(data stored in SCRATCH3701 zone)

EMBL: CP000027

ID   CP000027; SV 1; circular; genomic DNA; STD; PRO; 1469720 BP.
XX
AC   CP000027;
XX
PR   Project:PRJNA214;
XX
DT   25-AUG-2005 (Rel. 85, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 8)
XX
DE   Dehalococcoides mccartyi 195 chromosome, complete genome.
XX
KW   .
XX
OS   Dehalococcoides mccartyi 195
OC   Bacteria; Chloroflexi; Dehalococcoidia; Dehalococcoidales;
OC   Dehalococcoidaceae; Dehalococcoides.
XX
RN   [1]
RP   1-1469720
RX   DOI; 10.1126/science.1102226.
RX   PUBMED; 15637277.
RA   Seshadri R., Adrian L., Fouts D.E., Eisen J.A., Phillippy A.M., Methe B.A.,
RA   Ward N.L., Nelson W.C., Deboy R.T., Khouri H.M., Kolonay J.F., Dodson R.J.,
RA   Daugherty S.C., Brinkac L.M., Sullivan S.A., Madupu R., Nelson K.E.,
RA   Kang K.H., Impraim M., Tran K., Robinson J.M., Forberger H.A., Fraser C.M.,
RA   Zinder S.H., Heidelberg J.F.;
RT   "Genome sequence of the PCE-dechlorinating bacterium Dehalococcoides
RT   ethenogenes";
RL   Science, e1252229 307(5706):105-108(2005).
XX
RN   [2]
RP   1-1469720
RA   Seshadri R., Adrian L., Fouts D.E., Eisen J.A., Phillippy A.M., Methe B.A.,
RA   Ward N.L., Nelson W.C., DeBoy R.T., Khouri H.M., Kolonay J., Dodson R.J.,
RA   Daugherty S.C., Brinkac L., Sullivan S.A., Madupu R., Nelson K.E.,
RA   Kang K.H., Impraim M., Tran K., Robinson J.M., Forberger H.A., Fraser C.M.,
RA   Zinder S.H., Heidelberg J.F.;
RT   ;
RL   Submitted (19-OCT-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 9af8bcf87b7dee31b28a58dd52d4eca2.
DR   BioSample; SAMN02603990.
DR   EnsemblGenomes-Gn; DET_De16S.
DR   EnsemblGenomes-Gn; DET_De23S.
DR   EnsemblGenomes-Gn; DET_De5S.
DR   EnsemblGenomes-Gn; DET_tRNA-Ala-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Ala-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Ala-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Arg-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Arg-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Arg-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Arg-4.
DR   EnsemblGenomes-Gn; DET_tRNA-Arg-5.
DR   EnsemblGenomes-Gn; DET_tRNA-Asn-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Asp-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Cys-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Gln-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Gln-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Glu-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Glu-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Gly-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Gly-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Gly-3.
DR   EnsemblGenomes-Gn; DET_tRNA-His-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Ile-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Leu-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Leu-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Leu-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Leu-4.
DR   EnsemblGenomes-Gn; DET_tRNA-Leu-5.
DR   EnsemblGenomes-Gn; DET_tRNA-Lys-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Lys-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Met-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Met-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Met-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Phe-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Pro-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Pro-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Pro-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Ser-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Ser-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Ser-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Ser-4.
DR   EnsemblGenomes-Gn; DET_tRNA-Thr-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Thr-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Thr-3.
DR   EnsemblGenomes-Gn; DET_tRNA-Trp-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Tyr-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Val-1.
DR   EnsemblGenomes-Gn; DET_tRNA-Val-2.
DR   EnsemblGenomes-Gn; DET_tRNA-Val-3.
DR   EnsemblGenomes-Gn; EBG00001050581.
DR   EnsemblGenomes-Gn; EBG00001050582.
DR   EnsemblGenomes-Gn; EBG00001050583.
DR   EnsemblGenomes-Gn; EBG00001050584.
DR   EnsemblGenomes-Gn; EBG00001050585.
DR   EnsemblGenomes-Gn; EBG00001050586.
DR   EnsemblGenomes-Gn; EBG00001050587.
DR   EnsemblGenomes-Gn; EBG00001050588.
DR   EnsemblGenomes-Gn; EBG00001050589.
DR   EnsemblGenomes-Gn; EBG00001050590.
DR   EnsemblGenomes-Gn; EBG00001050591.
DR   EnsemblGenomes-Gn; EBG00001050592.
DR   EnsemblGenomes-Gn; EBG00001050593.
DR   EnsemblGenomes-Gn; EBG00001050594.
DR   EnsemblGenomes-Gn; EBG00001050595.
DR   EnsemblGenomes-Gn; EBG00001050596.
DR   EnsemblGenomes-Gn; EBG00001050597.
DR   EnsemblGenomes-Gn; EBG00001050598.
DR   EnsemblGenomes-Gn; EBG00001050599.
DR   EnsemblGenomes-Gn; EBG00001050600.
DR   EnsemblGenomes-Gn; EBG00001050601.
DR   EnsemblGenomes-Gn; EBG00001050602.
DR   EnsemblGenomes-Gn; EBG00001050603.
DR   EnsemblGenomes-Gn; EBG00001050604.
DR   EnsemblGenomes-Gn; EBG00001050605.
DR   EnsemblGenomes-Gn; EBG00001050606.
DR   EnsemblGenomes-Gn; EBG00001050607.
DR   EnsemblGenomes-Gn; EBG00001050608.
DR   EnsemblGenomes-Gn; EBG00001050609.
DR   EnsemblGenomes-Gn; EBG00001050610.
DR   EnsemblGenomes-Gn; EBG00001050611.
DR   EnsemblGenomes-Gn; EBG00001050612.
DR   EnsemblGenomes-Gn; EBG00001050613.
DR   EnsemblGenomes-Gn; EBG00001050614.
DR   EnsemblGenomes-Gn; EBG00001050615.
DR   EnsemblGenomes-Gn; EBG00001050616.
DR   EnsemblGenomes-Gn; EBG00001050617.
