FT                   FDLLKELTEEVE"
FT   gene            complement(289828..290364)
FT                   /gene="fliL"
FT                   /locus_tag="BG0282"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(289828..290364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="BG0282"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0279"
FT                   /db_xref="EnsemblGenomes-Gn:BG0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07135"
FT                   /db_xref="GOA:Q661Y6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y6"
FT                   /protein_id="AAU07135.1"
FT                   /translation="MPNKDDENLDIGDSNVGRKGGLLPDIIIKILQILAIGIFTVATMI
FT                   IVSYFVSKMVVSQSGAPSDFPVFSNEYLGKPPMLIWYESIDEIRGNTLDVPPKTFVVKL
FT                   ALGYAENNVNILNELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILRNG
FT                   EIKEIALTQIDIFDM"
FT   gene            complement(290412..291194)
FT                   /gene="motB"
FT                   /locus_tag="BG0283"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(290412..291194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BG0283"
FT                   /product="flagellar motor rotation protein B"
FT                   /note="ortholog to Borrelia burgdorferi BB0280"
FT                   /db_xref="EnsemblGenomes-Gn:BG0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07136"
FT                   /db_xref="GOA:Q661Y5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y5"
FT                   /protein_id="AAU07136.1"
FT                   /translation="MALRVKKPSKCDEGTPDYMLTYGDMVTLLLVFFVTMFSLNDIIFQ
FT                   ENVIRIMSASFTGAGFFKGGKTLDFNKLSYLSNSFMSLPSTVRNKQASQTAKNKSMIEF
FT                   IEKIQSKNIMVRQEERGIVISLAADAFFDSASADVKLEDNRDSIQKIASFIGVLSSRGY
FT                   NFKIEGHTDNIDTDVNGPWKSNWELSAARSVNMLEHILNYLDQSNVNSIENKFEVSGFG
FT                   GSRPIATDDTPEGRAYNRRIDILITTDASLSFPKEIAQ"
FT   gene            complement(291194..291976)
FT                   /gene="motA"
FT                   /locus_tag="BG0284"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(291194..291976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BG0284"
FT                   /product="flagellar motor rotation protein A"
FT                   /note="ortholog to Borrelia burgdorferi BB0281"
FT                   /db_xref="EnsemblGenomes-Gn:BG0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07137"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y4"
FT                   /protein_id="AAU07137.1"
FT                   /translation="MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITIVGSFS
FT                   ALMASSEVIAVKKIPTYLGFFFRRNSYAKVSIIKILVELSEKARKEGLLSLDDELEQIN
FT                   DPFFKSGMRLVVDGADPEVIRTMLYLELDQMQERHRVGSELFKTWAKLAPAFGMIGTLI
FT                   GLVALLGNLEDKSALGSSMAVALITTLYGTIMANLMFTPVQLKLEKIDSEEAAVKTMII
FT                   EGVLSIQSGDNPRILEQKLMTFLTPKDRSHLSSSIGGE"
FT   gene            complement(291973..292197)
FT                   /gene="flbD"
FT                   /locus_tag="BG0285"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(291973..292197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbD"
FT                   /locus_tag="BG0285"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0282"
FT                   /db_xref="EnsemblGenomes-Gn:BG0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07138"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y3"
FT                   /protein_id="AAU07138.1"
FT                   /translation="MIFVTKLNGYGYYLNPYHIESIEANPDTTILLMNGKKLIVKEKVE
FT                   EVVNRIKLYRKEVASFEKIVGEGNGSVEL"
FT   gene            complement(292219..293547)
FT                   /gene="flgE"
FT                   /locus_tag="BG0286"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(292219..293547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="BG0286"
FT                   /product="flagellar hook protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0283"
FT                   /db_xref="EnsemblGenomes-Gn:BG0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07139"
FT                   /db_xref="GOA:Q661Y2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y2"
FT                   /protein_id="AAU07139.1"
FT                   /translation="MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDMI
FT                   SQSISGASRPTDSRGGTNPKQVGLGMNVATIDTIHTQGAFQSTQKASDLGVSGNGFFIL
FT                   KEGKNLFYTRAGAFDVDSDRHLVNPANGMRIQGWMARDLEGEKVIHTASDIEDLIIPIG
FT                   DKEGAKSTKNITFACNLDKRLPIIEEGASSADIARGTWVVNKSLYDSFGNVSVLELTVV
FT                   KDLNTPNLWNAPVLINGEQNSNFTIGFDNEGALASLNGQPGQKEDILQIPITFNVVGAN
FT                   VGEVGEQQTVNLKLGTVGSYTDSITQFADSSSTKAIIQDGYGMGYMENYEIDQNGVIVG
FT                   IYSNGIRRDLGKIALASFMNPGGLAKSGDTNFVETSNSGQVRIGETGLAGLGDIRSGVL
FT                   EMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKN"
FT   gene            complement(293552..293995)
FT                   /gene="flgD"
FT                   /locus_tag="BG0287"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(293552..293995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="BG0287"
FT                   /product="flagellar hook assembly protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0284"
FT                   /db_xref="EnsemblGenomes-Gn:BG0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07140"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y1"
FT                   /protein_id="AAU07140.1"
FT                   /translation="MSKMNGIENVSNLTNSSKIKKESDFKIDNVSSKVNLGKDDFLKLL
FT                   ITQLRYQDPTNPMKDKEFISQMAQFSALEQMTNMSKSFEKLSSSLGIRRDLDLLGKVIK
FT                   FQHGDGEVVKGRVTNIKTGTIPQVMVNGNYYVYKNILSVGLEE"
FT   gene            complement(294009..295196)
FT                   /gene="flbC"
FT                   /locus_tag="BG0288"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(294009..295196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbC"
FT                   /locus_tag="BG0288"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0285"
FT                   /db_xref="EnsemblGenomes-Gn:BG0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07141"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Y0"
FT                   /protein_id="AAU07141.1"
FT                   /translation="MSNLLNLSKAYGNKFNLLNTIKGLNLNVSKMESRENASSFFNVMS
FT                   SKSKKIAKAKLMIFDFLNFFKDNGLIAKNSKKSPLDKSFFLKKLDNEAFVSDLKSLIAK
FT                   MNVFLDFEGLNSIKENLSFNFDNFDFLNKEKFFEKIERLCLAFNDLSSFLGFDFLTALI
FT                   DDHYNQISLNDKKEEKNVINIYVKNFKKNNSDHNDFVFSKFSLNTIDGQNFAGRYKVKE
FT                   ISDDSLKGFVEEFANYNIKSSKEADSFDFVSSLKPEWNLKINKNIVDKAKVVLKSNNTG
FT                   EIKLVLKPKELGSIRINLNLDSNNNLLGKIVVDNQNVKMLFDQNMHSLNKMLGESGFNA
FT                   SLNLFLAGENLNSFSKNFKDDSRDQNFHFGYNKFFQIEEEVEFSYDVDKNVNLIV"
FT   gene            complement(295204..295782)
FT                   /gene="flbB"
FT                   /locus_tag="BG0289"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(295204..295782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbB"
FT                   /locus_tag="BG0289"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0286"
FT                   /db_xref="EnsemblGenomes-Gn:BG0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07142"
FT                   /db_xref="GOA:Q661X9"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X9"
FT                   /protein_id="AAU07142.1"
FT                   /translation="MLFLIVILFFFVLFFIDFLGMYNTKRYFPEFIRTKFLGETSLVFD
FT                   HNSNIILDEARLVKEREAIDIKNQQIEKLKEDLKLKEDSLNKLEFELKQKQKDLDLKQK
FT                   VIDDIINKYNDEEANILQAAVYLMNMPPEDAVKRLEDLNPELAISYMRKIEELSKKEGR
FT                   LSIVPYWLSLMDSKKAAVLIRKMSVSSLE"
FT   gene            complement(295814..296245)
FT                   /gene="flbA"
FT                   /locus_tag="BG0290"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(295814..296245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbA"
FT                   /locus_tag="BG0290"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0287"
FT                   /db_xref="EnsemblGenomes-Gn:BG0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07143"
FT                   /db_xref="GOA:Q661X8"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X8"
FT                   /protein_id="AAU07143.1"
FT                   /translation="MNDLNFRKQKLNRILTIRAYHRKLSERNLMNINKKISKINQFSDG
FT                   IPNLLKSLNNFDALSIRGYIDYLNFKKKQNFKILEELRKHYNECYDIYVDKYREEKKIK
FT                   ILIKTLNNSIIKNREKKESLLLDEHVNYKVCQNLRIESE"
FT   gene            complement(296242..297552)
FT                   /gene="fliI"
FT                   /locus_tag="BG0291"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(296242..297552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BG0291"
FT                   /product="flagellum-specific ATP synthase"
FT                   /note="ortholog to Borrelia burgdorferi BB0288"
FT                   /db_xref="EnsemblGenomes-Gn:BG0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07144"
FT                   /db_xref="GOA:Q661X7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X7"
FT                   /protein_id="AAU07144.1"
FT                   /translation="MSNFFENYLRQVDDIETVSFVGRVQKIKGLLVESLGPQCAFGDLC
FT                   LIDQRNNKKVFAEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLNKGLEINLSDELLGRVI
FT                   DSLGRPIDNKGSFLKNRYKELTFEKINPINRSIFEEQILTGVKVLDGFLPVEKGQRVGI
FT                   FSGAGVGKSTLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEERLKKSVLVVSTS
FT                   DESPISRYKGAYVATMIAEYFRDQGKDVALLFDSITRFANAKREMSLSLGEPPVSKGYP
FT                   PSVFVEIPILLERSGFNGNGGSVTGFYTVLVEGDDFTEPVADNIKAVLDGHIILDRDLF
FT                   DRGIYPSINILSSTSRSINRIMNLEKQKLIMKARNLLSIYKDYEDLIRTGIYIKGSNKD
FT                   VDFAISKYPKIIDFISQGINEIFDFENLEDEIREILS"
FT   gene            complement(297571..298491)
FT                   /gene="fliH"
FT                   /locus_tag="BG0292"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(297571..298491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BG0292"
FT                   /product="flagellar assembly protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0289"
FT                   /db_xref="EnsemblGenomes-Gn:BG0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07145"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X6"
FT                   /protein_id="AAU07145.1"
FT                   /translation="MPKVLYKSSEVDNSVKFEFVEIAKPVFESLEIKEKEGKVYDIESR
FT                   IAKLKEELQFLRDEKLRLEEELVKRQELAKEEIQIESERLIEEARIKANEVLEMAKQEA
FT                   DLLQREAIYKKESIEAESNAEIERLSREYEEKLKRDLEVATAKGREEGYNKGYESGFED
FT                   FDKVMRKLHSIIASLIAERKSILESSSGQIVSLVMQIAIKVIKRITDSQKDIVLENVNE
FT                   VLKRVKDKTQITIRVNLDDLDIVRHKKSDFISRFDIIETLEIIEDPNIGKGGCIIETNF
FT                   GEIDARISSQLDKIEEKFKNFSLLS"
FT   gene            complement(298506..299540)
FT                   /gene="fliG-2"
FT                   /locus_tag="BG0293"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(298506..299540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG-2"
FT                   /locus_tag="BG0293"
FT                   /product="flagellar motor switch protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0290"
FT                   /db_xref="EnsemblGenomes-Gn:BG0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07146"
FT                   /db_xref="GOA:Q661X5"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X5"
FT                   /protein_id="AAU07146.1"
FT                   /translation="MEEKKEKEILDVSALTGKQKAAILLVSIGSEISSKVFKYLSQEEI
FT                   ESLTFEIAKLETITSELKDNVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQKAVDI
FT                   INNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSLPTEV
FT                   QTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMADRKTE
FT                   KFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDRSIQRVLREIDGQELAKALKSVDIPV
FT                   QEKIFKNMSKRAASMLKEDMEFLGPTRRKDVEESQQKIVSLIRKLEEQGEIVISRGGEE
FT                   DVLV"
FT   gene            complement(299556..301265)
FT                   /gene="fliF"
FT                   /locus_tag="BG0294"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(299556..301265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="BG0294"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0291"
FT                   /db_xref="EnsemblGenomes-Gn:BG0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07147"
FT                   /db_xref="GOA:Q661X4"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X4"
FT                   /protein_id="AAU07147.1"
FT                   /translation="MSNFFTNFFASAKGIFKKASTVQKIALGLIIFFVILAFVFLIGFS
FT                   TKSQSIALFGVEIKDQYLLDRISQRLDRENVKYFLSSDGRIYLDDEKLAKKMRAILVRE
FT                   ELVPVHMDPWALFDIDRWTITDFERSINLRRSITRAVEQHIVALDDVDAVSVNLVMPEK
FT                   ALFKEAQEPVKASVRITPRPGSDIITNRKKVEGLVKLIQYAIEGLESDNIAIVDNSGTI
FT                   LNDFSNLDGIDRIDLAEKERKLKLKYEAMLRGEIDSALSKVLSIDRFMIARVNVKLDTS
FT                   KETTESKEYAPIELQSQDPKASYNTRKVSDSTIISSQTQKKEYQGQGYSPWGPPGQEGN
FT                   TPPEYQDLSDITGKYNESQEIKNVALNEKKSTSEKEPARIVGVSLGIFVDGVWNFVYDE
FT                   KGDFVIENGMRKREYKPMALEEIKNIEDVLQSSFEYKPERGDSITVRNISFDRMNEFRK
FT                   IDENYFASERFKYFLFIASIMFSLLILAFTIFFAISRELERRRRLREEELAKQAHLRRQ
FT                   QALMDGGDDIGVDDVVGGIREGDELQNNAELLAREKPEDVAKLIRTWLLKNA"
FT   gene            complement(301280..301615)
FT                   /gene="fliE"
FT                   /locus_tag="BG0295"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(301280..301615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BG0295"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0292"
FT                   /db_xref="EnsemblGenomes-Gn:BG0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07148"
FT                   /db_xref="GOA:Q661X3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X3"
FT                   /protein_id="AAU07148.1"
FT                   /translation="MVRIDAFFTENNINLIKKNPLHLDVNFFSSKSSTKNNDAKTFKDV
FT                   LINTITDINKSQLNVSKVMEQVVLSPSSVDVHDFAIALSKANMNLSILKAVVERGIKAY
FT                   QDIINIR"
FT   gene            complement(301627..302085)
FT                   /gene="flgC"
FT                   /locus_tag="BG0296"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(301627..302085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BG0296"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0293"
FT                   /db_xref="EnsemblGenomes-Gn:BG0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07149"
FT                   /db_xref="GOA:Q661X2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X2"
FT                   /protein_id="AAU07149.1"
FT                   /translation="MGLFSSINVASTGLTAQRLRIDVISNNIANVSTSRTPDGGPYRRQ
FT                   RIIFAPRVSNPYWKGPFIPNYLDNGIGQGVRVVNIEKDKSPLKLKYDPTHPDSISFGDK
FT                   KGYVELPNVNLVEEMVDMISASRAYEANSTVVNSSKSMFRSALAILQS"
FT   gene            complement(302109..302516)
FT                   /gene="flgB"
FT                   /locus_tag="BG0297"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(302109..302516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BG0297"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0294"
FT                   /db_xref="EnsemblGenomes-Gn:BG0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07150"
FT                   /db_xref="GOA:Q661X1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X1"
FT                   /protein_id="AAU07150.1"
FT                   /translation="MNDFERSIDFSHRYLDVLSLRQGVISDNIANVDTPNFKRSRISFE
FT                   SELEKAFLNKGKNDLSLIKSSDKHLSGLKNPEYSDVKPHRVLDHFSTMNNNGNNVDIDS
FT                   EIKALVQNQMMYHLMTNIQAHYFKSVNIVLK"
FT   gene            complement(302550..303896)
FT                   /gene="hslU"
FT                   /locus_tag="BG0298"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(302550..303896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BG0298"
FT                   /product="heat shock protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0295"
FT                   /db_xref="EnsemblGenomes-Gn:BG0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07151"
FT                   /db_xref="GOA:Q661X0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661X0"
FT                   /protein_id="AAU07151.1"
FT                   /translation="MNKLEEHYIVPKDVVLELDKYIIGQDEAKKLVSIALVNRYIRSRL
FT                   PKEIKDEVMPKNIIMIGSTGIGKTEIARRLSKLIKAPFIKVEATKYTEVGYVGRDVESM
FT                   VRDLMSIAVNMVKEEMYNTVRDDALVKTEERIVESLFKGSGNSENVDPNEIKAEEKVKE
FT                   KLRKKLRAGELDNTTIEIQISSKMPFSTIEIFTGGNFEEIDMGIGGLLGNIFDRKKKRE
FT                   LKIKKAKEIILAEELEKLVDHENISDIAKSKVENMGIIFIDEIDKIAAKNRSGNDVSRE
FT                   GVQRDILPIMKGSKVNTKYGIVDTSHILFIAAGAFNLAKPSDLIPELQGRFPIKVELKS
FT                   LSIDDLKKILKQTKNSLIKQYVAMFKVYNLDLKFSEEAIDRIAELTFNMNLENENLGAR
FT                   RLHGVMERVLADLFFEVPGSKLKKFEINLDYVNKKIQINEQKDLNYYII"
FT   gene            complement(303889..304437)
FT                   /gene="hslV"
FT                   /locus_tag="BG0299"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(303889..304437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="BG0299"
FT                   /product="heat shock protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0296"
FT                   /db_xref="EnsemblGenomes-Gn:BG0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07152"
FT                   /db_xref="GOA:Q661W9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661W9"
FT                   /protein_id="AAU07152.1"
FT                   /translation="MGFKGTTVIAIKKNGKTVVAADGQVLFGHTVLKSNAIKIRKLLNG
FT                   KILAGFAGSTSDAITLFEKFEEKIKAKGDGLIDIKRAAVDLAKDWRSDKILHKLEAMML
FT                   VADSKNILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAFEVALRSLKIA
FT                   ARVCIYTNSNIVLEEIENE"
FT   gene            complement(304447..304563)
FT                   /locus_tag="BG0300"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(304447..304563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07153"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07153.1"
FT                   /translation="MNIQYVDSNNIEDDPKECCNCKNGSHVLIGDLLKEIYK"
FT   gene            complement(304538..305395)
FT                   /locus_tag="BG0301"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(304538..305395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0301"
FT                   /product="smg protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0297"
FT                   /db_xref="EnsemblGenomes-Gn:BG0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07154"
FT                   /db_xref="GOA:Q661W7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W7"
FT                   /protein_id="AAU07154.1"
FT                   /translation="MMKLLYIDNLKFLKGKEKLKLFNNFDFNDIIKLTQKDIESYLLRS
FT                   FRRSFRLPDLKLVELQEKVIRRTNAKITILGSKSYPNKLKRIYDPPFTIYYKGNLPNSS
FT                   SLSWAIVGSRRTSKALAERTREFSSHLAKNGVEIVSGFAIGADIEAHIAAINENSRTFA
FT                   VIPTDIDNIYPKQNRKYVFKLLEQGGGIISETLSFDKIQNYFFAKRNRLISGLSDAIFI
FT                   TYAPLKSGALITAELGLDLGLDIYVYDLDFCGDGALKFIRFWCSRDKNCKGSLCFIEYS
FT                   ICRL"
FT   gene            complement(305402..306094)
FT                   /locus_tag="BG0302"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(305402..306094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0298"
FT                   /db_xref="EnsemblGenomes-Gn:BG0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07155"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07155.1"
FT                   /translation="MKILSLIILINLFLSCGSESKEKLNLGLRLRELEISGGGSESKIE
FT                   VYKEFIEKEDKNILKIVNSIDKKARFFNLIGLEFFKLGQYGPAIEYFVKNLEINSNNYL
FT                   SHFYIGVASYNLAKNLRVKDEVEKYIILAENSFLKSLSIRDDFKDSLFAISNMYVYDLD
FT                   KQLEAKNYLNKLDDMGEDYFEFFMLRGANYYSLGDLGNAILFYEKASKNASTEEQKEGV
FT                   SRIMSNLK"
FT   gene            complement(306095..307294)
FT                   /gene="ftsZ"
FT                   /locus_tag="BG0303"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(306095..307294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="BG0303"
FT                   /product="cell division protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0299"
FT                   /db_xref="EnsemblGenomes-Gn:BG0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07156"
FT                   /db_xref="GOA:Q661W5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W5"
FT                   /protein_id="AAU07156.1"
FT                   /translation="MKDYNMIDSHTRRFDSTTNPTILKVIGAGGGGSNAVNRMIEYGVR
FT                   DVEFIVANTDLQALQTSIAPIKIALGAKVTAGLGAGGKPEIGQAAAEEDIDVIRNHLSG
FT                   ADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPFKFEGPKKLRLAEQGINNL
FT                   RKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGVQGIAGLIIEHGEVNIDFAD
FT                   VKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEEVRIEGSKGLLVNVTGGDDFS
FT                   LLELEEIMGIITVSVDDEATVIYGHAINSNLEDEIYVTVVATGFASKNQKEILSSPENN
FT                   TLSSKEFDTLMSGNQNVPSGSYEHQDSSFAAKSKNVNYFDEDIDVPTFLRNLNKKSSDD
FT                   "
FT   gene            complement(307316..308557)
FT                   /gene="ftsA"
FT                   /locus_tag="BG0304"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(307316..308557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BG0304"
FT                   /product="cell division protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0300"
FT                   /db_xref="EnsemblGenomes-Gn:BG0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07157"
FT                   /db_xref="GOA:Q661W4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W4"
FT                   /protein_id="AAU07157.1"
FT                   /translation="MSRNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKG
FT                   VLINIEAALDSISNSIEAAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSRTREINE
FT                   EDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSS
FT                   SSSQNLVRCVNRAGFAVDEVVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDG
FT                   SPYYTGVIPIGVNRVTLDIAQVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGT
FT                   RPPQEKSRKELSVIINSRLREIFEIMRAEILKRGLYNKINGGIVLTGGGALFPGISNLI
FT                   EEVFNYPARIGLPMSINGVGEKHIDPKFSSALGLVLYKHEHQKFIKLKKVSSKVKRKNK
FT                   ISSKLKGWFLKEWF"
FT   gene            complement(308557..309300)
FT                   /gene="divIB"
FT                   /locus_tag="BG0305"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(308557..309300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="BG0305"
FT                   /product="cell division protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0301"
FT                   /db_xref="EnsemblGenomes-Gn:BG0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07158"
FT                   /db_xref="GOA:Q661W3"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W3"
FT                   /protein_id="AAU07158.1"
FT                   /translation="MIFERKFLIKYIYFSTSLIFFEIIVIVFASPYFLIRYISINNDTS
FT                   LSKEDIIRISGIKPNTYYHNANARIYEENLKKDLRVKNVKVDLQFPNKINIKIEKRIPV
FT                   AVALENINGNITYYCIASDGVILEKGKHLIYDLPIISGLVLSDNNVGDFLEDRMLNVVR
FT                   SLDYLKINQKYLYNLISEVNFLKLNFYDYNVILYIKSIYNKILITVDMDLMDVMHKVFL
FT                   GVNLLKGKPGVIDLRSGDIILLGEG"
FT   gene            complement(309336..310394)
FT                   /gene="ftsW"
FT                   /locus_tag="BG0306"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(309336..310394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="BG0306"
FT                   /product="cell division protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0302"
FT                   /db_xref="EnsemblGenomes-Gn:BG0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07159"
FT                   /db_xref="GOA:Q661W2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W2"
FT                   /protein_id="AAU07159.1"
FT                   /translation="MLVLLLLVAYGLVVFYTSSFFLSLELTGNPNFLFFTRLNYLFLSF
FT                   IVFLVFERISLNFLKKSIFSVLTITLFLIMATFLSPSISGAKRWIFFQGISIQPSEIFK
FT                   ISFTIYLSAYLSKFDLRKNNGVSYWLKPMLIFAIFWVLIILQNDYSTAIYFAILFFIVL
FT                   FVSNMAFSYVLAIVITFLPVSAIFLMLEPYRVSRIFAFLNPYDDPSGKGYQIIASLNAL
FT                   KSGGILGKGLGMGEVKLGKLPEANSDFIFSVLGEELGFLGVLFAISLFFLFFYFGYFIA
FT                   INSNSRFKFFIAFISSLAIFLQSIMNILIAIGLLPPTGINLPFFSSGGSSIIVTMALSG
FT                   LISNVAKNLSNN"
FT   gene            complement(310437..311492)
FT                   /gene="mraY"
FT                   /locus_tag="BG0307"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(310437..311492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="BG0307"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0303"
FT                   /db_xref="EnsemblGenomes-Gn:BG0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07160"
FT                   /db_xref="GOA:Q661W1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661W1"
FT                   /protein_id="AAU07160.1"
FT                   /translation="MFYLLGLRLLKYITFRMAYATIFAFLLSLIIGPHIILRLKKLRVD
FT                   QVLREDGPKRHLSEKAGIPTMGGILIFFCVFISLVFWSNILNVYFLIMLFVMLGFAFLG
FT                   FIDDFLKIKKKTSDGLKARFKIYGQIIFSFISVGTLYYFGSEHVSMIYFPFIKSFRIDL
FT                   GLFYIPFGMFILISASNSFNLTDGLDGLAIGLSIVITGALIIIAYLTSRADFAAYLHIP
FT                   NIKGSEELVIFLGALLGGSFGFLWFNAYPAKIMMGDTGSLALGAILGMAALIVKSEILF
FT                   SILAGVFIIETMSVIIQVMVYKKTKKRVFKMAPLHHHFEELGWSEMQVVIRFWIIGLIF
FT                   AIIALSTIKIR"
FT   gene            complement(311510..312901)
FT                   /gene="murF"
FT                   /locus_tag="BG0308"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(311510..312901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BG0308"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanine ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0304"
FT                   /db_xref="EnsemblGenomes-Gn:BG0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07161"
FT                   /db_xref="GOA:Q661W0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q661W0"
FT                   /protein_id="AAU07161.1"
FT                   /translation="MRIKIKDILISSKDVKFVGNIKNIEKVVSFYSLDSREIKDDNINV
FT                   SLYFAYRGNKVDGFSFVKYLIDLGVKCFICAREHESECIKYLNDNEGLVFLLTSDVIKL
FT                   LQTLASCLIERTNFKRIAITGSNGKTTTKEMLYSILSKKYKTYKTWGNLNSDIGLPLSI
FT                   LRVEGNEEYAGFEVGGSYIGEMDLLSQILKPEIVIITNISYAHMQAFKELQSIAFEKSK
FT                   IIGKNIEIFVTNEMNDYCIYLEKRAKIANPNVKIVYFDFESLNIKSFSFLEGKFSYDFV
FT                   YKGFEYSILLLGRHNIFNAIGCINLALFLGMREKEIREGLIETAFQKGRAEILTKNGYL
FT                   ILNDSYNGNMGSFIALKNMILDLDIQGKKFMVLGSFKELGEFAYKTHKDLIKEAVSMNF
FT                   DKIFLIGEEFLDVRYSENLVEKRLYYFSEFDKFIDFFLNSLEPSVFIVIKGSRFNRLER
FT                   ILNYI"
FT   gene            complement(312923..313204)
FT                   /locus_tag="BG0309"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(312923..313204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0309"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0305"
FT                   /db_xref="EnsemblGenomes-Gn:BG0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07162"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07162.1"
FT                   /translation="MNSISKIEFEVYCILILILTVIVCFNIYLNFRYVVKLREFNHLDN
FT                   EQENIIDDNLRLLTVIYELENINRIESFSFGELNLEKKANEDINIFAE"
FT   gene            complement(313201..314091)
FT                   /locus_tag="BG0310"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(313201..314091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0306"
FT                   /db_xref="EnsemblGenomes-Gn:BG0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07163"
FT                   /db_xref="GOA:Q661V8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07163.1"
FT                   /translation="MNNNVFHFPVLLDAICKLIEDLPVKSDLIYIDSTLGEGAHAKAIL
FT                   EKYDFLSLVGIERDPQILERAKQFLFAFKGRITYFNDWFDNFFVNYPLNAKANFILVDL
FT                   GISMFHYKGSKKGFSFLEDEPLDMRLCSSSCSISAADIVNTFSKYDLESLIYDLSNEHY
FT                   SRRISKAIVEYRKIKRIETTKELQAVINKVYPFSKAKINPATKTFQALRICVNDELARL
FT                   KRSLPLWIENLAKDGILAIITFHSIEDRIVKDFFRSLSCDLYAKISKKPIIPSFDEIKK
FT                   NKPSRSAKLRALKKI"
FT   gene            complement(314084..314920)
FT                   /locus_tag="BG0311"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(314084..314920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0311"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0307"
FT                   /db_xref="EnsemblGenomes-Gn:BG0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07164"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07164.1"
FT                   /translation="MILIVFVFFFNVLDLYPFLEFRNDEKFALVKDFGVLDNDKLNIGI
FT                   RLKPLEKTVSVFSNNYKILYSKNRLDRDNSILIIFDNDLNLNLEILGGFFYKLGKIFLK
FT                   DEKSVIDLVVNDPSAKKIINPLFVIKNRNNLVAETVYTLGRVFLKGKGDDERLEVFKNI
FT                   NLNVDSGQYSLLLYFHTQKVESFKNSLKGIYYFEAILNNKSIFRSDFQNIFLFNNTYTL
FT                   AQEKNYGLDILNIKKDGGCLKINDLNFIKGKNELKIKYGDVYGNEKKIIYRFKLNE"
FT   gene            complement(314917..315993)
FT                   /locus_tag="BG0312"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(314917..315993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0312"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0308"
FT                   /db_xref="EnsemblGenomes-Gn:BG0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07165"
FT                   /db_xref="GOA:Q661V6"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07165.1"
FT                   /translation="MSFNVEEGTSKFRKLKIFLILSLFLLFIILIDFFIRSTMAVSNFY
FT                   DFKNFENKSDYKNINLSKNVFVSNKVLNLNFRESCYSLLSDNLISSSDYYYVLFNSSKD
FT                   YSVFSVKNNKFLFTLKSKDFVFVINNLIFTLNDFYKTLEIYDFGGNNILVLNFLSSILS
FT                   VDYNNEVLVLGLSNGEIHIYKQGKMIYMENFLERKFPTCFVKLSSDNKYLVSLKGNSEY
FT                   FLEIIDLESDYKKILELNNLTINSFETFIKIDDYNNLFIEVENSLVVINIKSGRIFKVE
FT                   NKISILRASYDYFQNIYRVYFYSESEKIINIKTYSANSFGLFDNVFIRDEISSFVEFGK
FT                   GLLYFNGNNDLKYLGLGQ"
FT   gene            complement(316022..316780)
FT                   /locus_tag="BG0313"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(316022..316780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0313"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0309"
FT                   /db_xref="EnsemblGenomes-Gn:BG0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07166"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07166.1"
FT                   /translation="MDLVDNENYKKILYINNLVLRTLNDIAAIKEINEFTSNAKLSFDL
FT                   IDFNLNVLSYISSLNYYYTRPRLKVNYSIKKILSGLISDFSLVISPVLSITPRELIEIP
FT                   QTLNLNPEERFLIVKKLGYLIDLAKNFSKKDSKTLVFLEDMYLKFIVFSKNIIDFRDFS
FT                   KNLQLESPYYTFQFEHLIKVLELLEEGAFILRGKYELSGSHEFGLHSLGYLEAGRVLAT
FT                   IASQKEAAEKFSRFHGVWSSKFSSDLIKAK"
FT   gene            complement(317096..317935)
FT                   /locus_tag="BG0314"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(317096..317935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0311"
FT                   /db_xref="EnsemblGenomes-Gn:BG0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07167"
FT                   /db_xref="GOA:Q661V4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661V4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07167.1"
FT                   /translation="MKSKALLCINTLKSGAGILGDDIKVYLETKHFVEVVLIDVSKPLL
FT                   SFPRENFLFLITLGGDGTVLLAVNLLLENKNVDIPIISINMGKVGFLADIKIEDFKKVI
FT                   DRFFKNSLVINKKFLLHVTVYKHGKDLISRYALNDIIIRSSLLNKMIHVDLKVNSENFL
FT                   SYKSDGIIVSTPTGSTGYSFSAGGPILEAELEGFLLTPISPHSVYNRSFVFSKLSKLSL
FT                   SFSKEYFIAPASIFLDGINFGSFGVDVVFEFEISSQSLNFVSFCTDTFVKRLKNKLL"
FT   gene            complement(317925..318455)
FT                   /gene="cheW-1"
FT                   /locus_tag="BG0315"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(317925..318455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-1"
FT                   /locus_tag="BG0315"
FT                   /product="purine-binding chemotaxis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0312"
FT                   /db_xref="EnsemblGenomes-Gn:BG0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07168"
FT                   /db_xref="GOA:Q661V3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V3"
FT                   /protein_id="AAU07168.1"
FT                   /translation="MLRKEISEDRKSQLQVAGFKIGKESYGVSIEHIREIIKVPSEGVY
FT                   AIPNVPEYIIGIYNLRGSIIPLVNLNIKFGVPSISVTEEDMLLTGYLIVKIKNKLLGIF
FT                   VDRVLKVISFDDSRIQEPPATLQTLDRKYISGVVKLDDADNLESEYLVLIDIAKIFDKC
FT                   EFDDIPYKDQHEE"
FT   gene            complement(318501..319079)
FT                   /gene="ftsJ"
FT                   /locus_tag="BG0316"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(318501..319079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="BG0316"
FT                   /product="cell division protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0313"
FT                   /db_xref="EnsemblGenomes-Gn:BG0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07169"
FT                   /db_xref="GOA:Q661V2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661V2"
FT                   /protein_id="AAU07169.1"
FT                   /translation="MYHLGDEYSQKAKREGYLARSVYKLIEINEKFSLFSSGNVLDIGA
FT                   SPGSFSQYAYKKLKRGVLVSVDINDISLRYVNNFYFIKGDIFSDDTASKINKFGPYSLV
FT                   ISDVAPKTTGNRLVDTSNSFNLNMRIIDLSFEVLLKKGNLLVKVFQGGDEMQIFKKFEK
FT                   YFKFVKKIRPKAVRKNSFEIYFLGKSFGK"
FT   gene            319130..320173
FT                   /gene="ispB"
FT                   /locus_tag="BG0317"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        319130..320173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="BG0317"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /note="ortholog to Borrelia burgdorferi BB0314"
FT                   /db_xref="EnsemblGenomes-Gn:BG0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07170"
FT                   /db_xref="GOA:Q661V1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V1"
FT                   /protein_id="AAU07170.1"
FT                   /translation="MQNKLFLKNIEKNINSIFSTTNFLNLFKDKDLNFTFKIKKETLDY
FT                   IKFPAIEIINRGGDRIRPMLMILLAYALGLKEKNDRLIYKLSLLLELPHSGSLIIDDIE
FT                   DNSLKRRGRSAIHLIYGIDNSINAGNLIYFLPAKLIERSNLKENQKLLIYENYFTTLSN
FT                   LHLGQGIDIKFHNESYIPSIKEYISLVELKTASLFGMASFLAAIITNNEDKAKKLYSTF
FT                   LKLGVYFQIIDDIKNIKNKINGKEFGDDLIEGKKSLPIIYFLQEKKFEPKIIAKFNQIK
FT                   NAQTTTERKEIFKLTEMINSSKSIRNSTTIALKYLNEFKTELNLYPLKNRYKNILIDIV
FT                   EQIKEGI"
FT   gene            320173..320856
FT                   /locus_tag="BG0318"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        320173..320856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0318"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0315"
FT                   /db_xref="EnsemblGenomes-Gn:BG0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07171"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q661V0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07171.1"
FT                   /translation="MRKTIIIALFYGLITNIYPEIKSTSKLNEQANKYKIEKLYQKSML
FT                   LKNSKKYNKAIANLKKIVNMDQNQVDAHLLLSELEYLNKNWKKAIVKSQDYLKIIDFKD
FT                   KKNFLDISWAYFLIGEVENSMDYIIKFFQSGKELFKENIFIAIDALFKKSIYHFINNEN
FT                   EAFNTILTSTFQLALNDDTLFIIFLNNLEIIKQIPFYYFNRKKLKELYLQISALKTIQN
FT                   TMCKT"
FT   gene            complement(320858..321664)
FT                   /locus_tag="BG0319"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(320858..321664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0319"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0316"
FT                   /db_xref="EnsemblGenomes-Gn:BG0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07172"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U9"
FT                   /protein_id="AAU07172.1"
FT                   /translation="MFGIFEQAIVFSYLALGALYTERIKLLNVSIEGISYLSIFLTSFF
FT                   IYLGYGIFMSTIFTLFISFLFGFFLSFIVKKNYDIFIAGIGINIFCYFFVDYLMKSNFN
FT                   FIPGFTLNLSGNFEIIIFITIFFIFLFITVYVISYSRIRAVFEFISSGNYEDILGEKIS
FT                   NRFKSFAIFVSIFTASLAGSFVAVNLNAYSYNLGLNNGWLAICILYISFSNPLLIFPIS
FT                   FLIVFFEYQFFHTQEYINSYFSLSFPFYVAIIINILVSLIKQKDKS"
FT   gene            complement(321665..322597)
FT                   /locus_tag="BG0320"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(321665..322597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0320"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0317"
FT                   /db_xref="EnsemblGenomes-Gn:BG0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07173"
FT                   /db_xref="GOA:Q661U8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U8"
FT                   /protein_id="AAU07173.1"
FT                   /translation="MTLFRNGLMALISSFLILSISYFFSDFFQFSYIKMISWRFILFLI
FT                   MATGIATCAKSNALNLGNEGQVYFGAFFVYIFSSFFGLTYFNFIYLIFLSSFFVGLLGL
FT                   LPFFITFFFGLNRALTGLLISYGNQRLVDGFILNMLKTGSFSNQTKRINGLFALDSSFI
FT                   YLFLFGMSIWLFYFFIHKKTIYGLQLEILSNKKKIDIFSNINEFKYKFFAVFGSAFLNG
FT                   LAGSIFVVFFKPYLVLGLTSGLGWNSLIVAVISGFNYIYVLFFSLLFSILIEFNNFLNI
FT                   NYDFKYEFIGLCQSIAIFLSLFLIKARKK"
FT   gene            complement(322594..324054)
FT                   /gene="mglA-1"
FT                   /locus_tag="BG0321"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(322594..324054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA-1"
FT                   /locus_tag="BG0321"
FT                   /product="methylgalactoside ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0318"
FT                   /db_xref="EnsemblGenomes-Gn:BG0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07174"
FT                   /db_xref="GOA:Q661U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U7"
FT                   /protein_id="AAU07174.1"
FT                   /translation="MVEFKNIVKYFPDIDKPILDSINLKIGEVKIFTVVGKNGEGKSTL
FT                   AKIIAGLVEFDSGEILVNGIKQKNWNVDKAKNNGIYLVSQVPNLKMNLRVWEYLSIYWF
FT                   GYAFFMPMNKSKTYKYYKWLMQFYNISFNLDKKIKDLNIKEIYFLLIIASLKENAKIII
FT                   FDESAAYFSQKEAQAFIKLLVLLKKSGIASFFITHSEITDAVKFSDEFIVLKDGKCFRT
FT                   INKESILSKLESSSDKTFFANINFNKFEKDSIKFNLFFEDFWKYDVSFSLNKRGVLGII
FT                   GEEATIKTWEKLFLGELIFVGCIKIDGIRYERINIFECKAGFLPLGIGNLFPDNSSILD
FT                   NFLAKFMNFENKIFIRQSYINNIKDFFKKKMEFCSEEKIYRILYSKSLAFSGGTLKKFA
FT                   LYREMYIAKSFLVCFSPLSNLDHKAYNEMSVAIRNYSKEKPVLLITSNLDELLLLSDNI
FT                   LAMKMGEVLLNASREKISKEKLKELLFL"
FT   gene            complement(324054..325106)
FT                   /gene="tpn38b"
FT                   /locus_tag="BG0322"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(324054..325106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn38b"
FT                   /locus_tag="BG0322"
FT                   /product="exported protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0319"
FT                   /db_xref="EnsemblGenomes-Gn:BG0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07175"
FT                   /db_xref="GOA:Q661U6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U6"
FT                   /protein_id="AAU07175.1"
FT                   /translation="MSKNVFFKVFWILFTVFHLYLFVYLIFLKKRKTDVSNKTNIALFI
FT                   PGVISGSPSYKEMYDSLFEFKKKHEDLEIKVLEAGFNQSEWIEMLEKLLNSKKYDFLIT
FT                   TNNAMQDIVDSVSSNYPHTKFLIFDSLVKNTNNQVYSVSYNVAEEAYILGYYVGLFLME
FT                   FIKSGFGNAALIAGQNYPAMRDYIYYYFKKGILDVDVRSEVYYRVLGNWHDSNLAKLLS
FT                   DSLIKDSGALVILPIVGPAVEGVLSSVRENNISAVLFDSEDYLDNKENIIGSGITNQKY
FT                   YVSYILDKALKSEINYGNSDVFGIKHKGVLFNVSNVFYLEQTSQKLKEDLLKKIEEVSA
FT                   NGIKIDLEQN"
FT   gene            complement(325524..326564)
FT                   /locus_tag="BG0323"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(325524..326564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0323"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0322"
FT                   /db_xref="EnsemblGenomes-Gn:BG0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07176"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07176.1"
FT                   /translation="MFSQVAVIKEIEGKVGVIRNTVPVKLDLDDEIFEYDFIEVGENSK
FT                   LKINLYGINGISADLIFYSNTNSLVFYSSFKDLQDAKIYLFRGSLDAVIYNIVKGSSFS
FT                   VIIDNNSFKAENASKFYANSDYFNNFFINVYKGRLRHINKAEYLIFPNTSLLLFNGNSF
FT                   LHKVNEGTLKGVNQNFIRMAKDNFISLNQGFLYFFILKYIEDSFRFNFMYDYLMKDFKF
FT                   NSIYSKWSLEDKNYKLGNRVDMIKNVNYLKGRIGVLFNNFVDLANRFYFVDHIFKSFST
FT                   FLDKSIAANSPISKFLKDYKANKNVLKNKFFKTIHSLKMYLRRSNDDITSNLNVNELHL
FT                   LRPREF"
FT   gene            326853..327983
FT                   /locus_tag="BG0324"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        326853..327983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0324"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0323"
FT                   /db_xref="EnsemblGenomes-Gn:BG0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07177"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07177.1"
FT                   /translation="MNIKNKLILMLCIVVAVSFIACKTPPEARESKNAKIAKPDTKSFE
FT                   LRDIKDIKNEVIKERGHLFYSKEFNEAEKLEEVMKQNFSKKKAKEVNEIALKVLERYKP
FT                   IIKEPREKKEKVNYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKNYDLD
FT                   DALDMYSKAFNRAQQAAKNAKEAKALKETDERMYKQLKALEAASNLPIYSNNKLIKPSP
FT                   WNGRAFIKERNSHLNLLNINEDTYLLGETETPIVLAYAEKLEIAKNSKPQEQFKTLELI
FT                   ERSRKLWEKGVEAKNVKNFRLANELFLESARYLEAYQSNASSELYVIKIGNTLWGISKK
FT                   LYNDPYLWPKNWFGYRQKIQNPDLIHSNWKIIIPAK"
FT   gene            328078..328443
FT                   /locus_tag="BG0325"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        328078..328443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0325"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0324"
FT                   /db_xref="EnsemblGenomes-Gn:BG0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07178"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07178.1"
FT                   /translation="MRKLALLNLILISCYTINLKKLTKETPYGIYLREAQKAINVNDYN
FT                   SALKAYEKMIQNFDHNPNIVATGKYEIAFIYYTINKTEKAKEIFEELIENKAEMPKWIK
FT                   PLAKKILNKMENKNLKK"
FT   gene            complement(328450..329559)
FT                   /locus_tag="BG0326"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(328450..329559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0326"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0325"
FT                   /db_xref="EnsemblGenomes-Gn:BG0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07179"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07179.1"
FT                   /translation="MKKIFFFLFISFYLFGFEDKSLKIDIDDVYVEAHEEGFHLFIRKK
FT                   PSIKSVILTESFEIPDKKKDVATYSFRTLSYNKINGDEIRILNGRVIKNKELLSLTSST
FT                   PVPNKKFGEAFHILIPKKLKYGFPNFSTRSGDIDLEILKSKKEPFWFSIRSFEKKYNDY
FT                   LGRYQDNAYELFFKDTQNQGKIEFNELKDTFTKFSDEVVIANNGIDIVDKIKKILKNSE
FT                   DSVYDLDLVLVVDVTDSMKSNIEILKEHLFSIIEPQLQKFKSYRIGLVFYKDYLEDFLT
FT                   KAFDFNTIPYLNNILKYVSVGGGGDYPEAVFEGIDAAITQFDWRAERRFIIVIGDAPPH
FT                   EYPRGSVVYKDVINSAKEKDITIYGIIFQ"
FT   gene            complement(329610..332414)
FT                   /locus_tag="BG0327"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(329610..332414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0327"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0326"
FT                   /db_xref="EnsemblGenomes-Gn:BG0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07180"
FT                   /db_xref="GOA:Q661U1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07180.1"
FT                   /translation="MPDIDKIKQFKREILDNLSLERLSKESFGVSMDVKVPEPGESIVP
FT                   WISEDLALEENDDDLDLNFMLDALENEDKLPYSDIFNDNLPLSSSDLRVDMDSEFSTLN
FT                   NDFDVSSSDSFENNIDKVLDDNSIDLDIASKLDFDKLINSSEFNSEELINNQDNNNFLE
FT                   SNNDFSVSGDDDFLKSNKSNEINIDATVNDKIPADEQSEMFVGGDLNLGTYDNDFENVA
FT                   DDFKFLEYSQNTNSKRFEFKVNYPLFLKHLSSYPRNLRIAIAEALTKENVSKYKLEALI
FT                   DLVEKNKKGLKFIAKFVGDIVGRSIKLPLIYFKAEEFSKLQQKLSYRISRALLPLIKIA
FT                   SLFVVLVLVSLYFIVDVVFFYVASEGKYKEGIESIYANKRELAKAIFRDAYYIRPDDKW
FT                   FLNYAKAFEEIRDFDSAEEKYEELFTIEPFSKNSTSRRRKKFNKEGYIAYASMKISLGE
FT                   YSQANSILDEVISYDLYDYDALVLKGDNYFKWAKTNSNYYKDSINSYTVALSKYGQKKE
FT                   ILFKLFNAYIEADLDTESDNVNNFIKSNEILDVDEVVYTKYAKKLVDKYISFVTYNQRA
FT                   NNLAINLNYLNGQTNLLNKEFSDFKRNDSRTIFKLDNNVNMNSEIEYILRKILNKNPNY
FT                   DKALFESGRYSYYIGDFKKAEVYLLKALNSFRQKNSIEDAEDKILAYKILADIYEKSKD
FT                   SLRASNIIGLALNDYSFYKKHNLIQGSKEISSIYEKQGDILRSLNDFKSAISSYKLAIN
FT                   EGVDYPDVYYKVGLLSYRENNYDDALKYLFKVESMAGFSSSNEVLNSIALTLYKIGDFL
FT                   ASRSYYLRVMQNLELEKANVLNFNPKENDYHKILLLKEIETYNNLGVVEVMASFSSIRD
FT                   TKLFNSGLSNLSESAKIFDILNRDEDMIKSVKKDLASLNLRNIFKNSFSKSNVLFYENL
FT                   SEKL"
FT   gene            complement(332438..333331)
FT                   /locus_tag="BG0328"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(332438..333331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0328"
FT                   /product="glycerol-3-phosphate O-acyltransferase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0327"
FT                   /db_xref="EnsemblGenomes-Gn:BG0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07181"
FT                   /db_xref="GOA:Q661U0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q661U0"
FT                   /protein_id="AAU07181.1"
FT                   /translation="MFVQNESFDKYFKDMESDFISQFKSVENVNYLDKSYRNADSNSRK
FT                   LADRMIERLLKSGSTIVGIQNILELYEKAKSGKSSIILMEHYSNFDFPCFQFLLYKMGY
FT                   HEIADHIIPIAGVKLFRDNLFVKTLSLGYNAILVYPPHAFVGVGLEHARQRRVFNANSM
FT                   KYIYEKKNSGYIILIFPTATRYRKGRPETKKIIFEIGNYFKIFDYCLMIGVNGNVLEVS
FT                   EDGDMSHDVFKRDSLIYNADKVMSIAEYRDKILSALKDCQTEITKEVLGLKIAEDLENR
FT                   FNVLHAEGLEVYKKSF"
FT   gene            333722..335293
FT                   /gene="oppA-1"
FT                   /locus_tag="BG0329"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        333722..335293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA-1"
FT                   /locus_tag="BG0329"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0328"
FT                   /db_xref="EnsemblGenomes-Gn:BG0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07182"
FT                   /db_xref="GOA:Q661T9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T9"
FT                   /protein_id="AAU07182.1"
FT                   /translation="MKYIKIALILTIFSLIACTNNGKKEKITFRASNLSEPSSLDPQLS
FT                   TDLYGSNIITNLFLGLAVKDSQTGRYKPGLAKSWDISGKGTIYTFTLREDIVWSDGVAI
FT                   TAEEIKKSYLRILNKKTAALYANLVKSTIKNAQEYFDETVPESELGIKAIDSKTLEITL
FT                   TSPKPYFPDMLTNSAYIPVPIHIVEKYGENWTNPENIVVNGAYKLKERLINDKIVIEKN
FT                   EKYYNAKNVEIDEVIFYPIEGNVAYNMYINGELDFLQGAEKSNLEEIKIRDDYYSGLKN
FT                   GVAYIAFNTTIKPLDNLKVRQAISLAIDRETLCKIVLKGSSEPTRNLTPKFDDYSYGKN
FT                   LILFDPENAKKLLAEAGYPDGKGFPTLKYKVSGGGQKGAEFLQEQFKKILNIKIEIENE
FT                   EWTTFLGSRRTGNYQISSVGWIGDYFDPLTFLESLFTTENHFFGAYKYSNKEYDALITK
FT                   SNLELDPIKRQDILREAEAIIVEKDFPMAPLSIPKSHYLFRNDKWTGWAPNIAESYLYE
FT                   NIKTKK"
FT   gene            335391..336974
FT                   /gene="oppA-2"
FT                   /locus_tag="BG0330"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        335391..336974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA-2"
FT                   /locus_tag="BG0330"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0329"
FT                   /db_xref="EnsemblGenomes-Gn:BG0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07183"
FT                   /db_xref="GOA:Q661T8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T8"
FT                   /protein_id="AAU07183.1"
FT                   /translation="MKLQKLLFSVIFFLTFLCCNKEEKKEGISFKISLGSEPSSLDPQL
FT                   ADDNVGSKMIDTMFRGLITGDPNTGGNKPGLAKSWDISPDGTVYTFTLREKIIWSDGVA
FT                   ITAEGIRKSYLRILNKETGSNYAEMVKSTIKNGQKYFDGQVSDSELGIRAIDEKTLEIT
FT                   LESPKPYFIDMLVHQSFIPIPIHIAEKYGQSWTSPENIVTSGPFKLKERIPNEKYVVEK
FT                   NDKYYNSNQVEVQEITFYTTNDSSTAYKMYENKELDAIFGSIPPDLIKDLKLRSDYYSS
FT                   AVNAIYFYAFNTHIKPLDNVKVRKALTLAIDRETLTYKVLDNGTTPTRRIAPNFSSYSY
FT                   AKNLELFNPEIAKTLLAEAGYPNGNGFPILKLKYNTSEAHKKICEFIQNQWKKILNIDV
FT                   ELENEEWTTYLNTRSNGNYEIARAGWIGDYADPLTFLSIFTQGYTQFSSHNYSSPEYNE
FT                   LIKKSDLELDPIKRQDILRKAEEIIIEKDFPIAPIYIYGNSYLFRNDKWTGRNTNITER
FT                   FDLSQLKLKK"
FT   gene            337116..338741
FT                   /gene="oppA-3"
FT                   /locus_tag="BG0331"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        337116..338741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA-3"
FT                   /locus_tag="BG0331"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0330"
FT                   /db_xref="EnsemblGenomes-Gn:BG0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07184"
FT                   /db_xref="GOA:Q661T7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T7"
FT                   /protein_id="AAU07184.1"
FT                   /translation="MNFNKAKKIGRKIKIAALIMLAISLITCNNNSEKEKLTFKVYIGG
FT                   APSSLDPHLVDETIGARILEQVFSGLLALNTKTGKLMPGLAKNWEASKDKKTYQFYLRD
FT                   NLFWSDGVSITAEGIKKSFLRILNKETESTHVDMLKSIIKNGQEYFDGKVSDSELGFKA
FT                   IDSKTLEITLTSPKTYFLELLLHHTFMPVPIHVIEKYKENWTNPENMVTSGPFKLKKRL
FT                   PNEKIIFEKNEHYYNAKEVELEELVYITSDNDMTVYNMYKNNEIDAIFNSIPPDIVNEI
FT                   KLQNDYYQHKSNAIYLYSFNTKIKPLDDAKVREALTLAIDRETLTYKVLNDGTVPTREI
FT                   TPDLENYNYGKKLALFDPEKSKKLLTEAGYPNGKGFPTLTLKYNTNETHKKVATFIQNQ
FT                   WKKILNINIMLTNENWPVLTNSRNTGNFEIIRIGRIGEYLDPHTYFTIFTSKNSQLASY
FT                   KYANLEFDKLIKESDFEQDPIKRKNLLRKAESIIIEKDFPAAPIYIYSGHYLFRNDKWT
FT                   GWSPNVSEIYYFFELKSIKNAKRN"
FT   gene            339078..339998
FT                   /gene="oppB-1"
FT                   /locus_tag="BG0332"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        339078..339998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB-1"
FT                   /locus_tag="BG0332"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0332"
FT                   /db_xref="EnsemblGenomes-Gn:BG0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07185"
FT                   /db_xref="GOA:Q661T6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T6"
FT                   /protein_id="AAU07185.1"
FT                   /translation="MLRFTLKKIIGMIPTLLAIVFLCFFVMRMAPGSPFDSEKPIDPQV
FT                   KARLMEKYHLDKPFYIQAFYYILNVLKGDLGPSLKKKDLTVNQYIKLGFPKSLTLGVIS
FT                   LIISLSIGIPIGILAAIYKNTYIDYIIVSIAIFGISIPLFVIGPILQYFFAIKWGLLYT
FT                   SGWITERGGFSNLILPIITLTMPNIAIFSRIIRGSMLEIIQSDFVRTARAKGLSFRKIV
FT                   IKHMLRGAMLPVVSYIGPAFAAIISGSVVIEKIFRIAGMGMFITESALNRDYPVLMGGL
FT                   LVYSIILLISILISDIIYKMLDPRV"
FT   gene            340011..341060
FT                   /gene="oppC-1"
FT                   /locus_tag="BG0333"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        340011..341060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC-1"
FT                   /locus_tag="BG0333"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0333"
FT                   /db_xref="EnsemblGenomes-Gn:BG0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07186"
FT                   /db_xref="GOA:Q661T5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T5"
FT                   /protein_id="AAU07186.1"
FT                   /translation="MNSIEKQNEENSSKSERRAWSRFKENKLAFGSLFVIGFYISIAIL
FT                   RPILPIYKYHTQIVEHSDLPPSFQPAGELWYKKEKKFIERLAKKEKREINENELKKLED
FT                   IKRKIENEVQIIDKKEVKVHKRVYLLGTDNLGRDLLARLIQGSQISLAVGFIGAFLSMI
FT                   IGTILGSIAGFFGGLPDKIITKIIEILYVLPYLLIVIILMAIMERSIIGLFIALAFVSW
FT                   LTVARVVRGQVQSLSSSEFIQAAKTFGATNQRIILKHLIPNSIGMIVIFTTIRVPSFII
FT                   AEAFLSFLGLGISAPMTSWGELVQNGIATFVEYPWKVFIPAIVMTIFLLFMNFLGDGLR
FT                   DAFDPKDSI"
FT   gene            341068..341115
FT                   /locus_tag="BG0334"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        341068..341115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07187"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07187.1"
FT                   /translation="MNGKRKYIRNKKFSN"
FT   gene            341072..341944
FT                   /gene="oppD"
FT                   /locus_tag="BG0335"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        341072..341944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BG0335"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0334"
FT                   /db_xref="EnsemblGenomes-Gn:BG0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07188"
FT                   /db_xref="GOA:Q661T3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T3"
FT                   /protein_id="AAU07188.1"
FT                   /translation="MEKENILEIKNLAIEFRLKHTTIHPVRNINLSVKRGEIRAIVGES
FT                   GSGKSVTSMAILKLLPELTTVYKSGEILFENQDLLKLSEKELLKIRGNKISMIFQDPMT
FT                   SLNPFLRISTQLEETIILHQGLGKKDAKEKAIEMLKTVGVVNAEERIRHFPHQFSGGMR
FT                   QRVMIAMALSCHPSLLIADEPTTALDVTIQEQILLLIKNLSKKFNTSTIFITHDLAVVA
FT                   EICDTVSVMYQGKIVEEGTVEEIFNNPKHPYTIGLLKSILTLEQDPNKKLYSIKENTIN
FT                   ITKTSIEEF"
FT   gene            341945..342916
FT                   /gene="oppF"
FT                   /locus_tag="BG0336"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        341945..342916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BG0336"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0335"
FT                   /db_xref="EnsemblGenomes-Gn:BG0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07189"
FT                   /db_xref="GOA:Q661T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T2"
FT                   /protein_id="AAU07189.1"
FT                   /translation="MSSKKEIILKVENLIQTFTTGEDFLFWKNKQKVNAVNNVSFEVEK
FT                   NKTLGLVGESGCGKSTTLRSIMQLYTPTSGNIYFNGKNITKLSKKELLKTKKDMQMVFQ
FT                   DPHTSLDPRMTIKEIIAEPLEIYNENKILPKTKQEIEQRVTELTDIVGLHKSMLARYPH
FT                   EFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKTLQKEFNLSYLFIS
FT                   HDLAVVKYMSDKIAVMYLGVILELASRETLFSNPIHPYTKMLIASIPEINPEKRKNKNI
FT                   KLDEQTLANIRKIHLSTQAHPKLEEVEKDHFVSKYLFDEMNK"
FT   gene            complement(342930..343685)
FT                   /locus_tag="BG0337"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(342930..343685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0337"
FT                   /product="P26"
FT                   /note="ortholog to Borrelia burgdorferi BB0336"
FT                   /db_xref="EnsemblGenomes-Gn:BG0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07190"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q661T1"
FT                   /protein_id="AAU07190.1"
FT                   /translation="MKESFLYLFIFTALCVNNLFSDDYVIYDFDLSLNEFLEVSTRKGN
FT                   LEPIVDSKRILLFYPPNKEIRKIFAAFDFDHYSKKYLFKKNEYGVFFVKVNIPHGTSNI
FT                   KYRLIVDGVWTNDEYNKNVVYNEDLIPFSKIEVAKEKSSYISLRNPIQSYDNNEIEIFY
FT                   IGRPGQIVTIAGSFNNFNPFLNRLVEKEDNRGIYTIKLKNLPKDRIYYYFIDSGNKVID
FT                   KNNVNRINLYFVEGIDNKIDFEVSYFDHK"
FT   gene            343804..345120
FT                   /gene="eno"
FT                   /locus_tag="BG0338"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        343804..345120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BG0338"
FT                   /product="enolase"
FT                   /note="ortholog to Borrelia burgdorferi BB0337"
FT                   /db_xref="EnsemblGenomes-Gn:BG0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07191"
FT                   /db_xref="GOA:Q661T0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661T0"
FT                   /protein_id="AAU07191.1"
FT                   /translation="MGFHIYEIKARQIIDSRGNPTVEADVILEDGTCGRSAVPSGASTG
FT                   INEAVELRDGDKSVYMGKGVLKAIENIKNIIAPELEGMSALNQVAIDRKMLELDGTPTK
FT                   EKLGANAILAVSMATAKAAAKYLGLKVYQYLGAYKANILPTPMCNIINGGAHSDNSVDF
FT                   QEFMIMPVGAKTFSEAIRMAVEVFHTLKGILNGKGYATSVGDEGGFAPNLKSNEEACEM
FT                   IIEAIKKAGYEPGKDIAIALDPATSELYDPKTKKYVLKWSTKEELTSEQMVEYWSKWVE
FT                   KYPIISIEDGMAEEDWDGWKKLTDKIGHKIQLVGDDLFVTNTSFLKKGIEMGVANSILI
FT                   KVNQIGTLTETFEAVEMAKKAGYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRT
FT                   DRIAKYNQLIRIEEELETTAEYHGKNVFYSIKQKQIKSL"
FT   gene            complement(345172..345582)
FT                   /gene="rpsI"
FT                   /locus_tag="BG0339"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(345172..345582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BG0339"
FT                   /product="ribosomal protein S9"
FT                   /note="ortholog to Borrelia burgdorferi BB0338"
FT                   /db_xref="EnsemblGenomes-Gn:BG0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07192"
FT                   /db_xref="GOA:Q661S9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661S9"
FT                   /protein_id="AAU07192.1"
FT                   /translation="MKKSNFSNVNLSMGTGRRKSSVARVYIREGSGNIRVNNRDFDSYI
FT                   QLENLRTMALSPLVLTNTLGKYDLYINVYGGGISGQSGAIRHGISRALFELDESNKMIL
FT                   RSNGFLTRDSRRVERKKFGQKKARKSFQFSKR"
FT   gene            complement(345579..346043)
FT                   /gene="rplM"
FT                   /locus_tag="BG0340"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(345579..346043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BG0340"
FT                   /product="ribosomal protein L13"
FT                   /note="ortholog to Borrelia burgdorferi BB0339"
FT                   /db_xref="EnsemblGenomes-Gn:BG0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07193"
FT                   /db_xref="GOA:Q661S8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661S8"
FT                   /protein_id="AAU07193.1"
FT                   /translation="MKKITNNVTIWIKPKTVEKKWYLIDAADRVLGKVAVDVVRILRGK
FT                   HKAYYTPHQDLGDNVIIINASKVRLTGKKHQQKLYYRHSRYPGGLYSDTFKTLSERKPC
FT                   APLEIAIKGMLPKGPLGRDLFRNLKVFSGSEHTLKAQNPIKLEANLREVK"
FT   gene            complement(346096..346932)
FT                   /locus_tag="BG0341"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(346096..346932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0341"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0340"
FT                   /db_xref="EnsemblGenomes-Gn:BG0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07194"
FT                   /db_xref="GOA:Q661S7"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07194.1"
FT                   /translation="MKFFYKVYQMYDLSLIDNLPVIKRARFFYLYDINGKRYLDLYLNG
FT                   GKNFLGYRIQGLNRLFKQTMSRGLISPYASVFKNQFINLVFTFFKEAGSVYIFKLEQDA
FT                   KKFLLSLTGKDKVFMPWEKEEGIYEFKVGFRNIKYPMIFNIPLPDFMSVIIVVVDNLSR
FT                   KIEFRDNFDAVTLSLARHTLSKLLFYSKNLNIDFNSFATSLFRVTDRYMFPLYDACYHA
FT                   EIFNEFLKHGYLISPNFSIPSIIPLKFSKGDLDNFKKICFALKDKFIDVLDSDPYK"
FT   gene            complement(346898..348355)
FT                   /gene="gatB"
FT                   /locus_tag="BG0342"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(346898..348355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BG0342"
FT                   /product="Glu-tRNA(Gln) amidotransferase, subunit B"
FT                   /note="ortholog to Borrelia burgdorferi BB0341"
FT                   /db_xref="EnsemblGenomes-Gn:BG0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07195"
FT                   /db_xref="GOA:Q661S6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661S6"
FT                   /protein_id="AAU07195.1"
FT                   /translation="MEYKLVIGLEIHIQLGLRTKAFCGCKNEFGGVPNSRICPICLGLP
FT                   GSLPSVNVELINSAILAGHATNSNIRHVVKFDRKHYYYPDLPKGYQISQNDKPICERGS
FT                   LLIETSSGLKKINIIRIHMEEDSGKSLHLLDSENQSYIDFNRSGAPLLEIVSAPDISSG
FT                   DEAVAFLTSLREIFRYLDLSECNMENGSFRCDVNVNLIITESGVEHKTPIAEIKNLNSF
FT                   KSIKAAIEYEELRQKEEWVQFRKTLDSCGKHTRGFDDKNGVTVVQRDKETVSDYRYFQE
FT                   PDLPLIEIDDFYIANIKKIKLIEFPFDARVRLKDQYGLSDFDVITLTTDKHLLRYFEEA
FT                   AINASDPKKVANWILSEVLSVLNDKGISVLEFNLFPSYITELVEFIVAGKISGKMAKKV
FT                   FLEMMSREVPASVIISENQLEQISDKFVIRQIVFEVLNENPKSIELYKKGKDHAIKFMM
FT                   GQIMKKSSGKINPILANEILLQSLSNV"
FT   gene            complement(348345..349790)
FT                   /gene="gatA"
FT                   /locus_tag="BG0343"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(348345..349790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BG0343"
FT                   /product="Glu-tRNA(Gln) amidotransferase, subunit A"
FT                   /note="ortholog to Borrelia burgdorferi BB0342"
FT                   /db_xref="EnsemblGenomes-Gn:BG0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07196"
FT                   /db_xref="GOA:Q661S5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661S5"
FT                   /protein_id="AAU07196.1"
FT                   /translation="MDLSNLTLTKIQELVLTKKCKIYDILLAYKNNYELNKDINGYIEF
FT                   FDDSLDIAKRYDDCLKNCELEDLPLIGMPIAVKDNISIQDKSLTCASEILKGYISPYDA
FT                   TVIKRLKNKGAILIGKTNMDEFAMGSTGEFSCYGATLNPLNREYVIGGSSGGSAAVVAS
FT                   FQAPFSLGSDTGGSVRLPASFSGILGFKPSYGGLSRYGLASYASSFDQIGFFSHSIEDI
FT                   ALILKHTCGADKMDSTSVDIFDDFYPLKTEPLQGKNLALIKELSEDLMDKNVASSFAKF
FT                   KFDLLSKGANIKEVSIEEINFILSIYYTISPVEASSNLARYTGLCYGKRISENLSLNDF
FT                   YFKHRSNFLSEEVKRRIILGNYLLSEGYDAKYYAKACEILQNLIIPKFNKLFESCDFII
FT                   TPTSFVKPFRVGLDFDDPVKMYYSDICTVIANLIGAPAISLPYSKDKEGLSIGMQIIGR
FT                   SKKDFELLSFSKNVIRELGLNGI"
FT   gene            complement(349801..350076)
FT                   /gene="gatC"
FT                   /locus_tag="BG0344"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(349801..350076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BG0344"
FT                   /product="Glu-tRNA(Gln) amidotransferase, subunit C"
FT                   /note="ortholog to Borrelia burgdorferi BB0343"
FT                   /db_xref="EnsemblGenomes-Gn:BG0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07197"
FT                   /db_xref="GOA:Q661S4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S4"
FT                   /protein_id="AAU07197.1"
FT                   /translation="MEDIHLENSLKLSLVTLSRDNEDKFISKFEKVIKLVNEISNFEVK
FT                   VNFNANKKKISTLREDKVRCSLSIESIKKLSNSFLDGYFSSPKILE"
FT   gene            complement(350086..352182)
FT                   /gene="uvrD"
FT                   /locus_tag="BG0345"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(350086..352182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="BG0345"
FT                   /product="DNA helicase"
FT                   /note="ortholog to Borrelia burgdorferi BB0344"
FT                   /db_xref="EnsemblGenomes-Gn:BG0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07198"
FT                   /db_xref="GOA:Q661S3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S3"
FT                   /protein_id="AAU07198.1"
FT                   /translation="MDKIKNFFSSLNSSQEKIVFSKSKNPILVLAGPGSGKTRVIIAKI
FT                   VYLIKNMNINPNEILALTFTNKAANEMNDRINDLLKFDKKLHIQTFHSFGSWLLRAYYN
FT                   DFDRNYDSNFTIWDTNDVVKFVKEINLAPNFEMAKHIAALILKDKEHFFLEKFIKFTEK
FT                   EYEYIKIYEEEKAKNNAFDFADLIIKPILMLRHSKSLKESVQSKFKVIFVDEYQDTNYS
FT                   QFLFLKELYSDGMYFMVVGDEDQSIYSFRGARIENILEFEKTFDNVIKFYLVQNYRSNS
FT                   NIVSIANGVISKNKNRYEKQITTQNGSGKRMKFLVFQSTSDEAEYFSNLLVANDIETAI
FT                   LYRFNSQSFHFETSFLKKNIPYKVLGSIKFYEREEIKDIVCLLRLLINKKDKIAFLRMI
FT                   NKPSRGIGKTTLDKIISFLNDDDVNFNLFCASKKTLSSLKNRAKESLLLVLNIYDKLVR
FT                   KLFEGNYINLSAFIEDVVIKFGLLDYYKKFDKDEKLRNIDELINSGIEYSGTFEGLAIF
FT                   LENSSLSPLISGDFKSNIFLSSIHGVKGLEFDRVVISGLEKGLLPAEIEALSEDRLEEE
FT                   RRLFYVAITRAKSELIIALNLKRAFRGFFKSTELSVVFQDIDKNFYDTIFIPEYLKENF
FT                   NNFFIDSKRDVGFNIGDYIIYNGERGMIIDSWYQGNSQFVKISLINGKKAILSYEYIKR
FT                   IIKV"
FT   gene            complement(352185..353384)
FT                   /locus_tag="BG0346"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(352185..353384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0346"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0345"
FT                   /db_xref="EnsemblGenomes-Gn:BG0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07199"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07199.1"
FT                   /translation="MEENDFIKFGSYLRKVRNGKNLTLEMVAEDIKISIKYLKALEDSN
FT                   IEIFPNEVLAVGFLRTYSEYLDIDSRLISTLFKDYKSKLNNSYIGIRSEDKISNLGFLS
FT                   DNKVLDKKLFFLNLESLSILKILLGIVGVILLLFVFFAFREVEVYFKKFFKLSQNEKII
FT                   SNLHEVSFDKKNFWNISLKEGDSLFLTYGDNIAKYRASFISDDLVIVDESKKSKNIFNL
FT                   GEFKEINLDDNIRVKIIYENYYYDKSKIANVSLESFALNVKYVSETNIDNRFNILNWQF
FT                   DVKGTEKLPSGDYLTLYSSQKLSNVDLKIDFLNDTFFRYADENNLHGKSFFASKGIPIN
FT                   LAFEKSLILFFSRLSDVNIILNERDITPFLKEQGKEIFAVQFFWVKTPSGFDLKVSEVY
FT                   "
FT   gene            complement(353395..354045)
FT                   /locus_tag="BG0347"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(353395..354045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0347"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0346"
FT                   /db_xref="EnsemblGenomes-Gn:BG0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07200"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07200.1"
FT                   /translation="MIKTMLLLVLYPVAVFAQISANQYFEGIYAKYQNIEDMQATINFT
FT                   LKGLKQTGILLYKFPDKFIINLDSNNQVFVSDGEFLTVYVPSLGTSFNQQLLKGSSGGG
FT                   LMKVLNSEYSVSYTNSPNLEALDSSEPGKYIKLTFSRKLYKGAATINSFIIAFTPDGII
FT                   RRITAYPTSGGREIVIDLIAVKFNIGILDSKFKYDPPKSSNKVDNFLYDIKKN"
FT   gene            354239..355657
FT                   /locus_tag="BG0348"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        354239..355657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0348"
FT                   /product="fibronectin/fibrinogen-binding protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0347"
FT                   /db_xref="EnsemblGenomes-Gn:BG0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07201"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q661S0"
FT                   /protein_id="AAU07201.1"
FT                   /translation="MSLNYVEINTLIKEIPFANSLIKEIIQPDYKSLILEIYNKIDNKK
FT                   FKILISLNPSTTRFHITRKNFKKNALKLRFSDFLKSKIQNGKILKASQMKNERIIYLEI
FT                   FKKDIIILFIKLWPSSPNIIATNQNFKILDAYYRRPKAKETTGETFLKAKEIHESNKMP
FT                   DKKIMGLKEEYDNTSHKSYSEFLENYYESLSNQIKKNNIKELLIEKYKKELIALEKRIG
FT                   SLKQQIKLIKNIENEKEKGELILLNINKIQKGIKEIALLNYKEEKIKISLNQSLSPKEN
FT                   ALQYFKAYKKGKNSFETIQNQLKDNLDKFNLIKSKINMLKIKNFIPKEEYNQEETAIKK
FT                   KEKTPKIGLHFTSCGFEILIGRNAKENDELLRRCVKGNDYWLHTRDYPGAYVFIRNQKN
FT                   KTPCLDVLLAAGNLCVFYTKLAKKSGKADLYYTQVKNLRRVKNGKLGLVIPKAEKNLHI
FT                   KLDEDLIKKIKNKT"
FT   gene            355755..357188
FT                   /gene="pyk"
FT                   /locus_tag="BG0349"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        355755..357188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="BG0349"
FT                   /product="pyruvate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0348"
FT                   /db_xref="EnsemblGenomes-Gn:BG0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07202"
FT                   /db_xref="GOA:Q661R9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R9"
FT                   /protein_id="AAU07202.1"
FT                   /translation="MISKLTKIVATISDLRCEPEHIKDLYDAGVNVIRLNTAHQSHEDT
FT                   IKVIDNVRKISNKIALMIDTKGPEVRTANIENPIIVKTGDNVIISTSPINEPNNLQTNY
FT                   DGFVKEVPQGSKVLIDDGELEMTVVTKLPDRLICEIKNDGQIKNKKSINTPGISLKLQS
FT                   VTEKDKGFIELAAKYNVDFIAHSFVRNSKDIQDVQRILNAAGNPDVKIISKIENQEGID
FT                   NIEEIVKASYGIMVARGDMGVEIPAEDVPIAQLKITQTCIKYGIPVITATQMLHTMIEN
FT                   PRPTRAEVSDIANAILNGTDAIMLSGETAYGKYPIEAVKMMTSIAKKVEKHRKMTLYKD
FT                   ELFYDKSITRNYIIKCAIDATKLMDVKAIIVDSLKGKTARIMATYRASVPLFITTNSER
FT                   LARELSLSYGVYSNLVDNNFKRTTEFVVTSLKMLKEQNIVNDKDTVIIISGNPNRDTDK
FT                   GTEFMEINTVEDAIKGRNI"
FT   gene            357206..357946
FT                   /locus_tag="BG0350"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        357206..357946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0350"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0349"
FT                   /db_xref="EnsemblGenomes-Gn:BG0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07203"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07203.1"
FT                   /translation="MVENIFYSNNTNGLSFKLAEKKTHKAILTNYGNYEFFLKNECLFK
FT                   KIISNQTNNVFIISEAKSNFLINISNHHVWRIFNKNIKVNLKILKLLKILNFINIDDKL
FT                   IENDHKIEITLNFISNIKQNIKIIPIIFGKICNTHLLQFCEFLTPFINEEENSFIFLSY
FT                   FISKSTNIKKTLRLEENLKRIFLEEKPPNLNIILESYKSKKIFPENINAIMAISSLFKN
FT                   FEFKDSKITTDPPEYLISSSILIK"
FT   gene            complement(357965..358243)
FT                   /gene="rpmB"
FT                   /locus_tag="BG0351"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(357965..358243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BG0351"
FT                   /product="ribosomal protein L28"
FT                   /note="ortholog to Borrelia burgdorferi BB0350"
FT                   /db_xref="EnsemblGenomes-Gn:BG0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07204"
FT                   /db_xref="GOA:Q661R7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661R7"
FT                   /protein_id="AAU07204.1"
FT                   /translation="MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVN
FT                   LINKKFFIPELGRSINIKVSANALRSISKVGLDAFLKKNCKKIENFL"
FT   gene            complement(358265..359827)
FT                   /locus_tag="BG0352"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(358265..359827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0352"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0351"
FT                   /db_xref="EnsemblGenomes-Gn:BG0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07205"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07205.1"
FT                   /translation="MNLGLFDFILSMFSINKELTSEQIKQKRLKEVKISLSRASNFFNA
FT                   SKIHALPQFSRFLYNFYKIFSPLRPFVQRYKNSNKIVHFVVEKYLNESQKKSLDYIYSF
FT                   SASDNINLTPDLPKNLHNNLSYLFKNITQEQIKLIDETYGALHNFFDLVLYQYYLVLKN
FT                   FDNLLPEDDFVYRPRFSSIGCGVIIDDLKDLLECISCIKNISIWKNLYDIILEIYGNKE
FT                   DFPIKSNVWIKIVSSILDINKSKEILYLIRYVSGDPDYFPISIGQKPNPVARIFFNDLT
FT                   KHVANEIEKIKVLQKNSKSKILAEQLFPGISFLNLDNYNEKMNEKIVSKIMSTTGYIYC
FT                   ELLVYLRTYTIYFVKKDLNDIINLLIIKGQWKLIELSREMSNDMHALINIYASLIDFDS
FT                   SLGEQGGYGNRINALLHRASVGDKSSEKLLLNIIADVNKKAFTISSEYYSKIYSIEQRL
FT                   QDCLSDYSKASLERELIYNWKELDVDLAKSYGNNLNFGGIMKSILGSLALFLKLMDLYL
FT                   EKK"
FT   gene            359950..361071
FT                   /locus_tag="BG0353"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        359950..361071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0353"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0352"
FT                   /db_xref="EnsemblGenomes-Gn:BG0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07206"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07206.1"
FT                   /translation="MRIKNLILIAILLISTSCAKNKNIIVLTDNKTIPFYINQFNIENK
FT                   LDFIIKFRNNIDLQTVEKDNAQIIISKNIGNTNIINYFKSIKINYNTDYPILKNIFKQF
FT                   NYKIIPLSFDIPILIYKNTHHVKKYINNKYLKEEYENFIKDGKFFISPYISENLFYVIS
FT                   EINDVGFSFEKNKLNYNENKILKMLEYFSSFLNAKQMDLQKDFFNKYGYLKLNKILLNK
FT                   KSLLITGLSDLTFYNSLSEQEKAQIKFSYLINNNNEIVISNPNFIGTLETSILTKKFIN
FT                   WILDKKTQKNLIGFNNQFQSNICFGFANGFTPYKKLNLKIKHSIDGISPFIIDETQINS
FT                   YSYVLSKKTIEKENLLINEWFFSRIKNQKKNKN"
FT   gene            complement(361068..362867)
FT                   /locus_tag="BG0354"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(361068..362867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0354"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0353"
FT                   /db_xref="EnsemblGenomes-Gn:BG0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07207"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07207.1"
FT                   /translation="MKREIYAFLSNFIIFLCFFLGLIFSYSYFFGENFLEKHRLIAAFF
FT                   DSILLFYKYFYGFFIFIVCIYFAFFVQQEIKIYLKSYNGYLFSRLYAFLLLFFIIGLFF
FT                   TFIFNLILPYIIAQRNEYKFSYDRYNLLESEANEISLKIKNIDISLSSNRLFLSTDLSD
FT                   SMKQKRKHLENLIRIYDKMRIIYVNNEELLTNYYLVKSEYNKIPSYDVDLEKVKKTFSR
FT                   YPLRSLKKQDFFNIVNEFISQNDYHTANYFAYIAYVATKDDNFVALLNLTLKFINENRN
FT                   FEKEKMQLISEEKQKNFLYLNTEKFKLAYYGFSNLHKLLPSDNEILNYKNKSLEKLRKK
FT                   YLFFDEIEKYFEYYGINDVFLLQPDSNKRFYDYIYMQKVVTLNNYSKIIKNFELIRFNK
FT                   AGNVILHIKIPFATLRGNFVYQNVLNKDDEQSEITLTKVFVSVDSFDTNVLEVVKINEN
FT                   VENLALFSNFSEVGFFLKIQSLSSAFNKVAILNLKLINIFSLSLILLISPILLVLMGAF
FT                   FISLFSKIEFNFNSKAMIFLVSLMIAIFSGIICLFVNYFLIVFTSLLIYTFNSVHISLA
FT                   ILSSLLFFLIFKVIVGNYKEKHI"
FT   gene            complement(362880..363830)
FT                   /locus_tag="BG0355"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(362880..363830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0355"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0354"
FT                   /db_xref="EnsemblGenomes-Gn:BG0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07208"
FT                   /db_xref="GOA:Q661R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07208.1"
FT                   /translation="MLDSLRLIFLIIYRFILIFCLFSLMFIFTFYLKYKFLYFNFSIFS
FT                   YSLYYNAYIYSFPLSLVVTFMRIPYPFYGVVLKPPRDTFHFYCIIFILILLFSYLGFLV
FT                   SHSFHFHYINSKSNDNFVLKDEVVHFLNGKIIFSSNRPKFYGFNGVLIVAEDDKKDKSF
FT                   SYQSNLSYSNKIDLIDKNFLEQKIYNSFVDFLFRDLKILNNFLLSLNYLNLIFNILGIS
FT                   LLLFAFSYVFNLIFSNSFAIFLYPIFIILFLKIYNVYSIEFPKIYNVIIGKSVISDFIP
FT                   FIFCVLTFFSTYLFGFVSEYIKISKDLDNNLYKVS"
FT   gene            complement(363864..364352)
FT                   /locus_tag="BG0356"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(363864..364352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0356"
FT                   /product="transcription factor, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0355"
FT                   /db_xref="EnsemblGenomes-Gn:BG0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07209"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R2"
FT                   /protein_id="AAU07209.1"
FT                   /translation="MAFLLNQSVVYPMHGVGTIKDIRTKEFNGEIIDYYEIHFPFSDMI
FT                   FMVPVAKVDDFGIRALVSREKVEEVFDVIKEFEGQIDSKKIKDGGHEFYKKSDILDTAK
FT                   LYKFLYKKSTQKELPFYEKRILNDFELILEHEISLALQISFEEAKEKIKNILVDNKKA"
FT   gene            complement(364392..364985)
FT                   /locus_tag="BG0357"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(364392..364985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0357"
FT                   /product="hypothetical protein"
FT                   /note="fused from Borrelia burgdorferi BB0356 and BB0357"
FT                   /db_xref="EnsemblGenomes-Gn:BG0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07210"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07210.1"
FT                   /translation="MANLKDIYSKPDRFYFLGVPIDVFDSRSKLISRFAYLSGHPYHSI
FT                   VIFIGFKAFLKVLIFKKFRNHIKNSSLVFLNSKIVRFFCRIFKRVNIDCYDSNTVLLIL
FT                   MEILENAHKTCYIIDKDKVISKKKFLRLKESHKEISFIGYYDLKAVKRNKEMFFANINK
FT                   LTPSVIISFCNDRYLENLFYKNKFNIRTNLSVFL"
FT   gene            complement(364978..365709)
FT                   /locus_tag="BG0358"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(364978..365709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0358"
FT                   /db_xref="EnsemblGenomes-Gn:BG0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07211"
FT                   /db_xref="GOA:Q661R0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q661R0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07211.1"
FT                   /translation="MKQIVLDANCLAGDFIIVKDMKIYHHLVNVRRLKKGDKLNILLKD
FT                   KESRTSEIVKIGSNFIKFATNKIDKIEKNNFEISIFISSLKGKKIDSVLRQVVEIGVSE
FT                   INIINADHSVSKIDINSTSAKTLRFSKIIDEALKQSGNQIVPKINFYNNFFYLPYSFCT
FT                   TKYYVAHQSGMILSKNESFDNFSKIGIIIGPEGCFSKPEIAFFKEKGFNFVRFNTPVLR
FT                   ADTAIIYSLAYFKALLGDYNG"
FT   gene            complement(365713..367143)
FT                   /gene="ctp"
FT                   /locus_tag="BG0359"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(365713..367143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="BG0359"
FT                   /product="carboxyl-terminal protease"
FT                   /note="ortholog to Borrelia burgdorferi BB0359"
FT                   /db_xref="EnsemblGenomes-Gn:BG0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07212"
FT                   /db_xref="GOA:Q661Q9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q9"
FT                   /protein_id="AAU07212.1"
FT                   /translation="MKNKFLICAYFLLTLSISSLVIVESIFAVDESNNNKLSRSSYEQM
FT                   MIQAFEFVKENYVEPVNDEVIFEGALKGIFQALGDPYSQYLTKKDLEEISKTTVGDYVG
FT                   IGISIIKKMHSQDKQDKAKNLDSNSFCVSIVTPFEGGPAYKAGIKSGDCIIAVDGKSVS
FT                   SMEVDQVVDRLKGKEGTKVKVSILRGKDLTLDFELTREKIEIQTIKYDVINPDIGYIRI
FT                   VSFNPYTSVDFSKALDNLKNRNIKSLILDLRLNTGGYFQAAIKMADDILSKGTIVSTKS
FT                   RNSSKPIDYKASSKQVLPSDIKIVALIDRSSASASEVFVGALKDNKRAYIIGEKSYGKG
FT                   VIQHVVPFYTGGFKITSSKYYTPSGKSIHKVGIEPDLEIKSPDFSEEEAVIYKEIFDKK
FT                   LIEGFLKGKKSITEQEIDFFVENLVKENPKYKIDKEFLGKYVFFNYYQDNNKELPIYNL
FT                   HYDKVLKAACEYLSKLGN"
FT   gene            367637..368779
FT                   /gene="ylxH-2"
FT                   /locus_tag="BG0360"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        367637..368779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylxH-2"
FT                   /locus_tag="BG0360"
FT                   /product="minD-related ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0361"
FT                   /db_xref="EnsemblGenomes-Gn:BG0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07213"
FT                   /db_xref="GOA:Q661Q8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q8"
FT                   /protein_id="AAU07213.1"
FT                   /translation="MIIIPVASGKGGVGKSLFSANIAICLANEGKSVLLVDLDLGASNL
FT                   HSMLNITPKKSIGTFLKTKINFSDIIIKSGIKNLNFIAGDSDIPELANITASQKKTIIK
FT                   NLKALEYDYLVIDLGAGTTFNIIDFFLMSKRGVIVTTPTVTATMNAYLFLKNIIFRLLS
FT                   SVFKRGTKGNEILKTIKQNSIDLQRVYIPNLLLKLESEDPENYSTFNKLFKKISPFMIF
FT                   NMLKTPNDIGKTEKIIKSAKNYLSINLQSIGAIYKDEMVDQALNNKIPITIYKPTSLTS
FT                   KSIKKIAKKLIEIEDLTNDAELLNEEDLNESYDFVLREAQEEYIEKIEYLESLIKNKTI
FT                   ESSEIIDIIKSQKREIETLRKQNMLFKKKLFEKFEKAKEV"
FT   gene            368779..369765
FT                   /gene="lgt"
FT                   /locus_tag="BG0361"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        368779..369765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="BG0361"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0362"
FT                   /db_xref="EnsemblGenomes-Gn:BG0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07214"
FT                   /db_xref="GOA:Q661Q7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661Q7"
FT                   /protein_id="AAU07214.1"
FT                   /translation="MPNYINYPSWLHPEVIQGIPITWYSLSYIFIILISYKFIWYQIQS
FT                   DRIDIKKEDYETFMFSLVLGAILGGRLASTLVYDKSGIYYSHPWLIFLPFDQNWNFTGF
FT                   RGMAIHGGFLGAIIAPLIIINTKLKNTNVKKYFLKLTDYGSIAFSSGYILGRLANFANA
FT                   ELYGRVMKGGIIFPNAEPFDTNTPGVKEFASSIGLEILPHDLLINLPRIPSQLIEGFFE
FT                   GPVTCMLLWFLFRKIKKYDGFIFGIYVMLYAFFRFFIEYLREPDKDLGFIINYKPIKSL