DR   EnsemblGenomes-Gn; EBG00001050618.
DR   EnsemblGenomes-Gn; EBG00001050619.
DR   EnsemblGenomes-Gn; EBG00001050620.
DR   EnsemblGenomes-Gn; EBG00001050621.
DR   EnsemblGenomes-Gn; EBG00001050622.
DR   EnsemblGenomes-Gn; EBG00001050623.
DR   EnsemblGenomes-Gn; EBG00001050624.
DR   EnsemblGenomes-Gn; EBG00001050625.
DR   EnsemblGenomes-Gn; EBG00001050626.
DR   EnsemblGenomes-Gn; EBG00001050627.
DR   EnsemblGenomes-Gn; EBG00001050628.
DR   EnsemblGenomes-Gn; EBG00001050629.
DR   EnsemblGenomes-Gn; EBG00001050630.
DR   EnsemblGenomes-Tr; DET_De16S-1.
DR   EnsemblGenomes-Tr; DET_De23S-1.
DR   EnsemblGenomes-Tr; DET_De5S-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ala-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ala-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ala-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Arg-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Arg-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Arg-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Arg-4-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Arg-5-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Asn-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Asp-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Cys-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Gln-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Gln-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Glu-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Glu-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Gly-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Gly-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Gly-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-His-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ile-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Leu-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Leu-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Leu-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Leu-4-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Leu-5-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Lys-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Lys-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Met-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Met-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Met-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Phe-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Pro-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Pro-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Pro-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ser-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ser-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ser-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Ser-4-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Thr-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Thr-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Thr-3-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Trp-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Tyr-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Val-1-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Val-2-1.
DR   EnsemblGenomes-Tr; DET_tRNA-Val-3-1.
DR   EnsemblGenomes-Tr; EBT00001653649.
DR   EnsemblGenomes-Tr; EBT00001653651.
DR   EnsemblGenomes-Tr; EBT00001653654.
DR   EnsemblGenomes-Tr; EBT00001653656.
DR   EnsemblGenomes-Tr; EBT00001653658.
DR   EnsemblGenomes-Tr; EBT00001653660.
DR   EnsemblGenomes-Tr; EBT00001653662.
DR   EnsemblGenomes-Tr; EBT00001653665.
DR   EnsemblGenomes-Tr; EBT00001653666.
DR   EnsemblGenomes-Tr; EBT00001653669.
DR   EnsemblGenomes-Tr; EBT00001653671.
DR   EnsemblGenomes-Tr; EBT00001653673.
DR   EnsemblGenomes-Tr; EBT00001653675.
DR   EnsemblGenomes-Tr; EBT00001653678.
DR   EnsemblGenomes-Tr; EBT00001653679.
DR   EnsemblGenomes-Tr; EBT00001653681.
DR   EnsemblGenomes-Tr; EBT00001653683.
DR   EnsemblGenomes-Tr; EBT00001653685.
DR   EnsemblGenomes-Tr; EBT00001653687.
DR   EnsemblGenomes-Tr; EBT00001653690.
DR   EnsemblGenomes-Tr; EBT00001653692.
DR   EnsemblGenomes-Tr; EBT00001653694.
DR   EnsemblGenomes-Tr; EBT00001653696.
DR   EnsemblGenomes-Tr; EBT00001653698.
DR   EnsemblGenomes-Tr; EBT00001653700.
DR   EnsemblGenomes-Tr; EBT00001653702.
DR   EnsemblGenomes-Tr; EBT00001653704.
DR   EnsemblGenomes-Tr; EBT00001653706.
DR   EnsemblGenomes-Tr; EBT00001653708.
DR   EnsemblGenomes-Tr; EBT00001653711.
DR   EnsemblGenomes-Tr; EBT00001653712.
DR   EnsemblGenomes-Tr; EBT00001653714.
DR   EnsemblGenomes-Tr; EBT00001653715.
DR   EnsemblGenomes-Tr; EBT00001653717.
DR   EnsemblGenomes-Tr; EBT00001653718.
DR   EnsemblGenomes-Tr; EBT00001653719.
DR   EnsemblGenomes-Tr; EBT00001653721.
DR   EnsemblGenomes-Tr; EBT00001653722.
DR   EnsemblGenomes-Tr; EBT00001653725.
DR   EnsemblGenomes-Tr; EBT00001653727.
DR   EnsemblGenomes-Tr; EBT00001653729.
DR   EnsemblGenomes-Tr; EBT00001653731.
DR   EnsemblGenomes-Tr; EBT00001653732.
DR   EnsemblGenomes-Tr; EBT00001653733.
DR   EnsemblGenomes-Tr; EBT00001653734.
DR   EnsemblGenomes-Tr; EBT00001653735.
DR   EnsemblGenomes-Tr; EBT00001653736.
DR   EnsemblGenomes-Tr; EBT00001653737.
DR   EnsemblGenomes-Tr; EBT00001653738.
DR   EnsemblGenomes-Tr; EBT00001653739.
DR   EuropePMC; PMC1428132; 16513756.
DR   EuropePMC; PMC2394903; 18326677.
DR   EuropePMC; PMC2563115; 18832143.
DR   EuropePMC; PMC2764846; 19893622.
DR   EuropePMC; PMC4703385; 26734727.
DR   EuropePMC; PMC5440377; 28533514.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000027.
DR   SILVA-SSU; CP000027.