FT                   SEFSFLNISMGQILSLVLMFSGLIWVVVTKKIADKKIKNNTNLAYKN"
FT   gene            369786..371798
FT                   /locus_tag="BG0362"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        369786..371798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0362"
FT                   /product="periplasmic protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0363"
FT                   /db_xref="EnsemblGenomes-Gn:BG0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07215"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q6"
FT                   /protein_id="AAU07215.1"
FT                   /translation="MKGVNNYKNINSIVISKNEIDVRDLIKLKSIFNLIQIVKSEKALY
FT                   SEYVKQNNIKFAIIYNHEKPIDFSINVANELKNINKIHSIIISNEKFDEEYLKLNHIEI
FT                   IKDISELEYKKSLIHQKKLFCDNQNSTLDFFLNLSELIKEIVIITNTENEIIYINEKGS
FT                   KNLNLPMKTSGNKIKVTDIDIRDWEKLKKIDLSCHTNSIPEFKNILITNCILTLKNNKK
FT                   LYVDVFISTIDQNNIDKLITIKEIPNLNEIENYKYLEIIDSQDEIQNAKEIEKLLVNHV
FT                   DIYKKKRIYLLNLDLFLTTEYEYKEDKEKLNIKILKIMYSKIMSLYSEYIFKLKNNNLI
FT                   VIICTSGDENQIISIAKKIKKTITLALKKEDIIIFEFNIGIIEVNLRENLELKIPKLMM
FT                   ATKISSEYKDSNPIIYKEELPEAVILKNQNKIFQYILKAIKNDFFTLYYQKINPLKKNL
FT                   KPKIEILTRLFDHMGKPIPNEQIFNLIDKYNLTAEVDQLVVKKALREYKSFVSKNGVHI
FT                   FSINISPYSLKSQNFRIFLRDTLLKSQIPLQNICLEITETGILENFEIINKYFQELKSF
FT                   GIKLALDDFGSGHTSLSYIKTLPIDLLKIDGSFIKAINSSEIDYVIIKSIKKIADTKNI
FT                   KIIAEFVYNEEILKKINELEIDYGQGFLWHKPEPI"
FT   gene            371893..372273
FT                   /locus_tag="BG0363"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        371893..372273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0364"
FT                   /db_xref="EnsemblGenomes-Gn:BG0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07216"
FT                   /db_xref="GOA:Q661Q5"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07216.1"
FT                   /translation="MEKKIALIAHDKKKDDLVNFVKQNYLFLSKFKLIATGTTGSRIQQ
FT                   ATDLTIIKYKSGPMGGDQQIGAEVAEGNVLAIFFFRDPLTNQPHEPDVSALIRLCDVHN
FT                   IPLATNVKTAEILIKGFEGLNT"
FT   gene            complement(372327..372914)
FT                   /locus_tag="BG0364"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(372327..372914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0364"
FT                   /product="lipoprotein LA7"
FT                   /note="ortholog to Borrelia burgdorferi BB0365"
FT                   /db_xref="EnsemblGenomes-Gn:BG0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07217"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q4"
FT                   /protein_id="AAU07217.1"
FT                   /translation="MYKNGFLKNYLMGFLFFLIIACTSKDSSNEYVEEQEVDNTSKLDD
FT                   TSKIDEHTIGHVFHAMGVVHSKNDRKSLGENIKVFYFSEKDGYFETIPSKEDAKLIVYF
FT                   YDNIYAGEAPIKISGKEAFIFVGITSDFKKIINSNLHGAKSDLIGTFRDLNIKNSKLEV
FT                   TVDENNSDAKTFLESVNYIIDGIEKISPMMMN"
FT   gene            373038..374414
FT                   /gene="yscI"
FT                   /locus_tag="BG0365"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        373038..374414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yscI"
FT                   /locus_tag="BG0365"
FT                   /product="aminopeptidase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0366"
FT                   /db_xref="EnsemblGenomes-Gn:BG0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07218"
FT                   /db_xref="GOA:Q661Q3"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR022983"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661Q3"
FT                   /protein_id="AAU07218.1"
FT                   /translation="MKKQNPWISLSEEEKNQIFNFSESYKKFISKFKTEREVTSYALDK
FT                   AKKRGFIDAEEKKNLIPGDKIFYTCREKSVAFAIIGKNPIENGMNLIVSHTDSPRLDAK
FT                   PSPISEENELAFLKTNYYGGIKKYQWLSTPLSIRGVVFLKNGEKVEINIGDNENDPVFV
FT                   IPDILPHLDKKIQRNKKSDEIIEGENLKILIGSLPIESKEQDKVKLGTLQLIKEKYKIE
FT                   EEDFVSSEIEIVPAGTAKDVGFDKALIGAYGQDDKICAYASLEAIFDLEEIPSKTAICF
FT                   LVDKEEIGSTGSTGLDSRYLEYFVSDMIFKIKKSEYNNLQVQKALWNSKSISADVCAAI
FT                   NPIFNSVHDAQNAPKLGYGIPIMKYTGHGGKVMASDADAELVSYIRQLLNKNNIAWQVA
FT                   TLGKVEEGGGGTVAKFLASYGIRTIDMGPAVISMHSPMEITSKFDLYNAYLAYKAFYKE
FT                   "
FT   gene            374421..374699
FT                   /locus_tag="BG0366"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        374421..374699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0366"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0367"
FT                   /db_xref="EnsemblGenomes-Gn:BG0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07219"
FT                   /db_xref="GOA:Q661Q2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07219.1"
FT                   /translation="MADIEKTNKIKVAEHIVECFGGIKNIKNISKDITRIKILVDSNSL
FT                   VKRDDLTKNDNIIGTIKSNELTEIVMNFEIIEDVYNKILYMMNDQKQ"
FT   gene            complement(374725..375780)
FT                   /gene="gpsA"
FT                   /locus_tag="BG0367"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(374725..375780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BG0367"
FT                   /product="glycerol-3-phosphate dehydrogenase, NAD(P)+"
FT                   /note="ortholog to Borrelia burgdorferi BB0368"
FT                   /db_xref="EnsemblGenomes-Gn:BG0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07220"
FT                   /db_xref="GOA:Q661Q1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q1"
FT                   /protein_id="AAU07220.1"
FT                   /translation="MKISVIGAGAWGTAIAKSLADKFDFNIFLWSFEEDVKNGINNDNV
FT                   NDKYLKGIKLPKNLVASSDLFEVVSMSDYILISTPSLFTVDIFKKLDQFFDSLELKPKL
FT                   AILTKGFLTFNGKTHTVIEAAEKVIKGYKDEITYIVGPSHAEEVGLGVITGLVAASNSR
FT                   ENAYLFINLFSKTSISLFYSNDVFGVQIAAALKNVFAIAFGILDAYKLNYPNLIGNNTE
FT                   SFLFSISLNNMKDIAIELGGKNVETFLFLSGSGDLDVTCRSMFGRNRRFGNEIVSKNIL
FT                   ESFFSIDDLINNIEKIGYLPEGVFAAKSIFSLLKELNRDFNPNSLLSVIYKILNKELRA
FT                   ESVIDYMRNIG"
FT   gene            complement(375798..378065)
FT                   /gene="clpA"
FT                   /locus_tag="BG0368"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(375798..378065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="BG0368"
FT                   /product="ATP-dependent Clp protease, subunit A"
FT                   /note="ortholog to Borrelia burgdorferi BB0369"
FT                   /db_xref="EnsemblGenomes-Gn:BG0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07221"
FT                   /db_xref="GOA:Q661Q0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q661Q0"
FT                   /protein_id="AAU07221.1"
FT                   /translation="MFFNTFLFFIKSKHLVFTEEHIFYGLIKSDKIKELLNFCTIDFYK
FT                   LNKQLEEFFSKLPLRDNYIPDYVSSMDYLYDDIISVLFVYKKPYKIQEKDLLWVLVKKR
FT                   KNSILDALINSGFNLTIFDKLIEVHDYLAVNTKSDSGYDIELIAEYIHNNVPKSKGGFN
FT                   IFNDNRDKLNQNNTFLEKNDSIGNFLTNIIDALDLKHNPLIGRKRELSRLIQVILRKHK
FT                   SNPILFGEPGVGKTVLIQGLAYKIKIENVPRDLIGYEIYSLDIGRLISGTKYRGDLESR
FT                   INRVLDFLNSRKKVMLFIDEIHMIVGAGATSFGSMDISNLLKPILTLGKIKFIGATTEY
FT                   EYRKFFLKDKALMRRFQSIELKEPDFDDTYNILQEIKKDYERYHNVEYTDEAIRACIIM
FT                   SQKYIKDRFLPDKAFDILDELGSKFKLENRRRVITKDDVCDLIKSVVGSNIFNFEEYDS
FT                   ELLINLENRIKKELIIHDSLVFDLILNIKLLKFNLLANRSTIGIFAFIGPSGAGKCKLT
FT                   DILSEELGIQKFSLNMGEYGDFNSLDRLLGPVLSNEGYYESTRFFNFLNKSSNSIIFLS
FT                   DFDKCNKRILDFFLEGFKTGKLFDGLGKKASLSESLIVISINAESNELNSIGFKNKMTG
FT                   ENDFNLILEKRFPNEFLELIDYVLLFKSIDELDFEKIVFNELNRFARILRDRKFDVFFE
FT                   KSVIDYIREKIYGKGYGLKSIKKFIFKEVGKLLIDEILFKKIENSGKIKIYLDKTIKYE
FT                   FL"
FT   gene            complement(378103..379320)
FT                   /gene="tyrS"
FT                   /locus_tag="BG0369"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(378103..379320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="BG0369"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0370"
FT                   /db_xref="EnsemblGenomes-Gn:BG0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07222"
FT                   /db_xref="GOA:Q661P9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661P9"
FT                   /protein_id="AAU07222.1"
FT                   /translation="MNLALNLLYKRGFLKQCTSLKVLSDLMDREKIVFYAGVDTTSSSL
FT                   HIGHLIPFLAMMHLRQHGHMPIVLIGDSTTKIGDPSGKSEMRKILSSEVINNNALSIKN
FT                   QLQKITRFSSSCFIHNSNWLDNLNYIEFLRDIGIHFSVNRMLSFETYKRRLDFGLSFIE
FT                   FNYQLLQSYDYYMLNKIKNCKLQIGGDDQWGNIVSGVDLIRRKMGVEAFGLTFPLITRS
FT                   DGKKMGKSEKGAVYLDSSLYSIYDFYQYFRNTSDSDVKTFLYLFTFLEEDEIESISNFK
FT                   GNSLNKAKEILAFEITKIVHGEVEALKVQEASFAAFRGSGDRSNIPFFKFSFSGLEEEI
FT                   LLIDLMLDSKIVPSKSEGRRLINSGGVYINGKRVENQNHCITREDFNNNEIELRVGKKK
FT                   FLRIVL"
FT   gene            complement(379317..380654)
FT                   /gene="glyS"
FT                   /locus_tag="BG0370"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(379317..380654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BG0370"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0371"
FT                   /db_xref="EnsemblGenomes-Gn:BG0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07223"
FT                   /db_xref="GOA:Q661P8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661P8"
FT                   /protein_id="AAU07223.1"
FT                   /translation="MVRMEDIISLAKRKGFVFQSSEVYGGLSGAWDYGPLGVELKKNIK
FT                   SEWWKSMVYLHENIVGLDSAIFMRPEIWRASGHIDGFSDSMVDCKDCKSRFRADFIDLS
FT                   KNCPNCKVGNNFTSPRSFNLMFKTHIGVVEDSSSEIYLRPETAQGIFVNFRNVLDSSRL
FT                   KIPFGIAQVGKAFRNEIVTKNFIFRTCEFEQMEMQFFVHPKQIDEWFCYWQQNRMNFFI
FT                   ETLKIRPDKLRFKAHDSTQLAHYAKSAFDIEYEFPFGFQEVEGIHNRGNYDLTQHSKFS
FT                   NNPKIFEYHDLLTKERYVPHVIETSAGLTRSVLMTLCNAYSEEELSDGDKRIVLRLHPK
FT                   LAPYKIAIFPLVKKVELVEIARRIYIELCDDFHIFYDDSGTIGKRYRRQDEIGTPYCVT
FT                   VDYSTIEDETVTVRERNNMTQKRIFINDLYSYIKTEILNYKEDFNK"
FT   gene            complement(380672..382144)
FT                   /gene="gltX"
FT                   /locus_tag="BG0371"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(380672..382144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BG0371"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0372"
FT                   /db_xref="EnsemblGenomes-Gn:BG0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07224"
FT                   /db_xref="GOA:Q661P7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661P7"
FT                   /protein_id="AAU07224.1"
FT                   /translation="MSIRVRYAPSPTGLQHIGGIRTALFNYFFAKSCGGKFLLRIEDTD
FT                   QSRYFPEAENDLYSSLKWLGISFDEGPIVGGDYAPYVQSQRSAIYKKYAKYLIESGHAY
FT                   YCYCSPERLERIKKIQNINKMPPGYDRHCRNLSDDEVENALIKKINPVVRFKIPLEGET
FT                   SFDDILLGKITWSNKDISPDPVILKSDGLPTYHLANVVDDYLMKITHVLRSQEWVSSGP
FT                   LHILLYKAFEWKSPIYCHLPMVMGNDGQKLSKRHGSTALRQFIEDGYLPEAIINYVTLL
FT                   GWSYDDKREFFSKNDLEQFFSIEKINKSSAIFDYHKLDFFNSYYIKEKKDEDLYNLLLP
FT                   FFQKKGYVSELITLEESQKLKLLIPLIKNRIKKLSDALNMTKFFYEDIKSWNLDEFLNR
FT                   KKTAKEVCYILELTKPILEGFEKRSSEENDKIFYDFAENNGFKLGEILLPIRIAALGSK
FT                   VSPPLFDSLKLIGKSKVFKRIKLAQEFLRINE"
FT   gene            complement(382157..382924)
FT                   /locus_tag="BG0372"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(382157..382924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0372"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0373"
FT                   /db_xref="EnsemblGenomes-Gn:BG0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07225"
FT                   /db_xref="UniProtKB/TrEMBL:Q661P6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07225.1"
FT                   /translation="MVEKIRLGFNIIFLGLFIYFLAILRFQMNLSFILFNYQFIVIYFL
FT                   LVIVFNIIYSQHFSSRLYFILNGMEDTFTFLKLKMVRKKLKSVFEISILLRFILIKQDK
FT                   KSLDELYFYLKDNRLRHKTIIELYSVLISFREKEKASSLILNYKWSRNKWVKYCEALSM
FT                   LSFEEHLKLKELVNFLDKFFLKNDIFTIYFYYLLRKSSMSFDLLESRKIEIRDRYYKFK
FT                   NRIDSKHTKLLSSNLFFVVFYYIYDFSKKDVFY"
FT   gene            383050..384186
FT                   /locus_tag="BG0373"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        383050..384186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0373"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0374"
FT                   /db_xref="EnsemblGenomes-Gn:BG0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07226"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q661P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07226.1"
FT                   /translation="MQNFESIIKNIKNSSYLIDKEFLVWPENAFIGDKNIELIEKWKLK
FT                   SYIKERTNFFSDDSVKREYEEIHKKFNEEAISSYHVIISNLEEIYENCKRNKKIYYQDI
FT                   MPTVKKVIEFYKKQKKIFIKYFRIPKLSANYHIIHSVNTAILTVALGNEMGLNNYKTVE
FT                   LCSIALLHKIGFLFIPSKISEKKETLTDKELEIIQKYPIISYKVASTSNLSRSICLTLL
FT                   THKENLDGTGYPKGLTSENISIESNIIGAASAYSAIILDKAYKKSFNSGASIIELIKDA
FT                   DKKFDKRVLKLIINAISSCPLDFIVELNDNSIAKIVDIDDSNPNLPYVNYIIKNGKVVD
FT                   KNEPSVQSIPNTNTGIKKILNQDEIELIKNKHSLADSI"
FT   gene            384209..384922
FT                   /gene="pfs-1"
FT                   /locus_tag="BG0374"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        384209..384922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs-1"
FT                   /locus_tag="BG0374"
FT                   /product="5-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0375"
FT                   /db_xref="EnsemblGenomes-Gn:BG0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07227"
FT                   /db_xref="GOA:Q661P4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q661P4"
FT                   /protein_id="AAU07227.1"
FT                   /translation="MILIISAMQEEAEEINKMIDDREEVLLNHYLENKKIYKGKILGKD
FT                   VISLTTGIGKVNAATWSNQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYD
FT                   FDLTKFGHKIGQVPNLPQKFKADEELLKKVVNIVENKLLNIDIHIGLILTGDRFVDNEK
FT                   SLETIKKNFKDALAVDMEGAAIAQVAYIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTS
FT                   SINSSKMTKELIRLI"
FT   gene            384919..386097
FT                   /gene="metK"
FT                   /locus_tag="BG0375"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        384919..386097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BG0375"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0376"
FT                   /db_xref="EnsemblGenomes-Gn:BG0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07228"
FT                   /db_xref="GOA:Q661P3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661P3"
FT                   /protein_id="AAU07228.1"
FT                   /translation="MNKILAANQTLTSEAVSEGHPDKIADQISDAILDEILKVDKNAKV
FT                   ACEVIITQNLVVIAGEINSPVKKTLDIKEIAKKIIKDIGYTNIDYGLDYKTITVIDAIG
FT                   NQSQDIINAIKKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSG
FT                   AIEWLRPDSKSQVTIEYDKNRRPVKIKNIIVSHQHHPNISQKLIREPIIEEIIKPTIQD
FT                   KSIIDENTTYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVD
FT                   RSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISIQITSGINDPKYANKILNFIV
FT                   NNFDLTPNGIIEKLKLKQPIYLKTCTYGQLGKNEFEWEKLDFVKKIQTVLKK"
FT   gene            386094..386567
FT                   /locus_tag="BG0376"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        386094..386567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0377"
FT                   /db_xref="EnsemblGenomes-Gn:BG0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07229"
FT                   /db_xref="GOA:Q661P2"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07229.1"
FT                   /translation="MKKITSFTIDHTKLNPGIYVSRKDTFENVIFTTIDIRIKAPNIEP
FT                   IIENAAIHTIEHIGATLLRNNEVWTEKIVYFGPMGCRTGFYLIIFGNYESKDLIDLISW
FT                   LFSEIVNFSEPIPGASHKECGNYKDHNLDMAKYESSKYLQILNNIKEENLKYP"
FT   gene            complement(386578..387237)
FT                   /locus_tag="BG0377"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(386578..387237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0377"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0378"
FT                   /db_xref="EnsemblGenomes-Gn:BG0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07230"
FT                   /db_xref="UniProtKB/TrEMBL:Q661P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07230.1"
FT                   /translation="MRRSFFYFFLMLNALRLYSGIPGYLNVYNGIGVGVDNFTQDLFFY
FT                   ERLKYQFFSGLGINVSQNFAFGGEFNLDIKFLPSHTLYTKEIMFMLDNQAYLKHSLNYF
FT                   IVKDVSASMRMYGNYFFLPYTPMFSLIFFAGLKFSYIGAKVYFRDSRGSVLFDNIVLGV
FT                   DIGARINIDFIFLEYTISPIFYNKLLLLNQMHKITLGFIFQLDVATKNDSEILSIL"
FT   gene            complement(387264..387683)
FT                   /gene="pkcI"
FT                   /locus_tag="BG0378"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(387264..387683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="BG0378"
FT                   /product="protein kinase C1 inhibitor"
FT                   /note="ortholog to Borrelia burgdorferi BB0379"
FT                   /db_xref="EnsemblGenomes-Gn:BG0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07231"
FT                   /db_xref="GOA:Q661P0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q661P0"
FT                   /protein_id="AAU07231.1"
FT                   /translation="MYDCIFCKIVNKELPSYKVYEDDLVLAFLDVNPLTVGHTLVIPKE
FT                   HSENLLNMDDKFNERVLRVCKKISNALKRMNSSIYGGINIYSSLGAGAGQEIFHTHFHV
FT                   IPRFKNDGFGFKRGNKINLEVEKFKELSIQISMNI"
FT   gene            complement(387734..389098)
FT                   /gene="mgtE"
FT                   /locus_tag="BG0379"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(387734..389098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="BG0379"
FT                   /product="Mg2+ transport protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0380"
FT                   /db_xref="EnsemblGenomes-Gn:BG0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07232"
FT                   /db_xref="GOA:Q661N9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q661N9"
FT                   /protein_id="AAU07232.1"
FT                   /translation="MIDIDELRIFLKERSYSKIKEKFLKHDSFDIAEALKRLNGSELIL
FT                   LYRFLPKKIAVETFSNFDQSTKNKLANSFTNKEISEMIDELNLDDVIDLLEEVPANVVQ
FT                   RFLASSTEENREIINKFLSYSDDSAGSIVTIEYVELKEDFTVGESLDYIRRVAKTKEDI
FT                   YTYYITDDEKHLKGVIKIEDLILAKDDVILSSIMRSSGFYIVGVNDEKEDVALLFQKYD
FT                   ITSVPVVDNEGRMIGVIIIDDILEVIQSVNTEDFQMIAAVKPLDTSYLDTSILVMTKNR
FT                   IIWLLVLMVSSTFTATIILNYQNLMLSLVVLASFIPLLMDTSGNAGSQASALIIRELAL
FT                   GTVKVKDFFKVFLKEICVSILVGVILASVNFLRIIFFVAPHHADKLKIAFVVSACLMVS
FT                   LTVAKILGGLLPIVAKIFKLDPALMAGPLITTIADAITLIAYFNIAKWVLVSYAV"
FT   gene            complement(389152..390576)
FT                   /locus_tag="BG0380"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(389152..390576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0381"
FT                   /db_xref="EnsemblGenomes-Gn:BG0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07233"
FT                   /db_xref="GOA:Q661N8"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q661N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07233.1"
FT                   /translation="MNKKMFPKIYYYDQDFIDIYNKSLSWIQDKVILQKVADKGKKDKN
FT                   YYSENCNYIDQMQACMASFFLVYSNGEYSSTSAIDKFYQLQEESGAIRARYDNDNAIID
FT                   LDENEENIGFPIFAWAEYNLYHKTGNKKRISEVLPILDKYYKWIESKFLKENGLYSIDV
FT                   NKIFYKNSPRVGAYYPIDFNSLQVHSAYCISKLADILNDKNLSLEYKKRFFSLKVKINS
FT                   LMWSEKDGFYYDLDVNENILEIKTIVGFFPMLSEIPSEDRIERMIFYLKSTNHFGTPNP
FT                   FPTLSVSEPGFSEDGNGYHGSVYTYMNFFVIKGLEYCGRANIAREFTIRHLYYILDTLM
FT                   PFNKIKGHIWEAYKPMQEGPAYFDSNKKTYTEKDLICYLALFSISLMIENIIGLTISLP
FT                   DKTVYWNIPTLEIMGIESLSLKKNQTTIICNKGKRGWEIKMESEKLYYFTINILNKKEK
FT                   TLPIPSGRCSMLLDKL"
FT   gene            complement(390689..391714)
FT                   /gene="bmpB-1"
FT                   /locus_tag="BG0381"
FT   CDS_pept        complement(390689..391714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpB-1"
FT                   /locus_tag="BG0381"
FT                   /product="basic membrane protein B"
FT                   /note="ortholog to Borrelia burgdorferi BB0382"
FT                   /db_xref="EnsemblGenomes-Gn:BG0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07234"
FT                   /db_xref="GOA:O31362"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31362"
FT                   /protein_id="AAU07234.1"
FT                   /translation="MRIVIFILGILLTSCFAGNEIESGSSKIKISMLVDGVLDDKSFNS
FT                   SANRALLRLEEDFPENIEKVFSSAASGVYSSYVSDLDNLKMNGSDLIWLVGYMLTDASL
FT                   SVSLENPKISYGIIDPVYSDDVQIPKNLIGVVFRIEQGAFLAGYIAAKKSVSGKIGFIG
FT                   GVKGDIVDAFRYGYEAGAKYADKGIEIVSEYSNSFSDVNIGRAIANKMYAKGIDIIHFA
FT                   AGLAGIGVIEAAKELGDGYYVIGADQDQSHLAPRNFITSVIKNVGDALYLVTSEYLKNN
FT                   NTWEGGKIIQMGLRDGVVGLSNANKFEYIKVIERKIVNEEIIVPYNHEGYEIFIKQILK
FT                   L"
FT   gene            complement(391811..392824)
FT                   /gene="bmpA-1"
FT                   /locus_tag="BG0382"
FT   CDS_pept        complement(391811..392824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpA-1"
FT                   /locus_tag="BG0382"
FT                   /product="basic membrane protein A"
FT                   /note="ortholog to Borrelia burgdorferi BB0383"
FT                   /db_xref="EnsemblGenomes-Gn:BG0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07235"
FT                   /db_xref="GOA:Q661N6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661N6"
FT                   /protein_id="AAU07235.1"
FT                   /translation="MNKLLLLILFECIIFLSCSGKGSLESEIPKVSLIIDGTFDDKSFN
FT                   ESALNGIKKVKEEFKIEPVLKESSTNSYLSDLEGLKDTGSNLIWLIGYKFSDVAKSVSL
FT                   QNPEIKYAIIDPVYSDEPIPANLVGMTFRSQEGAFLTGYIAAKVSKTGKIGFLGGIEGE
FT                   IVDAFRYGYEAGAKYANKDIKISAYYIGSFADLEAGRSVATKMYSDGIDIIHHAAGLGG
FT                   IGAIEVAKELGSGHYIIGVDGDQSYLAPNNIITSATKDVGRSLNIFTSNYLKTNTFEGG
FT                   RLINYGLKEGVVGFIKNPKMIPFELEKEIDNLSSKIINQEIIVPYNKESYEKFIKE"
FT   gene            complement(392865..393559)
FT                   /pseudo
FT                   /gene="bmpB-2"
FT                   /locus_tag="BG0383"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(393689..394702)
FT                   /gene="bmpA-2"
FT                   /locus_tag="BG0384"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(393689..394702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpA-2"
FT                   /locus_tag="BG0384"
FT                   /product="basic membrane protein A"
FT                   /note="ortholog to Borrelia burgdorferi BB0383"
FT                   /db_xref="EnsemblGenomes-Gn:BG0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07236"
FT                   /db_xref="GOA:O31357"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31357"
FT                   /protein_id="AAU07236.1"
FT                   /translation="MNKLLLLILFECIIFLSCSGKGSLESGIPKVSVIVNGTFDDKSFN
FT                   ESALNGIKKVKEEFKIELVLKESSTNSYLSDLEGLKDAGSNLIWLIGYRFSDVAKAVSL
FT                   QNPEIKYAIIDPVYSEEPIPTNLVGMTFRAQEGAFLTGYIAAKVSKTGKIGFLGGIEGE
FT                   IVDAFRYGYEAGAKYANKDIKISAHYIGSFNDVEAGRSVATKMYSDGIDIIHHAASLGG
FT                   IGAIEVAKELGSGHYIIGVDEDQSYLAPNNIITSATKDVGRSLNIFTSNYLKTNTFEGG
FT                   RLINYGLKEGVVGFVKNPKMIPFELEKEIDNLSSKIINQEIIVPYNKESYEKFLKE"
FT   gene            complement(394743..395804)
FT                   /gene="bmpC"
FT                   /locus_tag="BG0385"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(394743..395804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpC"
FT                   /locus_tag="BG0385"
FT                   /product="basic membrane protein C"
FT                   /note="ortholog to Borrelia burgdorferi BB0384"
FT                   /db_xref="EnsemblGenomes-Gn:BG0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07237"
FT                   /db_xref="GOA:Q661N4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q661N4"
FT                   /protein_id="AAU07237.1"
FT                   /translation="MFKRFVFIALSLLVLACFKSNKKSVKSDKVIIGVLANGSFYDKGY
FT                   NQSVYDGVVKLKDDFGIKLITKSLRPYPIEGKRLLTVNEAMAEDAYEVQKNPLNLFWLA
FT                   GYQFSSLSVKLSYERPDIYYGIIDAFDYGDIQVPKNSLAIKFRNEEAAFLAGYIAAKMS
FT                   RKEKIGFLTGPESEYLNDFKFGFKAGIFYANPKLRLVSKKAPSLFDKEKGKEMARFMYK
FT                   EDKVGVIFPIAGITGLGVYDAAKELGPKYYVIGLNQDQSYIAPQNVITSVLKDIGKVIY
FT                   SVSSDYIKNGVFKGGVVIDRGLKEGVIEIVKDPDVLNNRLVNEVVELENKIISGEIIVP
FT                   DSEYAFDLFKSKL"
FT   gene            complement(396127..397152)
FT                   /gene="bmpD"
FT                   /locus_tag="BG0386"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(396127..397152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpD"
FT                   /locus_tag="BG0386"
FT                   /product="basic membrane protein D"
FT                   /note="ortholog to Borrelia burgdorferi BB0385"
FT                   /db_xref="EnsemblGenomes-Gn:BG0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07238"
FT                   /db_xref="GOA:Q661N3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q661N3"
FT                   /protein_id="AAU07238.1"
FT                   /translation="MLNKVYCFIVFLFIIACSGSDDVKLESKTVSLIVDGAFDDKGFNE
FT                   SSSKAIRKLKTDFNINIIEKASTGNSHLGDIATLEDGNSNLIWGIGFRLSDVLLQRASE
FT                   NISINYAIMEGVYNEIQMPKNLLNISFRSEEVAFLAGYFASKTSKTGKIGFIGGVKGKV
FT                   LESFMYGYEAGAKYANSTIKVISQYVGTFGDFGLGRSTASNMYRDGVDIVFAAAGLSGI
FT                   GVIEAAKELGPDHYIIGVDQDQSYLAPNNVLVSAVKKVDSLMYSLTKKYLETGIWDGGK
FT                   NIFFGLKEDGLGLVLNENLKSNYSEIYNKSLEIGQSIMEGIIKVPYDKASYDNFVLQIA
FT                   N"
FT   gene            complement(397254..397727)
FT                   /gene="rpsG"
FT                   /locus_tag="BG0387"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(397254..397727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BG0387"
FT                   /product="ribosomal protein S7"
FT                   /note="ortholog to Borrelia burgdorferi BB0386"
FT                   /db_xref="EnsemblGenomes-Gn:BG0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07239"
FT                   /db_xref="GOA:Q661N2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661N2"
FT                   /protein_id="AAU07239.1"
FT                   /translation="MSRKNKKIKKKIFIDTRYNSRIVAKFANRMMYDGKKSISESILYS
FT                   SIDLLADKLEDSDKMAVFYKALDNIKPLVEVRSRRVGGATYQVPVEVREERREALAMKW
FT                   IIFAARKSSGRSMKEKLSNELLNAYNSTGAAFKKKEDTHRMAEANKAFTHYRW"
FT   gene            complement(397752..398126)
FT                   /gene="rpsL"
FT                   /locus_tag="BG0388"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(397752..398126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BG0388"
FT                   /product="ribosomal protein S12"
FT                   /note="ortholog to Borrelia burgdorferi BB0387"
FT                   /db_xref="EnsemblGenomes-Gn:BG0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07240"
FT                   /db_xref="GOA:Q661N1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661N1"
FT                   /protein_id="AAU07240.1"
FT                   /translation="MPTINQLIRKPRKSQTEKTASPALQNCPQRRGICTRVMTVTPKKP
FT                   NSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDT
FT                   LGVNNRKKGRSKYGTKKPKA"
FT   gene            complement(398192..402325)
FT                   /gene="rpoC"
FT                   /locus_tag="BG0389"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(398192..402325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BG0389"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0388"
FT                   /db_xref="EnsemblGenomes-Gn:BG0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07241"
FT                   /db_xref="GOA:Q661N0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661N0"
FT                   /protein_id="AAU07241.1"
FT                   /translation="MKEIKDFEKIKIKIASPDQIRNWSYGEVKKSETINYRTLRPEKDG
FT                   LFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELAAPVAHI
FT                   WYYKYIPSRIGLLLDITASSLNSILYYEKYVVIEPGDTDLKKMQLLNEDEYIEARERYG
FT                   MSFNASMGAEAIKTLLENLDLDELSSKLRIQMIDKDDKTDKKLLRRLEIIENFKVSGNK
FT                   PEWMIMEVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNAPEIIV
FT                   RNEKRMLQESVDSLFDNSHKRKVVKGSSSRPLKSLSDALKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLHQCGLPAKMALELFKPFVIRRLIESEAVFNIKRAKNLIEQEVDEVWQ
FT                   ILDFVIKEHPILLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVH
FT                   VPLTPSAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMEKKNIVGEGKKFL
FT                   NFSNVILAINNRSLDYNASIYVKIDGEYKKTTAGRVIFNEALPKGIEFVNKTLSDLELQ
FT                   ILISKVYVVHGSSTVIEMLDIIKELGFKYATKFGCTISMSDIIVPDEKKTYIDRANKEI
FT                   AKIQNDYAKGVITGEERYNNVVSVWLKTNEELTNKMMEILKKDRDGFNVIYMMADSGAR
FT                   GSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTNGARKGLADTALKT
FT                   ADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVETVKNGEEILESLKEKAVGSYSIERIK
FT                   NPITGEIVLDANEEISEAKIELLEKIGIEKLVIRSVLTCEAEHGVCQKCYGRDFSKNKP
FT                   VNIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKISLKNAFILNSIEGFNVN
FT                   VDNGILFTRKGTLKIINVFYEEKIKNIKEIKVLDSQRVIKGIPLFVNKKGVEILSSYIG
FT                   YAKLRDDKFLIVSEEQEVALKAGTKLEIGVGDYVESGKVIGTFDPFAEPIIAEVKGKIK
FT                   FKDIILGTTLKEEINTETGNVEKRITDNVFESLDPRIFIIDSSGMEVASYVLPGDAYLQ
FT                   VEDGQNINIGDVIAKLSKGSEKTQDITGGLPRVNDLFETRIPKNLTEMAKVSGIVQFKS
FT                   IQKGKRLINILDEYGVEHKHYIPAGKHLLVRDGDVVKAGDMLCDGRINPHDVLEILGGI
FT                   SLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKVKIVAVGDTNFVYGQKVDKHTFY
FT                   EQNRKVIEQGGEPAIASPILIGVTKTSLNIDSFISAASFQETTKVLTDASIAGKIDDLR
FT                   GLKENVVIGHLIPTGTGMGLYKKIKVSENIDAKV"
FT   gene            complement(402341..405808)
FT                   /gene="rpoB"
FT                   /locus_tag="BG0390"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(402341..405808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BG0390"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0389"
FT                   /db_xref="EnsemblGenomes-Gn:BG0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07242"
FT                   /db_xref="GOA:Q661M9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661M9"
FT                   /protein_id="AAU07242.1"
FT                   /translation="MIKRVHLGQGRADEILDLPNLIEIQLNSYEKFLQLDKLKNKKPLL
FT                   NEGLESVFRNIFPIKSGNGDVALEYERYYIENDALNFTEKECKRKGQSYEAVLKVRLNL
FT                   QFLTTGEIRQKDVYMGTIPLMTERGTFIINGAERVVVSQIHRSPGVVFYKEKDLYSARI
FT                   IPYRGSWLEFEIDSKKDYLYVKIDRKKRILITLFLRALGFDTREKIIETFYNIKKIKVE
FT                   DSTKRDLPGQYLAKSINIRENMYYRAGDKITLQDVEDFLQNGVNEIELVDFDGYDAISG
FT                   KCFVSSNVILNCLEKEDAFFALKDGSKELPKESVMLAVYGALFPGEPISIDNAENDLKT
FT                   IFFSERRYDLGRVGRYKLSKKFGFDDLSTSVLTMYDIVNTISHLLRIYEGHDILDDIDH
FT                   LGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPIVSAVKEFF
FT                   ATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPE
FT                   GPNIGLIVSLATYSRVNDYGFLETPYRKVVNGEVTDELEYLSAIDEEKKCIAQANAAFN
FT                   SNGKYLEDLVSVRISGDYTTTNPKNIDYMDVSPRQLISVSSALIPFLEHNDANRALMGS
FT                   NMQRQAVPLLFPKPPIVGTGMESVVAKDSGVVVKAKRSGEVILATSSKIVVKPFESENA
FT                   KDLDEYHIVKYERTNQDTCFNQSVLVKEGQKVESGEIIADGPATRYGELALGNNLLLGV
FT                   IPWNGFNYEDAILISDRIVKEDLYTSIHIKEFSIEVRETKLGPEKVTGDIPNVSEKILN
FT                   KLDENGIIRIGTYVKPGDILVGKVTPKSEGDITPEFRLLTSIFGEKAKDVKNNSLKVPH
FT                   GTEGTVIDVQRITKEDVGNLSPGVEEILKVYVAKKRKLKEGDKMAGRHGNKGVVAKILP
FT                   VEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKYLGESYNVPVFESATNEQ
FT                   IQEKLKKAGFNPTSKEILYDGYTGEPFENEVMVGVIYMLKLHHLVDDKMHARSTGPYSL
FT                   VSQQPLGGKAQFGGQRLGEMEVWALEAYGAAHTLQELLTVKSDDMSGRVKIYENIVKGV
FT                   PTNVSGIPESFNVLMQELRGLGLDLSIYDDNGNQVPLTEKEEELINKG"
FT   gene            complement(405891..406265)
FT                   /gene="rplL"
FT                   /locus_tag="BG0391"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(405891..406265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BG0391"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="ortholog to Borrelia burgdorferi BB0390"
FT                   /db_xref="EnsemblGenomes-Gn:BG0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07243"
FT                   /db_xref="GOA:Q661M8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:Q661M8"
FT                   /protein_id="AAU07243.1"
FT                   /translation="MALSKEDILTWLEGAKTMEVVDLVTAIEEKFGVTAAISAVGGGAA
FT                   STGSTDSEEQIEFDVILMSFGNSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSK
FT                   SDAEELKKKLEAVGAKVEVK"
FT   gene            complement(406336..406824)
FT                   /gene="rplJ"
FT                   /locus_tag="BG0392"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(406336..406824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BG0392"
FT                   /product="ribosomal protein L10"
FT                   /note="ortholog to Borrelia burgdorferi BB0391"
FT                   /db_xref="EnsemblGenomes-Gn:BG0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07244"
FT                   /db_xref="GOA:Q661M7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661M7"
FT                   /protein_id="AAU07244.1"
FT                   /translation="MSAKINSKKLEMFDLLKKFIDNKQNLFFLDYRGLSVSQLTDLRNK
FT                   IEGEHGALKVVKNNIMKMVLKEKNINIVDSCLVGPTVVVTALEEANVIAKIFYDFVKSS
FT                   TLKVKGGFVLGEFYDEAKVQAYSKLPTKKESISLLASVLKAPVSKLARTLKALADIKN"
FT   gene            complement(406829..407509)
FT                   /gene="rplA"
FT                   /locus_tag="BG0393"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(406829..407509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BG0393"
FT                   /product="ribosomal protein L1"
FT                   /note="ortholog to Borrelia burgdorferi BB0392"
FT                   /db_xref="EnsemblGenomes-Gn:BG0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07245"
FT                   /db_xref="GOA:Q661M6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661M6"
FT                   /protein_id="AAU07245.1"
FT                   /translation="MSKKGKKYIAAFSKVDKSKFYSIEDAISLLKEIKFVKFDETIDIS
FT                   INLNLKKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYIGDDDLINKIKSG
FT                   WDEFDIVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRAN
FT                   KNGVISFSFGKSSMDNAKIKENYDEFIKEVVKKRPSDLKGAFIDSIYISSTMGPSIKID
FT                   FVWR"
FT   gene            complement(407509..407940)
FT                   /gene="rplK"
FT                   /locus_tag="BG0394"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(407509..407940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BG0394"
FT                   /product="ribosomal protein L11"
FT                   /note="ortholog to Borrelia burgdorferi BB0393"
FT                   /db_xref="EnsemblGenomes-Gn:BG0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07246"
FT                   /db_xref="GOA:Q661M5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661M5"
FT                   /protein_id="AAU07246.1"
FT                   /translation="MAKKKAISWIKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFNE
FT                   RTAKMDPGIVVPVIITVYSDKSFSFIVKTPPASILIKKTIGIESGSKKSNTDKVGTISK
FT                   EKLMEIVKIKMPDLNAKSESAAFKIISGSARSMGVEVEK"
FT   gene            complement(407992..408546)
FT                   /gene="nusG"
FT                   /locus_tag="BG0395"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(407992..408546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BG0395"
FT                   /product="transcription antitermination factor"
FT                   /note="ortholog to Borrelia burgdorferi BB0394"
FT                   /db_xref="EnsemblGenomes-Gn:BG0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07247"
FT                   /db_xref="GOA:Q661M4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q661M4"
FT                   /protein_id="AAU07247.1"
FT                   /translation="MSRAWYVIQTYSQYEKKIEQDIRLLISEGAFGSIVLDVKAPIEKV
FT                   EEIRNGKKRIRERKIWPGYILIELDLPEVGWKDVVANIIKVQGVINFVGVSKGQKPIPI
FT                   NDEEVKSVFMLTGEIKANKSIFMLYDFEEGERVRIKGGPFDSFEGLISSIDYKRKKLKV
FT                   AVQIFGRSTPVEVDFQHIEKI"
FT   gene            complement(408570..408740)
FT                   /gene="secE"
FT                   /locus_tag="BG0396"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(408570..408740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BG0396"
FT                   /product="preprotein translocase subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0395"
FT                   /db_xref="EnsemblGenomes-Gn:BG0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07248"
FT                   /db_xref="GOA:Q661M3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q661M3"
FT                   /protein_id="AAU07248.1"
FT                   /translation="MFRFIKDSILELKKVTWPKYNEVVENGKQVFWLVLFVSIFLGVVD
FT                   YLMFLVVTYVF"
FT   gene            complement(408767..408839)
FT                   /gene="trnW"
FT                   /locus_tag="BG0397"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(408767..408839)
FT                   /gene="trnW"
FT                   /locus_tag="BG0397"
FT                   /product="tRNA-Trp"
FT   gene            complement(408848..409027)
FT                   /gene="rpmG"
FT                   /locus_tag="BG0398"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(408848..409027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BG0398"
FT                   /product="ribosomal protein L33"
FT                   /note="ortholog to Borrelia burgdorferi BB0396"
FT                   /db_xref="EnsemblGenomes-Gn:BG0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07249"
FT                   /db_xref="GOA:Q661M2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661M2"
FT                   /protein_id="AAU07249.1"
FT                   /translation="MGKKKGKGAVELISLICEETGIRNYTTTKNRRNKQEKLELMKYCP
FT                   KLRKHTLHKEGKIK"
FT   gene            complement(409055..409127)
FT                   /gene="trnT"
FT                   /locus_tag="BG0399"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(409055..409127)
FT                   /gene="trnT"
FT                   /locus_tag="BG0399"
FT                   /product="tRNA-Thr"
FT   gene            complement(409192..410049)
FT                   /locus_tag="BG0400"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(409192..410049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0400"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0397"
FT                   /db_xref="EnsemblGenomes-Gn:BG0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07250"
FT                   /db_xref="UniProtKB/TrEMBL:Q661M1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07250.1"
FT                   /translation="MHFLKFLFSYLFLLYSNVSIIKDEVAETSVHRIIDWDRKVICFDI
FT                   VKEINENEFRPVGLNTASKLIATINDFKDTLIRESLFKIIMDSENTFKNYFDLNPSLIL
FT                   NFSGPNSILKRSYIKYSEDLRSLTVRYELSLFPDFINLFFSHEKPYKAFYPLVNSDIDK
FT                   TDYTGIVIYVGEVYNNAFGSKKLEDSFFIKIYDENIRPYFDKRMVSSEALKKWGMLEYS
FT                   NDILYNNKNRVGHRPLKLVAKSVYGKNNTDIILDEYSINKLFSNNNNIKLLQDGKLVVI
FT                   KQEN"
FT   gene            complement(410063..411094)
FT                   /locus_tag="BG0401"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(410063..411094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0401"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0398"