DR   StrainInfo; 884844; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1469720
FT                   /organism="Dehalococcoides mccartyi 195"
FT                   /strain="195"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:243164"
FT                   /type_material="type strain of Dehalococcoides mccartyi"
FT   gene            261..1598
FT                   /gene="dnaA"
FT                   /locus_tag="DET0001"
FT   CDS_pept        261..1598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="DET0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P05648; match to
FT                   protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:DET0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39192"
FT                   /db_xref="GOA:Q3ZAJ3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAJ3"
FT                   /protein_id="AAW39192.1"
FT                   /translation="MSVRPAQELWETALGEIELQVNKPNFRTWFAKTVGLKYDGSEFII
FT                   GVPNTFVAEYLEVNQRSLIEKTLINITHSPVELGFQLVQSAQVQAAAPQTAREKTVSPF
FT                   NPRYTFESFIVGSCNRLAHAASLAATQNPGKSYNPLYIYAAAGLGKTHLLQAIGHLANL
FT                   NRRKALYVSGEQFTTDFISSIRNGQTEEFRARYRDVDLLLLDDVQFIGGKEQTEECLFH
FT                   TFNDLHNSNRQIVISADSPPKSLPQLAERLRSRFEWGLTIEIEPPDEKTRLELLQLKAE
FT                   QSGTELNMDTLEYLAQEVKHNIRELEGSLNRVLAYARLLRATITPDLAARALSDIGSRP
FT                   VRENSPLRPGNIISAVSQVFQIPATELLGAARDKDTALARQFAMFMLKQQNSASLVEIG
FT                   QSLGGRSASTVSHACDKIQLELENSAFLRLKMSEVQNQLSQQRLSR"
FT   gene            1924..3198
FT                   /locus_tag="DET0002"
FT   CDS_pept        1924..3198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0002"
FT                   /product="GTP-binding protein, GTP1/OBG family"
FT                   /note="identified by match to protein family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:DET0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39191"
FT                   /db_xref="GOA:Q3ZAJ2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAJ2"
FT                   /protein_id="AAW39191.1"
FT                   /translation="MFDRVEIRIKSGDGGSGKVSFRREKFVPYGGPDGGDGGDGGNVYL
FT                   EADSGLYSLLNFKHKRVHKAANGENGMGSRCTGHNGADLVIKVPVGTVATIVEENGQKR
FT                   VLADLAADGDRTLVARGGQGGLGNTHFVSSTNQAPMLAQKGQPGGEYELILELKLIADV
FT                   AIIGYPNVGKSSLLSLLTAAKPRVANYPFTTLSPVMGVVERTEGTFVMAEVPGLIEDAH
FT                   LGRGLGHDFLRHISRTRMVIHLLDGTSDNPIDDMIKVNSELYLYDASLSERPQVVAVNK
FT                   IDDELVQLRREELTETFKEAGLEVFFISALTGEGVEVLLDKVAEKLAILKAADAPETET
FT                   DQEIKVFRPAPKGKMGFHITRLEDGWQVEAPEIERIIEHSDIEDLEVRRQIMVLLKHRN
FT                   VQQALIKAGAVIGQKIITGRLEWYL"
FT   gene            3186..3800
FT                   /gene="nadD"
FT                   /locus_tag="DET0003"
FT   CDS_pept        3186..3800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="DET0003"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /note="identified by match to protein family HMM TIGR00125;
FT                   match to protein family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:DET0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39182"
FT                   /db_xref="GOA:Q3ZAJ1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAJ1"
FT                   /protein_id="AAW39182.1"
FT                   /translation="MVSLKTGILGGTFDPIHTGHLILAEEVKKRLGLDEIIFIPTGQPY
FT                   YKADKTISPAADRLNMVKLAISGKPYFRVMDIEIKRSGPTYTADTLNDLKLILPEKTEL
FT                   YFILGWDNLEALPRWHKASEIIRLCQLVAVPRIGQAKPDVDELDDKLPGLQQSLIMLSK
FT                   PEVDVSSSLVRERLENGQGVEHLVPEAVAAYIKEHGLYHRQ"
FT   gene            complement(3881..5809)
FT                   /gene="gyrB"
FT                   /locus_tag="DET0004"
FT   CDS_pept        complement(3881..5809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="DET0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986"
FT                   /db_xref="EnsemblGenomes-Gn:DET0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39181"
FT                   /db_xref="GOA:Q3ZAJ0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAJ0"
FT                   /protein_id="AAW39181.1"
FT                   /translation="MLDENKAKPGANAENYNASDIQVLEGLAAVRKRPGMYIGSTDQRG
FT                   LHHLVYEIVYNSVDEAMAGVCDRIKVIIYKDGSVSVEDNGRGIPIDIHPVTKISALETV
FT                   MTVLHAGAKFGGKTYQVSGGLHGVGASVVNALAEWTTVKVRRNGKIYQQSYQRGKPSTP
FT                   LEEVGVSDGSGTTTIFKADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEQSDQE
FT                   RTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSDSTILEVAIQYNDGYSDSTLTFANC
FT                   VNTIDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQ
FT                   FEGQTKGKLGNIEIKSFVESAVTEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARD
FT                   LIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGK
FT                   ILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPAKLRYNRLVLMTDADVDGSHIRTL
FT                   LLTFFFRHMPRLITESHLFIAQPPLYKIKIGSNEHWVYNDAEKETLLSQTKSNKVDIQR
FT                   YKGLGEMSAEQLWKTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSK
FT                   TVKNLDI"
FT   gene            complement(6013..8199)
FT                   /gene="relA"
FT                   /locus_tag="DET0005"