FT                   /db_xref="EnsemblGenomes-Gn:BG0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07251"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q661M0"
FT                   /protein_id="AAU07251.1"
FT                   /translation="MNLFAEIAKFFLILFLFASCKQKQSEIQNLTHLLKSSNKNRLDKF
FT                   LIVDRAVNIYIANKNYENALEIVNSGIIDDESREYYPLYLYLMGNIYDSMGEDFVAFSI
FT                   YKYVVDNFDDYVYENCSVKTKVAKKIVNLNIDSIDKINYYKFILNTEIDNLNNEEKGNY
FT                   FYNLALSLEDVQNYDESYFYYKKFLSIPRAHLKIDSRDYFNVVTKINYFNNPEFIVYRN
FT                   LGDLIQDVKKFVLSGDTSRLLNIRDKNNFFIQSWDQKGGKSNSINTNSFLTTMIRLGGR
FT                   RKNGIQFAKHLEADSSDDISYLESSGWDHIREWYFVFKRIAYPKDPEINNGWTWIGVYL
FT                   GKK"
FT   gene            411418..412077
FT                   /locus_tag="BG0402"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        411418..412077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0402"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0399"
FT                   /db_xref="EnsemblGenomes-Gn:BG0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07252"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07252.1"
FT                   /translation="MKKELMILFLLLQIIKNLNSINTDTSTSIIKELQKNLYAFNSKEY
FT                   QNNKDTLNKFINSININDKKTLQNLEKIKNDLFIISVFFDNKKGILIALNLGAEINLKH
FT                   KISPISISIINNKFEIIKILVDYGIGLNQIDDTGHSPIFWAIYTNNEKVFEFLKESGAD
FT                   LSCTLENRKTPMQAAIETENIKLIESLKNKKIYIDDNYKKEIKALKNKEIVRILTK"
FT   gene            complement(412087..413610)
FT                   /locus_tag="BG0403"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(412087..413610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0403"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0400"
FT                   /db_xref="EnsemblGenomes-Gn:BG0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07253"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07253.1"
FT                   /translation="MYKYPDYVDTDLDSRLPNILTLEEHDKQFFTKDFYKNLISSSKEI
FT                   GLKLHKVLVDYLNPQPEEVDRVLKYNQVINIYWSFLRSIAKNISALTMEQKILFRFAAL
FT                   IPNALGSEIQLLISKTIWDNHYNESFIYFDEWLYGVSSLKLSRLATDLPMDNFKEEDME
FT                   KILLNKKEKLLANIDFAKSSLKRTDKIREEALCKLRNMFGFLFSHNSQNDSTYIPEYGV
FT                   RSPYANSILKPLNFASDYVDDLIKSNRDIHVFINKIEDANKELFEIQNKMNNIGMSVES
FT                   TIAYDEVEVIRSANKLAIGPRGNHFPILLRNNIVANPQFFGSRERIMQLVWEIEDIQPR
FT                   LFQKAYRGDLLRVVPYFILIPSYGDKGICWESIDVKNRANGRGKILIPMYAKNLRKAVI
FT                   LGIGDFVWELAKEQASFRWMETGITGQYYDYYVKFIKKGNVKNFFLEDYFLWIEKESKG
FT                   IQKLDKLVRGIMWRNLPFSKNLKETLAKKSFIYKDLIDKDKNIQTSDGY"
FT   gene            413744..414946
FT                   /locus_tag="BG0404"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        413744..414946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0404"
FT                   /product="glutamate transporter, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0401"
FT                   /db_xref="EnsemblGenomes-Gn:BG0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07254"
FT                   /db_xref="GOA:Q661L7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L7"
FT                   /protein_id="AAU07254.1"
FT                   /translation="MNVKINFFFTIPIGILLGLFLPLGIYSSLSHAFIRLSYLSLIPFL
FT                   IFSIPLGIENIIENKNFKKLFSKTIYYGILINLSGVAVSITAAIIYLPQRIPILEKTIQ
FT                   NIYFFEKEALLETFFPKNIFKIFTSSNPNLLSIYMISIIIGTSFYYAKQKGRIARELML
FT                   SASNLFYHANGFIVNILNIGIIFITADYTTSLKSFKDYQNYTNSITFFLTWTIIILFAI
FT                   LPIISYRLTKNFRMIYKGIFVSFKNIIFSGLTKDSYSPYVILIEDIKNERINIKKSIII
FT                   NIPLINFVSKFGTIFVSVISFFIILKSYSSLPISIYEISYMSTLSFFFVLAFPHIPNSL
FT                   IYVITMLCSTYTKGIELNVSNITPMLPILISLALLIDFAFNIAIIHIINFKELKDQEKI
FT                   N"
FT   gene            complement(414958..416424)
FT                   /gene="proS"
FT                   /locus_tag="BG0405"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(414958..416424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BG0405"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0402"
FT                   /db_xref="EnsemblGenomes-Gn:BG0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07255"
FT                   /db_xref="GOA:Q661L6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661L6"
FT                   /protein_id="AAU07255.1"
FT                   /translation="MSDFIASKEDDYSKWYLDIVQKAKLADYSPVKGCMVIMPYGYSIW
FT                   SKIQSILDKKFKETGHENAYFPMLIPYGFLEKEKDHIEGFSPEFAIIKDAGGESLAEPL
FT                   VLRPTSETIIWNMYSKWIKSYRDLPLKINQWANVVRWEKRTRPFLRTTEFLWQEGHTAH
FT                   ATEEEAVEETLLILDLYKRFMEDYLAIPVFCGKKSEKEKFAGAVSTYSIEALMQDKKAL
FT                   QAATSHYLGLNFAKAFDVKFQDKDGKMRHVFASSWGISTRLIGALIMVHSDEKGLILPP
FT                   RIAPIEIIVIPIFKKEDEINKKILDYSDCVVHALKKAEFRVEIDKDVRSSPGFRFSSAE
FT                   FKGIPIRIEVGINDVLLNSVTIMRRDKDRKFKYQISLDSLASKVKVELDSMQKDLFKKA
FT                   LNFRTLNTKEIFRIGKDSYELFKAYMNDHSGFVLSCWCGGLDCENIIKNETKATIRCIP
FT                   DDFKAKDLTGMACIYCASRAKYFVLFAKSY"
FT   gene            complement(416477..417046)
FT                   /locus_tag="BG0406"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(416477..417046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0406"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0403"
FT                   /db_xref="EnsemblGenomes-Gn:BG0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07256"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07256.1"
FT                   /translation="MFGEYGFENGYYYSAVYFVDVIRNNFANSGVHSKIFKEHIEYSDS
FT                   YDKSLYELLKMINFKVKEFKINHLRRGREIYFYVNSEIPETDFLNFVDFKTGNEYQVFV
FT                   NKDINFQELSSSFNIFLSVRYCNSALEKHLTVGRGNYYRKNVIDYKIREIFLFPNEDGI
FT                   VFVLEKIMLNSYGNKYKRFMVEVKKY"
FT   gene            417734..418345
FT                   /locus_tag="BG0407"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        417734..418345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0407"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0405"
FT                   /db_xref="EnsemblGenomes-Gn:BG0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07257"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07257.1"
FT                   /translation="MRMLLATIILILTTGLLTAQSKSKSMVEDDFDFEKLLAKEESVRR
FT                   LFGIGFGVGYPLTNITISVPYVDIDLGYGGFVGLKPNNFMPYVAAGIDLLFKDEIHKNT
FT                   MISGGIGIGADWSKGSPEKSNEKLEEEEENEAQQVNSLQNRIGIVIRLPLVIEYSFLKN
FT                   IVIGFKAVATIGTTMLLGGPMSFEGARFNFLGTGFIKIYI"
FT   gene            418356..418967
FT                   /locus_tag="BG0408"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        418356..418967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0408"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0406"
FT                   /db_xref="EnsemblGenomes-Gn:BG0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07258"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07258.1"
FT                   /translation="MIKNFKKMHILILVLGVAHLSFASDNYMVRCSKEEDSTTCIAKLK
FT                   GIKEKKSYDLFSMGIGIGNPIANIIITIPYVNIDFGYGGFIGPKSNNFENYLNGGIDII
FT                   FKKQIGQYMRIGGGIGIGADWSKTSLMPPDEEEETDYERIGAVIRIPFVMEYNFAKNLY
FT                   IGFKVYPALGPTILLTKPNILFEGIKFNFFGFGFIKFAFN"
FT   gene            complement(419020..420135)
FT                   /gene="manA"
FT                   /locus_tag="BG0409"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(419020..420135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="BG0409"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0407"
FT                   /db_xref="EnsemblGenomes-Gn:BG0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07259"
FT                   /db_xref="GOA:Q661L2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L2"
FT                   /protein_id="AAU07259.1"
FT                   /translation="MNKDNIYLMKNNIKEYDWGGISFIPNLLGDKIDGKPKAEMWLGAH
FT                   KTFSSKILYKNEYVLLSGFLEDHKELLGCNDEFPFLFKVLSSNKPLSIQIHPSKDIALK
FT                   GYESENNKGIDINDPKRIYKDKNPKIELIYALSDFYALKGFLPLGEIKKICEILKLNLD
FT                   FQSHRGFVKTIFDLQVHELEKIIEKILKNLNLMDSFRGYWFNEIYNIYGVDVGLLVFLG
FT                   MNILKLKPGEVVYTNSQEVHAYLKGDCIELMTNSDNVIRAGLTTKYIDKEEMLRVGQFE
FT                   EGRVSFLKPDFQNTFNVFRLPNTNLKLIQKKVNESICINRNSAMVLLVLDGCVSINKSL
FT                   DLDKGESIFIGKKAENLFIDGNGQAFIAGFN"
FT   gene            complement(420132..422009)
FT                   /gene="fruA-1"
FT                   /locus_tag="BG0410"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(420132..422009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA-1"
FT                   /locus_tag="BG0410"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /note="ortholog to Borrelia burgdorferi BB0408"
FT                   /db_xref="EnsemblGenomes-Gn:BG0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07260"
FT                   /db_xref="GOA:Q661L1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L1"
FT                   /protein_id="AAU07260.1"
FT                   /translation="MFFNFLKKDLVFILPEANSKEDVIDFLVEKVNDKGYIDSKKEFLQ
FT                   GILDREKIGDTSWENGVAIPHFIGDAVKTSFISLLYIKGTGVKWSEENPPVNLIFLICM
FT                   SKKQQGNEHIKSIAFIAKLFEDDAFQNALSGIVTADDIYYYIENVHRKVKEEVFGATKK
FT                   EKIVAVTACPVGVAHTYIAAKKIENEVKKQGYNIRVETQGSIGIENALTEEEIRNADIV
FT                   ILAVDKDVDEKRFEGKRVYKVSTVKAINNTENIIKEAFNAPVFFCKDSGANNRSKGSII
FT                   TGKGSFYKYLMSGVSPMIPVVATGGILIALSIAFVGIGPDGPNFSEHPFYKQLADIGSV
FT                   AFGMMLPVLAGFISMAIADKPGLAPGLVGGVMSGNVKAGFLGAIFAGLLAGYVARFLAK
FT                   RSVPEWLRPVMPIFVIPLISTIIVGFFILHVGVYIGEFMGVLESGLKSLQSNSETFGVL
FT                   GKIFLGLVLGSMITVDMGGPFNKVAFLFGVGLIPQVPEIMGMVAAAIPVPPMAMGLATF
FT                   LAPKLFENEEKESGKIAFLISFIGISEGAIPFAASDPGRVIPSIVVGGAVSSIIAAFLG
FT                   VANHAPHGGPIVLPVVDNKFEFIIAIAVGVAVATALVIFLKSLKSKESE"
FT   gene            422179..422808
FT                   /locus_tag="BG0411"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        422179..422808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0411"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0409"
FT                   /db_xref="EnsemblGenomes-Gn:BG0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07261"
FT                   /db_xref="UniProtKB/TrEMBL:Q661L0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07261.1"
FT                   /translation="MKKNPNIYISLTLLIISTLNALANEEDNTNEKNNQSKQSSNFFNP
FT                   ERGFTYSTGIGIGIGFFLNSNTKHLIFRPYYTFSINTFDFLIVAMILTRETLNIPKEMQ
FT                   YFKSYIGGGINWHIANLIKKTKYFCSTIGIGGRFYLSTNFIGDIQFYEKLPYVLEPYMF
FT                   IEISTKKAIPLMGLDFKIDFLFLDTFNISFNFTIRYNLKDEKEMET"
FT   gene            422805..423686
FT                   /gene="nucA"
FT                   /locus_tag="BG0412"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        422805..423686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BG0412"
FT                   /product="endonuclease precursor"
FT                   /note="fused from Borrelia burgdorferi BB0410 and BB0411"
FT                   /db_xref="EnsemblGenomes-Gn:BG0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07262"
FT                   /db_xref="GOA:Q661K9"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K9"
FT                   /protein_id="AAU07262.1"
FT                   /translation="MKKRSKFFLYCYILCLAGFLFFSLNPKVLKQIKHKINDYLEIIEN
FT                   KYIKITKSIPIKESQLIPKGYLTTQIISKKHYTLGYAESARQSEWAAYPLKREMVELAL
FT                   TLLKSKKIKRSPKFFEDTNIKGIFPKLEDYFKSGYDRGHIVSSADMSFSENAMKDTYFL
FT                   SNMSPQKSEFNSGIWLKLEKLVREWAILKGYIYIISAGILTENKGFIGKNKILIPKNFY
FT                   KIVLAINNKNFYDIISFIIPNEKAKDLNLKNYVVNVDLIEKKTKIDFFAKLDSKIKKNI
FT                   KKIKTTHSWRFK"
FT   gene            423683..424462
FT                   /locus_tag="BG0413"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        423683..424462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0413"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0412"
FT                   /db_xref="EnsemblGenomes-Gn:BG0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07263"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07263.1"
FT                   /translation="MKSIFTKLNASINLFLFIIFILATLVILIFSYKIKYNGNYQNYVL
FT                   EIYNNNFIILVNKFAIFFAGIIGSLWSYINYKRTNNIQFILFYCFISSYTLEPILISED
FT                   FFLKNNLNSSYYLFTKFIIFVNTFSLLNLFFLSLYICDFKIKSINYTIYIILTFACIYS
FT                   YTMPINSYENSQNYGILKIKSTKFYIDAFLSLILINFIVAFLRKKNFDYFFLFVSMLLI
FT                   LSGIYLNLLKIPYAFLPISIGIPIYLKKSGKIFFYWL"
FT   gene            complement(424450..425070)
FT                   /locus_tag="BG0414"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(424450..425070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0414"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0413"
FT                   /db_xref="EnsemblGenomes-Gn:BG0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07264"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K7"
FT                   /protein_id="AAU07264.1"
FT                   /translation="MFNKFKRIIFREDVKYEIFRKFFHIFSLIVLFFYGINFWIGFFSN
FT                   ILFMILYLSSEVFRITKKKLLFFKTISDIILKSRKILPNKVSFPPVFLFLGILISYCLV
FT                   MEPFNYIGIFSVCLGDGFASIAGKLIPSFKLVNGKTISGSLVVFCATFFSYYYFFPYLI
FT                   TALILGILAVLVELFDADNYDNLFLPLIVSTSSYFLTSFFYSQ"
FT   gene            complement(425063..425125)
FT                   /locus_tag="BG0415"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(425063..425125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07265"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07265.1"
FT                   /translation="MFKKKFANADLIYLKRLNDV"
FT   gene            425317..426174
FT                   /gene="cheR-2"
FT                   /locus_tag="BG0416"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        425317..426174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR-2"
FT                   /locus_tag="BG0416"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0414"
FT                   /db_xref="EnsemblGenomes-Gn:BG0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07266"
FT                   /db_xref="GOA:Q661K5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K5"
FT                   /protein_id="AAU07266.1"
FT                   /translation="MLEIEDKLFLKFCDFIYNNSGMRFDEKNKFVLQSRINDAVRELAL
FT                   KNPSQLYNLIISEKLKKEYFLDLVTTNLTRFFRNSLHFQTFEKFVIPNLINIKNIEEKN
FT                   RIIIWSAGCSTGEEPYSLAFVLKSKLPKEIDFIIIASDLSLKSLMIAKEGYYSSNKCEN
FT                   IPKEYRHYIYSHSNGYKIKHEIKNHIRFDYHNLNFESNFSEIDVIFCRNVLIYFDEKSK
FT                   IKVLKKFYNNMSKNGYLFIGHSESLFGLNLPFKFLKTPWAIIYEKKDTGSQKEKFKLQN
FT                   KYKL"
FT   gene            426110..426193
FT                   /locus_tag="BG0417"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        426110..426193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07267"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07267.1"
FT                   /translation="MKKKILALKKKNLNYKINISYNLTRIK"
FT   gene            426207..427334
FT                   /gene="cheB-1"
FT                   /locus_tag="BG0418"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        426207..427334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB-1"
FT                   /locus_tag="BG0418"
FT                   /product="protein-glutamate methylesterase"
FT                   /note="ortholog to Borrelia burgdorferi BB0415"
FT                   /db_xref="EnsemblGenomes-Gn:BG0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07268"
FT                   /db_xref="GOA:Q661K3"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K3"
FT                   /protein_id="AAU07268.1"
FT                   /translation="METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNK
FT                   LKKHNPEVILMNLEENNIKDILFLEKKNNINKTIPIIVTSSNQNLINIAALKGADDLIL
FT                   VSKNKKSHEIKKEQIINSLLAYGSISIKNKIVCNKDMKIKNYEGARIFLNHKNDIFSLN
FT                   KLEEHTKEKILNEKEIKKLKLRKFDIIAIGISAGGPVALKSILPEIPESFPPIIIVQHM
FT                   PKGFTEEFAKNLNNLCKIRVKETANKEILKQGHAYISSGGYHTKIQKIDGNYKIQIFDG
FT                   KHINGHKPSIGVLFQSIAEIAKDKAIALIMTGMGNDGSREIGDIKKAGGLTIAQDKESS
FT                   MVFGMPKIAIKENNIDYIVPLNHMVKLLKAILIDS"
FT   gene            427358..428572
FT                   /gene="traB"
FT                   /locus_tag="BG0419"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        427358..428572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="BG0419"
FT                   /product="pheromone shutdown protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0416"
FT                   /db_xref="EnsemblGenomes-Gn:BG0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07269"
FT                   /db_xref="GOA:Q661K2"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K2"
FT                   /protein_id="AAU07269.1"
FT                   /translation="MDNKKGNTNKEDYFSHVSKFNIHDKTIYILGTAHVSKKSSEDTAN
FT                   LIEILKPDYIAVELDEARYHSILNTDENEKWRNLDIDKALKQGKAFFLIINIILSNFQK
FT                   KLAKEQGIQPGEEMKTAILKAKKHNIPLILADRKIETTLKRAWISIPIFEKIKIISSLF
FT                   SLTDTKLTKDEIEKLKEQDALSKVMEELSKEIPKVKKVLIDERDEFITNKILEGTGIVL
FT                   AVVGAGHVNGIMSTLKEISQNKKIINVEELDKIPKKHFSFGKVLSYLIAISIILLIVSS
FT                   FYFKGFDFAYKNLKLWIISNSLFSGIAAILLKSHPLPFLTAVIGSPIFSLIPFIGTGMV
FT                   AGLVEAYINKPKVKDFENLQEELSTTKGYFKNKVTRILLIVLFVNLGSTIGTIVGLKFL
FT                   LNVFK"
FT   gene            428611..429246
FT                   /gene="adk"
FT                   /locus_tag="BG0420"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        428611..429246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BG0420"
FT                   /product="adenylate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0417"
FT                   /db_xref="EnsemblGenomes-Gn:BG0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07270"
FT                   /db_xref="GOA:Q661K1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661K1"
FT                   /protein_id="AAU07270.1"
FT                   /translation="MGLVFLGPPGSGKGTISKIISNEFKYHHISTGDLFRENILNSTTL
FT                   GKEIKKIVEKGELVPDQITIKIVKDKIKAIKKNDNFILDGFPRNICQAEALDKFLPNVK
FT                   IINFLINEELVIKRLSGRRICKSCNNIFNIYTLATKKNGICDVCKGDLYQREDDKEECL
FT                   KTRLKEYKLQTKPLIEFYSKCSRLNNVDASVEIDEIKKKIIKIMLKKN"
FT   gene            429269..430312
FT                   /locus_tag="BG0421"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        429269..430312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0421"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0418"
FT                   /db_xref="EnsemblGenomes-Gn:BG0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07271"
FT                   /db_xref="UniProtKB/TrEMBL:Q661K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07271.1"
FT                   /translation="MEKVFKIKKICFCLLLLLQAKIVLAQNQHDLKFNNEYFYFNFQSA
FT                   YYPPHELGTSGSNFSQSFKHPNFQNIEPSLKIPANYWGGIKLISYLGYYKNFKALHNPN
FT                   SIFFKNNGIEVDLNIGLSPVSISLKSMLSFTPIAFLNLYVSNEIGMGWKAFGFKGIGVH
FT                   IENGKYSNDIEFYSEITIGGRFQFDLNAIFKGEWTHIITVIGNDFTYLINPHANKDQLW
FT                   KYKADDGKNINGMLIKPYALLAYKMPIPLNTIGLLYEGKTQIGKERNISSWKNKGWGSD
FT                   IFYHNISLIANFEVVKPLTIGLQLKLSTNPTYTSNTAGLADVSKRIATGNSYFYYDSIG
FT                   ISVTYKY"
FT   gene            complement(430331..431254)
FT                   /gene="rrp-1"
FT                   /locus_tag="BG0422"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(430331..431254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp-1"
FT                   /locus_tag="BG0422"
FT                   /product="response regulatory protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0419"
FT                   /db_xref="EnsemblGenomes-Gn:BG0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07272"
FT                   /db_xref="GOA:Q661J9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J9"
FT                   /protein_id="AAU07272.1"
FT                   /translation="MEMIIKDKAFEVENQKLLIVDDSPTNLDLLVNILQGAYEVEVATN
FT                   GLDALKQVEKDSPDLILLDIGLPDINGYEVCRKLKSDPDTKEIPVIFISSRGSTDAQLE
FT                   GFNVGGVDYILKPFNSRIIDARVKTHLELKRLRDYFKSLSRIDGLTQIPNRRFFMDKFS
FT                   KSWIKALESKEIVIVGMLDIDNFKNYNDNYGHTNGDECLKLIAKALYKVSLKYKIDVAR
FT                   YGGEEFIFFSVNKSLNEMISIIKTMINDIKCLRIVHDHSSTSNIVTVSIGLAQEIPIDN
FT                   NFTNIIKLADSKLYEAKVSGRNQFRY"
FT   gene            complement(431257..435747)
FT                   /locus_tag="BG0423"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(431257..435747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0423"
FT                   /product="sensory transduction histidine kinase/response
FT                   regulator"
FT                   /note="ortholog to Borrelia burgdorferi BB0420"
FT                   /db_xref="EnsemblGenomes-Gn:BG0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07273"
FT                   /db_xref="GOA:Q661J8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J8"
FT                   /protein_id="AAU07273.1"
FT                   /translation="MKKANFLSINFLILLLVCFFNVNLFSKDIFKFKLVGQYFPFYYKN
FT                   GKGKYEGLIFPILDKWAKDNNFDIRVETIDNLNESKIEDDSIYLGLTYRSKLNDLFYFK
FT                   SEFSRSIAILFSKSSNKKYKNAHSPWLSNFNIGVVKNPIYEEFLKLRRANTIFLVDNAE
FT                   ELLLALKNDKVDYIYGDCKTLAYIAKRFLGEDLAIFNGDIFYSIKNRVAISRNAPEIIK
FT                   NLNLDLFSYLMEIPDEHVFSFLDSTSKGNFIDIGLYNDYPPLSFINSKGKLSGILVDLW
FT                   NLLSRQHIFKPIFKGFPKEDIKKSLDGKSVGIFGGIISNDSVFKNVNYVVSKPIYPLNF
FT                   KFYSKGLSNNVGPINSQFIDFDFNNIQLNKNQDIVNNFIDIVNNSYGFIENSITTKYLL
FT                   KLNGYNGRLKSYDSIFNKNRFLVLAIDNRIYKVIKYILNSIFDDISFESLLQIDKNWLD
FT                   KEEINSSRINSYKIMNKLKFNIEEKIWLLKNNKLNLAVKNWYPIDYVEANNYKGINQFL
FT                   LDKIRMFSGLEFNIIETHSILDLKKLIKSGKIDMLNTNAIDSNLDNVFNIKLNSRIPLY
FT                   IFSNKKRVLPSRSLERFAVLDFLYNKNLTSNIKSKLILVSSFKEALLLLYKGKIDGIIS
FT                   DEYTAAAVFEELNVADVEKLPTFRDLAFDLSLAIYNQDYILKEIIQKVVIRSNVDSQKY
FT                   LNDWKFDIYYKSKGIRFKNFKFLVLTVIIFYFTFLGFVIILMFKLSFEQKRKYFSVMNE
FT                   KKIAESANTAKTIFIANISHDIRTPINGIMAATELLDTTILTDVQKDYVRMINYSSDSL
FT                   LSLIDDILYLSQIDVNELYVDSQEIDLESEMEMVLKIFQSQCAKKNIDLFSYSKSIFKN
FT                   YIKGDIVKIKQVLINLIGNAFKFTDDGVIVLNYEEVCRTRVDDNRVLVTVEFKVIDTGK
FT                   GIKRENLSKIFEIFKQEDDSSSRVHEGAGLGLSISRELIRLMGGLGIAVDSKVGEGATF
FT                   SFMLPFYLGDELKSESLSINTFQLINSNNKVKVLNVLLSQKSIKIFEHCSTLLGESSNV
FT                   DYVASFEDAYKSFKEAPFYNFVFVNVNNDNIKESIRFANNIERLSPDVQIIFLFYYLDN
FT                   KALKNLKYMYVKKPLMGLGISSILSKKEFKIETDFEDLVPIDSAFKIKGPINVLIAEDN
FT                   QVNQKVLKDILVVIGINENLIDVVDDGLKALKSLKEKQYNISFIDIRMPRYDGFSVARE
FT                   IRKFEKAKNLKPCVLVAVTAHALQEYKDQCFESGMNDYISKPIHISSIKIILKKYLQFE
FT                   VDDTWENKDLNQPVNFPHLDINRALKELNLSYALYSELCRGLVDFISINIIDLEKAFDE
FT                   ENLPLIRDISHSISGALSNMRSELYKDFKKIETSKDSIYELKKMYSFVKDDLLRLINNI
FT                   KENVLLESEVISENKLYFKNNDQFLTLLNKLLIGIKTRKPKEYKEILESIEKYVLDDNI
FT                   QILFSDLRRNLRLYRFAESSKILKEIIEMFSNKRY"
FT   gene            435846..435957
FT                   /locus_tag="BG0424"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   rRNA            435846..435957
FT                   /locus_tag="BG0424"
FT                   /product="5S ribosomal RNA"
FT   gene            435979..438912
FT                   /locus_tag="BG0425"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   rRNA            435979..438912
FT                   /locus_tag="BG0425"
FT                   /product="28S ribosomal RNA"
FT   gene            439090..439201
FT                   /locus_tag="BG0426"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   rRNA            439090..439201
FT                   /locus_tag="BG0426"
FT                   /product="5S ribosomal RNA"
FT   gene            439223..442156
FT                   /locus_tag="BG0427"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   rRNA            439223..442156
FT                   /locus_tag="BG0427"
FT                   /product="28S ribosomal RNA"
FT   gene            complement(442357..443196)
FT                   /locus_tag="BG0428"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(442357..443196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0428"
FT                   /product="hydrolase"
FT                   /note="ortholog to Borrelia burgdorferi BB0421"
FT                   /db_xref="EnsemblGenomes-Gn:BG0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07274"
FT                   /db_xref="GOA:Q661J7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J7"
FT                   /protein_id="AAU07274.1"
FT                   /translation="MNSNYKRYKMLVFDLDGTLLNDSHEITFLTLEVLLTLEKDFKIII
FT                   ATGRRLSEIRNVRNQLKEININENYLVTANGAEVFLQENLIFRHAMSYSLVKEILKIHK
FT                   DNVDVNLYTFDTWYSNSDVKSPIMKHFIRDLGLNVIIGDLTKLDVDSVSKIVYYCDDLA
FT                   TLNKLDNEIKNKDFQDIRVFFSSKDLLEITNINADKYNAIKNIAFLENIPLSDVLAFGD
FT                   NNNDYEMLKNLGKGVLMKNANEFLKINLANNETTKFSNNEDGVARFLIDFFELNIKY"
FT   gene            complement(443330..443890)
FT                   /gene="mag"
FT                   /locus_tag="BG0429"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(443330..443890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mag"
FT                   /locus_tag="BG0429"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /note="ortholog to Borrelia burgdorferi BB0422"
FT                   /db_xref="EnsemblGenomes-Gn:BG0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07275"
FT                   /db_xref="GOA:Q661J6"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661J6"
FT                   /protein_id="AAU07275.1"
FT                   /translation="MDRYFFLQDATTVARLLLGNLLIRKINKKEIVARIVETEAYMGIA
FT                   DSACHSYGGKRTNRTNAMYSIGGYSYVYMIYGMHYMFNVVTADKNNPQAVLIRSIEPIS
FT                   PLLGKKSALTNGPGKLTKFLNIDLTFNKVDLIGNNELFLQRDLNLDFNIVCSKRININY
FT                   AQEDDINKLWRFYIKDNKFVSRR"
FT   gene            444915..444988
FT                   /gene="trnI"
FT                   /locus_tag="BG0430"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            444915..444988
FT                   /gene="trnI"
FT                   /locus_tag="BG0430"
FT                   /product="tRNA-Ile"
FT   gene            complement(445610..445708)
FT                   /locus_tag="BG0431"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(445610..445708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07276"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07276.1"
FT                   /translation="MSPDHHGPYVLGNTYYNGLCKAELNSDAKQGA"
FT   gene            complement(446525..446598)
FT                   /gene="trnA"
FT                   /locus_tag="BG0432"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(446525..446598)
FT                   /gene="trnA"
FT                   /locus_tag="BG0432"
FT                   /product="tRNA-Ala"
FT   gene            complement(446773..448310)
FT                   /locus_tag="BG0433"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   rRNA            complement(446773..448310)
FT                   /locus_tag="BG0433"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(448522..449070)
FT                   /locus_tag="BG0434"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(448522..449070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0434"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0426"
FT                   /db_xref="EnsemblGenomes-Gn:BG0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07277"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07277.1"
FT                   /translation="MKIYLASPFFNEEQIKLRDEVLKFLEEFNLDIFSPEHHAVKKMGL
FT                   LEKVDYKFANRDIREKIREIDLKELVSSDIVLALVNYVDAGTAYERGFAFAKKIPSIDF
FT                   FKDKKDSDFYNLMYSDCNASFSNYKDLREGILTFKELWIKFKGDNESFRTFFDYLKAKL
FT                   GDKLKKILTTLPVNEKCGC"
FT   gene            complement(449165..449839)
FT                   /locus_tag="BG0435"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(449165..449839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0427"
FT                   /db_xref="EnsemblGenomes-Gn:BG0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07278"
FT                   /db_xref="GOA:Q661J3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661J3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07278.1"
FT                   /translation="MLYIVGTPIGNLEDITYRAVDVLKSVNVIFAEDTRVTIKLLSRYK
FT                   INKKMISCNAVTENKKIRLLLDYLAKGDSVAFVSDAGTPGLSDPGSLLVAAAFREGYKV
FT                   CPIPGVSSFNTIVSVNPFRDKSVLFEGFLPNKGLKRFKKIAELYKRGDAFVLLESGHRL
FT                   LKLLVEISSVSLDAKILIGREMTKIYEEYQIGKPLELKKYFESSKEKVKGEFTILVSRS
FT                   SS"
FT   gene            450048..450365
FT                   /locus_tag="BG0436"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        450048..450365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0436"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0428"
FT                   /db_xref="EnsemblGenomes-Gn:BG0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07279"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07279.1"
FT                   /translation="MFALIRKIFIIYFLCITLAGFAMIFIDSKFTEQSNAKENQNKINQ
FT                   HKIEPNLIMFTSSIGGFLGVYAGIWIFNYDKNNFYLNWGNLIILIYNIALIITVYSKSH
FT                   S"
FT   gene            complement(450395..450784)
FT                   /locus_tag="BG0437"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(450395..450784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0437"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0429"
FT                   /db_xref="EnsemblGenomes-Gn:BG0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07280"
FT                   /db_xref="GOA:Q661J1"
FT                   /db_xref="InterPro:IPR015067"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR037081"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07280.1"
FT                   /translation="MISGLNPTLRLFKDHKILYSNMERGLKPLLEVDNFINKYIQNKEG
FT                   LEIYDKVVGKAAAIIIYNIGLQNVQAGVVSQPAKDFLESRGIKVAYKKLVEKINDKAEN
FT                   LIESLENPEEVYKYMIKRGIIVNNL"
FT   gene            450902..451507
FT                   /locus_tag="BG0438"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        450902..451507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0430"
FT                   /db_xref="EnsemblGenomes-Gn:BG0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07281"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q661J0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07281.1"
FT                   /translation="MIFVPKNNSNSKIEIKKSIFVSYILNIEKKEDISKTIKKYKIKFK
FT                   NATHVVYGFRIGNKNSFLNGMSDNREPNLTAGKPTLDAIIHNNLTDTLIITLRYFGGTL
FT                   LGRGGLIKAYYKSAKEVIKNTPIIEKEELETLSLNLNYNQYNLLLKMKNKLEIEIIDSN
FT                   FSNKINTSIKFKTKNKQKISEFFIKNGLIQEIIKFNKE"
FT   gene            451616..452368
FT                   /locus_tag="BG0439"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        451616..452368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0439"
FT                   /product="chromosome segregation protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0431"
FT                   /db_xref="EnsemblGenomes-Gn:BG0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07282"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I9"
FT                   /protein_id="AAU07282.1"
FT                   /translation="MKIISVINQKGGVGKTTSAINISYSMTLLNKKILLIDIDSQGNST
FT                   SGTNTSEYIVENSSYELINKKIKVKPLNHFELDIIPSSIKLALLEKELINELSRENFLK
FT                   NALTLYEKDKYDFIIIDCPPTLSILNINALIASNYLLIPIETEFFAFEGINQLIDTINT
FT                   VKQINTNLEILGVFINKYDIRNKSKEKYVSSLKKVFKEKLLNTKIRKNITISKSQEAKM
FT                   PVYEYDKESNAAKDFLELSKEIIDKIEE"
FT   gene            452371..453084
FT                   /locus_tag="BG0440"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        452371..453084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0440"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0432"
FT                   /db_xref="EnsemblGenomes-Gn:BG0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07283"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07283.1"
FT                   /translation="MSDNLETLMFLMGKKLETSSSDSRNIEKKEIISIERKNFDYNNLD
FT                   KSISDFLKTKQYEIFNIFNNTYTKIGKILKETQDKLKGNNQYNGLFYRWFKSMGFKKDK
FT                   VYALISRYNLLIENSDKQLTIEKLPLSLSYEISKKSCPSILKDEVLNGKINSLKEFKIV
FT                   YKKSFDLKNTHKSLLNKDKKYENDIKEELDFILKNIIEFKNIEFNKLSQENLKLFFHSI
FT                   LEIKKKIKYIKNNFI"
FT   gene            complement(453353..454135)
FT                   /gene="spo0J"
FT                   /locus_tag="BG0441"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(453353..454135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0J"
FT                   /locus_tag="BG0441"
FT                   /product="stage 0 sporulation protein J"
FT                   /note="ortholog to Borrelia burgdorferi BB0434"
FT                   /db_xref="EnsemblGenomes-Gn:BG0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07284"
FT                   /db_xref="GOA:Q661I7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I7"
FT                   /protein_id="AAU07284.1"
FT                   /translation="MDGVYKMIDIQLLDIDNDQPRKFVSPVELEELSISIKENGILQPI
FT                   IVCKANERYKIIVGERRFRAAKLIQMTNIPVIEVNIKESCRDFMPLVENIQRENFTPVE
FT                   EAYAYKNVMNKYSLTQKDLSEKIGKSRAYISNLVRILDLEQEILNAVHRKEISFGHAKV
FT                   ILSLKDKQDRYNLYLMIVKKKFSVRDAEKYVKNFYKSIVRKRELEQDPFLSNIKEFLFD
FT                   KIQTKIDIKGNQDKGKIEIEYFTAGDLRRIVSFFGNIS"
FT   gene            complement(454254..456686)
FT                   /gene="gyrA"
FT                   /locus_tag="BG0442"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(454254..456686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BG0442"
FT                   /product="DNA gyrase, subunit A"
FT                   /note="ortholog to Borrelia burgdorferi BB0435"
FT                   /db_xref="EnsemblGenomes-Gn:BG0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07285"
FT                   /db_xref="GOA:Q661I6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I6"
FT                   /protein_id="AAU07285.1"
FT                   /translation="MAVGENKEQILNIKIEDEIKTSYLNYAMSVIVSRALPDVRDGLKP
FT                   VHRRILYSMYELGLRSDKAFKKAGRIVGDVLGKYHPHGDQSIYDALVRLAQDFSLRYPV
FT                   IRGQGNFGSIDGDPPAAMRYTEAKMERITEYIVKDIDKETVNFKSNYDDSLSEPEIMPS
FT                   SFPFLLVNGSSGIAVGMATNMAPHNLREICDAIVYMLDNENASIFDLLKIVKGPDFPTF
FT                   GEIVYNDNLIKAYKTGKGSVVIRARYHIEERIEGRNAIIVTEIPYTVNKSALLMKVALL
FT                   AKEEKLEGLLDIRDESDREGIRIVLEVKRGFDPHVIMNLLYEYTEFKKHFSINNLALVD
FT                   GIPKQLNLEELLFEFIEHRKNVIERRIEFDLRKAKEKAHVLEGLNIALNNIDEVINIIK
FT                   SSRLAKDARERLVANFGLSEIQANSVLDMKLQKLTALEIFKLEEELNVLLSLIKDYEDI
FT                   LLNPARIINIIREETINLGLKFGDERRTKIIYDEEVLKTSMSDLMQKENIVVMLTKKGF
FT                   LKRLSQNEYKLQGTGGKGLSSFDLNDGDEVAIALCVNTHDYLFMVSNEGKLYLINAYEI
FT                   KDSSRASKGQNISELINLGDQEEILTIKNSKEFTDDSYLLLTTASGKIARFESTDFKAV
FT                   KSRGVIVIKLNDKDFVTSAEIVLKDEKVICLSKKGSAFIFNSRDVRLTNRGTQGVCGMK
FT                   LKEGDLFVKVLAIRENPYLLIISENGYGKRLSISKISELKRGATGYTSYKKSDKKAGSV
FT                   VDAIAVSEDDEILLVSKRSKALRTVAGKVSEQGKDARGIQVLFLDNDSLVSVSKFIK"
FT   gene            complement(456698..458602)
FT                   /gene="gyrB"
FT                   /locus_tag="BG0443"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(456698..458602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BG0443"
FT                   /product="DNA gyrase, subunit B"
FT                   /note="ortholog to Borrelia burgdorferi BB0436"
FT                   /db_xref="EnsemblGenomes-Gn:BG0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07286"
FT                   /db_xref="GOA:Q661I5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I5"
FT                   /protein_id="AAU07286.1"
FT                   /translation="MNYVASNIQVLKGLEAVRKRPGMYIGSVSVNGLHHLVYEVVDNSI
FT                   DEALAGFCDRIDVVINLDNTITVIDNGRGIPTDIHEEEGISALELVLTKLHSGGKFNKG
FT                   TYKVSGGLHGVGISVVNALSSFLEVYVNRDGKIFRQTFSKGIPTSKVEVVGESSVTGTK
FT                   VTFLADSEIFETLDYNFDVLEKRLKELAFLNDKIYITIEDKRAGKEKSSKFYFEGGIKS
FT                   FVDYLTNDSKAFQSESYYIDGFINDVIVNVGLKWTESYSDNILSFVNNINTREGGTHVM
FT                   GFRSGLTKAMNEAFKNSKISKKDIPNLTGDDFKEGLTAVISVKVPEPQFEGQTKSKLGN
FT                   SEIKKIVEIIVYEHLLEIISSNPLEIDIILEKAIRAARAREAARKARESERKKNAFESL
FT                   ALPGKLADCASKNPSEREIYIVEGDSAGGSAKMGRNRFFQAILPLWGKMLNVEKTREDK
FT                   VITNDKLIPIIASLGAGVGKTFDITKLRYHKVIIMADADVDGSHIRTLLLAFFFRYMRD
FT                   LIENGYIYIAMPPLYKIKYDNRIYYFYDEKEKEKFLDSIETKNRNNIFLQRYKGLGEMN
FT                   PTQLWETTMDPARRKMRLINIDDAIEAEKIFVTLMGDLVEPRKEFIEQNALNVINLDV"
FT   gene            458789..460243
FT                   /gene="dnaA"
FT                   /locus_tag="BG0444"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        458789..460243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BG0444"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0437"
FT                   /db_xref="EnsemblGenomes-Gn:BG0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07287"
FT                   /db_xref="GOA:Q661I4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661I4"
FT                   /protein_id="AAU07287.1"
FT                   /translation="MEKSKNIWSLILTEIKKELSEEEFYVWFENLCFLESIGDNIQIST
FT                   PNLFHKNQIEKRFTKKIKEILTKNGYNNVTIVFTNQPPKTYSSKQESEKTTFKETLQNF
FT                   DKLKGNTLSKEPIQSIKDRIKMYIKEEEPTNFKNPFLKKRYTFENFIIGPNNRLAYNAS
FT                   LSISKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHNNLKILYVTAENFLNEFVES
FT                   IKTHETKKFKKKYRYLDMLLIDDIHDLQKKEGIQEELFHTFNALYEDNKQLVFTCDRSP
FT                   SELTNFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKDILNLVAQKVTT
FT                   NVRDLEAAVTKLKAYIDLDNIEIDIDIVEKIIKEIIIYEKETTNESSNKINIENIKKIL
FT                   LRELKIAHKDIEGHSKKPEITKARHIYAYLLRNFTELSTVEIGKIIGGKTHSTVLYSIN
FT                   KIDRDRNNDKEINNLITELMNKIKKN"
FT   gene            460484..461644
FT                   /gene="dnaN"
FT                   /locus_tag="BG0445"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        460484..461644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BG0445"
FT                   /product="DNA polymerase III, subunit beta"
FT                   /note="ortholog to Borrelia burgdorferi BB0438"
FT                   /db_xref="EnsemblGenomes-Gn:BG0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07288"
FT                   /db_xref="GOA:Q661I3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I3"
FT                   /protein_id="AAU07288.1"
FT                   /translation="MLNNTFFICETNQITSEIEKAKGIILNRNMNDIWSALLIEVKRSN
FT                   LIIKSTDRNIFFESTISIISETDFKVLINASNFYDAVKAFSFYKKIKIVFNENNSKLEI
FT                   MGEAKDEKEEKCEDHLKEPTFSYEEIENYNYDMVNEDYTFEIELKQKSFKKIINRIAFS
FT                   AHLDESKNVLNGIYFTKGEDSKLLLVSTNGHRMSICKTEVIVEEDVNFIVPVKIFNFLK
FT                   HLMSGEGMVKIKSSDKKFYVEFDNYKIACSLISGNYPDYESIIPKEQENKSLVSLSILK
FT                   DRLARVNLYVDKSKKLILTFSELQFKLLGEDLITGRKGEFFIKNPNYLYDGSDEVVAIN
FT                   ISYFIEAISVFETSKIEIQFNSGNVLKLSEPENFNFTHLIMPMSLG"
FT   gene            461737..462036
FT                   /locus_tag="BG0446"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        461737..462036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0439"
FT                   /db_xref="EnsemblGenomes-Gn:BG0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07289"
FT                   /db_xref="UniProtKB/TrEMBL:Q661I2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07289.1"
FT                   /translation="MNDSAFKKIGNVLKDYLESNLLVNKKISSKLLIADKWNQIFKTLS
FT                   DDVKFLDLKNEQVLFLEVSNSSILYSISINKSKIIREIKELTRIAIIDIKVLVK"
FT   gene            462128..462283
FT                   /gene="rpmH"
FT                   /locus_tag="BG0447"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        462128..462283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="BG0447"
FT                   /product="ribosomal protein L34"
FT                   /note="ortholog to Borrelia burgdorferi BB0440"