FT   CDS_pept        complement(6013..8199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="DET0005"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="identified by similarity to SP:O54408; match to
FT                   protein family HMM PF04607; match to protein family HMM
FT                   TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:DET0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39180"
FT                   /db_xref="GOA:Q3ZAI9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI9"
FT                   /protein_id="AAW39180.1"
FT                   /translation="MEFADLKEKASKYLPPEKLVFLEEAYNYAAAAHTGQMRKSGEPFI
FT                   EHPLNVAITLADLQLDSATLAAALLHDVPEDAHISLEQIEKKFGADVAKLVDGVTKLSK
FT                   LALGPGIEDARRPGGNASLRQAENLRKMLVAMSEDLRVVFIKLADRFHNMRTLQALSAE
FT                   KRRSIAKETMEIYAPLAHRLGIWELKWQLEDLAFRYLDPRHYRQVANLVDSKLAQRKNY
FT                   IEHVSAILQSEFEKNGLKVELSGRPKHLYSIYQKMEKYASQGKQFEDIYDVLALRVLVN
FT                   DIPDCYHAIGIVHSLWHPIPGAFDDYIANPKPNGYQSLHTAVMSLGTTPLEVQVRTYQM
FT                   HHIAEYGVAAHWRYKTAGKEDVNFEDRIGWLRQLIEWHRDMRGAEEFLESVKTDIFNDQ
FT                   VFVFTPKGEIKDLAKGATPIDFAYRIHTELGNRCIGAKANGRLVPLDYQLKNGEVVEIV
FT                   TTKKDRGPSRDWLNANMGYIKTHHAREKILAWFKKQERTENLERGRELLEKELKHIGIK
FT                   TVDREALAKAFKYENADEFLAAIGYGAVSVHQVSMKLLSQQEQPRVITPTVQTAKPSSQ
FT                   SSVSVMGTGSLLTNIAKCCNPVPGDDIIGYVTRNRGVTVHRQDCHNILHEEEKERLVSV
FT                   DWGIPKEELYPASIRMQAWDRVGLVRDISTMVAEEKISILSMTVTENDDKTTTLAMTAQ
FT                   IKSLSQLTRLMAKLEGIRGIISISRVGADGSRSG"
FT   gene            8328..9584
FT                   /gene="hisS"
FT                   /locus_tag="DET0006"
FT   CDS_pept        8328..9584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="DET0006"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:DET0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39179"
FT                   /db_xref="GOA:Q3ZAI8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAI8"
FT                   /protein_id="AAW39179.1"
FT                   /translation="MYQSPRGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFED
FT                   AGLFVRSVGEGTDIVSKEMYTFEDRGGDKLTLRPEGTAPICRAYLEHGMQTRTKPVKLY
FT                   YLSSIFRYDRPQAGRYRQHHQFGFEAIGEADASLDAEVIEMAWRFYNLLGINDLSLELN
FT                   SIGCRECRPAYISALKAYYGQHEGKLCSDCKTRLDKNTLRLLDCKREECQCVAENAPRS
FT                   ADYLCPDCLAHYNRLKECLTVVDLPFHENFRLVRGLDYYSRTVFEIQPRIEGAQSTIGG
FT                   GGRYDGLIEQLGGEPTPAIGFATGIERIILNLKRQGITPPPLPSPSVFLAYMGEAASLA
FT                   SIALASDLRKAGIGIYQTYAQKSIKAQLRQANSLGADWAVILGEEELKQGCAVLRNMKE
FT                   AGQATIPLDQLICEIKKQI"
FT   gene            9581..10744
FT                   /locus_tag="DET0007"
FT   CDS_pept        9581..10744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39178"
FT                   /db_xref="GOA:Q3ZAI7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI7"
FT                   /protein_id="AAW39178.1"
FT                   /translation="MTKNILIIGGYGNAGSCIAMLLLQETDARIFLGGRNLEKARYVAE
FT                   GLNQLENIQRVEGVKLNVEDPQSLKEAFCGMDIVVVASNTPEYARQIAFAALEAKVDYI
FT                   DIQYSDRKLHQLKLLSQKINNANLCFITEAGSLPGLPSALVHFCHQGFTTLERVSVGAI
FT                   ICQNWKSAISEERTNEVMRQLSDYQPYIYRDYHWKRLGWFRPGTSRTFNFGPFGRFSCG
FT                   PMTLEEMRPLPGMYPTLKELGFYLGGFNWFTNWISIPLLNLGLRFLGKEAKRSLGRLLV
FT                   WGLRNFDSQPYGMAIKVSARGERGGIRERQEMLLSHKDSYMFTAIPLVACLKQYIDGSA
FT                   RRSGLHYMGHLVDSRRLVADMEKMGMTIRFQTHLIDKPPAERPRIEN"
FT   gene            complement(10741..11367)
FT                   /locus_tag="DET0008"
FT   CDS_pept        complement(10741..11367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0008"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to OMNI:EF1643"
FT                   /db_xref="EnsemblGenomes-Gn:DET0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39177"
FT                   /db_xref="GOA:Q3ZAI6"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAI6"
FT                   /protein_id="AAW39177.1"
FT                   /translation="MSLLIGYFLGSIPSAYLVTRRLTGRDIRQMGGGNMGGLNTFREVG
FT                   VGAGAAVVLMDLAKGALAVSVAYYLLIQNAQWVILTGFAAVIGHNWPIWLDFKGGKGLG
FT                   PAFGAMLFLLPVYGLPQHLLILALLVFIPLAITRNIALATGIALFSLPFLVWYGSHSEF
FT                   ATLISVLLFLMIGIKFVLDNRKNLRDPANRRNLIVDHWKRPDKNS"
FT   gene            complement(11400..12320)
FT                   /gene="ilvE"
FT                   /locus_tag="DET0009"
FT   CDS_pept        complement(11400..12320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="DET0009"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by similarity to SP:P00510; match to
FT                   protein family HMM PF01063; match to protein family HMM
FT                   TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:DET0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39176"
FT                   /db_xref="GOA:Q3ZAI5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI5"
FT                   /protein_id="AAW39176.1"
FT                   /translation="MGTSYAYFKKQIIPLEDAKIGVMTHALHYGTGVFEGIRGNWNNEK
FT                   KQMYIFRLKEHYTRLLTGAKVLKMNLPYTVDELCKITIDLIKKCGFKEDIYIRPLAYKS
FT                   SETFGVRLHNLDCDLLIVAIPWGRYIDKDTCHCCVSTWHRPDDNVMPPQLKSTGIYLNN
FT                   AFTKTEAVENGFDEGIMLTPDGHVSEGSGENLFIVRKGKLITPPICDSILDGITRNSVM