FT                   /db_xref="EnsemblGenomes-Gn:BG0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07290"
FT                   /db_xref="GOA:Q661I1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661I1"
FT                   /protein_id="AAU07290.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRMKLTVS
FT                   DEKKKY"
FT   gene            462264..462599
FT                   /gene="rnpA"
FT                   /locus_tag="BG0448"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        462264..462599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BG0448"
FT                   /product="ribonuclease P protein component"
FT                   /note="ortholog to Borrelia burgdorferi BB0441"
FT                   /db_xref="EnsemblGenomes-Gn:BG0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07291"
FT                   /db_xref="GOA:Q661I0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661I0"
FT                   /protein_id="AAU07291.1"
FT                   /translation="MKKRNISLKSKIEIQKIFKEGNLIRFSNLNLKMFFKSNNLIYSRL
FT                   LVTFSKGFRGSVKRNRVRRLFKEAFRKRLELLEGRAVDIIFVVSYNRLNLTYFRIESLI
FT                   KNLVLMV"
FT   gene            462610..464244
FT                   /locus_tag="BG0449"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        462610..464244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0449"
FT                   /product="inner membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0442"
FT                   /db_xref="EnsemblGenomes-Gn:BG0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07292"
FT                   /db_xref="GOA:Q661H9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661H9"
FT                   /protein_id="AAU07292.1"
FT                   /translation="MNQSKKILRTVYLSLFLIGLFMLINDIFSSIMLSFKSSDKEVQFD
FT                   LNKSFDDNEIFLSKSNGFDLINKSQNIVVETEIYFATFSTFRGNLVSLKLKNHLNLEKD
FT                   PTDLINVDYKNETFFDVSLDYLVEDLFLYKKIDNLNHEFKAYFKNHGKIYEYVKKYTFS
FT                   EKNEYLMKFTVIVNSLNDYDLFDIDSYKIVFSSEIERLSDKAKLQYNNYLSQIIYYDNK
FT                   LKYGKDGLSINNPRWIGSSTKYFEVLISRENMEVEFKKERGVLKSFIVNNVGNKKNISD
FT                   EFFIYAGPKDNRYLDIFDKSGDNTFGLSDIAFGMSVEKSLWYLIQVPMQMVMQVFYDVI
FT                   PNWGLSIIFLTIVVRILIFPLTFKGFRATAELSKLQPKMKELQVKFKHDPKKLNEEMGR
FT                   LYKEEGVNPLGGCFPVILQLPIFFALYSLVNNLFLLRGASFIPGWIDDLSIGDSVYNFG
FT                   YRLYFVSWTDIRILPFIMMFTQLGSTIVSSNLDLKNLGAQQKFLYFGMPIMFFFILYNM
FT                   PSGLLIYWITTNIFTILQQYYIKMHLS"
FT   gene            464257..464985
FT                   /gene="jag"
FT                   /locus_tag="BG0450"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        464257..464985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="jag"
FT                   /locus_tag="BG0450"
FT                   /product="spoIIIJ-associtated protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0443"
FT                   /db_xref="EnsemblGenomes-Gn:BG0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07293"
FT                   /db_xref="GOA:Q661H8"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H8"
FT                   /protein_id="AAU07293.1"
FT                   /translation="MSYEFYGKTEQEAIKKAMRDLELKEGEFDVEILDKERVGFLFKKE
FT                   MIKIRVSPHVKEVKKGGFEIKIGDEICDKILEFLKEMLIKMGYSVNLIIEPKEGGHIKI
FT                   SIETDSPNILIGREGKNLDSLQLLTNVYTSKLIGENGSFNRVVLDIGDYRERFKSRFIN
FT                   LAINSFHKVKRTRRSILLPSMNPFERRIIHTTLNRYSDIKTESEGDGNIKRIRVSYVRN
FT                   NRFSNNNSRSYQKKDLGFKK"
FT   gene            464912..465016
FT                   /locus_tag="BG0451"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        464912..465016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07294"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07294.1"
FT                   /translation="MSEIIGLVTIILAVIKKKILVLKNKLMALVCIEF"
FT   gene            465031..466098
FT                   /locus_tag="BG0452"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        465031..466098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0452"
FT                   /product="nucleotide sugar epimerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0444"
FT                   /db_xref="EnsemblGenomes-Gn:BG0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07295"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H6"
FT                   /protein_id="AAU07295.1"
FT                   /translation="MKIFLTGIAGFIGFHVAKKLVEEGHEVLGVDILNDYYELKFKNER
FT                   LEALGFCPKDVKTHKIIKSKKYNNLSFAYLDILNKDKLLKLFKEYKFTHVCHLAAQAGI
FT                   RDSLENPDSYVSINIVGFFNVLDVCRVYKENIKHFVYASTSSVYGINENIPSSEDSITD
FT                   HPLNLYAASKKSNEMIAHAYSASFNIPTTGLRFFTVYGTYGRPDMALYLFSDGIKNCEP
FT                   INIFNNGNMARDFTYVSDIANGVYKVLKNPAKSDCNFDVKNPNSSTSSFPYRIYNIGTG
FT                   HATKLLDFIRELEANFDKKALKNYMPMQKADVVESCCDIVKLKNDVGYEAKISIKEGIK
FT                   EFSQWYKMLESTEKV"
FT   gene            466260..467339
FT                   /gene="fba"
FT                   /locus_tag="BG0453"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        466260..467339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="BG0453"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="ortholog to Borrelia burgdorferi BB0445"
FT                   /db_xref="EnsemblGenomes-Gn:BG0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07296"
FT                   /db_xref="GOA:Q661H5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H5"
FT                   /protein_id="AAU07296.1"
FT                   /translation="MGVLDKIKPGVVYGKELHSLYEICKKEGFAIPSINCIGTNSINAV
FT                   LEAAKEINSPIMIQFSNSGSAFICGKGLKMEKLQGVSIVGAISGAMHVHLMAEHYGVPV
FT                   VLHTDHCAKNLLPWVEGLLEYGEKYYSQHKRPLFSSHMLDLSEEPIKENIEISKKFLER
FT                   MAKIEMFLEIELGITGGEEDGVDNSDRALHELFSTPEDIYYGYSELLKISPNFQIAAAF
FT                   GNVHGVYKPGNVKLTPKVLKDGQDYVISKTGVNVTKPVSYVFHGGSGSTIDEINEALSY
FT                   GVVKMNIDTDTQWAAWEGVLNYYKKNESRLQGQLGDGKDIDIPNKKFYDPRVWLREAEV
FT                   SIKERVKIACKNLNNINRN"
FT   gene            complement(467793..469553)
FT                   /gene="aspS"
FT                   /locus_tag="BG0454"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(467793..469553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="BG0454"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0446"
FT                   /db_xref="EnsemblGenomes-Gn:BG0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07297"
FT                   /db_xref="GOA:Q661H4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661H4"
FT                   /protein_id="AAU07297.1"
FT                   /translation="MFKVIKCNELNEKLINKKVEINAWVKKIRHHGKFIFLNIRDRYEK
FT                   AQVLITEEHLLKIAEKIKLEYCIKIQGLLSKRPPNMINENMKTGSFEILAKNIEIISKC
FT                   NELPFMIEDDNNASENSKLKYRYLDLRRDSLKNKIILRCQATHLIRNFLVKKKFLELET
FT                   PTFVKSTPEGARDFVIPSRIHKGSFYALPQSPQLYKQLIMIAGFDKYFQIARCYRDEDS
FT                   RGDRQPEFTQLDLEMSFVKKENIFKLIENMLFLIFKNCLNIKLPKKFKKITYKTAMNKY
FT                   GSDKPDTRFELTLQDISRNLKNSEFNVFKETLKNKGSIKILIVKDEADKFSRAKINNLE
FT                   EIAKLYKTQGLYFAKIENNKFSGGIAKFLKTEEQQLIKTYSLENNDIIFFTANKKWETA
FT                   CKAMGQIRIKIANDLGLIDENKFEFLWVYDFPLFEYDENTKTYTPAHHMFSLPKKRYIA
FT                   SLEKIPNKTIGEIYDLVLNGVELGSGSIRIHNKELQQRIFNIIGFQKEKSEDRFGFFLK
FT                   ALEYGAPNHGGIAIGIDRLIMLMTKSTSIKDVILFPKNSFATSPLDDSPSKISNEQLKE
FT                   LGINIVTDDA"
FT   gene            complement(469557..471662)
FT                   /gene="napA-1"
FT                   /locus_tag="BG0455"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(469557..471662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA-1"
FT                   /locus_tag="BG0455"
FT                   /product="Na+/H+ antiporter"
FT                   /note="ortholog to Borrelia burgdorferi BB0447"
FT                   /db_xref="EnsemblGenomes-Gn:BG0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07298"
FT                   /db_xref="GOA:Q661H3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H3"
FT                   /protein_id="AAU07298.1"
FT                   /translation="MNKKIFYTTILLHLPNLLFSYSTKYDIEAKMSYFVMSLAIIVISS
FT                   ISLGNLVTKIGIPKVIGQITAGIILSPNAFGKIKIPLLFPLGITQIGENYLIDEKIFAI
FT                   STIASIILLFTAGLETDLKLFIKFLPRGGIIGITEVIGTFTSFVLMASIIFNVPLISPT
FT                   SLFIGIIGTPTSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMLMLTSVITISRSI
FT                   SDLDIASSIKTIIQSIVIWLCLTFSLIYVSETLSKLLKKLNSVTLATVITLSLALTIAS
FT                   IFQNLGMSFVVGAYVFGLAMSKTDIVYVIQDKLTIFERFFIPIFFTSIGLMSDINEILS
FT                   KEVLILGLAISAIAIITKSIFCFIPALFLGFNKLGALKIATGMVPRGEVSLIMANVALS
FT                   SGFISQKIFGIIIIMVFLPTIIVTPIINFLFKINKSGLKKELPIDQNTHICVYFEYDNL
FT                   AKILIWDLKNELRKEGFFTQQIKNDSSQYINARKNNISFSIKREGSQITFECPNNHLII
FT                   IQDLFRETILNLEKITEEVKTVSLRAKKLDYSINYDKILSKINLNKRIKKENIILELKA
FT                   SNKADVIRELLSVINIEIDKKRIFQDLMEREKLITPALKEGFAIPHLKTNLISKIHIAI
FT                   GISHEGIDFNALDKNLSHVFILILCPAKDYVSYPRILASVVGKVDLYKKEILNAKTDKE
FT                   IYNIIVG"
FT   gene            complement(471677..471940)
FT                   /gene="ptsH-1"
FT                   /locus_tag="BG0456"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(471677..471940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH-1"
FT                   /locus_tag="BG0456"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="ortholog to Borrelia burgdorferi BB0448"
FT                   /db_xref="EnsemblGenomes-Gn:BG0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07299"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H2"
FT                   /protein_id="AAU07299.1"
FT                   /translation="MQEVKIEIINKDEIHSRSANIIAEFINKHSLCYIKITKKNSRKAD
FT                   AKSAIEIIILGTIYKEKTKIIIIEKKEKLVIKNLLNLLKCNF"
FT   gene            complement(471953..472246)
FT                   /locus_tag="BG0457"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(471953..472246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0449"
FT                   /db_xref="EnsemblGenomes-Gn:BG0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07300"
FT                   /db_xref="GOA:Q661H1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07300.1"
FT                   /translation="MEPKIQTVNYNLNESEKNFILKKLEKFDTHIKKHVENLKITIKKE
FT                   HELFEFDAHVHFNWGKIIHIREDDKVFLNLIDRAIEKLYKTATKEKEKKNNK"
FT   gene            complement(472236..473393)
FT                   /gene="ntrA"
FT                   /locus_tag="BG0458"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(472236..473393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrA"
FT                   /locus_tag="BG0458"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="ortholog to Borrelia burgdorferi BB0450"
FT                   /db_xref="EnsemblGenomes-Gn:BG0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07301"
FT                   /db_xref="GOA:Q661H0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q661H0"
FT                   /protein_id="AAU07301.1"
FT                   /translation="MEESENNECLEIDSNKIFFETLKTYRFKKVFYKEDNMIKNQHDIA
FT                   LEKTQTNTSLKEHLLLQLRIQRINEDELKIGEILINNLNNKGFHIINPYDLFKKEEKEK
FT                   VKKIIELIQKFDPIGICVPNIIESLILQAKHHKLETNIIKILEKAELLEKTQEKLKEEL
FT                   KIRSKEFNKALEIIRQKLNPNPTLEFKDPEDTNFYVDPDILIINHNNKFEIKIKEVNIF
FT                   KKELKKTAINPQKQKKAKWLIESLRYRDEILAKIGIAIYTLQKEFLRRGFKSLRPMNLS
FT                   ILSEKISVSKSTISRAIKNKYLKCEWGTILIKELFSSVGGAKTNEFSKLSIKITVKKLL
FT                   EVNKKMSDKAISAILKSKGISISRRTVNKYRNELKSEKGKIYYGT"
FT   gene            complement(473498..474031)
FT                   /locus_tag="BG0459"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(473498..474031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0459"
FT                   /product="chromate transport protein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0451"
FT                   /db_xref="EnsemblGenomes-Gn:BG0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07302"
FT                   /db_xref="GOA:Q661G9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G9"
FT                   /protein_id="AAU07302.1"
FT                   /translation="MILINLFITFLKIGLLNFGGGNGIAATINNEIINNKQWITKEEFV
FT                   NMITISRITPGPIATNIATYVGMKTAGIAGAIIATGALITAPIIIMVIIILMLHKTSFL
FT                   TYCLENLKPIIVALWIITIIILLENTYLKIENDKTEFLRTLAIVGINFFILFFYNKISP
FT                   ALVIILSGFFYTLI"
FT   gene            complement(474028..474621)
FT                   /locus_tag="BG0460"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(474028..474621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07303"
FT                   /db_xref="GOA:Q661G8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07303.1"
FT                   /translation="MKKKKQKKLYEILNLFLLVFKTTTLTIGGGLIIISELKKILVKKR
FT                   KIISEDDFNKILATSNVIPGVTAINFVFLVGRRFGGFPCALLLVVAGILPSIIVIIMVF
FT                   FYLKLVPNSIHVEKFLEGAKISSIIIMLTVVLKFSKKMLNNSIIKWTICFLVIFAIFKL
FT                   KIRISYVLLIFFLIYTLKYITIKKILTKEKKDID"
FT   gene            complement(474590..474709)
FT                   /locus_tag="BG0461"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(474590..474709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0461"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0452"
FT                   /db_xref="EnsemblGenomes-Gn:BG0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07304"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07304.1"
FT                   /translation="MPILNKKMHITIIFVVELVPKVFTKFEETNEEKKTKKTI"
FT   gene            474840..475682
FT                   /locus_tag="BG0462"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        474840..475682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0453"
FT                   /db_xref="EnsemblGenomes-Gn:BG0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07305"
FT                   /db_xref="GOA:Q661G6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07305.1"
FT                   /translation="MFKEFFIFQDYFNYILESVVGYGLKVSIAIALWYFLKLIVKKIGK
FT                   ILFKTLEKSKLEEKLEATVFNFLKSFFKILTDFLIVLIILPYLGVPTTSIIAVFGSLGL
FT                   AIGLAAQGILSNFVSGIIVLNSKFFKCGDHIKCGDVEGLVENVQIFFTTLKTFDEEIIK
FT                   IPNSKLTSNFVVNFSANPRRRVVFSFQVPHDTNIDLLKDKIEDLIIFNNKKFNVEICSP
FT                   TLIVKKYTPCYIVVQVRFFINTDAFWTFQYFIGESIKNVLLDMKIKFPICFIPFDKLY"
FT   gene            complement(475679..476827)
FT                   /locus_tag="BG0463"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(475679..476827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0463"
FT                   /product="lipopolysaccharide biosynthesis-related protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0454"
FT                   /db_xref="EnsemblGenomes-Gn:BG0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07306"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G5"
FT                   /protein_id="AAU07306.1"
FT                   /translation="MKVAIFTDTYIPEKNGVATSIKQIKEGFEKNGYEVYIFCPKSKTS
FT                   LNEKNVYRCSSIQINKKLDAVIAFPNKRKISKIIKSYKPDIIHTHSEFSMGKIGKQIAL
FT                   KQNIPIVHTSHTMWDYYLHYLGIFKYFIKPDKMMQKHYNKIKHFIYPSSKAKERYFRLS
FT                   NNSNYRIIPNGVDRKLFIKTLSKEKKDEIFKKHNIKQTDKIIIFVGRINKEKNINSLVM
FT                   NLKDLLIQNKNYKLIIIGKGSEEKEIKNFSIKHRLEKQILLIGTIPWEEICFYYKISDI
FT                   FASLSRSEVYPMTVIEALTAGIPAILINDYIYKDVIKEGINGFLIKKYENLSYYIEKVI
FT                   KDDKTLKTFKQNAKKHSIKFSSHFFTKKIENYYSEIIARKNH"
FT   gene            476884..477873
FT                   /locus_tag="BG0464"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        476884..477873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0455"
FT                   /db_xref="EnsemblGenomes-Gn:BG0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07307"
FT                   /db_xref="GOA:Q661G4"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07307.1"
FT                   /translation="MQVVYLLLGSEQGLKEAYLKELLVKMDAFKSKVLVTKIFLSELSV
FT                   VEFVEKLFSNSFFSEKEIFIVYESELLKADKDLELVCNAILKSSNKTIIFVSNSNTCNI
FT                   DFKGKLKFIKKVFYEIPDDDKFTFVKRNFFNLNIKITDSAINLMLLMLNSDTKILKFYI
FT                   DSFALFAKNNTIDEEDITSWISFVRFENTFSLFNSILKKHMEHSLIKIKSILDQGEDFL
FT                   NVLMSLIWQFKRLLKVQIDYNTCGSLQSALNKNKIFFSLNKIYRVGVKNYSIEEIKIVL
FT                   KILYKFDLYLRIYSKNIHQNLSYFLIFSILNFNNNFLIDCSKESKFNF"
FT   gene            477940..478518
FT                   /locus_tag="BG0465"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        477940..478518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0465"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0456"
FT                   /db_xref="EnsemblGenomes-Gn:BG0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07308"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07308.1"
FT                   /translation="MAEIVLIEFFDSIKNLQSSPEIFFNYLNIPSDDDLRAKIFGLKSQ
FT                   AKDDFIFYPLFFNNLRYEIIGKKNISKGFEFEVIIKNINFKNGIEKFLVKLNKIEVGSS
FT                   KIKNLGEKERKKIFDNLINEVVGELDNFDYTEIVHFFRVVKSSSGDYKIELLGDVLNIQ
FT                   VRNKLINELFLVLSPGISNSVLILKNINK"
FT   gene            complement(478590..480332)
FT                   /gene="uvrC"
FT                   /locus_tag="BG0466"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(478590..480332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BG0466"
FT                   /product="excinuclease ABC, subunit C"
FT                   /note="ortholog to Borrelia burgdorferi BB0457"
FT                   /db_xref="EnsemblGenomes-Gn:BG0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07309"
FT                   /db_xref="GOA:Q661G2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661G2"
FT                   /protein_id="AAU07309.1"
FT                   /translation="MLNENKKILYIGKAKNLRSRIKSYFLEKKSHKIKILMKNVKSIEV
FT                   ITTNSEYEALLLECNLIKTHKPDYNVKLKDGKGYPMIRITHEKYPRILKTRKIINDQSE
FT                   YFGPFTNVKKLDQVLDFINKTFKIRKCKKKSNAPCLYYHMGQCLGVCYKENLEKEYQIE
FT                   VNKAKSILNGNISEILSQIDIKLKLAVQKEDFETAIKLKEMKSSLIEINQIQIVTKANN
FT                   LNIDYVYVHPGENVNTIIVLKYRDGKLVERDANFDESICKKDELVLQFLIQYYTSINMI
FT                   VPDKIHIFLKDVDTKNVEKLINEIKNTKTEIIYKETKEILKIMEMAISNAKLSLREYEN
FT                   KSNKALESLKIFLEMDKLPKIIEGFDIAHLKGQETVASMVTFKMGIPFKENYKLYKLNS
FT                   LLKGEIDDFRAIKEAILRRYSEIINKKLELPNLILIDGGKGQLSAAFSILKSLKIEDKV
FT                   KVCSLAKKHETIFLITNKKGINLPQGHPALRILQNVRDEAHRKANGFNKKRREKITLLY
FT                   KKIDGVGEKTAQKILKLIGTYKDILPLSENEISEKIKVNIKLAKRIKEFAIKENSIKNI
FT                   DNDK"
FT   gene            480523..482040
FT                   /locus_tag="BG0467"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        480523..482040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0467"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0458"
FT                   /db_xref="EnsemblGenomes-Gn:BG0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07310"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07310.1"
FT                   /translation="MRLILMLLLFFLCFSILLSQELKLILDSKKNFKFVQDSSNITFER
FT                   DMRGVLGIYLDRYKAVLDLNNIDLRLEIGRDNKLKDTSSNYLVSANSLRVSNEFRNVSN
FT                   GSLIFYSNQNPVKFKPLTKKAFFSSGNTVSDFTIKFWVYRTTSVTGEIIFSWDGYKNIN
FT                   NLWVDQSIRLESDEGNFVWVLNNVFLKDNKKPLKIRMKSNDDFIPKKWHLHTLRYRQRD
FT                   GILEYLIDSKPQAIEYITDNKKEGSGYLLSIGNFIDFTLGTYFTGAVENLEIHKSFEEV
FT                   SNAFFSKNMGYIITEPIKLSKYYSQVLSFDVDSNVPKDTEIVYYYRLDNKVFYDTDSYG
FT                   NIKKNLTGAWIHFDPKKDFPDSKISKYIQIKVEFYPSGDSVSSPSLYSMSITYVPEAAP
FT                   FPPVITRVIPGSREVFLEWIPVVNSSVEGYYIYIGVTSGNYHGKTSGVLTSPIDVGNPT
FT                   SFKITGLEDGRLYYISIAAYNLDKSVNKTSFSKEISVRPMEILKKYE"
FT   gene            482033..483352
FT                   /locus_tag="BG0468"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        482033..483352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0468"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0459"
FT                   /db_xref="EnsemblGenomes-Gn:BG0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07311"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q661G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07311.1"
FT                   /translation="MNNFNFEKALNFYKNGDLKSSLDNLDVFDENLDSLALKALIYFKK
FT                   KDYKALLYVLNTYPAVLSEYNFLVKLIDYGKIEKNKEDLGPFESYNLGVFYFNLKEYKL
FT                   ALSCFLKAKEQKSDFIQALNNSAVLFEMLGNKDEALKLFFKARDLDQNNSLVRLNIWIL
FT                   KNRESLKAGSFLEVDKIFSDVNLALVVNYLMYYFYFIGEISRAIRLSEKFLTDSHYSKY
FT                   IWHNRGTIFHKIGNMTQATTSYVKAILNFPNIYTIYNMHIATIELLKFSPKKSIERMID
FT                   DYSNLDLIYLYATLFFLRNRDLEDAYFYMKKLCELNPEPYSKFLKLLESSEDMLIENLL
FT                   EEFAVSLRANWHLEYLFFIDNSLNLGDPIFIFDHNIRINTYIWRIKDEFIELKFSNNEE
FT                   KMVQEILHSECVCPKIDISIGDFQKLIEAYKEFRINYYYL"
FT   gene            483406..483494
FT                   /gene="trnS"
FT                   /locus_tag="BG0469"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            483406..483494
FT                   /gene="trnS"
FT                   /locus_tag="BG0469"
FT                   /product="tRNA-Ser"
FT   gene            483551..483637
FT                   /gene="trnS"
FT                   /locus_tag="BG0470"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            483551..483637
FT                   /gene="trnS"
FT                   /locus_tag="BG0470"
FT                   /product="tRNA-Ser"
FT   gene            complement(483664..484368)
FT                   /locus_tag="BG0471"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(483664..484368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0471"
FT                   /product="lipoprotein, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0460"
FT                   /db_xref="EnsemblGenomes-Gn:BG0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07312"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F9"
FT                   /protein_id="AAU07312.1"
FT                   /translation="MKTKIIIFLLMSSISSCSKSVSNEINSEFIIKTKNIKEKILKNNN
FT                   ILHIDAKIPFMENTNFEFENFIKKWKKEIENKISKTESSENEYFYFSSFTIFQNENIGI
FT                   TSILYKESLKEKESSTLLRYYPLNLKGNKKIEISEIISKDQLDSLINVLKEQVRSKIKD
FT                   FNVKDKHTPNELEKKFTTIFPRYKYYFKKNQIVIFYNPFLIDYKKFDKIEFQFPIHENT
FT                   ENEYQSNKKLRP"
FT   gene            484443..484516
FT                   /gene="trnR"
FT                   /locus_tag="BG0472"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            484443..484516
FT                   /gene="trnR"
FT                   /locus_tag="BG0472"
FT                   /product="tRNA-Arg"
FT   gene            484533..484619
FT                   /gene="trnS"
FT                   /locus_tag="BG0473"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            484533..484619
FT                   /gene="trnS"
FT                   /locus_tag="BG0473"
FT                   /product="tRNA-Ser"
FT   gene            484951..486633
FT                   /gene="dnaX"
FT                   /locus_tag="BG0474"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        484951..486633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BG0474"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="ortholog to Borrelia burgdorferi BB0461"
FT                   /db_xref="EnsemblGenomes-Gn:BG0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07313"
FT                   /db_xref="GOA:Q661F8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F8"
FT                   /protein_id="AAU07313.1"
FT                   /translation="MAPSRGTALKKRPRDFNSLEGQDFVVETLKHSIEKNKIANAYIFS
FT                   GPRGVGKTSSARAFARCLNCKNGPTVMPCGECNNCKSIENDSSLDVIEIDGASNTSVQD
FT                   IRQIKEEIMFPPAISKYRIYIIDEVHMLSNSAFNALLKTIEEPPNYIVFIFATTESHKL
FT                   PETIKSRCQHFSFKLLSLEKIYNMLKKVCFEDHIKYEDEALKWIAYKSSGSVRDAYTLF
FT                   DQVVSFTSSDIKLDQIRSKMGLTNDEFLEKLSASILSEDVKELICVLDSIFLSGVSYEQ
FT                   FLLDSIEFFREALFLKIGIKNFEFIGIKSEDLRKKLAEFDLNYLERIIVVLLETYRDLQ
FT                   FSVNPRYELEINFVKILRLKNYIPNHVLIKQIQNLEDNLLENMALDSSNFDVLANKKNK
FT                   DDLAFISAKPGLEDEFPEIRPLEKEETSFDKNLSTKIDENLLEANSIEEIDEIFIEDDN
FT                   SSEANDFINIRDKFIYVVSRYIQTLVHSGEVVIDDNVLYYKVFSEFEYNELQNYKGEIR
FT                   SEFYKEFPNLSIVFQKNFKSLEKDFEKLETVKNIFGASEVLEG"
FT   gene            486638..486937
FT                   /locus_tag="BG0475"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        486638..486937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0462"
FT                   /db_xref="EnsemblGenomes-Gn:BG0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07314"
FT                   /db_xref="GOA:Q661F7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07314.1"
FT                   /translation="MAVNPLDFLKNMSSVKNNIDNIKKEMSKITVCGKAGSNIVVIEMD
FT                   GEFNVKKVSINKEFFDDLDNGAFEQMVKSALNDAVSKVKEEIKLKTMGVLPFGM"
FT   gene            487109..487618
FT                   /gene="ndk"
FT                   /locus_tag="BG0476"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        487109..487618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BG0476"
FT                   /product="nucleoside-diphosphate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0463"
FT                   /db_xref="EnsemblGenomes-Gn:BG0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07315"
FT                   /db_xref="GOA:Q661F6"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F6"
FT                   /protein_id="AAU07315.1"
FT                   /translation="MSMLLQKTLCIIKPDGVRRGLIGDVVARFERVGLKIVAAKMLIID
FT                   ESLAKKHYLYDDIVLRHSEAVWKSLIKFISNSPVFAFVVEGVESIEVVRKLCGATEPKL
FT                   AIPGTIRGDFSYHSFRYSNEKGFSIYNVIHASANEVDAIREIPIWFKDNEILNYKRDDE
FT                   CEHYYC"
FT   gene            487889..488431
FT                   /locus_tag="BG0477"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        487889..488431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0477"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0464"
FT                   /db_xref="EnsemblGenomes-Gn:BG0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07316"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07316.1"
FT                   /translation="MLKIVMRILRLYSLFLFFACTFDYDEYSNRSDAAKKFPSIQILGI
FT                   KYYNVVYNREQTALESLSFSYFNDYKVYKAENGRFLYHSLDNEISGKFNNLEGSYITKD
FT                   LDMRDSVEFKIEDKNNYYLLNSNRILWKNKDKKLQSPPNELVLIRFNGSKIKGKGFSYF
FT                   LKSNVFYFDSGVEGIMN"
FT   gene            488428..489123
FT                   /locus_tag="BG0478"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        488428..489123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0478"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0465"
FT                   /db_xref="EnsemblGenomes-Gn:BG0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07317"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07317.1"
FT                   /translation="MKDLILIWIFIIFVNNIQATQIESKPQSKGFKENEKKNTNFTFKS
FT                   DFAQGIVSSFYKKIVLKGNSEVISPDFKLRADEIEIYGENGSYLEARGNIFYEDYKNKM
FT                   HVKAQFLFFNRKLDNFYLQKGVELEDLENNMLIKAERVEGSNKSNVYIMQYSVKIYKDD
FT                   TFARAENGTYNKEDKEMILEGVPVIYQKDNYYSASRIIFNTKTNRYKLEGSVEGEFTQV
FT                   ENDVSEEKK"
FT   gene            489092..489892
FT                   /locus_tag="BG0479"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        489092..489892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0479"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0466"
FT                   /db_xref="EnsemblGenomes-Gn:BG0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07318"
FT                   /db_xref="GOA:Q661F3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F3"
FT                   /protein_id="AAU07318.1"
FT                   /translation="MKMMFLKKKNKIKEIKESLNLNSVNNVVLRADNIIKKYGEKFAVN
FT                   GITINIHKGEVVGLLGPNGAGKTTTFYTIVGFIRPNAGKVLINNYNISSLNMYERARIG
FT                   IVYLPQDASIFRELTVEENIMVALERREDLSKAERKIELVNLLKEFEIKRIQSQKAYTL
FT                   SGGERRRAEIARALAVNPYFLLLDEPFAGIDPIAIGDIKNIIKILKERNIGVLITDHNV
FT                   RDAFDIIDRAYIVYQGQVLDEGDVGYIINSEKAKKLYLGEEFRL"
FT   gene            489889..490578
FT                   /locus_tag="BG0480"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        489889..490578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0467"
FT                   /db_xref="EnsemblGenomes-Gn:BG0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07319"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07319.1"
FT                   /translation="MKTIDHEFYYEFRVADDVRMIYTKKPFHLNLRELNNDNLNFVPKS
FT                   KKIKYLKQLHTDIIYRAEDDFINFQEGDGLISSSLDVALVAYFADCLPIYFYDSAKKIV
FT                   GLIHSGYKGSFSLIILKMLFMFEKMGSTFKDLKIVFGPYNRSCCYEVSEIFLKEVGNKF
FT                   SKGLLNTVFDIRDGKIYFDNASFNLNLLSSFNLNIYNSKLCTHCLKNLYSYRRLREGQS
FT                   YALIWRI"
FT   gene            490580..491326
FT                   /locus_tag="BG0481"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        490580..491326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0468"
FT                   /db_xref="EnsemblGenomes-Gn:BG0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07320"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q661F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07320.1"
FT                   /translation="MKVRDLSFKLNSIFDIEKYEHVDKNLNGLQVGNLNAEANKVAFAV
FT                   DASYSTLKEAKGNDFLITHHGIFWSKKERIVSSMYDKIKFLIKNNIALYSVHLPMDAHP
FT                   VYSHSKVFSDVLGLKNPFAFANYGGFNLGIIADSTFSFSEILEKIKKENKHILFYKKFK
FT                   ESVNRVAIISGSGYSFFEEALCHGIDLFITGDTSHQIYSLAEECGVSLIFAGHYFTETF
FT                   GLIKLMEDFKIQEDLEVKFIFKDTNL"
FT   gene            491337..491849
FT                   /gene="lsp"
FT                   /locus_tag="BG0482"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        491337..491849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsp"
FT                   /locus_tag="BG0482"
FT                   /product="signal peptidase II"
FT                   /note="ortholog to Borrelia burgdorferi BB0469"
FT                   /db_xref="EnsemblGenomes-Gn:BG0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07321"
FT                   /db_xref="GOA:Q661F0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661F0"
FT                   /protein_id="AAU07321.1"
FT                   /translation="MGAKSKQYFNIFVFVISLIFFDQLSKYLVVKYVKLGSIYFSFFDN
FT                   FFRIIHVRNTGILFSMGSDIHYSLKKIFFIAMPIFILIFVFSLALKEKNCITRISLLLI
FT                   FSGGVGNIIDRLFRPSGVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMILFLVYDFFI
FT                   KRKVLNT"
FT   gene            492085..492915
FT                   /locus_tag="BG0483"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        492085..492915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0471"
FT                   /db_xref="EnsemblGenomes-Gn:BG0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07322"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q661E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07322.1"
FT                   /translation="MSLRVLIAGEVVGKAGIIAIKSFLSSFRVRRGIDFVISGNNFTTG
FT                   LRGLGKKHAFLLKKYGVDVLTLGENAFARADLSNDLDKYNFILKPLNCPAKLKGYSYFI
FT                   YNINGKKLAVVRIVGQTGITKYKFNHPFYSFDFFYKRIEMQTNNIIVLFDSNTTAEVNA
FT                   LFFYLKSRVSACLGTGKRILTADLRILDNTAVITDLGRVGSLDSVIGYVPDLEVDKFLK
FT                   GFLNQRFNESWEGIGFNGVLIDIDENGHSFSVETVREYIDYKSSLKDMDDMDII"
FT   gene            493043..494326
FT                   /gene="murA"
FT                   /locus_tag="BG0484"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        493043..494326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BG0484"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0472"
FT                   /db_xref="EnsemblGenomes-Gn:BG0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07323"
FT                   /db_xref="GOA:Q661E8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E8"
FT                   /protein_id="AAU07323.1"
FT                   /translation="MYSYIVEGGFKIGGQITASGNKNSALPCILAALLTNEDVILENIP
FT                   NINDVKVVLDILSDIGADIVREGNALKIKVSNIVKTEIDSSFTDLIRASILLLGPFVSR
FT                   FGEIDMALPGGDVIGKRRLDTHFYGLSKLGAKLINKDGRIVLKAKKLVGAEMFLDEASV
FT                   TATENIIMASVLAEGNTVIMNAACEPHVQDLCNMLNSMGANILGIGSNVLEIKGVKKLR
FT                   GTTFRIGADFMQVGSLISLAALTGGELEIKKADPQHFRLIRHIYSRLGINFEYDKENVY
FT                   VRDKQELKVKLDFGGHIPKIDDGPWPAFPTDLMSIIIVTATQVEGTVLVFEKMFESRMF
FT                   FVDKLIKMGAQIVLCDPHRVVVTGKSPLKGNVLSSPDVRAGMSLLIAAFVAEGRSEIQN
FT                   VYQIERGYEDVANKLINLGAKIKKVKSQ"
FT   gene            494922..496280
FT                   /locus_tag="BG0485"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        494922..496280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0485"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0473"
FT                   /db_xref="EnsemblGenomes-Gn:BG0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07324"
FT                   /db_xref="GOA:Q661E7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q661E7"
FT                   /protein_id="AAU07324.1"
FT                   /translation="MSKNKSKARELILKGNLYKVLFLISFPIVITNIIQAFYDLTDMFY
FT                   VGKLGAMPLSALSLAGPVNFFIMAIAMGMATGSISLTSKCIGEGNFSRFSRYAGQLIVL
FT                   NFVLSLFVAICSFFFIEHLLDLLGVKGELKELSRAYFYVTIFGIPIMFLSISITYILNA
FT                   QGETIISMIIVLFANIVNFILDPILIFSFNMGITGAAWATLFSKLLTVAFYLFLTYGLN
FT                   RGLKIYPKDLALDIRYIKEIVNLGLPSTFGQIMVSLSFFIFNYIGIEISPKFLAAYGLT
FT                   NTIISFLFLPAMGIGTGIISIVGQNLGAKKINRVGEVLKKGFFISLAILLIINSIVIIN
FT                   KHFILRLFTNDLEVLNYANNYLLLTTIGTFGYGLQQVFFGGLIGSGRTKVAMIIIFIRL
FT                   WLIRLPVVFIFQYFGIIENSLGYAFIISNYLAIIILVGFTCTRYWAKPILIKK"
FT   gene            complement(496574..496705)
FT                   /locus_tag="BG0486"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(496574..496705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0486"
FT                   /product="lipoprotein, putative"
FT                   /note="similar to Borrelia burgdorferi BB0475"
FT                   /db_xref="EnsemblGenomes-Gn:BG0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07325"
FT                   /db_xref="UniProtKB/TrEMBL:Q661E6"
FT                   /protein_id="AAU07325.1"
FT                   /translation="MVNYKSDSKNNLIIALKNKSGENINANSLAIFKEGSKTGELIR"
FT   gene            497347..498531
FT                   /gene="tuf"
FT                   /locus_tag="BG0487"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        497347..498531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BG0487"
FT                   /product="translation elongation factor TU"
FT                   /note="ortholog to Borrelia burgdorferi BB0476"
FT                   /db_xref="EnsemblGenomes-Gn:BG0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07326"
FT                   /db_xref="GOA:Q661E5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E5"
FT                   /protein_id="AAU07326.1"
FT                   /translation="MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKLNKDAKA
FT                   LKYEDIDNAPEEKARGITINARHIEYETANRHYAHVDCPGHADYIKNMITGAAQMDAAI
FT                   LLVAADSGAEPQTKEHLLLAQRMGIKKIIVFLNKLDLADPELVELVEVEVLELVEKYGF
FT                   SANTPIIKGSAFGAMSNPEDPESTKCVKELLESMDNYFDLPERDIDKPFLLAVEDVFSI
FT                   SGRGTVATGRIERGVIKVGQEVEIVGIKETRKTTVTGVEMFQKILEQGQAGDNVGLLLR
FT                   GVDKKDIERGQVLSAPGTITPHKKFKASIYCLTKEEGGRHKPFFPGYRPQFFFRTTDVT
FT                   GVVALEGKEMVMPGDNVDIVVELISSIAMDKNVEFAVREGGRTVASGRILEILE"
FT   gene            498583..498894
FT                   /gene="rpsJ"
FT                   /locus_tag="BG0488"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        498583..498894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BG0488"
FT                   /product="ribosomal protein S10"
FT                   /note="ortholog to Borrelia burgdorferi BB0477"
FT                   /db_xref="EnsemblGenomes-Gn:BG0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07327"
FT                   /db_xref="GOA:Q661E4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E4"
FT                   /protein_id="AAU07327.1"
FT                   /translation="MIAKDKIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPT
FT                   KIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIKQ"
FT   gene            498935..499555
FT                   /gene="rplC"
FT                   /locus_tag="BG0489"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        498935..499555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BG0489"
FT                   /product="ribosomal protein L3"
FT                   /note="ortholog to Borrelia burgdorferi BB0478"
FT                   /db_xref="EnsemblGenomes-Gn:BG0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07328"
FT                   /db_xref="GOA:Q661E3"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E3"
FT                   /protein_id="AAU07328.1"
FT                   /translation="MLGLIGKKVGMTQIFQKNGIVIPVTVIEFQPNYIIGKKTVDRDGY
FT                   SALIAGSVDLKGSKVSKPIKGQYKSLKDIEPKKYVIELKGLDGYDAGDEIKVDVFKSVK
FT                   YVDVTGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGGTGQATTPARTFKGTKMAGRM
FT                   GGNKQTIQNLEVVLIDEENRAILVKGAVPGAKGSFVVVKKSKK"
FT   gene            499565..500194
FT                   /gene="rplD"
FT                   /locus_tag="BG0490"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        499565..500194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BG0490"
FT                   /product="ribosomal protein L4"
FT                   /note="ortholog to Borrelia burgdorferi BB0479"
FT                   /db_xref="EnsemblGenomes-Gn:BG0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07329"
FT                   /db_xref="GOA:Q661E2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E2"
FT                   /protein_id="AAU07329.1"
FT                   /translation="MERKVFSKDGKEIGTINLDDRVFNIEISHGSIYNAIKNELSNLRV
FT                   GTSSTKTRSEVRGSSKKPWKQKGTGRARVGTKRNPIWIGGGIALGPKPRDYSYRLPKKV
FT                   KRLAFKSVLSLRAADENNFKVVENFNIESGKTKDLALIIKNFASFNGKVVILLGNDDQM
FT                   IKRAGKNIRDLKILSFNKLRVVDLFYAKNLIALESAVNKLNEFYVK"
FT   gene            500184..500228
FT                   /locus_tag="BG0491"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        500184..500228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07330"
FT                   /db_xref="UniProtKB/TrEMBL:Q661E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07330.1"
FT                   /translation="MLNKKDVEDKYESL"
FT   gene            500215..500511
FT                   /gene="rplW"
FT                   /locus_tag="BG0492"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        500215..500511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BG0492"
FT                   /product="ribosomal protein L23"
FT                   /note="ortholog to Borrelia burgdorferi BB0480"
FT                   /db_xref="EnsemblGenomes-Gn:BG0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07331"
FT                   /db_xref="GOA:Q661E0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661E0"
FT                   /protein_id="AAU07331.1"
FT                   /translation="MKAYDIIVSPMLTEKTNTQRESINVYVFKVNKRANKKEVGAAIKE
FT                   LFNVTPVSCNLLNIKSKAKVVVSRRGYPIGKGKTSSWKKAYVYLKKEDKIDIF"
FT   gene            500533..501366
FT                   /gene="rplB"
FT                   /locus_tag="BG0493"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        500533..501366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BG0493"
FT                   /product="ribosomal protein L2"
FT                   /note="ortholog to Borrelia burgdorferi BB0481"
FT                   /db_xref="EnsemblGenomes-Gn:BG0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07332"
FT                   /db_xref="GOA:Q661D9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D9"
FT                   /protein_id="AAU07332.1"
FT                   /translation="MGIKTYKPKTSSLRYKTTLSFDDLSKGNDPLKSLTKGKKLKSGRD
FT                   SSGRISIRRRGGGHKRKYRLIDFNRRDKFSIPARVASIEYDPNRSANIALLVYKDGEKR
FT                   YIISPKGIKVGDVLESGPNAPIKIGNALPLENIPIGRTIHNIELNVGKGGQLVRSAGGY
FT                   AMILASDGNYVTVKLSSGEMRLIFKKCIATIGEIGNEDYANVSIGKAGKSRWLGRRPKV
FT                   RGVAMNPVDHPHGGGEGKTSGGRHPVSPWGQPTKGYKTRKKKRYSDKFIIKRRNK"
FT   gene            501376..501654