FT                   ELAEKELGLEVLERSIDRVELYIAEECFLTGTAAHLTPVSEVDHRKVGNGEIGPVTAKL
FT                   KDLYFEAIKGNIAKYSSWCTPVYNL"
FT   gene            12308..12463
FT                   /locus_tag="DET0010"
FT   CDS_pept        12308..12463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39166"
FT                   /db_xref="GOA:Q3ZAI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI4"
FT                   /protein_id="AAW39166.1"
FT                   /translation="MTFPYCGLLSLKIDYSPPGIKGQAGFGYGINLEKIIPCKMVRSGG
FT                   KYPLSE"
FT   gene            complement(12471..13643)
FT                   /locus_tag="DET0011"
FT   CDS_pept        complement(12471..13643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0011"
FT                   /product="DNA polymerase IV, putative"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:DET0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39165"
FT                   /db_xref="GOA:Q3ZAI3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAI3"
FT                   /protein_id="AAW39165.1"
FT                   /translation="MAIRRVMHVDLDAFFVSVEQSLRPELKSKPVIVGGKPERRGVVAA
FT                   ASYEARKFGIHSGMPLLSAKHLCPQAVFIEGNHRLYREYSEKFMQILSDFSPFLEPMGL
FT                   DEAYLEVTGFESLHGSIGEMALKIRRRITAELSINASIGIANSKVVAKIATERAKPNGQ
FT                   CEVPAGEEAAFLAPLDISIMPGIGKKTEYHLKSLGINTLGRLAGIPATFLKIHLGTYAP
FT                   YLLNAAAGIDNRPVEMPAEAKSISRETTFETDTRNHTFLEAKLGYLSEKIAATLRKRGK
FT                   QARVVQIKIRFADFTTLTRQKHLNHPCSGNQEIFQTALKLMNGILDSDRRSVRLLGVGI
FT                   SDFCGPEKQLEIDPARARLEKLDASLDKIRQKYGFGSVQTGRTYKLKDLF"
FT   gene            complement(13643..13831)
FT                   /locus_tag="DET0012"
FT   CDS_pept        complement(13643..13831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01TT2569"
FT                   /db_xref="EnsemblGenomes-Gn:DET0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39164"
FT                   /db_xref="GOA:Q3ZAI2"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI2"
FT                   /protein_id="AAW39164.1"
FT                   /translation="MLEIFPGDVYKLRKPHPCGGADWKVDFAGSDIGITCLRCGHHLLL
FT                   PRPLFEKKVKCLIKRGE"
FT   gene            complement(13903..14715)
FT                   /gene="pyrF"
FT                   /locus_tag="DET0013"
FT   CDS_pept        complement(13903..14715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="DET0013"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by similarity to SP:Q9P9M3; match to
FT                   protein family HMM TIGR02127"
FT                   /db_xref="EnsemblGenomes-Gn:DET0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39163"
FT                   /db_xref="GOA:Q3ZAI1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAI1"
FT                   /protein_id="AAW39163.1"
FT                   /translation="MKFLEKLKQAGNSHNSLLCVGLDPDPKLMPVGMTALEFNREIIAA
FT                   TAPFVCGYKINLAFYEALGKQGWEILSETCKLIPPELLSIADAKRGDIGNTSKAYARAV
FT                   FDELGCDGVTASPYLGYDSLEPFIEYQDKGIFILCRTSNQGSADFQMLKTEYLGQKRFL
FT                   YEVVADKSLQWNRYENIGLVVGATQQEELKKLRLSYPKMPFLIPGIGAQGGDLKATVEN
FT                   GTNQSGQLALICASRGILYARSGSEFAQGAAEAAKQMRDAINHYRKRF"
FT   gene            14863..15558
FT                   /locus_tag="DET0014"
FT   CDS_pept        14863..15558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39162"
FT                   /db_xref="GOA:Q3ZAI0"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAI0"
FT                   /protein_id="AAW39162.1"
FT                   /translation="MKKEFPNKNFQRIEAGHGFELKLIQSDSFGVTVDASEDGFKNIEM
FT                   KQEGDKLWLMYSPSIFSLKNLLPGWYLPKATVKMPLLTGLYINGATRANLEGFDSDGKL
FT                   EICLSGASQLEGEVKAGEARIKAEAASEVKLKGVFKQLKLELESGSKVQMEGWTEELEA
FT                   EAAGVSQIVLDKMVCKQARVRLENASQAEVWVEEVLNVRLNGASELKYAGCPCFSEVEI
FT                   KGSSSLSKS"
FT   gene            15597..16391
FT                   /locus_tag="DET0015"
FT   CDS_pept        15597..16391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0015"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39161"
FT                   /db_xref="GOA:Q3ZAH9"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH9"
FT                   /protein_id="AAW39161.1"
FT                   /translation="MKKAGRSGLSVCIVFIMALLGGGCIPGIGGFVTGSGEVENRSFEY
FT                   AGFNRVEVSNAITADILYSGSFEVSVSTHENIFEYLELEKSGQTLKIGLKDSYTFMNVT
FT                   IEAVIRLPELVGLSVSGASRVNASGFDSANDFTALVDGASRLTLHNMQVGQSSFYISGA
FT                   STASGELICGKAAMKVSAASRLELSGQGGDIEVLAEGASTASLENFLVASARVEATGVS
FT                   NIRIYTDGELYITASGVSSVKYFGNPVIKDLNVSDVSSAGKG"
FT   gene            16437..17756
FT                   /locus_tag="DET0016"
FT   CDS_pept        16437..17756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0016"
FT                   /product="folylpolyglutamate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /note="identified by similarity to GP:4930039; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:DET0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39160"
FT                   /db_xref="GOA:Q3ZAH8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH8"
FT                   /protein_id="AAW39160.1"
FT                   /translation="MGLTDYESATSRAAANYDLRRVVELLLRLHSPHIGIPSVHLAGTK
FT                   GKGSTAALIASVMSAAGYRTGLYTSPHLLDFRERIRLDGKMISKAHLVRIMDYISPMVE
FT                   EMNARTCLGKITSFEVMTVLAFEFFHRQQAFFQVIETGLGGRLDATNVITPNLSVLTPI
FT                   SLDHTEVLGDSLAKISAEKAGIIKHFVPVVSAAQRPEAMAVIRERCLKTGSKLIEVTDS
FT                   YKAELLGYTAQGQSLKLSGRQAEYRLCLPLLGHYQRQNALTALASLEALVEEGFKISNE
FT                   DIAEGFGQVRWPGRFKVIKGKPLMVIDGAHNQEAAAELLLSLQEYPPAAKVEKEKRLLV
FT                   FGTSFDKDAGAMADVLSGYFGTVILTHSLHPRAMKPDLLRKAFDGRGLKVLEADGVPKA
FT                   LELAGRIAPADGLVCVAGSLFVAAEALKGQSQPRSGTGSK"
FT   gene            complement(17736..17951)
FT                   /locus_tag="DET0017"
FT   CDS_pept        complement(17736..17951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39159"
FT                   /db_xref="GOA:Q3ZAH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH7"
FT                   /protein_id="AAW39159.1"
FT                   /translation="MSCYFRHIGDIFQAAGVDPQGEKRKELDRIIHQFLGIEYKSCPET
FT                   WKKLKEEVIPYPDKKNQLIELLRASS"
FT   gene            complement(17965..18228)
FT                   /locus_tag="DET0018"
FT   CDS_pept        complement(17965..18228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39158"
FT                   /db_xref="GOA:Q3ZAH6"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH6"
FT                   /protein_id="AAW39158.1"
FT                   /translation="MQSSLIGKIEKAKRYAQEKDRIRFNQLSVQFRGENDIHTTEYING
FT                   QWHCTCNFFAAWGMCSHTMAMEKILDNMLPDEALSNVFAELP"
FT   gene            18528..18989
FT                   /gene="dtd"
FT                   /locus_tag="DET0019"
FT   CDS_pept        18528..18989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="DET0019"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:DET0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39149"
FT                   /db_xref="GOA:Q3ZAH5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAH5"
FT                   /protein_id="AAW39149.1"
FT                   /translation="MKAVIQRVSRASVMVGGDTVGEIGPGLAVLLGVAEGDTQADAEYL
FT                   VSKIINLRIFADGEGKFNLSLKDLCRELLVVSQFTLIADTRKGRRPSFVEAAQPEEADR
FT                   LYNLFIRLCRGEGVQAATGKFGAMMMLEIHNDGPVTIILDSRDRLNPRQ"
FT   gene            19041..19469
FT                   /locus_tag="DET0020"
FT   CDS_pept        19041..19469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0020"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by similarity to OMNI:NTL01TT1159"
FT                   /db_xref="EnsemblGenomes-Gn:DET0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39148"
FT                   /db_xref="GOA:Q3ZAH4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH4"
FT                   /protein_id="AAW39148.1"
FT                   /translation="MHKQNSIAGELANDGFRLTPQRVLILEALDMAEGHMSAEDIYAEV
FT                   GQEYPNINISTVYRTLELLKGQGLVLETDMGDGRLRYHSVNKGSRHYLVCRKCGKITDL
FT                   SEDMVREQEQSILKKYGFAADFKNLVIYGQCRKCGDSA"
FT   gene            complement(19524..20276)
FT                   /locus_tag="DET0021"
FT   CDS_pept        complement(19524..20276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MJ1433"
FT                   /db_xref="EnsemblGenomes-Gn:DET0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39147"
FT                   /db_xref="GOA:Q3ZAH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH3"
FT                   /protein_id="AAW39147.1"
FT                   /translation="MENRKLGRFIVTVAIISLTASTLLYLLHYYIFQDSHHIFIYMLGD
FT                   LAFIPLEVFLVVVVIERILTSREKHALSQKMNMVVGAFYSELGNALLGKLLDSFDNPEQ
FT                   ISSQMAVDKNWSNAEFKKALTYSAHFSHMPNPGKLDLQHLKNLLDAKRSFMLTLLENPN
FT                   LLEKDDFTDLLWASFHLGEELDARQSLENLPETDKAHIANDVKRMYALLLNQWIKYLIH
FT                   LKSQYPHLYSLVLRTHPFQPSPNPVIHE"
FT   gene            20379..20765
FT                   /locus_tag="DET0022"
FT   CDS_pept        20379..20765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39146"
FT                   /db_xref="GOA:Q3ZAH2"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH2"
FT                   /protein_id="AAW39146.1"
FT                   /translation="MAKHAPDMVVDKKDQLEQIEGICLPEELIHAVFDLKGQGTGFIGL
FT                   TNKRIIFYDREFAKKAKAIVSLPYSRVVTVGSEDKGGFIFRKGFMVSDKLYVGVSGQEV
FT                   KEFEFRGGDKAHQAHDIIMTYVLD"
FT   gene            complement(20846..20986)
FT                   /locus_tag="DET0023"
FT   CDS_pept        complement(20846..20986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39145"
FT                   /db_xref="GOA:Q3ZAH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH1"
FT                   /protein_id="AAW39145.1"
FT                   /translation="MANRIAEQIERTIFQFKWLFMPPKAKYAYLWNRSRASLQADYYGL
FT                   R"
FT   gene            complement(21043..23430)
FT                   /locus_tag="DET0024"
FT   CDS_pept        complement(21043..23430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0024"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="identified by match to protein family HMM TIGR00360;
FT                   match to protein family HMM TIGR00361"
FT                   /db_xref="EnsemblGenomes-Gn:DET0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39144"
FT                   /db_xref="GOA:Q3ZAH0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAH0"
FT                   /protein_id="AAW39144.1"
FT                   /translation="MIISLISLGLIGGVALSRLGLPVLPFIVLAAVLGGFWFIFRKRYR