FT                   /gene="rpsS"
FT                   /locus_tag="BG0494"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        501376..501654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BG0494"
FT                   /product="ribosomal protein S19"
FT                   /note="ortholog to Borrelia burgdorferi BB0482"
FT                   /db_xref="EnsemblGenomes-Gn:BG0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07333"
FT                   /db_xref="GOA:Q661D8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D8"
FT                   /protein_id="AAU07333.1"
FT                   /translation="MARSIKKGPFIEKSLYQKVLSSFGSEKRVVIKTYSRSSTIIPEMV
FT                   SLTISVYNGKTFIPIYITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK"
FT   gene            501623..502024
FT                   /gene="rplV"
FT                   /locus_tag="BG0495"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        501623..502024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BG0495"
FT                   /product="ribosomal protein L22"
FT                   /note="ortholog to Borrelia burgdorferi BB0483"
FT                   /db_xref="EnsemblGenomes-Gn:BG0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07334"
FT                   /db_xref="GOA:Q661D7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D7"
FT                   /protein_id="AAU07334.1"
FT                   /translation="MLSQIKREGNRVVMLVNRRYTARGKNLPSSPKKVRPIADNIRGKS
FT                   YIKAIAVLCSMPNKGAKLLEKVVKSAASNAMYHNKNLSEDMIFVKIVMVDDGRRRKKIW
FT                   PRARGRADRLVNRNCHIFVEVDEKKDIKG"
FT   gene            502028..502906
FT                   /gene="rpsC"
FT                   /locus_tag="BG0496"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        502028..502906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BG0496"
FT                   /product="ribosomal protein S3"
FT                   /note="ortholog to Borrelia burgdorferi BB0484"
FT                   /db_xref="EnsemblGenomes-Gn:BG0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07335"
FT                   /db_xref="GOA:Q661D6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D6"
FT                   /protein_id="AAU07335.1"
FT                   /translation="MGQKVHPYSLRVKINKDWKSKWYFDKKLYSTILHEDFLIRLEIMK
FT                   FLKGIKFDISDIEIIRNNPQKVTVVIVTPRPGSVIGLKGSNLEKIGQLLTKKISKKISI
FT                   KIKEVKRPELDAQIIANGIAKQVENRVSYRKVLKSSLSTSMLKGAQGLKIKIAGRLGGA
FT                   EIARSFEVKEGRVPLHTLRANIDYGFSEAQTTYGIIGVKVWLFKGEVLGRQTNSDAGQV
FT                   INKKPFRERGESVKNFDKILNNREKANERQSRAALNKKDGLSKDETGLLNKLGSSFSKE
FT                   RIDSNEQNIGG"
FT   gene            502911..503327
FT                   /gene="rplP"
FT                   /locus_tag="BG0497"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        502911..503327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BG0497"
FT                   /product="ribosomal protein L16"
FT                   /note="ortholog to Borrelia burgdorferi BB0485"
FT                   /db_xref="EnsemblGenomes-Gn:BG0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07336"
FT                   /db_xref="GOA:Q661D5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D5"
FT                   /protein_id="AAU07336.1"
FT                   /translation="MLSPKKVKYRKKQRGRLSGEAQKGNKISFGEYGLVSLETSFITAR
FT                   QIEAARIAMTRKIKRGGRVWIRIFPDIPYTKKPAETRMGKGKGGVDHWNAPVKLGTVMF
FT                   EMAGVIEELAQEAMSLASSKLPVKTMFVVRRDLR"
FT   gene            503330..503530
FT                   /gene="rpmC"
FT                   /locus_tag="BG0498"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        503330..503530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BG0498"
FT                   /product="ribosomal protein L29"
FT                   /note="ortholog to Borrelia burgdorferi BB0486"
FT                   /db_xref="EnsemblGenomes-Gn:BG0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07337"
FT                   /db_xref="GOA:Q661D4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D4"
FT                   /protein_id="AAU07337.1"
FT                   /translation="MLKSFKNFTLEDMKAKRLELKKEYLDLRFKSIVGHVENPLKKREI
FT                   RRDIARLNTIICEYELGIRKV"
FT   gene            503533..503787
FT                   /gene="rpsQ"
FT                   /locus_tag="BG0499"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        503533..503787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BG0499"
FT                   /product="ribosomal protein S17"
FT                   /note="ortholog to Borrelia burgdorferi BB0487"
FT                   /db_xref="EnsemblGenomes-Gn:BG0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07338"
FT                   /db_xref="GOA:Q661D3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D3"
FT                   /protein_id="AAU07338.1"
FT                   /translation="MARENKKELIGKVVSDKMSKTIVVEIVQRKMHPIYHKYLKVSKKV
FT                   KAHDEKEVSKVGDKVKIIEVRPISKDKRWALVEVLEKLK"
FT   gene            503815..504183
FT                   /gene="rplN"
FT                   /locus_tag="BG0500"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        503815..504183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BG0500"
FT                   /product="ribosomal protein L14"
FT                   /note="ortholog to Borrelia burgdorferi BB0488"
FT                   /db_xref="EnsemblGenomes-Gn:BG0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07339"
FT                   /db_xref="GOA:Q661D2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D2"
FT                   /protein_id="AAU07339.1"
FT                   /translation="MIQMQTYLTIADNTGGKLAQCIKVLGGSKRRYAKIGDIITIVVKQ
FT                   AIPNSSVKKGDVCKAVIIRTSKEVRRKNGTYVRFDDNACVILDANLSPRGKRVFGPVAR
FT                   ELRDANFMKVVSLASEVI"
FT   gene            504198..504503
FT                   /gene="rplX"
FT                   /locus_tag="BG0501"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        504198..504503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BG0501"
FT                   /product="ribosomal protein L24"
FT                   /note="ortholog to Borrelia burgdorferi BB0489"
FT                   /db_xref="EnsemblGenomes-Gn:BG0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07340"
FT                   /db_xref="GOA:Q661D1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D1"
FT                   /protein_id="AAU07340.1"
FT                   /translation="MKTKLKIGDSVKILSGKDKGRIGKIASINRKKNKVIVESCNMVKK
FT                   VIKARTPQEKGKIIDKEAAIDISNVIIFIKGTSSRLGIRFENNEKIRYLKKNGQRI"
FT   gene            504509..505057
FT                   /gene="rplE"
FT                   /locus_tag="BG0502"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        504509..505057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BG0502"
FT                   /product="ribosomal protein L5"
FT                   /note="ortholog to Borrelia burgdorferi BB0490"
FT                   /db_xref="EnsemblGenomes-Gn:BG0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07341"
FT                   /db_xref="GOA:Q661D0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661D0"
FT                   /protein_id="AAU07341.1"
FT                   /translation="MNYIPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVVSVGVGE
FT                   AVRNKKLLDSAVLELSQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMYEFLY
FT                   KLIHLALPRVKDFRGINGNAFDGNGNYSFGITEQIIFSEIDYDKIERISGLNVTIVTTA
FT                   SNDKESKALLLKFGMPFSN"
FT   gene            505075..505260
FT                   /gene="rpsN"
FT                   /locus_tag="BG0503"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        505075..505260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BG0503"
FT                   /product="ribosomal protein S14"
FT                   /note="ortholog to Borrelia burgdorferi BB0491"
FT                   /db_xref="EnsemblGenomes-Gn:BG0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07342"
FT                   /db_xref="GOA:Q661C9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C9"
FT                   /protein_id="AAU07342.1"
FT                   /translation="MAKKSMIIRALRKPKYKTRQNNRCKLCGRPRGYLRDFCMCRICFR
FT                   KYASQGLIPGVSKSSW"
FT   gene            505270..505668
FT                   /gene="rpsH"
FT                   /locus_tag="BG0504"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        505270..505668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BG0504"
FT                   /product="ribosomal protein S8"
FT                   /note="ortholog to Borrelia burgdorferi BB0492"
FT                   /db_xref="EnsemblGenomes-Gn:BG0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07343"
FT                   /db_xref="GOA:Q661C8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C8"
FT                   /protein_id="AAU07343.1"
FT                   /translation="MAITYSVGDMLTKLRNASRVKHGSVDLKMSNMNKSILNILKEEGY
FT                   IKDFNFLEKEGIAFIKVLLKYDNKRNPVINKIDAISTPGRKIYSSYKNMPRIKNGYGIL
FT                   IISSSKGVITGKEAKNKKIGGELICSVW"
FT   gene            505686..506228
FT                   /gene="rplF"
FT                   /locus_tag="BG0505"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        505686..506228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BG0505"
FT                   /product="ribosomal protein L6"
FT                   /note="ortholog to Borrelia burgdorferi BB0493"
FT                   /db_xref="EnsemblGenomes-Gn:BG0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07344"
FT                   /db_xref="GOA:Q661C7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C7"
FT                   /protein_id="AAU07344.1"
FT                   /translation="MSRIGRLPIKIPDTVKIDVKGNLVIVEGTRGKLVQDIKDSINVKV
FT                   ENGSVIVNRAFNDKKTKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLF
FT                   LNLGYSTQFEYVVPDGVSVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIK
FT                   YDNEVIRRKVGKSGVKK"
FT   gene            506246..506605
FT                   /gene="rplR"
FT                   /locus_tag="BG0506"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        506246..506605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BG0506"
FT                   /product="ribosomal protein L18"
FT                   /note="ortholog to Borrelia burgdorferi BB0494"
FT                   /db_xref="EnsemblGenomes-Gn:BG0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07345"
FT                   /db_xref="GOA:Q661C6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C6"
FT                   /protein_id="AAU07345.1"
FT                   /translation="MKKIKEAEQRKLRRKKRIKDKIGRGVASRPRITIFKSNRYFYAQV
FT                   IDDSRGHTVVSISTIEKSLNLSKNIDDIKKLGEVLAKRLKEKNINNLIFDRNGYKYHGL
FT                   IASFATSLREFGINI"
FT   gene            506618..507118
FT                   /gene="rpsE"
FT                   /locus_tag="BG0507"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        506618..507118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BG0507"
FT                   /product="ribosomal protein S5"
FT                   /note="ortholog to Borrelia burgdorferi BB0495"
FT                   /db_xref="EnsemblGenomes-Gn:BG0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07346"
FT                   /db_xref="GOA:Q661C5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C5"
FT                   /protein_id="AAU07346.1"
FT                   /translation="MVDVQAQRKQIEKLISLNRVTKVVKGGRRFSFAAFMVVGDGEGYV
FT                   GWGFGKANDASDAIKKSLTSARKNLRFVPIRKGTLPHEVIGCFKKAKVLIKPATHGTGV
FT                   IAGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLNAEKVAEMRGKKTLKT
FT                   LWG"
FT   gene            507122..507433
FT                   /gene="rpmD"
FT                   /locus_tag="BG0508"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        507122..507433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BG0508"
FT                   /product="ribosomal protein L30"
FT                   /note="ortholog to Borrelia burgdorferi BB0496"
FT                   /db_xref="EnsemblGenomes-Gn:BG0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07347"
FT                   /db_xref="GOA:Q661C4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C4"
FT                   /protein_id="AAU07347.1"
FT                   /translation="MIKRKLRLQLKKARFNASRSRSKNKCFIRRMEKNREIISKNNINV
FT                   QVFLVRSLIGKLNKKVKVLKALGLNKIGDKKVHFLNESIKGMLNETINMILLSEVNNV"
FT   gene            507426..507863
FT                   /gene="rplO"
FT                   /locus_tag="BG0509"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        507426..507863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BG0509"
FT                   /product="ribosomal protein L15"
FT                   /note="ortholog to Borrelia burgdorferi BB0497"
FT                   /db_xref="EnsemblGenomes-Gn:BG0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07348"
FT                   /db_xref="GOA:Q661C3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C3"
FT                   /protein_id="AAU07348.1"
FT                   /translation="MFNLLKPKGASKRRKIVGRGPGSGLGKTSGRGQKGQKARNTSPRL
FT                   GFEGGQTPLYRRLPRKGFSNNDYKLEYTIVNLGDIDKKFKDGQVVNYDTLLENKLIRKK
FT                   NKKIKILSNGELTKKVSLEVSKISKSAESLVIRIGGTIKLV"
FT   gene            507876..509180
FT                   /gene="secY"
FT                   /locus_tag="BG0510"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        507876..509180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BG0510"
FT                   /product="preprotein translocase subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0498"
FT                   /db_xref="EnsemblGenomes-Gn:BG0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07349"
FT                   /db_xref="GOA:Q661C2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q661C2"
FT                   /protein_id="AAU07349.1"
FT                   /translation="MKELFLSLFTVKDLRNKFLVTLFILFLFRVGSYLPIPGIDSVALK
FT                   SYFKSQSDFSIANYFDFFSGGAFSNFSIFMLSIGPYISASIIVQLLVYSFPSLKKMQEG
FT                   DGGRQKTKKYTKYLTIVAAMVQGYATSLYAKGIPGAVTIPFYRYIFIAILTVTTGTFIL
FT                   LWFGEQINQRGVGNGTSLIIFSGIVVRLQAALFNLFQSMQDPSQNVNPVFVILVISIFI
FT                   LVVILIIYEYKAQMRIAIHYARANSNSTVSSYLPIKLNPSGVLPVIFASVLITLPLQIL
FT                   SGFAETSSIARQVLSYLRPNGFYYTFLNVVLIIGFTYFYSKIQLNPKDISNNIRKNGGT
FT                   IPGIKSDEMEKYLDEIMNKTLFSGSIFLSIIAIIPFLVQNIFRFPHDVSRIMGGSSLLI
FT                   MIGVALDTLIHIDAYLKTQGFSYRNKKNYAFLQKI"
FT   gene            509193..509306
FT                   /gene="rpmJ"
FT                   /locus_tag="BG0511"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        509193..509306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BG0511"
FT                   /product="ribosomal protein L36"
FT                   /note="ortholog to Borrelia burgdorferi BB0499"
FT                   /db_xref="EnsemblGenomes-Gn:BG0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07350"
FT                   /db_xref="GOA:Q661C1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C1"
FT                   /protein_id="AAU07350.1"
FT                   /translation="MKVRASVKPICEKCKVIKRKGVLRIICDNLKHKQRQK"
FT   gene            509324..509701
FT                   /gene="rpsM"
FT                   /locus_tag="BG0512"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        509324..509701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BG0512"
FT                   /product="ribosomal protein S13"
FT                   /note="ortholog to Borrelia burgdorferi BB0500"
FT                   /db_xref="EnsemblGenomes-Gn:BG0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07351"
FT                   /db_xref="GOA:Q661C0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661C0"
FT                   /protein_id="AAU07351.1"
FT                   /translation="MARISGIDLPSNKQLKIALTSIYGIGRTRALEVCNKSSISPSKIA
FT                   KDLDNDEVNRLRKVIESDYVVEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTK
FT                   TNARTRKGKRKTVANKKIASK"
FT   gene            509729..510121
FT                   /gene="rpsK"
FT                   /locus_tag="BG0513"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        509729..510121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BG0513"
FT                   /product="ribosomal protein S11"
FT                   /note="ortholog to Borrelia burgdorferi BB0501"
FT                   /db_xref="EnsemblGenomes-Gn:BG0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07352"
FT                   /db_xref="GOA:Q661B9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661B9"
FT                   /protein_id="AAU07352.1"
FT                   /translation="MSAKLSTNSKKKIKRNIGEGNVYIQATFNNTIVTVSDIKGNALAW
FT                   ASAGGMGFKGAKKSTPYAAQITAESALNKVRDFGINYVHVYIKGPGIGRESAIRAIGSI
FT                   GMTVKSISDITPIPHNGCRPKKTRRV"
FT   gene            510137..511171
FT                   /gene="rpoA"
FT                   /locus_tag="BG0514"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        510137..511171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BG0514"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="ortholog to Borrelia burgdorferi BB0502"
FT                   /db_xref="EnsemblGenomes-Gn:BG0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07353"
FT                   /db_xref="GOA:Q661B8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661B8"
FT                   /protein_id="AAU07353.1"
FT                   /translation="MPVEKFLKDFTIPEKIEFLKSQDDGSYGKFTIYPFERGFGVTIGN
FT                   TLRRVLLSSIEGYAITAMRIQSNNKDSSSKVVSSEFDLIPGVSEDTLEVIANIKNIHLK
FT                   LGEGEQRKIISFSVSGKDTKVLKASHFERDGVEVFNRDLVIATLSQDVNLDLEFQINYG
FT                   RGYVSSEQNSKYLEEVNVIALDSIFSPIEKVSYSVEDTRVGQRSDYDKLVMEIWTTGVI
FT                   SAKDAIKKAASIIREFLFPLIDFEDNINTSFEKSKSESSNLLDMSIEKLDLSVRSLNCL
FT                   AKENVRTLGELISKNAEELSKARNFGKKSLEEIIEKLSSYQLFLGMSKEDALFVLSKNV
FT                   KISE"
FT   gene            511193..511564
FT                   /gene="rplQ"
FT                   /locus_tag="BG0515"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        511193..511564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BG0515"
FT                   /product="ribosomal protein L17"
FT                   /note="ortholog to Borrelia burgdorferi BB0503"
FT                   /db_xref="EnsemblGenomes-Gn:BG0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07354"
FT                   /db_xref="GOA:Q661B7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661B7"
FT                   /protein_id="AAU07354.1"
FT                   /translation="MKTKLGFNRLSRKSSHRRALLKNMVISFLKHEKISSTKAKLFEVK
FT                   RFAERLITRAKVDTVHNRRELSKFIHDKYILNKLFTKISPVFRQRSGGYTRMIKLGKRY
FT                   GDAAEMAILELVEKPLKVE"
FT   gene            511634..513166
FT                   /locus_tag="BG0516"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        511634..513166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0504"
FT                   /db_xref="EnsemblGenomes-Gn:BG0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07355"
FT                   /db_xref="GOA:Q661B6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07355.1"
FT                   /translation="MIYIIFSSIFAGFILGFLVRVFLGRLSLLDLEKNLTKVRVESQLE
FT                   IENERKQIIANAKSQMLKEKNQQDRDIRDRKNEIVNLEKRLLQREETLDKRISALDKQQ
FT                   SRVDFKIKEFEQKEKAIREKEADLVKRLENISGLTREDARKIVIEKVEHESRRDAQVII
FT                   NKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEFTVASVELPNDEMKGRIIGKEGRNIR
FT                   ALETLIGADIIIDDTPEAVVISCFDPIRKELAKRTLERLVTDGRIHPARIEEVVYNVTN
FT                   EINSIIQEEGEKVVFDLNIHGLDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEILAK
FT                   EMKLDPIVVKRACLLHDIGKGMESISENSEGHAITGAELAQSCGESEIVVNAIAAHHNE
FT                   VKPESLEAIVVQIADAISASRPGARRESLNNYINRLKRLEDIAYSFEGVQKCYAIQAGR
FT                   EVRIIVDNVLVNDEKSILLARDIAKKIEAEMRYPGKIKVTIIRETRVIEYAR"
FT   gene            513156..513944
FT                   /locus_tag="BG0517"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        513156..513944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0505"
FT                   /db_xref="EnsemblGenomes-Gn:BG0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07356"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q661B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07356.1"
FT                   /translation="MQDSTIKTLIIGDIVGESGLKKVFFNLKNIKNKYRIDLVIANGEN
FT                   SSNGFGITPEIANNLFRSGVNVITTGNHVYSNYKINDYLNKQTYILRPNNFSDLLDGHG
FT                   YCFLTIRDEKVAVINVQGVLNMNFIVKNPFNNTKKLVNMLSNKVRTIFVDFHAESNYEK
FT                   ESFGYFLNGFVTGVVGTHTHVMTKDERILSKGTAYISDVGMTGGLNSVIGFNPDISLKG
FT                   LLKYTPLRAEVVEDNIILRGVIITSNLKTGRALKIERIQK"
FT   gene            513997..514716
FT                   /gene="tlyA"
FT                   /locus_tag="BG0518"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        513997..514716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="BG0518"
FT                   /product="hemolysin"
FT                   /note="ortholog to Borrelia burgdorferi BB0506"
FT                   /db_xref="EnsemblGenomes-Gn:BG0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07357"
FT                   /db_xref="GOA:Q661B4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q661B4"
FT                   /protein_id="AAU07357.1"
FT                   /translation="MILILTGNVYVNSHKEKNPKILINKTSKIDLVENACQTFVSRGGY
FT                   KLLESLKDFEIEVKNKICVDVGSSTGGFTDCLLQCGANFVYSVDVGINQLSYKLRIDPR
FT                   VKVLERTNIFDVTEFKIVPNFAVVDVSFRSSISICVNLIDKLSDNFIIVLIKPQFEVKS
FT                   LNLDIKNFNGVVNGDYLKTILQSVIEKFYKNKLQVKNILKLKTKGKKGNQEFMFLVARS
FT                   SVLNIVSSMQLLNNIEF"
FT   gene            complement(514713..515459)
FT                   /locus_tag="BG0519"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(514713..515459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0519"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0507"
FT                   /db_xref="EnsemblGenomes-Gn:BG0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07358"
FT                   /db_xref="InterPro:IPR016862"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:Q661B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07358.1"
FT                   /translation="MKRKKSSSSTKSDILLILIAIILTIISALLIIKNSLIMHIFKEEN
FT                   YDNSLFESSQTQDNKLIEAKKDANQNVNIKILKNESFLIQPPEIKKLEEELKQNQRNNN
FT                   LKNKKFIKLYFIKVTPEGYFLRQTVKRAIYYDKNILEETLKSLIKGPNEYELKNNFLSL
FT                   IPIKTKLLNLSLSEGIAKINLSKEFYENSFGIEGIINQIAQITLTCLEIKGIAGIILTI
FT                   ENNPIILEELNLNFSGILNKKTLDKY"
FT   gene            515546..516847
FT                   /locus_tag="BG0520"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        515546..516847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0520"
FT                   /product="GTP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0508"
FT                   /db_xref="EnsemblGenomes-Gn:BG0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07359"
FT                   /db_xref="GOA:Q661B2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661B2"
FT                   /protein_id="AAU07359.1"
FT                   /translation="MLSYKKVLIVGRPNVGKSALFNRILDAKRSITESTYGVTRDLVEE
FT                   VCKVGSFNFKLIDTGGFTILKDEISKIVVQKVLSSLEKVDLILLVLDVNEILLEDYEII
FT                   ERLRKYSSKVILVLNKVDTKDKEFLAHKFHNLGFKRYFLVSALHRRGITKLRDFLKVEV
FT                   GRVNIEEEVNIKVGIIGKPNSGKSTLINYLSGNEISIVSDQPGTTRDFIKTKLTRNGKV
FT                   FEIIDTAGIRRRARVNEVVEYYSVNRALKVIDIVDIVFLLIDVEEELTSQDKKIAHYVT
FT                   KKGKGIIIVFSKWDLLEESKGYFETLKGRVKFFFPVLNFAPIFRISVYKKIGLDSLFKE
FT                   ALKVKDQLELKTNTPDLNKMLNLWIKDYHLNISHKIKYITQVSTNPVKFILFANKIKNF
FT                   PNSYYNYLVNNLRKIGYKNIPILVELREKIRDLK"
FT   gene            516844..518103
FT                   /locus_tag="BG0521"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        516844..518103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0521"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0509"
FT                   /db_xref="EnsemblGenomes-Gn:BG0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07360"
FT                   /db_xref="UniProtKB/TrEMBL:Q661B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07360.1"
FT                   /translation="MKYIFLFLIIKSLNLFALESFFYDFDIRSKYSKYFNSSDVQKKIS
FT                   PIKHFITENCYIEVSSAVYPGYVYYSFFNKKKNVDYIFPGSYVIKVGKDGIEQIKIFFI
FT                   NRGDTFIRIKSSKFSSSADFYLINTLIYKDVKLPFKIQDIAVTSIGNIINYIAKVIDFR
FT                   YFIPEYFDIYKNISNMVISLRKTLSSFPIAEVVDGAMDEYGKMVHIETGLLQKDPVGFN
FT                   CSGFVKWVADSIYKSMTGRLLRIDDLKIRHIGARGSVFTKSQEFNKDPFFGLDWIRNIA
FT                   YRINNINVDLKLSKIKENDVNNIKFFNYIDNRGYKIENLEFLLYSLALDEPGYIYFGSI
FT                   STGVNNLSSTMLHKHVVLFLPFLDENRIFRVSVNEVNSETSIKSLQKRYPNSYIHLVRV
FT                   KVPENLPIVPIPIKANNQSS"
FT   gene            518100..518786
FT                   /locus_tag="BG0522"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        518100..518786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0522"
FT                   /product="hypothetical protein"
FT                   /note="fused from Borrelia burgdorferi BB0510 and BB0511"
FT                   /db_xref="EnsemblGenomes-Gn:BG0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07361"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q661B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07361.1"
FT                   /translation="MIKAVIFDLDGTLYPEVDRNKLMFFEFLTNVKFFLAFKQIRKKIR
FT                   ILQSNQFSPSNRDEFLSLQVKMLSQHLNLDENRCAFLLNKIYYSQTFSDKFKKLKPYLG
FT                   VQDLIYWLKFKGIKLGVMSDFPILDRVKNLLGIQDSFWDILYSSEDTGYLKPHKVPFLK
FT                   VIEDLNLSSNNILYVGNSYEYDILGAKNVSMKAAFFSKKNINWKVMIDFIFHDYKDLRE
FT                   YIRLNI"
FT   gene            518806..525294
FT                   /locus_tag="BG0523"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        518806..525294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0523"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0512"
FT                   /db_xref="EnsemblGenomes-Gn:BG0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07362"
FT                   /db_xref="GOA:Q661A9"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07362.1"
FT                   /translation="MIDFATILVNLFLVSIVLFIYRQYDKRSRALDKIKKFIDLVKVNL
FT                   EDFIEDKTKEINDLAVDMEAYQRSSIEIIKKIDEVQPKIKNKSNDFAEVEKKIAYHDSM
FT                   LKDLDEMTLKVQENIQRLQVDGKIVDKLSKTLKGFNTQIDSVESNLNSVLEKFEKSNKE
FT                   NLESIKIASWEKFDINIKDLVFKMDNLNREIDLYEKDLANIEERKKDILDKGNEKLDLE
FT                   FNDFLEKVEFNIGKYNKEIESSFIFYENKYKLIEDSIELIMESVKNKINEKEDFILNRL
FT                   NEELENKFKDIFTYVDDRSREIQDKLEDKLILVDNEISSMSSSFKDNVYSRINSLEESI
FT                   RIEMGKYEEQVDDVFDKFRSQVELNLKNIYEDYEDKISQVDKNIRERVELSLLDLNSKM
FT                   ESVQTGAISLIKRLEDDSNRIYLEFKNKFESDIEIFSESFKDDINQLKRQLESQLLDVD
FT                   SNMQEKLIKLNDNLISNFQEIDGRFNNNYSNLTDNINSKYITLFESLDSSSSKFEDQME
FT                   SKYKGFKDKLTAEMDEFSLVYSEKFDTLSQEAINNYQEFQDLNKKLENEIESLCNMFEE
FT                   NQEILKRDFNTNLINIKDEIDKNIVEFKDRYSDEVNNFVSKLEESKLQYSKWQGDMDSN
FT                   LKNIESQINKTNEEFLSLIQIQKDKGIELSENVFNDLSDHIQKKAIDIHGSWKDELIAL
FT                   NKSLLDIKISSEELLSSATLKIENLERDVNDRIEYVLLKTGDIESLVIEKYKELKDMSY
FT                   SQSDEAILGIKEFINRQTEIIKDKSVFMLEDLNKKFDDKNNFVISKIEECDYKLKDFKS
FT                   ESEDILNNFKSDLNEFIESKLQIVSNIKSDNQKQIDDFLDRISKDILNRKDSINNEVDS
FT                   KLNDWQSKLNEITVKIENLLSSGKVDLDLIDSEVTTKIKELKFSIESLESYYLEKIDEF
FT                   RNQGAIYSDELLQDIMNHFNKETRELEENLSKKFAVVLNNSEEFVKEVDSLLQDKRTDI
FT                   ASFQANIDITLDSLSVKFNDINKEINGKYNEVISNYRGYSENISSKLENEIMHEIENIN
FT                   RRLTDRIDNLSKGMDENLQKLKESFDVSKYQVEKFELKVKDLTDSGEAKISEFIKEIEQ
FT                   YYKSRLEEAIDYRRTIDSDIMQAKERFGEITNDLKNNIESKSEFLNDLYKERFKLIESN
FT                   FEERYSTFLIESEGAISKIRDEIYKTLTINDENLQIKISEMDHNFEIIEQRSKDILEFE
FT                   KELRDKIQDCYGIINSQFGEIKGSVEENIKNHFEVCIKKVNTLIDDDIVKYENEIHKRI
FT                   DSLKSIENTFDSIEKNLNDKVNGCIDKISNDFNLKYIELEERCNEGQLNLESKIDNKIK
FT                   AIDNLALSQYDGLEKKYADMYDEFLERLNSHIATLSEEFKHSNKEMIFELESQLKNLKN
FT                   LESDLNNVEKDVIRLKEESYHNVSSHLKLLEEDFFKDLKIRGEELKYSLENFIASHNDK
FT                   IQNLEYDLSKNLENKTELIQSFRLDIEQKMKNDKETFYLDFTKEFSSKKKDMESEIALM
FT                   ETNITERIDEFIDFVNNRQNIIDSWFLNIKDDVKNWQEKSYSAIEKKISLAELEIKSFE
FT                   NDILNVKIGLESFKDSFEIKAEEIFGNLQSEAKKFEQSVNLDFKNIGESLNLKVLDLEK
FT                   FVDFKVEKIDERVNKKTEDILIQAEVKFLTQQKSLEDRIFELNQKLENEFTTLSSNLDK
FT                   VRREMIDVISSDKKSFEGQIELMHKNISEFSEKIGLYRNNIETSIENEYNAFSKSIKSE
FT                   FGLLEDELKKNLKHSTLEIETVKNDLQEQIDKFEVEFKKNHKKLLKEVDTNILELESKI
FT                   LNCDTEFNKFISESKDNLVEYKSDLRKEFEDSYDKINFQIENFKKLDAELEKNNSIFLE
FT                   AYSLKEKLEKLWETLKNEINLAQEYKNNFENVNKEFYNIQKETLGIIETFNELKLEQES
FT                   IKAIKNDFNRFFEFYSSFDSRYKSLIESYDEMQIYKAKIKEIADEQRNILDNYERISNK
FT                   EGILKSTIESVDKNFDLINEMEKRFNNLSKESANFQNNLKDMENVVSNLLLNKGLSEEV
FT                   LINAQNLKEMLLDIENRLKNTLTMREKVVKSETRLENLNIAAEERIKTLGILVKTDSKY
FT                   QDNVGLNNETVRNSVIKLMRQGWSAEEISRATKLSIGEVELILELGISNKGD"
FT   gene            525306..526868
FT                   /gene="pheS"
FT                   /locus_tag="BG0524"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        525306..526868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BG0524"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0513"
FT                   /db_xref="EnsemblGenomes-Gn:BG0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07363"
FT                   /db_xref="GOA:Q661A8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A8"
FT                   /protein_id="AAU07363.1"
FT                   /translation="MKADLNLIKTLHPLEMKVILNNGEEDDISASIIIEKLGFNEGQAN
FT                   KTIEWLNSKRIIEETCRKLNVFYKATERGLSALIAGFVEEKIINLVSRKAVLASNLALE
FT                   LDLDVKEVGKAFGNLLKEGILSLDLNKQIIINCLDGIEVNYQKIRFLLERAKSSDLLRE
FT                   SLTNEELLLISNFAKKKGADSVFFKIIEKLDLTFRLSGFGLEVKNFLMKNKLTGDEIAK
FT                   LTPEILKNKTYENKKFRAYNIHVPSAKTFIGRFNSYLDYISKIKDKLVGLGFEEFDGPL
FT                   IETEFFNNDALFMPQFHPSRDIKDVYYISDPSMQKSLPEPYFSNVKLAHETGYATGSRG
FT                   WRYSFSEDLSKRLVLRTHGTVLSAKQLINAKNPSRYFGVIRCFRYDQVDATHGVDFYQT
FT                   EGIVIEDGVSIKTLLGLLEIFAKEFAGATEVKYVPAYFPFTEPSIEIHVKHPVLGWFEL
FT                   GGSGIFRPEVTKPLGIDFPVIAWGIGIDRMALMHLGLNDLRDLFTYDIGDVVLRRGKRR
FT                   CQR"
FT   gene            526856..528556
FT                   /gene="pheT"
FT                   /locus_tag="BG0525"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        526856..528556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BG0525"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="ortholog to Borrelia burgdorferi BB0514"
FT                   /db_xref="EnsemblGenomes-Gn:BG0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07364"
FT                   /db_xref="GOA:Q661A7"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR040659"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661A7"
FT                   /protein_id="AAU07364.1"
FT                   /translation="MPKVEIYKNLFLDKIGKNFTNLEISELLEPFKAEFDGFDENSGKI
FT                   KIEFNDTNRPDLWSYTGLARQIKTYLFGEIPYYDFFSKKGDFKKCYGEILVDNKMSQIR
FT                   PFIFGFLAKGLIINDRMLEALIQFQEKLCQSYGQKRRRVAMGMYNSNFIKFPISYVASS
FT                   PNHKFVPLGMDCELSLLEINEKHPKGLEYSYIVKNFDKYPLLLDNNNNVVSYPPIINSN
FT                   NIGSLKVGDTELFVEVTGIDFEATLLALSIVACDFYDMGFEILPVKTVFKDPFGLDFEE
FT                   LVCPYYFQEEVEFDVKNVNRLLGNNLTLERICLNLKKMGVSSYSRDFKNYIVPPFYRND
FT                   FLHEVDVIEDVMIGEGLASFYPELPKAFTIGRLSALEEFSRNVRNLMMGMGFQEMIYNY
FT                   MGSRKDFIDRMNINDQNFLKVSNPMTENYEYIRASIIPNLLKSESVSSNFPYPHKIFEV
FT                   GKVALKNLDAAEGTSTFTNLAFLMSGKEISFNEINSIVATLFYYLNIEIILRESKATFY
FT                   INGRGADILIEGFNVGSFGEISPYVLNNFGIFIPCSVFEVNINKLVSQS"
FT   gene            528627..529607
FT                   /gene="trxB"
FT                   /locus_tag="BG0526"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        528627..529607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="BG0526"
FT                   /product="thioredoxin reductase"
FT                   /note="ortholog to Borrelia burgdorferi BB0515"
FT                   /db_xref="EnsemblGenomes-Gn:BG0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07365"
FT                   /db_xref="GOA:Q661A6"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A6"
FT                   /protein_id="AAU07365.1"
FT                   /translation="MLEFETINVNLTKKENLSQKEIEFIEDVIILGSGPAGLTAGIYSV
FT                   MSNYKVTILEGPEPGGQLTTTTEVYNYPGFKNGISGRDLMLNMREQVVNLGAKTFPETV
FT                   FSIKRENSIFYLYTENYIYKSKAVIIAVGSKPKKLETLKNSDLFWNKGISVCAICDGHL
FT                   FKGKRVAVIGGGNTALSESIYLSKLVDKVYIIVRKDYLRAIAMLRDSVAKLPNIEIFYN
FT                   SEAIEVDGESSVSSIKIFNEKDNVVNKLKVNGVFMAVGYKPNTEFLKGFLDLDEEGFII
FT                   TKDIVKTSVDGVFSCGDVSNKLYAQAITAAAEGFIASVELGNFLK"
FT   gene            complement(529657..530397)
FT                   /gene="yacO"
FT                   /locus_tag="BG0527"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(529657..530397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacO"
FT                   /locus_tag="BG0527"
FT                   /product="rRNA methylase"
FT                   /note="ortholog to Borrelia burgdorferi BB0516"
FT                   /db_xref="EnsemblGenomes-Gn:BG0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07366"
FT                   /db_xref="GOA:Q661A5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A5"
FT                   /protein_id="AAU07366.1"
FT                   /translation="MYITHSNSIIESIKNNKGFELYISKKSSKTKEIERLAKTQNIKII
FT                   KISINELDKILKSKDHRGFALKLKLEKNKNGKTQTKDFENLLETFKKKEHAFILLLDEI
FT                   EDPQNFGAILRTAEQFSIDLVVTTQKRSAKDNLTVLRTSSGASQYVKKITVTNINNTIY
FT                   FLKKHGFWIYAGDIKGQDINKIKINDKKIALILGNESKGVHKLIKENSDFLIRIPTSGK
FT                   IDSLNVSVSTGILIFEIKRQLNLL"
FT   gene            complement(530400..531494)
FT                   /gene="dnaJ-1"
FT                   /locus_tag="BG0528"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(530400..531494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-1"
FT                   /locus_tag="BG0528"
FT                   /product="heat shock protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0517"
FT                   /db_xref="EnsemblGenomes-Gn:BG0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07367"
FT                   /db_xref="GOA:Q661A4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661A4"
FT                   /protein_id="AAU07367.1"
FT                   /translation="MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASI
FT                   FKEATQAYEVLIDDNKKAKYDRFGHSAFEGGGFEGFSGGFSGFSDIFEDFGDIFDSFFT
FT                   GNKGQERNRKHARGEDLGYNIEISLENAYFGYKNNINITRQILCHSCLGKKSEKGTSPS
FT                   ICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKTISNPCKSCKGKGRITNQETIQLNIPS
FT                   GIDNNQQIKMKGKGNVNPDNQEYGDLYVKILIRSHKIFKRNGKDLYAMLPISFTQAALG
FT                   KEVRIKTIASKEIKIQIPKGIENEEQIIVKGAGMPILQTEKFGNLILITKIKTPKNLNS
FT                   NAIKLFENLSKELRDGDEIDLLKV"
FT   gene            complement(531494..533401)
FT                   /gene="dnaK-2"
FT                   /locus_tag="BG0529"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(531494..533401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK-2"
FT                   /locus_tag="BG0529"
FT                   /product="heat shock protein 70"
FT                   /note="ortholog to Borrelia burgdorferi BB0518"
FT                   /db_xref="EnsemblGenomes-Gn:BG0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07368"
FT                   /db_xref="GOA:Q661A3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661A3"
FT                   /protein_id="AAU07368.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEHGKPVVIQNSEGGRTTPSIVAYTNK
FT                   GERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEEVASEIKMVPYKIEKGLNGDARVNIS
FT                   NIKKQMSPPEISAATLTKMKETAEAYLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVKRIVNEPTAAALAYGIEKKHEEIVAVYDLGGGTFDISILELGDGVFEVKSTNGDTHL
FT                   GGDNFDDEIIKHLISEFKKESAIDLSNDKMALQRLKEAAEKAKIELSGAQEASINLPFI
FT                   TADANGPKHLQYTLTRAKFEQMVDHLVQKTKEPCLKAIKDAGLKASDINEVILVGGSTR
FT                   IPAIQKIVKDIFGQDPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPLSLGIETL
FT                   GGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIP
FT                   AAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAH
FT                   AEEDKKLKENIEAKNTANSLIYQTEKSLKEYSEKISSEDKEAIENKIKELKESLDKEDI
FT                   SLIKSRTEELQKASYKIAEMMYKDSSQQNASNQQENGTQSNTSEEGKEADYEVVDEDKK
FT                   "
FT   gene            complement(533425..533988)
FT                   /gene="grpE"
FT                   /locus_tag="BG0530"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(533425..533988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BG0530"
FT                   /product="grpE protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0519"
FT                   /db_xref="EnsemblGenomes-Gn:BG0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07369"
FT                   /db_xref="GOA:Q661A2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q661A2"
FT                   /protein_id="AAU07369.1"
FT                   /translation="MEKKETKNDAEKNNKQDNKSTKSQKKENLNLVNSDKKITELENEI
FT                   SNLKDLYLRKQAEFENFRKRLEKEKDNFVKFANETIMKDVVNFLDNLERAINSSRKSKD
FT                   FDNLLTGISMIENEILSIFDKKYNLKKFGENGENFDPSRHEAISIEEKEDLKNPEIVEV
FT                   YQKGYCYNDRILRTAKVKVAQSKN"
FT   gene            534365..535903
FT                   /locus_tag="BG0531"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        534365..535903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0531"
FT                   /product="NH(3)-dependent NAD+ synthetase"
FT                   /note="fused from Borrelia burgdorferi BB0521 and BB0522"
FT                   /db_xref="EnsemblGenomes-Gn:BG0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07370"
FT                   /db_xref="GOA:Q661A1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A1"
FT                   /protein_id="AAU07370.1"
FT                   /translation="MKISIVQTKYRVLDFNQCIDDFKINYEEALLRGSEVLVFPSMFLD
FT                   KTKHSELFERSQYSQNICKFIEFIREQVDDRILVVFGHSVYKGGEFVNIISVISNHKVI
FT                   LTISQCNFPGFFSYKDNVFAVLNFEDALLFNELSPKFGENLKKAQYLIVPSKSYFTKEK
FT                   NNLRLKFFERVAVENNLDVVYSNFYGAEDSAVYDGCSFFINSFGKIKQAKGFEFDFISN
FT                   DAFQDLKFDTYNDFFEKIIIAISLVLREYVRFSGFSKVHLGVSGGIDSALVACLACFAL
FT                   GADNVVGISMPSKFSSTGSISDAKELSRKLGFKLIEMPIKDLFEVSSRFLEGHFDVKGV
FT                   TEENLQARLRGLLLMSYSNSQNSLLLNTGNKSEIAVGYCTLYGDACGGLALIGDLFKTE
FT                   VYDLVKYINAKFDQCIIPVNIILKEPSAELRFDQKDSDYLPKYEFLDVILSRYLIDNES
FT                   VDSIYLHFEKGVVDKVLTLYFKNEYKRRQGAPIVKVSKKTFGFELSIPILNNMI"
FT   gene            536747..536842
FT                   /locus_tag="BG0532"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        536747..536842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07371"
FT                   /db_xref="UniProtKB/TrEMBL:Q661A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07371.1"
FT                   /translation="MFDKFSQLLLFNGVYEIKNKKMLIWIFMILY"
FT   gene            537167..537343
FT                   /locus_tag="BG0533"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        537167..537343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0533"
FT                   /product="inositol monophosphatase"
FT                   /note="similar to Borrelia burgdorferi BB0524"
FT                   /db_xref="EnsemblGenomes-Gn:BG0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07372"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z9"
FT                   /protein_id="AAU07372.1"
FT                   /translation="MVGEFYCGNKMTLDILDSMYILEPNNHKRWSLKDFFIYSDNKSTI
FT                   DIARKVANKKFNK"
FT   gene            complement(537370..537786)