FT                   LLLGLSLGVLAISGGILLAGSQLNTNSDPSQLSYYNDSGKLELKGIITQNPDNRDQTSL
FT                   IVLNVNSIATPDGWQGVSGNILLTLPSYPEYHYGEEIQINGYLKTPENFEGFDYKAYLA
FT                   NQQIYSVMVYPEITLLSEGNGNPLMAAIFSFRQNLSESLSRAIPEPESSLAKGILLGER
FT                   SNIPEDIQAEFSISGTTHLLAISGANLSILSGILLTALGWVLGKRGYIYIYLTLILIWG
FT                   YSLLSGFDPPVVRAVIMASIFLAAELLGRQKNAMPALCLAAAVMVAFTPSILWSVSFQL
FT                   SFMSMLGLILVYPMLKELNLRLLERFGLSEGILRTALGIVLDGLGVSLAAIAGIWPVLL
FT                   YYFENISLIGPVATLLAMPAMPFIIVLSFLTALLGLVFPAGAVFMGYLAWLPCRYMLTV
FT                   VSLTASLPGVLLAGIRPGAILMGIYYFLLGVLYRAYKHFLKIPARSHANPSSAIKLRWV
FT                   LVGMAVPVLVFSFGLNPSADQKMHVYFLDVGQGDAILIQYQNQDILIDGGPSPQALCNE
FT                   LDKHLPFFDRNIEMVILTHPDSDHLSGLLEVLERYSVTEVLLPQTQNQDALYQNYQDLI
FT                   QEKAIPARTAQTGMQITLANGAVLEVISPFEGLASKEADRDNNQSTVLTLSCGQINYLF
FT                   CADIETATEYQLITRRLLENTTVLKVAHHGSKYSSGTEFLNVTLPVFGLISAGADNRYG
FT                   HPHPETLSRLSLVMAENHIYRTDIWGSLDFATDGQSLYIFQP"
FT   gene            complement(23427..23927)
FT                   /locus_tag="DET0025"
FT   CDS_pept        complement(23427..23927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0025"
FT                   /product="competence protein ComEA, putative"
FT                   /note="identified by similarity to SP:P39694"
FT                   /db_xref="EnsemblGenomes-Gn:DET0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39143"
FT                   /db_xref="GOA:Q3ZAG9"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG9"
FT                   /protein_id="AAW39143.1"
FT                   /translation="MKVTKRFALLLGLALAVLSAQGCSETAPLEVYTPSQISPNQLEIN
FT                   ISGNIKLPGIYPGNTRDTLQSLLEAAGGLMDNSELTTIYLSFNPPVPGSSAQKIDLNRA
FT                   EIWLLVALPGIGEARANDIVTYRNQNGGFKNTLELMLIPGFSQSLYDQIKDLICVSETA
FT                   DMP"
FT   gene            complement(24098..24763)
FT                   /locus_tag="DET0026"
FT   CDS_pept        complement(24098..24763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0026"
FT                   /product="potassium uptake protein, putative"
FT                   /note="identified by similarity to SP:P23868; match to
FT                   protein family HMM PF02080"
FT                   /db_xref="EnsemblGenomes-Gn:DET0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39142"
FT                   /db_xref="GOA:Q3ZAG8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG8"
FT                   /protein_id="AAW39142.1"
FT                   /translation="MYVVVIGGGRLGYYLLKALLNDGHEVLLIEKNSALCDGINKEMGS
FT                   VCLHGDGCETAVLTEAGTSRADLLIAVTGDDEDNLVACQVAKYKFNVPRTIARVRNPKN
FT                   ESVFKKLGVDSTVNSTNIILEHIEHEVPSHAMTHLLTLHGKDLEIIDIRIPDNALTVGK
FT                   QIHELVLPSQTIISLIIRKDSKPVLPRPETTVQAGDQFMIVADASKETEIRDILTAAA"
FT   gene            complement(24768..25172)
FT                   /locus_tag="DET0027"
FT   CDS_pept        complement(24768..25172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0027"
FT                   /product="potassium uptake protein, putative"
FT                   /note="identified by similarity to SP:Q53949"
FT                   /db_xref="EnsemblGenomes-Gn:DET0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39135"
FT                   /db_xref="GOA:Q3ZAG7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG7"
FT                   /protein_id="AAW39135.1"
FT                   /translation="MKVVIMGCGRVGAQLATMLDKEGNEVISLDVDAYSFRRLPADFKG
FT                   TALLCNGMDEDSLKKAGIETADAFVAVTQGDNRNIMAAQIAKKIFNVPKVVCRIYDPLR
FT                   RDLYTLLGLDAISPTTIFAQMLKDKIEGKE"
FT   gene            complement(25176..25604)
FT                   /locus_tag="DET0028"
FT   CDS_pept        complement(25176..25604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0028"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39134"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG6"
FT                   /protein_id="AAW39134.1"
FT                   /translation="MEFERILVPVDGTETDEEAISLACTISKVSGKTRVFAVHIIPVER
FT                   ALPLDAELSSAITKAEGILAKAEEIAEKQGVKLETDLLQAREVANAIIDEAIEKEIDLI
FT                   LIGLSYKTRFGEFCMGGVLPYILQNAPCRVIVYHQRKV"
FT   gene            complement(25680..27125)
FT                   /locus_tag="DET0029"
FT   CDS_pept        complement(25680..27125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0029"
FT                   /product="Trk system potassium uptake protein, putative"
FT                   /note="identified by similarity to SP:P21166"
FT                   /db_xref="EnsemblGenomes-Gn:DET0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39133"
FT                   /db_xref="GOA:Q3ZAG5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG5"
FT                   /protein_id="AAW39133.1"
FT                   /translation="MKINNVLHYLGLVIAILGGFMFIPFVFSLINAEPDQLAFGVSIVI
FT                   TLSAGFLLWRFTPITERRISLRESLAIVAGSWIMAALFGSLPFIISGVLPSVIDCIFEA
FT                   MSGLTTTGASVFSSVENLPHGILVWRSLTQWIGGLGIIMLFVTILPMLGIGASQLMEAE
FT                   TPGQQERLTSRIRDTARTLWLLYLGFTVAGFIALMLAGLPGFDAFNIILTTTPTGGFAP
FT                   VSSIGVYNNLAVELILIFFMVASGVNFGLYYYLLWKGRPAKFFGNAEFKLYIGILIGCI
FT                   LLINWDLVANAGMGIFEGLRQASFQTASVMTTTGFATADFAQWPHFSQAILLVLMVVGA