FT                   /locus_tag="BG0534"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(537370..537786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0525"
FT                   /db_xref="EnsemblGenomes-Gn:BG0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07373"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07373.1"
FT                   /translation="MKIPKNYIPGTNPYKSLPKKPIIENKKKITKKQEQINSEIMKSQE
FT                   RILKLYMRRLQKKDQITLQNFILEGHRVGSKIFNNLPKTLKEIIALMNIESLKVLKKNT
FT                   KNPIKMLYIKFSSWTLNKLIKTLDIESNKTVKNK"
FT   gene            537927..539708
FT                   /locus_tag="BG0535"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        537927..539708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0535"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0526"
FT                   /db_xref="EnsemblGenomes-Gn:BG0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07374"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07374.1"
FT                   /translation="MFGVLILFVVIFLQFRNLNLNIFFLKDIKLEVNNKVENSEYILND
FT                   IVVNVRGLRILLSKLNPLIVLETGLNLLPISYKVQDMGIYVYFENNIFLGFLLDSENNF
FT                   SIESNLSKSFLLSYEVEDHYEVLLDKPTISIRQGENLEYRVFLGENVKLREKDILIFPQ
FT                   ATFRIGNAIYIDSPKKNIPNLIIEGNKSNILDHSTIHSKIKEVDNKIFSDTLDNFRQSA
FT                   YDFWNNPANFNVSRGGWLKYGDYGFDENLMVCFLAESLIRGDHESIFLKLNSLLVKNEH
FT                   KLTYLSLNYYANSDQIDKFIFYLSRNKTFIDSLEKDRLMVYLKEDPRLLEKIFLSENGY
FT                   KLNDALNLLKDPKKILSSNFDFTQTYNILSNYLTFLKISNDDSVYSDFKKELYRFIFTV
FT                   FGVTDEGKVYILNNYNMNSSDVVEYAVKISGVLKRIASYLKDNLILKLSFNVIYYSLIN
FT                   DYVKGIPYESYYSDIIDNQYIPQFIFIPSNGSIRWIYAASRILNREITDTKVIINFDQE
FT                   INYSNYIFFGNILNPTLVRFREIDWFTDYKFYIYSDGWKYYPLNKILVIKATPKKKKPL
FT                   NLLLRFDKIAKKINIYE"
FT   gene            539701..540489
FT                   /locus_tag="BG0536"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        539701..540489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0527"
FT                   /db_xref="EnsemblGenomes-Gn:BG0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07375"
FT                   /db_xref="GOA:Q660Z6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660Z6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07375.1"
FT                   /translation="MNKSLLSELIIDIGNTSIAFALFEDNKVNLFIKMKTNLMLSYDEV
FT                   YSFFKENFDFNVNQVFISSVVPVLNKIFENIIFSFFKIKPLFISFDLNYDLTFNPYGSG
FT                   KFLLGSDVFANLVAAIENYSLENVLVADLGTACTIFAVSRQDGILGGLINSGPLINFNS
FT                   LLDNAYLLNKFPISTPTNLLERTTSGSVNSGLFYQYKYLIEGVYHDIKKIYKRGFNLII
FT                   TGGNANLLLPLIEVEFIFNIHLTVEGIRILGNSIVVKFVN"
FT   gene            complement(540511..541458)
FT                   /locus_tag="BG0537"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(540511..541458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0537"
FT                   /product="aldose reductase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0528"
FT                   /db_xref="EnsemblGenomes-Gn:BG0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07376"
FT                   /db_xref="GOA:Q660Z5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z5"
FT                   /protein_id="AAU07376.1"
FT                   /translation="MNNLKEKINTYSKLILGSWQFGGGYFKQVEKEAAKKILKKAYNHG
FT                   IRNIDTAKAYGNGISEKIIGEIILKDPTIRENILIASKCYPMEISEFTNNFNESLKNLK
FT                   TDYIDIYYIHWPKNDFDLKPIASFLEEMRAKEKIKYVGVSNFEISHMESIKNVCKIDVN
FT                   QIGYNPLFRNKEKDVIPYCEDNNIATISYSTIAQGLLSKANIKDKRKFNDIITGKLILF
FT                   KKEIWPHTLKTINKLEEIAKRNNLTILELTYSWLKKTKLSGFIVGFSKESYVESNLNSF
FT                   KAEINDELYKEITSILDNFNHQTKNFPNLFNKKI"
FT   gene            complement(541547..542356)
FT                   /locus_tag="BG0538"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(541547..542356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0538"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0530"
FT                   /db_xref="EnsemblGenomes-Gn:BG0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07377"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07377.1"
FT                   /translation="MQIKAKNSLYDFLEEIYSKYNKKKFIHPDPLEFLYRYKEKEAIEL
FT                   VGLISSSLSLGRVEKILEAIEKILKPLGKSPSENLKLVNEKDLKEMFKGFVYRFFKEED
FT                   IVRLLYTLKIIKEKHHTLENLLYSIYYKNQNFILSIDELIKHMEKINGREFGMLLPKPS
FT                   KGSSCKRLFLFLRWMIRKDDVDLGIWEKFNPNKLIVPMDTHMTNIASKLFKIKEIKNVN
FT                   LKKAIKITRYFSKENREDPVKYDFSLTRFGINRDFNKEKLLKNIDKL"
FT   gene            complement(542340..542954)
FT                   /locus_tag="BG0539"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(542340..542954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0539"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0531"
FT                   /db_xref="EnsemblGenomes-Gn:BG0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07378"
FT                   /db_xref="GOA:Q660Z3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07378.1"
FT                   /translation="MIKKFLLLAMINIFLTNKAYSNEEVIEISTEIQKEKYIPFLISRG
FT                   KTQLEDLVKYTLEINPDLDKKYVNTIAKTYIEESLIEGINYDIAYAQMLLETGILKFNG
FT                   IVSKEQHNFSGIGATNNLTKGNSFPNITEGIKAHIQHLKAYASKQNINSNMVDPRFYLV
FT                   ERGSAPTIYDLTGKWAKDKFYDKKLKKILLELLEYNNANKS"
FT   gene            complement(542957..544252)
FT                   /locus_tag="BG0540"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(542957..544252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0540"
FT                   /product="hypothetical protein"
FT                   /note="similar to Borrelia burgdorferi BB0532"
FT                   /db_xref="EnsemblGenomes-Gn:BG0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07379"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07379.1"
FT                   /translation="MDTQIYELIFLTSFSIFLIVNLFNFKKEFTYEDYFIIFPGTFFVI
FT                   TLYFTEISPLMLYIGSIFLIFMIIIFFKNIKTIVNRRRRRSNNRPIKQSKGIFLSILLK
FT                   TILVMPAILTVIIATIFSYLALFINYPKDENSSYQIGFIRIKDHKNDLNLSIWYPVSST
FT                   LGLKKQNPFLLYEFNPFFINEMNYLPKQNNIYKQAFISNNQKIYDSILLILPYYSHDSM
FT                   FKSLISRLVKKGKIVYLYSPKYKHMKRYDFIKNSHKSIFSYVINKSISYLIEPANILNE
FT                   KADIASTENDIQSIIELVKSSKNLKFLNSKMNLNKLTLITLGNQANIANFILAKNTNII
FT                   KYINIGGKPQAIRNLKNLQLILKENEKELHTKVTNINSIKLIDISNIAEISDLIFSRNY
FT                   LKSFNFLKNKKSMLSRFNFIVTEINKFIEEEK"
FT   gene            544446..545207
FT                   /gene="phnP"
FT                   /locus_tag="BG0541"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        544446..545207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="BG0541"
FT                   /product="phnP protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0533"
FT                   /db_xref="EnsemblGenomes-Gn:BG0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07380"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z1"
FT                   /protein_id="AAU07380.1"
FT                   /translation="MVGTFLGTGASSGVPMLNCSCRVCTSSFSKNKRLRSSFFLKLSSD
FT                   IKLLIDTGPDIRQQLLRENIDKLDLVLYTHEHYDHIMGFDDIKFYTREAPLNIYARDTT
FT                   MAHIMNAFPHNFSSKPSLSGKANIIPNVIRDFEPIFFKGLEIVPIPLIHGEIVSLGYRI
FT                   GNLAYLTDVKFIPEESYDYLKNLDLLIIDAIRIKSHPAHLNFSEAICEVRKINPKISYF
FT                   THIAHDIMHEEFDYLEKDNIYLAYDGLKIYF"
FT   gene            545228..545995
FT                   /gene="exoA"
FT                   /locus_tag="BG0542"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        545228..545995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="BG0542"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="ortholog to Borrelia burgdorferi BB0534"
FT                   /db_xref="EnsemblGenomes-Gn:BG0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07381"
FT                   /db_xref="GOA:Q660Z0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Z0"
FT                   /protein_id="AAU07381.1"
FT                   /translation="MKLISWNVNGIRAVLKKGFLEFVKEYTPDILCVQETKALKEQLPR
FT                   DLILENYYSYFSKSKIKGYSGVCIYSKVKPISVNLLGKEIFDNEGRGLIAYYDNFVLIN
FT                   GYFPNSQALRRRLVYKLNFLSYVENLIDSLVNGGKNVVICGDFNIAHTKIDLISPDSNR
FT                   DSPGYYIEETTWLDSFLNKGYVDTFRIFNKEPGYYTWWSYRTRARERNMGWRIDYFVVN
FT                   EFFKRNVKKSLILDKVMGSDHCPVFLELADVVS"
FT   gene            546011..546784
FT                   /locus_tag="BG0543"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        546011..546784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0543"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0535"
FT                   /db_xref="EnsemblGenomes-Gn:BG0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07382"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07382.1"
FT                   /translation="MKKNIAIFYLIFSAIFSFGINLNDFDFYRSLEKEELMFFINLLKR
FT                   EQLTLANSCALEYIELAYKALKEKNINLLLKNDKELTVDSNIKHLRESKVYNNARLIFN
FT                   ATKDLNTLVHISKDGLLKTLDGRNVGFKDNKFIILDSFLNNDFYNNVPSEYTTIEIYNK
FT                   SILMPNLNKFILDKRSNPFVYLEDFNKNVYLNDIPKLSKEELLFLFYELFPISKLKSLK
FT                   DWNDFGFSSISKTLNKIYSEKINLKKGSANELSKN"
FT   gene            546765..549566
FT                   /locus_tag="BG0544"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        546765..549566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0544"
FT                   /product="zinc protease, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0536"
FT                   /db_xref="EnsemblGenomes-Gn:BG0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07383"
FT                   /db_xref="GOA:Q660Y8"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y8"
FT                   /protein_id="AAU07383.1"
FT                   /translation="MNCQRIKNYWKFTSVFLFFLFSCVSNDLKLDKNLVKGKLVNGLSY
FT                   YIYKNQTPKNAVNMGIVFNVGSINEEDNERGIAHYLEHMAFNGTKDYPGNSIVDVLKKF
FT                   GMQFGADINAATSFDFTYYRLDLSDGNNKDEIDESINILRNWASQISFIKEEIDLERNI
FT                   IIEEKKLGETYPRRIYEKMYKFLASGSIYEFRNPIGLEEQILFFQPEDFKKFYRKWYRP
FT                   ELASVIVVGDIDPREIEEKIKKQFISWKNPTDKIKKVKVNLDVRLKDKFLLLEDLEVGE
FT                   PSLMFFKKEIVNVEQTKDDVLNGIKSSLLAALFENRFSELKTVGVKHFKNVSNKDFFSF
FT                   KSDNNTIVARSISLNFNPDYLKEGIEDFFYELERIKKFGFTQDEFKKVRSQFFKFLSLK
FT                   KDNINKTNSWAIFEDLIDLAVGGSNKFDMSEYCDLSLQYLGKIDLKTMNNLVEKEFDVK
FT                   NCAIFYSYNGRVHPTLAFEDVDNLQKIALKREFKPYENSSIEGKFFKESLENKDIIREN
FT                   ELENKISSFVIENGVEVYFKYNDQKKGVIDFRATSWGGLINENPKLIPVLTFAPLVVSS
FT                   SGYGDYSALQIEKYLSDKSVSLNVSVGAQESYIVGSSAQKDLETLFELIYFTFKAPKID
FT                   DVFLQNAINDIKALIKSDENNSKYHFNKAISKFLNNNDPRFEDPKDSDLQYFTKENILS
FT                   FYKKRFTYANNFKFVFVGDSDIETIKAYSKKYLGNLNFKKISEYKDLDYSYSKNFNKTV
FT                   IRKGKDLTSFAYVVYPFKFNYLEETSLNLNALADLLTDDLIKNIREKMSSVYSIQASFD
FT                   SNLRKYVDSDGILSIVFTTEPKELDNVLNSINRYMIERQKIDFSDQDFSYVKKNYIKNT
FT                   KINSEKNSYWISNILASLSWHGVFKNNFGVKFIEANLSKDLINKFFKKINLNEKAEILL
FT                   IPE"
FT   gene            complement(549695..549767)
FT                   /gene="trnK"
FT                   /locus_tag="BG0545"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(549695..549767)
FT                   /gene="trnK"
FT                   /locus_tag="BG0545"
FT                   /product="tRNA-Lys"
FT   gene            complement(549878..549950)
FT                   /gene="trnK"
FT                   /locus_tag="BG0546"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            complement(549878..549950)
FT                   /gene="trnK"
FT                   /locus_tag="BG0546"
FT                   /product="tRNA-Lys"
FT   gene            complement(549999..550643)
FT                   /locus_tag="BG0547"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(549999..550643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0537"
FT                   /db_xref="EnsemblGenomes-Gn:BG0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07384"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07384.1"
FT                   /translation="MKFFFLLQITLILLFNLSLLFGQSQPKEKEDSLLLYKEGKFKEAI
FT                   SNTLEEIRLNPNNLDARTILIWSLIAIGEYKRAEKEAIVGLGIKKYDIRIIQALGEAYF
FT                   FQKNYENALKYFQEYISLDSKGARIIKVYNLIADSFYELKRYNEADFAYEHALRFAPNN
FT                   QNLLIKLARSRINANNKILAEEALIKLLTISPNNLEAKNLLEELKKNNSKP"
FT   gene            complement(550640..550996)
FT                   /locus_tag="BG0548"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(550640..550996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0538"
FT                   /db_xref="EnsemblGenomes-Gn:BG0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07385"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07385.1"
FT                   /translation="MSIDSLEFEESSTQNVIKKNFEFEGYIESNKPIIIEGKLKGLINS
FT                   SNSIYLREKASVEAEIKCQHLLNHGKIKGNIEALKTIKIYKTGKLIGNIKTKELFIDSG
FT                   AIFKGNCEMENFEE"
FT   gene            complement(551081..551779)
FT                   /locus_tag="BG0549"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(551081..551779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0549"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0539"
FT                   /db_xref="EnsemblGenomes-Gn:BG0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07386"
FT                   /db_xref="GOA:Q660Y5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y5"
FT                   /protein_id="AAU07386.1"
FT                   /translation="MIELTQEKQEILIKNKFLAKVFGLMSIGLLISAIFAYATSENQAI
FT                   KAIIFSNPMSFMAIILIQFGLVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIY
FT                   TQGSIVFTFGITAGTFLGMSVYGYTTTTDLTKMGSYLIMSLWGIIIASLVNMFFRNSGL
FT                   NFLISILGVIIFTGLTAYDVQNIAKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYL
FT                   LRFLGQRRND"
FT   gene            complement(551802..553883)
FT                   /gene="fus-1"
FT                   /locus_tag="BG0550"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(551802..553883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus-1"
FT                   /locus_tag="BG0550"
FT                   /product="translation elongation factor G"
FT                   /note="ortholog to Borrelia burgdorferi BB0540"
FT                   /db_xref="EnsemblGenomes-Gn:BG0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07387"
FT                   /db_xref="GOA:Q660Y4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660Y4"
FT                   /protein_id="AAU07387.1"
FT                   /translation="MDYNKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKGKDGV
FT                   GATMDSMELERERGITIASAATHVEWKDFPINIIDTPGHVDFTIEVERSLRVLDGAILV
FT                   LDSVAGVQSQSITVDRQLKRYSVPRLAFVNKCDKTGANPYNVRDQLRSKLDLNSVLMQI
FT                   PIGLEDKHIGVIDLVLMKAYYFEGKDGTEIIEKEIPSDLLGEAKKKREIMLDALADFND
FT                   ELMELHMEGKDVPIEIICNAIRTGTLALKLCPVFMGSAYKNKGVQLLLDAVTRFLPSPH
FT                   DIKNTALDINNNEKEIDLKIDNDLPTVALAFKLEDGQYGQLTYVRIYQGTLRKGQELIN
FT                   SRTSKKFKVGRLIRMHANNTEDIEFGGSGDIVALFGIECASGDTFCDPSINYSMTSMFI
FT                   PDPVISLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGELHLEVYI
FT                   ERMKREFKAEVETGMPQVAYRETITGKAEFNYTHKKQSGGAGQFGRVAGFMEPLNKEGE
FT                   TYEFVNLIKGGVIPTEYIPSCDKGFQKAMEKGTLIGFPIVDIKITINDGQYHIVDSSDI
FT                   AFQLAAIGAFREAYEKAKPTILEPIMKVTLEGPTEFQGNMFGLLNQRRGIITGSLEDGS
FT                   FSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLKYGKVPNAIFDELRKKFNDQNKS"
FT   gene            554195..554422
FT                   /locus_tag="BG0551"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        554195..554422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0551"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0541"
FT                   /db_xref="EnsemblGenomes-Gn:BG0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07388"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07388.1"
FT                   /translation="METLIISNELSKISQVGYDSSVSELSVFFKDGRAYKYFKIEPRHF
FT                   SVISKLIEDKRSVGKYLTENIFNKYDQEKL"
FT   gene            554653..555180
FT                   /locus_tag="BG0552"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        554653..555180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0552"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0542"
FT                   /db_xref="EnsemblGenomes-Gn:BG0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07389"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07389.1"
FT                   /translation="MYKLLFIVVFILSCSSIFREYQNISGEYYKLAKLNEELGNNETSV
FT                   LLYEKSIKFNINAGNDSSYNFILACINLKKYVEAELKLNSIIKEDPKNILLINLKGYLL
FT                   FKKNDLDNALIYYLKTLEFAPANKEALFNIFYNYHLKSDKKNAKKYILRYKELNHPMPS
FT                   GVEEIVSSILKS"
FT   gene            555289..555939
FT                   /locus_tag="BG0553"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        555289..555939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0553"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0543"
FT                   /db_xref="EnsemblGenomes-Gn:BG0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07390"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07390.1"
FT                   /translation="MMRLKVLILCLFGIFVVNGFTDTNFEFNFGGGVAFPVNPFSSFYN
FT                   EALEINAKLKQNLPSDLSPMKKEDIAQKFSDLANISKSGLRYGTYAQFGAKFDDFVSIG
FT                   CELMFDINLFKVIKRSDGTANENFSFVMAITPRFYTKLDFFVLALAFFTGPKINIATAA
FT                   ADSVLAEMGTMGWDIGARLSFSFLILEGYYVWNIQNFKFSDFKFGIGFEFGIV"
FT   gene            556145..557365
FT                   /gene="prs"
FT                   /locus_tag="BG0554"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        556145..557365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BG0554"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0544"
FT                   /db_xref="EnsemblGenomes-Gn:BG0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07391"
FT                   /db_xref="GOA:Q660Y0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q660Y0"
FT                   /protein_id="AAU07391.1"
FT                   /translation="MNLLKKKSIGIIACPGGRVFANKIIEELERIFINVENDIVDSICQ
FT                   DSKALKEEIFKIEKVLSPFLEGLSLSTFKSKEPLEIPVKFVKFANGEFKTEILKTIRNK
FT                   DIFIVQDVANTYEVEINSSEKIIMTVNDHIMNLMTTIDACMQAKANSVSVIIPSYPYSR
FT                   QDKKHSRECLTASLIGRFLEELGIRHILTLDIHSKAIENVFRKVYFENLNVSYEIFKSL
FT                   GDLIDIRDSNLVIVSPDTGAVSRNKFFASSLKSPLALLYKERDYSRVSNDVADSNISVT
FT                   KLLGDVEGKNVFMSDDMLATGGTLIKAMKLLKSMGAKKIICGISLPFFNGDAIKYFDKA
FT                   YEEGYFYKIIGTNAVCHNDELINKPWYHETNVAHLFANAIFAIYNKVGLQKILDRRDDI
FT                   QKLITKG"
FT   gene            557369..558736
FT                   /gene="xylB"
FT                   /locus_tag="BG0555"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        557369..558736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BG0555"
FT                   /product="xylulokinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0545"
FT                   /db_xref="EnsemblGenomes-Gn:BG0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07392"
FT                   /db_xref="GOA:Q660X9"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X9"
FT                   /protein_id="AAU07392.1"
FT                   /translation="MNSLSIDIGTSVLKAALVSSESGVLSYIDVSYSDYFDIDFENFDF
FT                   NIWLFSFKKAISNFQSSKIDCISVSGISPCLIALNSNLIPLEVLHWNSLKKIKPDFRGK
FT                   SVFLPYVLNTVERGTYSKISYFVSCFEYFIYLLTGKLFTSFPSIEYIPFIWDDIEIKKY
FT                   GLDKNKFPPFIKMGENVGVVTYKAGVEFGLNSGISVINAGSDYLSVLVGSGAFEEGIVS
FT                   NRMGTSEGFNFVSSTYLPGFSLEYPYFLEGYFIVGRIVPFGYLIQLLKDSFYKKSLTFE
FT                   ALLKKIVKSATLNNVYFYPSKIRLFNDLFILDPYICKDLSKGIFGSIKNPLEIGLAILE
FT                   FVCFAFYNRLVELKAYKKEISSIFVSGSNSDNLFLNQVKANILGEDLKIFDFKHSEIIG
FT                   GAIQAFYSLREFGSLNDSFLKLAKIKHVVSPISEIHEEYLEKYQKYINNYSLFVNG"
FT   gene            complement(558719..559402)
FT                   /locus_tag="BG0556"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(558719..559402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0556"
FT                   /product="hypothetical protein"
FT                   /note="similar to Borrelia burgdorferi BB0546"
FT                   /db_xref="EnsemblGenomes-Gn:BG0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07393"
FT                   /db_xref="GOA:Q660X8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07393.1"
FT                   /translation="MKDLNENNDNNKGFFVALTSIATVCIIIFLGTIIFFPNKNLASDI
FT                   AEKNIVLEEAKDQNILENIDENEKSLKVSETPNEIIIDLTQDLNKEKKLTSKTPNTSQK
FT                   SKPIEKSQPVAKKIPNTSQKSKPIEKSQPIAKKALDIDSVYDPNTEYYIQFVSLSDPIN
FT                   ADNYIQKLLKYNIVAKIYSATVDNKDIYRVRSGPYKTKSEAKADFKKITGISEFKETYI
FT                   LPVNK"
FT   gene            complement(559386..560003)
FT                   /locus_tag="BG0557"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(559386..560003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0547"
FT                   /db_xref="EnsemblGenomes-Gn:BG0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07394"
FT                   /db_xref="GOA:Q660X7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660X7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07394.1"
FT                   /translation="MGRNPLIIGITGRIASGKDAASKIISNKYGFYEISADKLGHLVLH
FT                   EKKEELVKIFGQKILNTRNEIDRLLIRNLVFNDNKELKKLESISHPIIFNKIKKILIQN
FT                   QSTKIIINAALLFKINLEKLCDYIIVVKAKAPIIKNRLSYSMPSIDSNIINKILEIQKD
FT                   IFFKKNIINLKIINIINNKNYAYLEKEIEKKMQEIINYERFE"
FT   gene            complement(559985..562714)
FT                   /gene="polA"
FT                   /locus_tag="BG0558"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(559985..562714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BG0558"
FT                   /product="DNA polymerase I"
FT                   /note="ortholog to Borrelia burgdorferi BB0548"
FT                   /db_xref="EnsemblGenomes-Gn:BG0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07395"
FT                   /db_xref="GOA:Q660X6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X6"
FT                   /protein_id="AAU07395.1"
FT                   /translation="MKELYLIDALNIIFRNYHVLKNYPLLNTQGENVNAFIGFFKTLFF
FT                   IIKEKNPEHLIIAFDSEMPTFRKQKYPNYKATRDAPPNDLIPQIGWIKEGLLKAKIPIF
FT                   EIDGYEADDILASFAKKAEKNGYLTYIISPDKDLLQTMSEYIKILKIENNSFIEMNNEY
FT                   VIKKFGINSFQIKDYLAIVGDRSDNIPGIKGIGSKGAANLLREFKTLKGIYSNLELINK
FT                   KHQEILIKEKENAFLSYDLVSLEENLQIPEIENFYLKNFNEEIISLFEKHSAVALIKTY
FT                   KKDILKKKEENLGQKSLFEQESITKSLNALNTIDTENVKYYSITTKKELDNLIEGLKQA
FT                   NYISIDTETSSLDTYTAKLIGISISFKEFEGYYIPIETKGKIYIEKHYIIQKFNNLFKS
FT                   NPKIIGQNYKFDYKILKNNGFSPIPPYFDTMIAAYLIDTNSKVSLDFLAEKYLMHKNIK
FT                   YEDVIQKNDNFANISLEMATSYSCEDADITFRLFNIFTEKLKEDELYELMHEIEMPFNN
FT                   VIIEMEENGIYLDKEYLKEYGKELGKELELIENEIIKSIGIDFNLNSPKQMHEILFEKL
FT                   NLKLPEKMKKDSTDIKVLESLREQHESIGNLIKHRRIAKLKSTYTDNLIELINYKTNRL
FT                   HTSFIQTRTATGRITSINPNLQNIPIKDEKGRKIRKAFKPENGNIFISADYSQIELAIL
FT                   AHLSQDETLIKAFENNKDIHIETASKLFKIEEKEKITPNLRRIAKSINFGIIYRMSDFR
FT                   LAKELGITKEEAKGFINSYFDSYPKIKEFIINQINFVKNTGYSETILKRRRYIKEINSN
FT                   NYLERSAAERIAINSTIQGSAADYMKIAMIKVFNEFKNKKMESKILLQVHDEMLIESPI
FT                   KEENEVKKILKIMMETAYTLNLPLRANIETGKSWGEIH"
FT   gene            complement(562711..563115)
FT                   /locus_tag="BG0559"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(562711..563115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0559"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0549"
FT                   /db_xref="EnsemblGenomes-Gn:BG0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07396"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07396.1"
FT                   /translation="MSVNEILKKYFSNLLLELKELKLILTIESNELQREKIRILNITNP
FT                   KKDLILESIKSYYKTINAWLKSSKNQKLDNFDHLIKEINLLKEEIYIKYQICYKLLQKI
FT                   VNSKRKIPKIKKHQSCIIVSNSPIMLDIKI"
FT   gene            complement(563105..563524)
FT                   /gene="flaJ"
FT                   /locus_tag="BG0560"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(563105..563524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaJ"
FT                   /locus_tag="BG0560"
FT                   /product="flagellar protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0550"
FT                   /db_xref="EnsemblGenomes-Gn:BG0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07397"
FT                   /db_xref="GOA:Q660X4"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X4"
FT                   /protein_id="AAU07397.1"
FT                   /translation="MIAKETIYKQTQINTSNPLSILIMLYDKAIQDLKIAKELIKDENW
FT                   QNKIKANEKIFHAQEIITELMSTLNFEKGGNISTNLLSIYSFLNKELENVLLKKEIHKI
FT                   DNVIKQLQELSFTWKKLRKKENNITQNKLGINIVG"
FT   gene            complement(563533..563913)
FT                   /gene="cheY-1"
FT                   /locus_tag="BG0561"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(563533..563913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-1"
FT                   /locus_tag="BG0561"
FT                   /product="chemotaxis response regulator"
FT                   /note="ortholog to Borrelia burgdorferi BB0551"
FT                   /db_xref="EnsemblGenomes-Gn:BG0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07398"
FT                   /db_xref="GOA:Q660X3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X3"
FT                   /protein_id="AAU07398.1"
FT                   /translation="MEEGKKALIADDSLFMRKNLIKILKQLGFKEFLEAEDGIQAVKEF
FT                   EKQNNIDLITLDITMMGMDGITALERMYEINKKLLKKVNILMVTAIGKQELIQKALSLG
FT                   ARGYITKPFKEDQIIEQIKLLD"
FT   gene            564160..566142
FT                   /gene="lig"
FT                   /locus_tag="BG0562"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        564160..566142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="BG0562"
FT                   /product="DNA ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0552"
FT                   /db_xref="EnsemblGenomes-Gn:BG0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07399"
FT                   /db_xref="GOA:Q660X2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660X2"
FT                   /protein_id="AAU07399.1"
FT                   /translation="MSIKIQQEIEDLKKLIRKWDKEYYVDSLPSVEDFVYDNHILRLKE
FT                   LESRHPEYKTLDSPTLKFGSDLLNNFEEVEHSVPILSLDKVYDLDLLKSWIDKIDFNNS
FT                   FNISVEPKIDGCSIVLYYKDGILEKALTRGNGKFGNDVTKNIRTIRHIPLFLDEKVDLV
FT                   LRGEVYITKENFFKINKFLEKPYTSSRNLASGILRRVDSREVANFPLNIFIYDFLNAEL
FT                   ELKTNDLAIAKLKKLGFKVDPLIRFFDQKSSIIEVLNYIADITKKRNSFEYEIDGVVLK
FT                   VSEFVLREKLGYTSHHPKWAMAYKFEALSGFSRVNSIVVQVGRSGKITPVANIDKVFVS
FT                   GAFITNATLHNQDYIISIGLNVGDVVKVSRRGDVIPAVEMVINKCSKGVFKVPDNCPAC
FT                   KTVLVKEGAHFFCTNNSCPSVAVERIKYFCSKNCMDIEGFSDKTISFLFEKEFISSEID
FT                   LYTFNFYKLLKFKGFKDRKVYNLINSIEASKKKPFSKLLLSIGIKELGENAIRLLFLNN
FT                   LNSFSKLFRLCQDRNFAFSTLLKIKGIGEKIALNIIEAFNDSTMLNKFKFFENLGFKME
FT                   ESILIDDENRLLAGKKFCITGTFNGYSRSIIIDKLKNKGAIFKTCVTEGLDFLIVGEKA
FT                   GSKLEKALNLNVKIMSFEDIKSYLN"
FT   gene            complement(566167..567654)
FT                   /locus_tag="BG0563"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(566167..567654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0563"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0553"
FT                   /db_xref="EnsemblGenomes-Gn:BG0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07400"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07400.1"
FT                   /translation="MNKTKNQSFKYFIMLLCISLFGANNTINYSSIEIPLEDLSEEFKD
FT                   TGNKNDQINTSKHLNKKIVSYKDPKKGKELKLPENIRDEKLLKKRMDENDLKSIIENYE
FT                   NKIKNIEKLLKAKNQKASSNENKKIESIEKKAKKYEILTNKLKNEITEIKKLLNKRSKP
FT                   KEDENYEKINIENIDDDDDDFEENYEYNDEIEEINEDKYPSNEGIINSLKENLHANEKY
FT                   YAINEKKIDELEDRINDNENTILDLQRELRNFKKKDNSDKNLEEIEENLSSIGRIINDL
FT                   KEKISANEAINKENQKKIRTDKHKLKELEDKIKENEETILKLQKELNNFKKKEISQKSS
FT                   NEETFIPSITNKNDELEESNKLEKKYFKPIEKNESEDLEEKAKNTKKTTMIKTANFQVY
FT                   PDIYINNYKFKEKGDQFAFKKENTYYIEIDPTNNLNEALKNHEIISKYKFEKYFINPTL
FT                   KNKEEFFRNLIEVKNIHELGIMYKSLKPKFKQIKIIK"
FT   gene            567938..569800
FT                   /locus_tag="BG0564"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        567938..569800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0564"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0554"
FT                   /db_xref="EnsemblGenomes-Gn:BG0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07401"
FT                   /db_xref="UniProtKB/TrEMBL:Q660X0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07401.1"
FT                   /translation="MTNVDAYEFWALPVCCNVKDSFIEDFSFVDEHLSSIFSISYKDNI
FT                   TLKFRDFVDSNEFNLKLFDNKVSFEGQIPLVLYSDNLEYLLKAEKSVLFNLRISDGSNN
FT                   YSPRFEKKESGDCNALNACYEFSDYNSFPDDFILVKIFFDSENLIIDANVDNISFLKFF
FT                   ISENFSVNKDKITINSLNNYWSSSIFPVSFNAILQGIVISKKINKRVNVIYYKRHFRIL
FT                   DNLNLTFSVSNCLLADNKLSKVILEIIINRPLNFLYKFYFKFINNIFKNLFFDGFLEIF
FT                   FVENKSDFIFFYDNLLAFETSVYNFIYSNFYNLALAMPCEPIGYLLTQIKGDYSRFFKI
FT                   FKRLDLKNSLIKKSSVISVNKNYDIFDTSRRGVGFAYLNSNAYFLSGEQYVVAFLYKDG
FT                   LNIFLPYSIIDNNLSNYLKNSLAKTLGLAYNSINFLIDGSSLDFTNFYSLLFKDPYLIE
FT                   KAILTIKDNFSSLISTGFISEYPVIFKEKIANEYVNDCVLGCSVELKFEFYSLNAVFTN
FT                   VSFFVEQGKFTKLKLNNKRIRTIFGLAVDYVFCSANVNCDIKDCLSLEFIEDGEFVFSF
FT                   RSFFIVSVSAIRTALIQIFDFNAGSTPLNFEEILNSWSVKIDIN"
FT   gene            569787..570254
FT                   /locus_tag="BG0565"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        569787..570254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0565"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0555"
FT                   /db_xref="EnsemblGenomes-Gn:BG0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07402"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07402.1"
FT                   /translation="MILINFNLNGESISKKISLSLGTRSLLDSIFFAKSNSLEYIVNNR
FT                   FFLILLDFRLVYSHLIPAFILNGRSVVTLEGLKKTNFYQHMQNILLEDDFNFCSNCFES
FT                   NILLFYYFLENKIVSKSDILGYRNSLKCNCMDVNTFLSLYLKAEELYRKNG"
FT   gene            570247..571116
FT                   /locus_tag="BG0566"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        570247..571116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0566"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0556"
FT                   /db_xref="EnsemblGenomes-Gn:BG0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07403"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07403.1"
FT                   /translation="MVNVKVYYPENFNILSNLFNKNLNNYIIYNELDFKKNPNLFNRET
FT                   PIDNFFLVGNFEKFNKVSLRGNFLEMGPCVTYNEILKIGKKNIPSLFYEFISKFNDKIY
FT                   LNSINLANGFYYKNTIFDIYPLLLSLDAQIEFKNVLTKKTYVFSAYNLNRAEYIANRST
FT                   VLVTKFKFPMMNLCNRSFYHKVFFNTLSFDILEEANIIFICILLNIKRDVINDFLLKIF
FT                   YDDKVIVIKDFQILLLNKSLPLSFSEIENSLKMLDKNIRDSKNFNIGERNLKLIKNFYL
FT                   DILMNFNF"
FT   gene            571254..571514
FT                   /gene="ptsH-2"
FT                   /locus_tag="BG0567"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        571254..571514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH-2"
FT                   /locus_tag="BG0567"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="ortholog to Borrelia burgdorferi BB0557"
FT                   /db_xref="EnsemblGenomes-Gn:BG0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07404"
FT                   /db_xref="GOA:Q660W7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W7"
FT                   /protein_id="AAU07404.1"
FT                   /translation="MVKKEAIIKAVNGLHVRPASTFVKKAKEYSSEITIESDGKSVSGK
FT                   SLFRLQTLELSSGKKLLICAEGEDEEIAASELAELIESFKE"
FT   gene            571535..573256
FT                   /gene="ptsI"
FT                   /locus_tag="BG0568"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        571535..573256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BG0568"
FT                   /product="phosphoenolpyruvate-protein phosphatase"
FT                   /note="ortholog to Borrelia burgdorferi BB0558"
FT                   /db_xref="EnsemblGenomes-Gn:BG0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07405"
FT                   /db_xref="GOA:Q660W6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W6"
FT                   /protein_id="AAU07405.1"
FT                   /translation="MTLSGKRISKGIGIGEVLCIRKNFDKIVSREKIEFSQVDSEISKF
FT                   NKAKLKAIEALKDLDRKAVLQFGDDKKGIFEGQVLIVEDDELSELVIELITKENYGAAY
FT                   SIYLAFENLVKSVEDYKDPYLKERASDYKDIRNRLISIILGQVTDFSEINKDIILVTEE
FT                   LTPSDTMQFDLNYVKGFLTAVGGETSHAAILARTMGLPALVMTLLDIDALKDGDKIVID
FT                   AISSIVIKNPSSDELDLYKGKILRQVEMEKELFSLKDKDAETKDGVKVFLKANIGTPVD
FT                   IAYVNKYGVEGIGLFRTEFLYMKSLQPPTEDEQFETYKRVLDTMEKKGIVTIRTLDVGG
FT                   DKEIPYLNFEKEENPFLGFRALRMYKKYEELIQAQFNAIFRASHYGKIRVMVPMLTRYE
FT                   EIETIEYFVNNAKISLKSRGLPFDENLEVGCMIEVPSAALISSKLANKLKFFSIGTNDL
FT                   TQYVLAVDRGNQKISNLYDKYNPAVLKLIKKVLDDGISSGIDVSVCGELGGDDAGALLL
FT                   VGLGFRSLSMIPSATLRIKYLLRKYTIMELEELANKVLNSNSEQETLSYFDKFIGD"
FT   gene            573259..573828
FT                   /gene="crr"
FT                   /locus_tag="BG0569"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        573259..573828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crr"
FT                   /locus_tag="BG0569"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /note="ortholog to Borrelia burgdorferi BB0559"
FT                   /db_xref="EnsemblGenomes-Gn:BG0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07406"
FT                   /db_xref="GOA:Q660W5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W5"
FT                   /protein_id="AAU07406.1"
FT                   /translation="MGFLDFFKKTATLDLIAPISGKVMSIDKVPDEAFAEKIVGDGIAI
FT                   LPTSNELLAPCDGKIGKIFKTNHAFSLETKEGVEIFVHFGINTLNLNGRGFTRVAEEGI
FT                   NVKQGEVIIRLDLEYLKEHSESVITPVVIANSDEVSSIEYSFGRLENESEYILSSSTVL
FT                   TEEIRHKISQTKPVTAGKDLVLRVRK"
FT   gene            complement(573866..575716)
FT                   /gene="htpG"
FT                   /locus_tag="BG0570"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(573866..575716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="BG0570"
FT                   /product="heat shock protein 90"
FT                   /note="ortholog to Borrelia burgdorferi BB0560"
FT                   /db_xref="EnsemblGenomes-Gn:BG0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07407"
FT                   /db_xref="GOA:Q660W4"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660W4"
FT                   /protein_id="AAU07407.1"
FT                   /translation="MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKFL
FT                   SLTNEKFKNIALEPKIEITFDDKSILIKDNGIGMNEQDLTNHLGVIAKSGTKEFINNLK
FT                   QDEKKSASLIGQFGVGFYSAFIVSEKVEVTSKKALESDAYIWFSDGKTGYEIEKAKKEE
FT                   SGTEIKLYLNKEGLEYANKWKIQEIIKKYSNHINYPIYIKYSEPIMKDGKQEGIEEKEE
FT                   KLNETTALWTKNKSEIKAEEYNEFYKNTTFDYENPLMHVHTKAEGNLEYTNLFYIPSKA
FT                   PYDLYYPNTKPGVKLFINRIFITDSEGSLLPNYLRFIKGIIDCQDLPLNVSREILQQNK
FT                   ILSKIKSSSVKKILSELEKLSKKNPEKFSKFSKEFGRCIKEGVYSDFENREKLISLIRF
FT                   KSSSVDGFVSFKEYKERMKESQKSIYYITGGKENILKENPIVSAYKEKGFEILIMDDEL
FT                   DEAILNLIPEYEGLKLKAINKNETSNELKDENFKKIEEEFKDILTKVKEILKDHIKEVN
FT                   LSATLIKEPSAIIVDSNDPTYQMQKIMLSMGQEVKEIKPILELNPNNKIVQNLKNLESE
FT                   KLEKISILLFEEALLTSGMPSKNPGKFINIINEFLEKELL"
FT   gene            575829..577223
FT                   /gene="gnd"
FT                   /locus_tag="BG0571"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        575829..577223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BG0571"
FT                   /product="phosphogluconate dehydrogenase, decarboxylating"
FT                   /note="ortholog to Borrelia burgdorferi BB0561"
FT                   /db_xref="EnsemblGenomes-Gn:BG0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07408"
FT                   /db_xref="GOA:Q660W3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W3"
FT                   /protein_id="AAU07408.1"
FT                   /translation="MDVGIYGLGVMGGNLALNIADNGFNVSVYNRDSEKTEIFVKQNSH
FT                   KKINGFKDVESFVKSLKPPRKIILMVTSLAVEKVVEQILPLLNKSDIIIDGGNSHYKNT
FT                   MRIEKELFAKDIYFVGLGISGGERGARFGPALMYGGSKSAYEILEPILNKIAAKTKNND
FT                   VCSTYIGENGSGHYVKMIHNGVEYADMQLISEVYFFMKKAFNLDNSKISEVFEKWNEGD
FT                   LSGYLLEITSKILRYKENNEYLVDKILDVANQKGTGVWTSIDALESSMPVNLILESVFS
FT                   RFMSGLKHERIIASDLLKMDTASFEFELSDWILDLYYALLVSKIVAYAQGFMMLKTASV
FT                   NYSWDLNLGKISLVWREGCIIRSSFLDKIKLAYDKNPHLINLLFDDYFLDLLKNNHKSL
FT                   RRIVSKASEIGIPLPAFYASLSFLDSYSTNYLPSNLIQAQRDFFGAHSFERLDSKRGEF
FT                   FHSIWQ"
FT   gene            complement(577254..577793)
FT                   /locus_tag="BG0572"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(577254..577793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0572"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0562"
FT                   /db_xref="EnsemblGenomes-Gn:BG0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07409"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07409.1"
FT                   /translation="MKKIFILLIMIANISTNSFAKDSYLNRGIGFGASIGNPIINLIMS
FT                   FPFIDFEIGYGGSNGINLSGLKLESKLYDFNLLAIAAFDFIFTIPLIKKLNLGVGIGGN
FT                   LSISSHTSKLINIELGFGIRIPLVIFYDITENLEIGIKIAPSIEFISNTRSLAHHKTYS
FT                   GIKSNFTGGIFAKYYI"
FT   gene            complement(577947..578465)
FT                   /locus_tag="BG0573"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(577947..578465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0573"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0563"
FT                   /db_xref="EnsemblGenomes-Gn:BG0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07410"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07410.1"
FT                   /translation="MRTKIIIMLIIILLAPSLGFANSKASARGKFGAGIILPLPIALHI
FT                   NMGSFDLDIGLYSGVNNLFLDWKTLFIALDYIFYIYTFPGTANILDFSVGAGGYGTIWF
FT                   SRFGGSKSGSGPMSIGARLPLALNLAVFRKKFDIFLRIAPGLGMNIWSAGIGFRWEVFA
FT                   GLGLRFWFT"
FT   gene            complement(578547..579131)
FT                   /locus_tag="BG0574"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(578547..579131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0574"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0564"
FT                   /db_xref="EnsemblGenomes-Gn:BG0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07411"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:Q660W0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07411.1"
FT                   /translation="MQSKNKIIKLLIIIILFFNVENIFTNEKSKNNSTSSKIDSLKTKT
FT                   KIKFGFIMPYPTAIEFSINNFNIGIGVTILSVSEFFPKSPVALLFKTYFDYMFLNLRIK
FT                   NSNFIFFLGSGLFFEIGKITNSNLTNVFSGITYKIGMGLPLGITYEAYYDVIEIIIKTT
FT                   PSIFIGQLPNGNLMFPIKGNFSIGIKGSLKI"
FT   gene            579337..579879
FT                   /gene="cheW-2"
FT                   /locus_tag="BG0575"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        579337..579879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-2"
FT                   /locus_tag="BG0575"
FT                   /product="purine-binding chemotaxis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0565"
FT                   /db_xref="EnsemblGenomes-Gn:BG0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07412"
FT                   /db_xref="GOA:Q660V9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V9"
FT                   /protein_id="AAU07412.1"
FT                   /translation="MGMDSDMQDSLSQYLLFSLDELYAIEVKYVVEVLEYTKISKIPRT
FT                   PSYMAGIINNRGKIVPIIDIRKQFGMDDRVVDEDAKKRNKGVNISNIIILTLVYEGDEF
FT                   NLGILVDYVNEVLELDPFSIDDAPKIGSGFNSKFISGIGKSNNKFIIILDVENLFDVRE
FT                   LSRFRNTTIYDPEHQQQ"
FT   gene            579891..580202
FT                   /locus_tag="BG0576"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        579891..580202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0576"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0566"
FT                   /db_xref="EnsemblGenomes-Gn:BG0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07413"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07413.1"
FT                   /translation="MIYRPEGELVVNSIFKVKEDLLHIFKKMKEGDTLTIDLSNVEKID
FT                   ITFIQILYASNKYAKNKNLFVKIEYPSDEVLSSLIYGGFLIDIEDVDSFDLGANLVGF"
FT   gene            580218..582359
FT                   /gene="cheA-1"
FT                   /locus_tag="BG0577"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        580218..582359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA-1"
FT                   /locus_tag="BG0577"
FT                   /product="chemotaxis histidine kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0567"
FT                   /db_xref="EnsemblGenomes-Gn:BG0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07414"
FT                   /db_xref="GOA:Q660V7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V7"
FT                   /protein_id="AAU07414.1"
FT                   /translation="MDSSDVIDKFKNSFKEESIENISDIEQALLNLEASSDQEIINSIF
FT                   RNLHTIKGSSGMFGFNFTASLVHEIETVLDVIKDGRAAFNQAAIDTTLMSVDFIRELIE
FT                   GDEAISEIDFDKRKQFLVDEIKRVLETPNVKGAFQEALENDFSKPDKSSVLEECLKVNS
FT                   DNKFDDEALRSEFKSYKILFSPAKGILFHGHKPINLLNKLIDLGSGHVRAKVDNIPDLE
FT                   LISPDNVYVDWEIRLDTEESRESIADIFIFLDSQSKIDIQELDKCLETDKGYNLGLKNF
FT                   NLSSLDRSIKDSANSAFKKSTFIGKSFLNGDKNRSNVQDDTARSKVNIASIKVDSKKLD
FT                   HLVNLVGELVTIQSKLSKEAENRNSNILNSISAEFSLLINELRDYTTGLRTVPIEILFV
FT                   KFQRIVKDLSTSLGKSILYNAYGGDTVLDKSIIEKLNEPLVHLIRNSIDHGIESPEERE
FT                   RLGKDPKGIIKLSACQSGDSVIVIIEDDGRGLDKNKILKKAIERNIISDSAVKTLSNID
FT                   VYNLIFEPGFSTASSVTDISGRGIGMDVVKKQVESLRGHVVLESELGKYTRTKLIFPLT
FT                   LAIIEGWLVRVKDEHFIVPLSNVESCLESNKLISQMDGVETKSNVMNYRGSMISCIRLR
FT                   EFFQVSSEKSFSEQVVVVNTNSGKMGIVVDEVLGQHQTVIKALGKIYSRVEGVSGATIL
FT                   GDGSLALVVDIDAITKLIR"
FT   gene            582415..583572
FT                   /gene="cheB-2"
FT                   /locus_tag="BG0578"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        582415..583572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB-2"
FT                   /locus_tag="BG0578"
FT                   /product="protein-glutamate methylesterase"
FT                   /note="ortholog to Borrelia burgdorferi BB0568"
FT                   /db_xref="EnsemblGenomes-Gn:BG0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07415"
FT                   /db_xref="GOA:Q660V6"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V6"
FT                   /protein_id="AAU07415.1"
FT                   /translation="MKILVIDIQGLIKQVFIRAFSKDNDVEILNAGFNSLNLINVFLQK
FT                   FPDLVIIDENTARSNFGNSLNNVLNNISLPVVFIAQNEMFPNFGCLEQSKEKVKLIINK
FT                   LNFKLTVDLFRSKYLALIKLELRNLGKNKLISSYEVKRISAPDFSSHSKVELRGNSLDD
FT                   SSIRKSYRVSDVINFAPKNDPDVIIKYQGLLNKHKTGKIIVVGSSTGGTEALRIFLSSF
FT                   KKDSPPIIIVQHMPGGFTKSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVK
FT                   YGSGNYFVNLLDGPLVSRHKPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAICMLEMKK
FT                   NGAYTIAQDQETSVVFGMPMEAIKIGAVYKILPLSKIADHVLRRS"
FT   gene            583575..585347
FT                   /locus_tag="BG0579"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        583575..585347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0579"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0569"
FT                   /db_xref="EnsemblGenomes-Gn:BG0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07416"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07416.1"
FT                   /translation="MDNDNNDFFANDYLATLFYKLEVFDESARHVYSNLSKSIPKLIEK
FT                   ISKDSKDLSFSIDLISNLDLDNDASLNNFIAKIIGALDDFVAYFNSSTTSLESQFSVIR
FT                   SKVKDIEILEDVIEKMKKSSLDMEIMSINTLTVAMRAGKAGGAFSYITSEIKVLTQSMI
FT                   KQADQLTSKGREVKIGLDRAKNQVYESNTAENKILEEFRDNLMKKIDAFSDGIGSVIAL
FT                   YDDILKVLLEFKFKLVNSISYLQFQDRLTQSLQHLNIMYSNIDVFKFRDISEIQKLKIL
FT                   SVFTDTSKVIVKDVLEKLEKNYTIFEKFIDASLSSIQTINDLRSDNSLYIDIPKIIEQF
FT                   SNILSDLLRRIDDVEKNNSNFLNLYYEQVKLIKSLELMFSNIAAISARFQNINIASKIE
FT                   VVKRSELKAMEGNISEMSKIIKEIDSNITKGIEFLDQIIFFLEKVVKDYDNRFYLEKNY
FT                   FNKFKKLFIEIKNDILDIKNIAIDNILSYEVFSIEFMEIFEEMKLEVYNVRNLKNSLLD
FT                   IENFLSNMESKINFSLNLELSKVGIQFVEIEDKEFVNRIANRFTLFVHKKYLLSLIEEA
FT                   KDVHSFDEGSVILF"
FT   gene            585388..585762
FT                   /gene="cheY-2"
FT                   /locus_tag="BG0580"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        585388..585762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-2"
FT                   /locus_tag="BG0580"
FT                   /product="chemotaxis response regulator"
FT                   /note="ortholog to Borrelia burgdorferi BB0570"
FT                   /db_xref="EnsemblGenomes-Gn:BG0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07417"
FT                   /db_xref="GOA:Q660V4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V4"
FT                   /protein_id="AAU07417.1"
FT                   /translation="MKKRILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGVLKFKEA
FT                   VGQGDKDFDLVITDINMPNLDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGAT
FT                   GWLVKPFNPEALMKTISKIF"
FT   gene            586027..586110
FT                   /gene="trnL"
FT                   /locus_tag="BG0581"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   tRNA            586027..586110
FT                   /gene="trnL"
FT                   /locus_tag="BG0581"
FT                   /product="tRNA-Leu"
FT   gene            complement(586119..586808)
FT                   /gene="smbA"
FT                   /locus_tag="BG0582"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(586119..586808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="BG0582"
FT                   /product="uridylate kinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0571"
FT                   /db_xref="EnsemblGenomes-Gn:BG0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07418"
FT                   /db_xref="GOA:Q660V3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V3"
FT                   /protein_id="AAU07418.1"
FT                   /translation="MLEIISLGGGVINSNQINIEFIKNFKNFVFKWLLENEKRKIILIV
FT                   GGGKVAREYQDAYKKINPDFKVRELDEIGIMSTRLNAEFLCKVMNPLCKDKIVTNPLKN
FT                   FSFKGKILIASGWKSGFSTDYIAVKFAEKFNKKDVINITNVNQVYDKDPKKFKNATAFK
FT                   KLNWKQLQNIVGQKWNPGLNLPFDPIATKLSSKLGLTLYIVNGNNIENLEKVFNKNNDF
FT                   LGTVIVK"
FT   gene            587026..588090
FT                   /gene="lgtD"
FT                   /locus_tag="BG0583"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        587026..588090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtD"
FT                   /locus_tag="BG0583"
FT                   /product="glycosyl transferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0572"
FT                   /db_xref="EnsemblGenomes-Gn:BG0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07419"
FT                   /db_xref="GOA:Q660V2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V2"
FT                   /protein_id="AAU07419.1"
FT                   /translation="MHKCKVSVIICFFNSAETLDAMIKDAVNQTLKDKEIILINDGSYD
FT                   SSLEIAEKYANKYSFIKIFSQKNMGLPASRDKGLSEAQGEYVIYWDSDDSVESTMLEVL
FT                   YNRAKADNSDIVCSQFYVYFLAINVKRKSLLPFPNYPLTGKEAFKNLFFTVYATFGRKN
FT                   FVVGTLWDKLIRRELILKNNIRQQNVVFEDIVFVMQIFLKASKVSFVNNYFYTNFQRMG
FT                   SMSSSISVLHKAKLSLNTIETLLKKEGILNEYQHLYKRFFLQFYYFISFKQIYIISWNI
FT                   SDKLVYRAYKEKLISVLDEIKGLSEFQDYYEYAKNFGFNEIQILPRIMLKIWNFSSRLY
FT                   VNFSIFIYKLFIKN"
FT   gene            588153..588959
FT                   /locus_tag="BG0584"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        588153..588959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0584"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0573"
FT                   /db_xref="EnsemblGenomes-Gn:BG0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07420"
FT                   /db_xref="GOA:Q660V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V1"
FT                   /protein_id="AAU07420.1"
FT                   /translation="MAIEVSNVKFSYKGKEVYSDLNLNIETPQAYLLLGKNGVGKTTLL
FT                   KLVSGLLEPLKGKVLFNSLAAFPRNPLNLMNLFFVPEEFSLPRLSLVEYSKALSRFYPN
FT                   FNKADFEKYLLDFNLDISLDLSSASFGQKKKSIIAFSLATNVSCLLFDEPTNSLDIVSK
FT                   NVFRNLLSNLNDRVIFITGHNVRDLIGVIDYLIIVGEKSIFFSNSISYINKNYKIKIIS
FT                   ELNGNELYYEKNKDGFKALYFESSNGAEVVDIEFFFLYVTENKKER"
FT   gene            588966..589817
FT                   /locus_tag="BG0585"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        588966..589817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0585"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0574"
FT                   /db_xref="EnsemblGenomes-Gn:BG0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07421"
FT                   /db_xref="UniProtKB/TrEMBL:Q660V0"
FT                   /protein_id="AAU07421.1"
FT                   /translation="MFSLKRFLNLFYFDFFYNKKFYILLIIKILGMIFISYFLVRFYFN
FT                   FTATDFLRFFVPKIMVLTLIISMFAMCDYYKVIHDPFRNILYLSLPVSTFERYFFNLIK
FT                   YLFVLPLILIFFYYLVFNIFLFLDSAFFVRGENAVFLELRYLSDFFFFSYLNFLSIFPI
FT                   FMFFRIAFKTHPFIKVLIFFLGNIVLLFFFTSFLYLVFKYVPCFSDLIFSFDRFLGDFF
FT                   LKIVYSSAFFLYLASYFKMVELGSVRKKGNLFAILGFLVFLAMFNYYYLTKGSLYCFVK
FT                   YD"
FT   gene            590007..591608
FT                   /gene="pyrG"
FT                   /locus_tag="BG0586"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        590007..591608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="BG0586"
FT                   /product="CTP synthase"
FT                   /note="ortholog to Borrelia burgdorferi BB0575"
FT                   /db_xref="EnsemblGenomes-Gn:BG0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07422"
FT                   /db_xref="GOA:Q660U9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660U9"
FT                   /protein_id="AAU07422.1"
FT                   /translation="MKKNLKILVITGGVISGIGKGVTSASIARLFRYDFRVTPIKCDGY
FT                   LNTDPGTINPVEHGEVFVLDDGGEVDMDFGHYERFLNLNAKSSWNITMGKIYKKILENE
FT                   RKGKYLGRTVQLIPHVTDEIKSTIFQIASSENSEMLIIEIGGTVGDMENILFIETVRQI
FT                   RHEIGSGNIAFIHLTYVPSPAGINEQKSKPTQQSVKTLNKAGIFPDLIIARSSQVLTDQ
FT                   IRKKVAMFCNVESNSIIDNIDVSTIYEIPISFYKQGVHEILSSKLNIKVDPKIEELSKL
FT                   VGVIKSNFFVPKKIINIAICGKYAELDDSYASIRESLVHVGANLDLLIKSTLIDSNDLN
FT                   ESYLKEFDGIIVPGGFGGKGYEGKIIAIKYARENNIPFLGICLGLQLAVIEFARNVCGI
FT                   LDADTEENLLKDKPLKSPVIHLLPEQKGIKDKGATMRLGGYPVILKKNTIVFNLYGQDR
FT                   IIERFRHRYEVNNDYIDLFEKNGLVVSGFSSDFKIAKLIEIPKNKFFVACQFHPELITR
FT                   IENPAKLFLGLIKACI"
FT   gene            complement(591625..592149)
FT                   /locus_tag="BG0587"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(591625..592149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0587"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0576"
FT                   /db_xref="EnsemblGenomes-Gn:BG0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07423"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07423.1"
FT                   /translation="MLIKFMFSNINLILIVSMTLFKILLEIIYRKILCKKIIGNVNILN
FT                   AQKKQCKIIVIVVLAFSNLLQSFLINALINLFNNLITLTNNSLESLISLNYNVLSAMLI
FT                   SSITWLAFSLPKVINDIIYEKRPFKLTMANAFFDLLIIILLTIFSKLFLSYKVLQFENT
FT                   TNINFENLPTH"
FT   gene            592285..592875
FT                   /locus_tag="BG0588"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        592285..592875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0588"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0577"
FT                   /db_xref="EnsemblGenomes-Gn:BG0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07424"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07424.1"
FT                   /translation="MKEEDIRKTILMKRLVKYFFDELKYRMKISCLRINNKEMSTKYIL
FT                   LNLFRKIANLPFNKQYEIEEQFALEVGERVVLTDAVLIKRIDHERCVIVGIVEAKTDQV
FT                   DLDYEFNRFFLQDKKTNVLFWQPKKVILKQDDKIFTAGSDDIFNFDNDFNLPKVKSKLE
FT                   EFINIFLCFFSYRDALFEYNEASGRYSWIKRNK"
FT   gene            593107..593169
FT                   /locus_tag="BG0589"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        593107..593169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07425"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07425.1"
FT                   /translation="MLESLYEKIFVFKEKERKSF"
FT   gene            593123..594295
FT                   /gene="mcp-1"
FT                   /locus_tag="BG0590"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        593123..594295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-1"
FT                   /locus_tag="BG0590"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0578"
FT                   /db_xref="EnsemblGenomes-Gn:BG0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07426"
FT                   /db_xref="GOA:Q660U5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U5"
FT                   /protein_id="AAU07426.1"
FT                   /translation="MKKFSFLKKKKEKVFDSSLLNVVDNDKKDLSTYEYKAPVKEMLKG
FT                   FYHTKASIATLKVGFESLQRILFSGIEDFDQIFSVLVKITNDARDQISVIFSDIGKNNK
FT                   EKLNQISSVIVGIQGSLETISSFLGATNMISLNAKLEAARAKEYGKGFSVVADEIKRLS
FT                   DQAKGVMNMISVKEIEEVSKDLISHNLKDLQIDIDKFFAEILEQLNYLESIFKRFSSSQ
FT                   EEFSSLVENLESIDANMAYYSRNCDSLISSDTFVLSNDEFLKELEFILSEQFSWINNLR
FT                   LIVEGQRAVFIQTDASKHGFGLFYKGLSPKNDAIKQLWEEVYIPYLNINKFAAEILIIF
FT                   RVENRNDSGLRQAKDFLSQAESLSEEIVRKLEQIKKMVIELDNQGISIFS"
FT   gene            594425..597868
FT                   /gene="dnaE"
FT                   /locus_tag="BG0591"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        594425..597868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="BG0591"
FT                   /product="DNA polymerase III, subunit alpha"
FT                   /note="ortholog to Borrelia burgdorferi BB0579"
FT                   /db_xref="EnsemblGenomes-Gn:BG0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07427"
FT                   /db_xref="GOA:Q660U4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U4"
FT                   /protein_id="AAU07427.1"
FT                   /translation="MSFKAKFIHLHVHSDYSLLDGAAKISDIISKAKKCNMSHIALTDH
FT                   GNLFGAIKFYKEAKKAGIKPIIGIEAYMAKTSKFFKKHDDLGKMSYHLILLAKNEIGYK
FT                   NLLKLTSISYLEGFYYRPRIDKEDLEKYSEGLICTSACIGGLIPRLILGNRFEDAKNEI
FT                   LWFKKVFGNDFYLELQRHGIKDQDIVNERLVEYSRELGVPLTAANDSHYVNREDAIAQD
FT                   IIVCIGTGAKKSDENRLKMETNEFYIKSQEEMCELFNDLPEALENTVRIAEKCDDFKIT
FT                   FPGPILPDYQIPIEFNTLGEYLEYLTLEGLKFRYKTLTSKIKDRAFYELSVIIRMGFEG
FT                   YFLIVWDFIKFAHDNDIPVGAGRGSGAGSIVAYALRITDIDPLKYNLLFERFLNPERIS
FT                   MPDFDIDFCFEGRDEIIKYVTNKYGEDKVAQIITFGTLKPKAVVKDVARVLDIPFAESN
FT                   ELTKLIPDGPKVSLKEVLDDNSLKEYFTSKPVYKELMDAALVLEGMNRHASTHAAGIVI
FT                   SKTPLTDYVPLYKDYKQGSVSTQYTMDLLEECGLVKMDFLGLKTLTLIKNAENLIRSVN
FT                   PDFKIKNIPDNDVKTFKMLGEGKSASVFQFESEGMQQILKDAKPDNIEDLIALNALYRP
FT                   GPMQFIPQFIAAKKGVKSIKYPHPDLKEVLKPTYGVIVYQEQVMEVAKIIGGFSLGKAD
FT                   ILRRAMGKKKEDEMDEMKVDFLRGAIEKGYDKEVASEIFELLKPFSGYGFNKSHAAAYS
FT                   LIAYQTAYLKANYPQYFMAANLTNEINNNDKLSYYIEESKAIGINVLKPDINRSFKEFR
FT                   VTDSGISYGLNAIKNLGEIVVDLIIDEREKNGKYSSFENFIRRVDDKVINKKFLESAIK
FT                   SGLFDSLDQNRKTLFENLDRLIEVVSEDKNNKKLGQNSLFDVLKGQNPIHQNFNYQAFK
FT                   EYSYSELLEFEKELLGFYVSGHPLDPYKKAINSFSSLNVLKDLATKKDSIVQFSGILNS
FT                   VKVIQTKRNNAKMAFGVIEDFKGAIDIVVFTESYERYRDFLFESNVIGVIGRLTFNRDK
FT                   FSIVVEKVVNIERLSEDKVKNIHIKFLNNKLNDLQLLNSLKESISNFEDNSGFSNVYFY
FT                   LRENGKDLKLKMNSILNFVPDEDKLDKLRRCMIVEDVWVD"
FT   gene            597877..598458
FT                   /locus_tag="BG0592"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        597877..598458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0592"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0580"
FT                   /db_xref="EnsemblGenomes-Gn:BG0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07428"
FT                   /db_xref="GOA:Q660U3"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U3"
FT                   /protein_id="AAU07428.1"
FT                   /translation="MLVVLIETLMVFLQIYRILILVRIILSWLVSSGINTNVFFRFIYI
FT                   VTEPFLSFFRRIPFFTFGMFDFSPIAALITLTILERMLAYGNYKLSTFIILFIVEIWGI
FT                   FRSIFIAIVFFLLLRLLLLLLNLFQGSDFFKTVDSFLIPLSTRISGVITDKHMSYTSRL
FT                   IIGSALMVAFIIIIEQVVFAIRVLGEYLPF"
FT   gene            598468..600528
FT                   /gene="recG"
FT                   /locus_tag="BG0593"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        598468..600528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BG0593"
FT                   /product="DNA recombinase"
FT                   /note="ortholog to Borrelia burgdorferi BB0581"
FT                   /db_xref="EnsemblGenomes-Gn:BG0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07429"
FT                   /db_xref="GOA:Q660U2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U2"
FT                   /protein_id="AAU07429.1"
FT                   /translation="MFLHEFEYELKGISGLGEKGVERLKNLQIFNVKDLIEFFPVKYED
FT                   RQNIQTFPDFSKVKSFDMMTVFTVIGHKKFGDSSKKNLKLTARSINDESFEILLFNRAF
FT                   LENVFRIDKKFYIYSKFTYNDYSGLWSCSNFDSEVFSDSPERFKKILPVYSLTEGLTSK
FT                   KISLYVREALEYFFKFGQTDIPKFLIEKYSLLSLSEALKEIHFPSSLEMLERAKKTLIY
FT                   REIFLLQFFSRYRSSKVLFREKKHLSRDLLERVVLSLPFELTEDQKISVDEIFSDLSSS
FT                   KPMNRLLQGDVGSGKTLVALLSGLPLIEAGYQVAFMAPTDLLARQHYDNLSNILSSFNI
FT                   SVTLLTGSLKKKDKEQALESIKSGVSGLIVGTHSIFYESTEFKRLAYVIIDEQHKFGVV
FT                   QREELKNKGEGVDILLMSATPIPRSFALTLFGDLEVSLIKTLPKGRLPITTYLAKHGNE
FT                   DKVYDFLRKELLKGHQVYFVYPLISSSEKFELKDVNNMYLKLKEVFSEYVVDMLHSKLP
FT                   SDLKEEIMKNFYSKKVDILVATSVIEVGIDCPNATCMVVEHAERFGLSTLHQIRGRIGR
FT                   SNLQSFFFLLYKEPLTSAGKFRLKTIKENLDGFKIAEEDLRLRGPGNLFGLEQAGYLKL
FT                   KISNFVDDRDVIVLIRKELDLFFDDNSSYDKLDIDLLDNLFCSYLNVGRSI"
FT   gene            complement(600525..601211)
FT                   /locus_tag="BG0594"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(600525..601211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0594"
FT                   /product="carboxypeptidase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0582"
FT                   /db_xref="EnsemblGenomes-Gn:BG0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07430"
FT                   /db_xref="GOA:Q660U1"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U1"
FT                   /protein_id="AAU07430.1"
FT                   /translation="MNEQCKNFIEKNPIQFLKDIKPLVDAEKNNLLTLINKKIPIPEDY
FT                   KIPDLVNIDDFKDLKNLGAKNLKVRRILIEDLIQLIKDAKKNGIEIKIKSAYRTKEYQK
FT                   FLFDYNVKTYGRKVAETQSAIPGHSQHHTGTTIDFINLDDNLLNTKEGKWLYENSLKYG
FT                   FSISYPKGYEIETGYKAEPWHYLYIGPKPCFIQKKYFNNLQHKLLEFWNHNKTNLINLI
FT                   EKYPAN"
FT   gene            601450..602787
FT                   /locus_tag="BG0595"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        601450..602787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0595"
FT                   /product="MATE efflux family protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0583"
FT                   /db_xref="EnsemblGenomes-Gn:BG0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07431"
FT                   /db_xref="GOA:Q660U0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q660U0"
FT                   /protein_id="AAU07431.1"
FT                   /translation="MIKKFKNYDQIIKELFIIAIPTAFESLLFQMVTFFDNFMISYLGS
FT                   FHITGVSLANRVTFLFFIIVFGLGTALSAYVSQAIAKKKFLQIRQSFAYILSIGTTIGI
FT                   IFFIFSFFFPKNILRLFTANQNSLNFGSEYLKIISWSYVLMAYSFLSAMGFKSAKEVKI
FT                   PLYVTSIVVLINIVFNYIFIFGFSMGIKGVAYATVLARIIEFVFYFLYSLIGDNSYYRI
FT                   KFSDFFASKIVTRANLKLIIPVLSHEIFWVLSITILHAFYARVGSIEYASFAVASNLFD
FT                   ICFVLLHGMGLATGVVIGHLMIHDKKHVRSVGFFLSFLGFLLGIFVAILLIGISGFAPY
FT                   IFSKLNSPKLVSVFIYVFASIVVFKAFTLQVLVGVFRASGIPNVCFFIESGVIVFYTLP
FT                   VAYLLVFYTNLSLPIVVFIVNAEEIIKNIFITIEFFHDDWIREIDY"
FT   gene            602800..602997
FT                   /locus_tag="BG0596"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        602800..602997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07432"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07432.1"
FT                   /translation="MIEQYDIFGVNKNFNDLGWSIIHSDYTDLKAIPFVLLQCFSICLC
FT                   KSLDFLFGEVHVFIKCVKKK"
FT   gene            602966..604321
FT                   /locus_tag="BG0597"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        602966..604321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0597"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0584"
FT                   /db_xref="EnsemblGenomes-Gn:BG0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07433"
FT                   /db_xref="GOA:Q660T8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T8"
FT                   /protein_id="AAU07433.1"
FT                   /translation="MYSLSVLKKNKIYKDLLKIAIPTAIEFFLFNFISLTDNAMVAYLG
FT                   DYPVAGVSLANKFFELFVTIGFAMVGAYNIIATRQYNRGDFKSFRNTFFISILIIILFS
FT                   FPFILISKLNPFFLLRLISNDLQAVYYGAIYLNIAIFSFVFAIIKGLVANALKVVEIVK
FT                   FQVYISVFSVLLNLILNYIFIFGFRMGVVGAAIATTAIRALELIVYLIYTVFNKNSVLN
FT                   LKLDDLNINIKSFVQLIKFFIPILLNDFIWFFGYLVLTSIFIGIDTHKYAAYSISFSIY
FT                   FIIFNIINSFCISLNIMMGYEMHNNSKKEVMKVAVYLGNIGFKLAFLTSFALFVFSFFA
FT                   PYIFYTLKYSQLTGIILRYSSISAFFMALAFQYLFGFFRAGASPSFGAIMEASVTFIYT
FT                   IPIAFVLANYTNLSFEIIVFIPALEDAIKLAISLPYFYSERWIKPVKTSWWV"
FT   gene            604334..605689
FT                   /gene="murD"
FT                   /locus_tag="BG0598"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        604334..605689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BG0598"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0585"
FT                   /db_xref="EnsemblGenomes-Gn:BG0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07434"
FT                   /db_xref="GOA:Q660T7"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T7"
FT                   /protein_id="AAU07434.1"
FT                   /translation="MRLDEIKNLNFLVMGLGLNGGGVALSRFLLKHGAKLVITDLKSEA
FT                   ELALSIDSLKDFDDQIRYVLGKHDINDFKKADIVVKNPSVKPNNKYLKLAKRVETDISL
FT                   FLIFNKNPIIAVTGTKGKSTLVSLLYQVLKKNYPRAKLGGNIGVSPLSFFDQLDGISPL
FT                   ILELSSWQLQSLENFNPILSIITNVYNDHQNYYLNFDDYIIDKSKIFVNQASGITIIQD
FT                   KAYYKYFSKFESKAKVILFSEFNPFVLDQDVFYYNKGEVYFNDNLIGSFSESQVVFMIP
FT                   KLITFFVSYYLNMDLNHTFKILNKFRGIEHRVEFVKLVQNVMFYNDTASTIPDSTVLSV
FT                   KSLKTNDNSINLIAGGTDKELDFSSFRKIINLVKTWILIKGSATVKIIKILEKSSIQYF
FT                   VFDSLRDAVNYAIKISSPGDIVLFSPASASFELFNNEFDRGLQFKNLVNMLG"
FT   gene            complement(605686..606729)
FT                   /gene="femA"
FT                   /locus_tag="BG0599"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(605686..606729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femA"
FT                   /locus_tag="BG0599"
FT                   /product="femA protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0586"
FT                   /db_xref="EnsemblGenomes-Gn:BG0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07435"
FT                   /db_xref="GOA:Q660T6"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T6"
FT                   /protein_id="AAU07435.1"
FT                   /translation="MTIKKIKTKEMEENYLQSELWALIKTTKNSNWKTIAFKSDVLGKI
FT                   VIMQRRLFKNFYLAYIPHPEFSNKTLENIDIDKISKTIKEFSIKIKPYLHKNTIFLRFD
FT                   LMYYYQRTLNDKYYPLKINIKYLKKSFDDIQPSNTTILNLNNSIENILLNMKKKTRYNI
FT                   KLSTKKNLNIIIDDKFKHLNEFYKLYKETSKRDKFTIHSEEYIKNLIEIFEQDKNAQIK
FT                   LIFAFYNNIIISGIIVGIYKEKAVYLYGASSKEYRNLMPNYAVQFKAIQILKKLGIKEY
FT                   DFLGIPPIVNKKHPLSGLFAFKTGFGGDIIHRIGCYDFIYKNFIYQIYANLEKLRYFYY
FT                   KVIRKKI"
FT   gene            complement(606739..608913)
FT                   /gene="metG"
FT                   /locus_tag="BG0600"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(606739..608913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BG0600"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0587"
FT                   /db_xref="EnsemblGenomes-Gn:BG0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07436"
FT                   /db_xref="GOA:Q660T5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660T5"
FT                   /protein_id="AAU07436.1"
FT                   /translation="MKKMNLVTAALPYVNNIPHLGNLVQVLSADAFARYSKMSGIETLY
FT                   ICGTDEYGTATETKALIEKTSPLELCNKYYKIHKSIYKWFNIEFDIFGRTTNKHHQDIV
FT                   QNFFLKLEKNGYIKERETEQFFCNKDSIFLADRYVIGECPECQSIAKGDQCENCSKLLN
FT                   PIDLINPKCIICKNKPVLKKTNHLYIDLPKIKRKLEKWIKNSTTSKNWNTNALKMTNAF
FT                   LRDGLKERAITRDLKWGIPVPKKGYENKVFYVWFDAPIGYISITKNLVKNWESWWKNNE
FT                   QVNLVQFIGKDNILFHTVIFPSIEIGSKENWTILNQLSSSEYLNYENLKFSKSEGTGIF
FT                   GNDVITTGIPSDVWRFYIYYNRPEKSDFQFMWQDLMERVNTELIDNFSNLVNRVLTFQK
FT                   KFFGDVIETIEIQNKFWKQIIPKYNKILNLFKKTELKSALKEILKISSLGNKIFQDNEP
FT                   WKRKDSSPQETKELISNLIYLIRDLSILMMPFIPETSKKIQQFFGNSYQFSTKILGTKS
FT                   GIKRIEFTEILFNKLEQKKINNLKLKYSGEKNMEEKEQPENLFREKVLLKVVKINKIER
FT                   NPEAKNLFILKLDDGTNENKQIVSSLEGYYTEKELLGKHIIIVDNLKPAKFRGIKSEGM
FT                   LIAAEDKNKNFKIIIVEDSIKNPIPGERIILENDQNKDLICPPKIDINKFSKANIVAKD
FT                   GELKINGINLILEHSKNKILSKDIPNGIVC"
FT   gene            609072..609866
FT                   /gene="pfs-2"
FT                   /locus_tag="BG0601"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        609072..609866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs-2"
FT                   /locus_tag="BG0601"
FT                   /product="5-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase, putative"
FT                   /note="ortholog to Borrelia burgdorferi BB0588"
FT                   /db_xref="EnsemblGenomes-Gn:BG0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07437"
FT                   /db_xref="GOA:Q660T4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T4"
FT                   /protein_id="AAU07437.1"
FT                   /translation="MNNFLRKFFLFLLVFSNGYVAFSKNINVLIVTAMDSELEEINKLM
FT                   SNKEEIVLKEYGLNKKIVKGKLSNRNVMAIVCGVGKVNAGVWTSYILSKYNISHVINYG
FT                   VAGGVISDKYKDIKVGDIVVSSEIAYHDVDLTKFGYKMGQLMGLPQKFIANKNLVNKAK
FT                   EAVKLKVRGSNAYSGLILTGDQFIDPIYIKKIIRDFKDVIAVEMEGAAIGHVAHMLNVP
FT                   FVVIRSISDIVNKEENEVEYSKFLKLASFNSAKVVQEILRIL"
FT   gene            609978..611015
FT                   /gene="pta"
FT                   /locus_tag="BG0602"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        609978..611015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="BG0602"
FT                   /product="phosphate acetyltransferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0589"
FT                   /db_xref="EnsemblGenomes-Gn:BG0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07438"
FT                   /db_xref="GOA:Q660T3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T3"
FT                   /protein_id="AAU07438.1"
FT                   /translation="MFCLKDYVFNKARIFVKENKFKASVVFPESSDSRVLKAAVIVLQK
FT                   NLANSVILVGKKDPVINSLKKFSNCNNILERIEVIDPNSFPDIEMYLDEYWSLLKLKGA
FT                   TKQSLKTQVLDEITFAMLMVRFGHVKSCVCGAISTSAKVLSNVLRIIPKLDGVKTVSSF
FT                   MIMDTLNIARNLDFCFGHNGILFFADCSLVVNPNSLELAEIALQSAKSFKDILNAKPKV
FT                   ALLSFSTKGSSNARETEKVKNALNIVKNKESDLLIDGELQLDSAIIKDVAEKKCSESLL
FT                   AGSANVLIFPNLDAGNIGYKLVERFAFAKAYGPFLQGLSKPISDLSRGCSVDEIVFASA
FT                   LMIGI"
FT   gene            complement(610998..611843)
FT                   /gene="ksgA"
FT                   /locus_tag="BG0603"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(610998..611843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BG0603"
FT                   /product="dimethyladenosine transferase"
FT                   /note="ortholog to Borrelia burgdorferi BB0590"
FT                   /db_xref="EnsemblGenomes-Gn:BG0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07439"
FT                   /db_xref="GOA:Q660T2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660T2"
FT                   /protein_id="AAU07439.1"
FT                   /translation="MILSLLSMNINYNSITSIKQILKERKIAPRKLWGQNYLINESIRQ
FT                   KIIESLDIKENEKIWEIGPGLGAMTDILLKKTNLLTAFEIDLKYSEILNEKFGKLKNFK
FT                   LIKGDFLKKYPNENKNIDKIFSNLPYNIASKVISKLIEENFLKEMVLTVQKELADRITA
FT                   KTNSKNYSSFTVLVQSHFTAIKIIDIGENNFYPAPKVKSTTLKLIPKKNNIKDFKEFNK
FT                   LIRTVFSGRRKKLKNTIINFIKNKAILEENFLKEYLGKRPENISVEEFIQISNNLNAYH
FT                   "
FT   gene            complement(612518..613132)
FT                   /locus_tag="BG0604"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(612518..613132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0604"
FT                   /product="competence locus E, putative"
FT                   /note="similar to Borrelia burgdorferi BB0591"
FT                   /db_xref="EnsemblGenomes-Gn:BG0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07440"
FT                   /db_xref="GOA:Q660T1"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T1"
FT                   /protein_id="AAU07440.1"
FT                   /translation="MILIFILILINLSIQYYLKLNLIYFDIILTLFFIIKNNKHLALSF
FT                   IFCTILLLSFQARLNFKTLEKNIYQITNIKNFKKDSKTIIEVIDNKINTHRFNFKNIEN
FT                   IYKIGDTIKIENQKIKLIKRPFFAKLRKKYTNNLNNFFTTLNPSYSHFAKTIIFNIKSE
FT                   ITKYEKTLFQNAGVAHILVVSGLHFYLISLISLLFTFNNHK"
FT   gene            613249..613962
FT                   /locus_tag="BG0605"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        613249..613962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0605"
FT                   /product="hypothetical protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0592"
FT                   /db_xref="EnsemblGenomes-Gn:BG0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07441"
FT                   /db_xref="GOA:Q660T0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q660T0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07441.1"
FT                   /translation="MQLLKNKYPFKLALLDIFLVYVVIYLASPFENVNSEFWNVNENHY
FT                   YFWISRSFLIVFIIYFFKLTSSYDDFRVEFFIPKFKFIFIWESVVIFIKTILSAMIFIF
FT                   LIAFLLEYLLPESALAYYFQNNVGFNWKISSKKSLFLMTFTSFFTGSFEELFYRAFVIT
FT                   KFAQMGFPAVVAIFFSSIFFAYGHLYYGMLGFLVTFILGIFFAFIYLRYKNVYYVIFIH
FT                   SFYNIIVSILLLVLS"
FT   gene            613988..615925
FT                   /locus_tag="BG0606"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        613988..615925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0606"
FT                   /product="long-chain-fatty-acid CoA ligase"
FT                   /note="ortholog to Borrelia burgdorferi BB0593"
FT                   /db_xref="EnsemblGenomes-Gn:BG0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07442"
FT                   /db_xref="GOA:Q660S9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q660S9"
FT                   /protein_id="AAU07442.1"
FT                   /translation="MRDTVPKRFKEAITLYSELDIFMYKEGDSKSFKKQIYADFWNEVK
FT                   RVASGLLHYGIKRGEKVVIISDSRREWVIIDIAALGLGCVDVPRGNDSSEDELTYIINH
FT                   SESTFIFVENNKQLQKVLSKKHDLRLVKYIVVIDDDKSYEEKMGTITVFSYKKLLELGA
FT                   EHLRANPKSFDIEIEKGSSKDIATIIYTSGTTGMPKGVMLRHESFIFQLDRLYDYLPAI
FT                   KPGKIMISILPLWHSFERACEYIVALKGVAIAYSKPIGPVLLKDFLLLNPQMIISVPRI
FT                   WEGIRIGIIKKVSESLIKKLVFGGFLKIGIIYAKLNEKFLGFSPVYRKPNLFISIFSKL
FT                   FLFIGIILIFPIKLLGDILVFKKIKNALGQNFEFGVSGGGALVDYVDYFFKAIGIKVLE
FT                   GYGLTETGPVLSVRRLKGPVARTVGPILPDVEYKVVGIDGKVLPYGEKGELWVKSPQIM
FT                   SGYFKDKAKTSEVLTEDGWFNTGDLVRLTINNEISIVGRSKDTIVLRGGENIEPEPLER
FT                   VLGKSLFIENIMIVGQDQKFLGAVIVPNFDNLEKWANSSGISFSSRSDLLVNEGVNKLY
FT                   SKHISDTINTKSGFKNFEKIVGFVLLQDSFSIGEELTNTLKLKRYYISQKYEDKIRLIF
FT                   SKSDLDLNGY"
FT   gene            complement(615954..617711)
FT                   /gene="argS"
FT                   /locus_tag="BG0607"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(615954..617711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BG0607"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0594"
FT                   /db_xref="EnsemblGenomes-Gn:BG0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07443"
FT                   /db_xref="GOA:Q660S8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660S8"
FT                   /protein_id="AAU07443.1"
FT                   /translation="MTKSVKKNIKNEISIIVANLALSKNIKLDKININIQKPPKSDLGD
FT                   ISILIFELSKTLELPIATISEEIIKTLKSKYEIKAMGPYLNIKIPRKEYINNTIQMVNA
FT                   QKDSYGTSKYLDNKKIILEFSSPNTNKPLHVGHLRNDAIGESLSRILKAVGAKITKINL
FT                   INDRGVHICKSMLAYKKFGNCITPEKAFKKGDHLIGEFYVEYNKYSQENENAEKEIQDL
FT                   LLKWEQKDKNTIELWEKLNKWAIEGIKETYKTTNISFDKIYLESEIFEIGKNVVLEGLE
FT                   KGFCYKREDGAICIDLPSDSDEKAEAKAKQKVLIRSNGTSIYLTQDLGNIAIRTKEFNF
FT                   DEMIYVVGSEQIQHFKNLFFVSEKLGISKNKQLIHLSHGMVNLIDGKMKSREGNVIDGD
FT                   NLILELIESIMPEITQKIDNKENAKKNALNIALGAIHYYLLKSAVHKDIVFNKKESLSF
FT                   TGNSGPYIQYVGARINSILEKYNALSIPIIKKINFELLKHEKEWEIIKIISELEENIIK
FT                   AAKDLNPSILTNYSYSLAKHFSAYYQEVKVIDINNTDLTAARIEFLKTILQTIKNCMHL
FT                   LNIPYMLKM"
FT   gene            617777..618073
FT                   /locus_tag="BG0608"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        617777..618073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BG0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BG0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07444"
FT                   /db_xref="GOA:Q660S7"
FT                   /db_xref="UniProtKB/TrEMBL:Q660S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU07444.1"
FT                   /translation="MFELWADIFVFINSFIIGISLLKSFKLPVFNISLIIEIVELRAMK
FT                   IKIGILEYLIIIDGFFMILKGSFLWNDIIMAIKMGIENLNSLYKVGVKYSMNK"
FT   gene            complement(618325..620472)
FT                   /gene="mcp-2"
FT                   /locus_tag="BG0609"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(618325..620472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-2"
FT                   /locus_tag="BG0609"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0596"
FT                   /db_xref="EnsemblGenomes-Gn:BG0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07445"
FT                   /db_xref="GOA:Q660S6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q660S6"
FT                   /protein_id="AAU07445.1"
FT                   /translation="MKEKKLNSNLFYKFNFIILAYTIIIIATTFLLLDQGYKKIITKEL
FT                   QDFTKFINQAMIKSFSDESKEIIKALSLLTARHDYKSAILNNRSDDHLVSDKILVTLPS
FT                   FIKIIEYANKDGYIIASSEKRRNGQYMSLKELLLGKAITAFQISILYNSLAKINNNFYI
FT                   PIAYKITDSKKSNIGYIILYADISEKIAELKEYLLLLLENSLLEQNASSQNSSKYFNVY
FT                   IINSSGDAFGGKDEVLKNIKHIFGFNVKTLTQILSALSQGKANYNTSNSNEIISLARIT
FT                   TSNWYLGIKIDYNNIFSKEFKNMRLVSLSIIFILVIIFILIMISTIKTLIISKIDKLNV
FT                   VIPKVKNGDLTFKIESKGKDSISSTINLFGHFIENLKNVINSLQERVRLLKENGDHLFS
FT                   EINKTHSTIKNSNQYIEKTQEEVEKQVEFISNTTGVIESLSKNISSLDNSIETQAASVE
FT                   QSSSAIEEMIGGIQSITEITQKAAKSTEELKRFSDDGRKKQEEVITQIKEIFKNSTRLQ
FT                   EANSLISSIASQTNLLSMNAAIEASHAGEAGKGFAIVAEEIKDLAEQVTSQSESVASSI
FT                   NEIMDSITKTVNTSELTNKAFNQIFDSINLVVQVIEEINHTMQEQSIGSQEILKALNTM
FT                   REITYEVKIGSNDMFRGNKEIISTFKLLGEINITVSNSMKGLKEEINKLVEAIERIKVL
FT                   GTTNSSHISGISESTNQFKTK"
FT   gene            620741..622948
FT                   /gene="mcp-3"
FT                   /locus_tag="BG0610"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        620741..622948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-3"
FT                   /locus_tag="BG0610"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ortholog to Borrelia burgdorferi BB0597"
FT                   /db_xref="EnsemblGenomes-Gn:BG0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07446"
FT                   /db_xref="GOA:Q660S5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q660S5"
FT                   /protein_id="AAU07446.1"
FT                   /translation="MTDENLIDVNLKNTKRFLYLILFGFLFLNFLFIGYSYINHKNEYL
FT                   DRFKFDAKLFLNSASSVIRAKYLESSRFLEEFIKDSYRFGILVNSSKSFLLSSSLKLGD
FT                   NLDENSDLFLKSREFSSIDKIFKTIPVAENSLEGIFYIPIGKNVLISNLNFSSLSLKDV
FT                   RLDPIYSVPVEKNFKYYSRFMRIDGKIYSIVSFPVRDSVATLGVIGILVCFDESFDIIE
FT                   NQLYSSLKFSSKDYNFFMLDRNYMPIFLNFNNLKAKSFSTSYSENVLNKVIAYIKKDSS
FT                   ASQHTFNYESDFYSLSFVKTDDFLIQGLIFNVNSIPIMFKSNWVVFFIFLLSSFAIIFY
FT                   LCNTFIFSLINDFNRIVNYQKSKSDPFNLEPPLEVKYSSAIISYISSKLDSISSKSNKS
FT                   FEKIKFYSEDLNAYLEQIETAMLNTESIDSSVLAYEQLRDTFSRFEKSIVDILRGFESV
FT                   ADPINDHNKHMSEISSNFEENVSFFYTIDKNLEIFNKVATTNSTDIENIKSKVLDLNIV
FT                   FENVNKNFADLLSQTNSLQSANKLLVSISAQTNMLAMNAAIEAAKAGDAGKSFAVVAEE
FT                   IRKLAINSGKYSKTIKDELKTVDSIIAVINSEIDTIYKNFIDIQDNVDSNFSRHEKVDL
FT                   TLAKHFKEIGEFKERYLSHDTKIRDAKNMYKEIFNNHFFVSSKFNNFSQDLKEFKVSKM
FT                   NLDAISSLQEYSSLMKSSKDKILKIKELTQKINDEIKDIIF"
FT   gene            complement(622945..623865)
FT                   /gene="murB"
FT                   /locus_tag="BG0611"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(622945..623865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BG0611"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /note="ortholog to Borrelia burgdorferi BB0598"
FT                   /db_xref="EnsemblGenomes-Gn:BG0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07447"
FT                   /db_xref="GOA:Q660S4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660S4"
FT                   /protein_id="AAU07447.1"
FT                   /translation="MIKRLNNFFEKINIKPQTKNLINYTTYKIGNISKLFLIPKNIQEA
FT                   ENIFKAAIEEKITLFILGGGSNILVNDKEELDFPIIYTGHLNKIEVHDNKIVAECGANF
FT                   ENLCKIALNSSLSGLEFIYGLPGTLGGAVWMNARCFGNEISEILKKITFINDKGKTICK
FT                   EFKKEDFKYKVSPFQNKNFFILKTELNLKKENKKIIEEKMNKNKQARINKGHYLFPSSG
FT                   STFKNNKSFLRPSGQIIEECKLKGLSVGGAEVSKYHGNFIININNATSNDIKSLIEKVK
FT                   TEVYSKTGLLLEEEVLYIGFKNQKS"
FT   gene            623917..625359
FT                   /gene="cysS"
FT                   /locus_tag="BG0612"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        623917..625359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BG0612"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="ortholog to Borrelia burgdorferi BB0599"
FT                   /db_xref="EnsemblGenomes-Gn:BG0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU07448"
FT                   /db_xref="GOA:Q660S3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q660S3"
FT                   /protein_id="AAU07448.1"
FT                   /translation="MILKLYNTRTKDFSELANFSDVKVYACGPTVYNYAHIGNFRTYIF
FT                   GDLLIKTLRFLGYKVNYAMNITDIGHLTGDLDDGEDKVAKTAREKGLTVYEISKFFTEA
FT                   FFKDCKKLNVVYPDKVLIASKHIPNMIEVIKILEEKKFTYFSNGNVYFDTSCFKSYGEM
FT                   AGIDLIDKDMAFSRVDIDKFKRNKTDFVLWFTNSKFKDQEMKWDSPWGFGYPSWHLECA
FT                   AMNLEYFKDTLDIHLGGVDHIGVHHINEIAIVECFLNKKWCDIFVHGEFLIMDYNKMSK
FT