FT                   SAGSTGGGLKVIRLLVLFKYTYRRIQLTFNPNAVIPIKIGGYVISDKLISRSVGLTILY
FT                   FATLWAGFLVMSAIGLDFVTALSSITSCLGNVGPALGTVGPMASYADIPGIGKLVLLTA
FT                   MLVGRIELFTLLVLFIPAFWRWR"
FT   gene            complement(27129..28493)
FT                   /locus_tag="DET0030"
FT   CDS_pept        complement(27129..28493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0030"
FT                   /product="potassium uptake protein TrkA, putative"
FT                   /note="identified by similarity to SP:P23868"
FT                   /db_xref="EnsemblGenomes-Gn:DET0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39132"
FT                   /db_xref="GOA:Q3ZAG4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG4"
FT                   /protein_id="AAW39132.1"
FT                   /translation="MFIVIAGGGTVGFNIASMLVVEDHEVVVIEQSETAVEYLNRQLDI
FT                   KTIFGNAAIPRILRDAEVQRADLVLAVTDRDETNMVICFIAKEMGASTTAARIRNSEYT
FT                   GYFIPPAKSTLSARRIIRPKSLGIDVFINPEVEMAREILGILSSFYSTPVEQLANGLVQ
FT                   IRNFTIEGSPMSGKTLSELNFTKPCVVASIARKEELLIPQPELVLEEEDVLYLVAERDN
FT                   MDHLGRMFSAIQRPAHSVFILGGSQIGLLVAEGLADHDVGVKLIEPDEEKSQKAAIRLE
FT                   KAVVLRGDPTDRDFLTEQGVPSADAFVATTENDEFNILSCLVAKNLGVDRSLSVINKPS
FT                   YIPLAEAVDIDVAGSPAIITARKIAHFVLSGGAIAAALLESGQLEAVEFVVSPQASIIN
FT                   QKVNQLDLPKEAVIGAVVQNNQVIIPPDEAVIHGGDHVIVVSQLNVLHDVEKLFK"
FT   gene            complement(28497..28649)
FT                   /locus_tag="DET0031"
FT   CDS_pept        complement(28497..28649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39131"
FT                   /db_xref="GOA:Q3ZAG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG3"
FT                   /protein_id="AAW39131.1"
FT                   /translation="MPKEEILKPISHREHCHHQVFRIERKQKSRISSLMSQLKQFRSSI
FT                   SKQRD"
FT   gene            complement(28782..29732)
FT                   /locus_tag="DET0032"
FT   CDS_pept        complement(28782..29732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0032"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:DET0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39130"
FT                   /db_xref="GOA:Q3ZAG2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG2"
FT                   /protein_id="AAW39130.1"
FT                   /translation="MSPVSSKKTTSDKQMPVSKKLKLGILFSGIILLAEFIGALVSNSL
FT                   ALLSDAGHVLTDVLALSLSYFALMQAKRPSNFKMTFGYHRIGVLVAILNSISLIGIAVF
FT                   IFYESFQRFQNPPEINAGLVLPVALLGLATNLTVALILHREQKENLNIKSAFWHAAGDA
FT                   LASVGVIISAVVIIISGNYLADIVVSIIIGLIISLGGVNIFRQGLRVILEASPKDINLN
FT                   QLADSVKTIPGVKDFHHIHIWSISPEIHALSAHVLIDDCPVSQADDIRQHIETILKESF
FT                   ALSHVTLQMECQVCRTNDILCQLEIEQKPHLHKHH"
FT   gene            29881..30510
FT                   /locus_tag="DET0033"
FT   CDS_pept        29881..30510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01CA3047"
FT                   /db_xref="EnsemblGenomes-Gn:DET0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39129"
FT                   /db_xref="GOA:Q3ZAG1"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG1"
FT                   /protein_id="AAW39129.1"
FT                   /translation="MPKISIIPREEKFFDLIELSAKNMVSTAQELDELVNNWADVDNKV
FT                   ARIADLEHEGDSIAHQIINLLHRTFVTPFDREDIALLAHTMDDVTDFIHSAADFMFIYK
FT                   TGRPGERAKELAGIIVLAAKEVALAVPHLRHKSEMKQVIVHCVEINRLENMADVAFRAA
FT                   LGELFTDSKDMANIIKWREIYEHMETATDRCEDVANVLEGVALKNA"
FT   gene            30503..31504
FT                   /locus_tag="DET0034"
FT   CDS_pept        30503..31504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0034"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DET0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39128"
FT                   /db_xref="GOA:Q3ZAG0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAG0"
FT                   /protein_id="AAW39128.1"
FT                   /translation="MPDASFIPYLIIILLAIGFAFVNGTNDTANAIATVVGTRVLSPRK
FT                   AIIMAAAANLVGVFTGTAVARTIGKGILGAESLTYETVIAGLIAAVIWSMVATRKGLPV
FT                   SLTHCLVAGLAMAGVAMAGVGAVDWGVLLKIVAAVGIAPIMGMAGGYLLMVALLWIFRR
FT                   SVPSKTHGLFSHLQIFSAAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIPIWII
FT                   ILSALSISAGTAIGGWRVIQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIPVSSTH
FT                   AISSAIMGVGATRRLSAVRWGVAGNIVSAWLLTFPICGALGFLVAGLFKLIF"
FT   gene            complement(31501..32121)
FT                   /gene="gmk"
FT                   /locus_tag="DET0035"
FT   CDS_pept        complement(31501..32121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="DET0035"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by similarity to SP:Q9CCQ7"
FT                   /db_xref="EnsemblGenomes-Gn:DET0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39120"
FT                   /db_xref="GOA:Q3ZAF9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAF9"
FT                   /protein_id="AAW39120.1"
FT                   /translation="MMTNWNFNKANKPLLLVVSGPSGVGKDAVLARMKERKLPLAYIVT
FT                   TTTRTKREKETEGVDYNFIRPAEFQQLIGQNELLEWANVYGNFYGVPKAPIRQALAHGF
FT                   DVIVKVDVQGAASIKKIVPNAVFIFLMPPDMDELTRRLEHRLTESPESLKRRLATAPLE
FT                   IEKLPDFDYVVVNPEGEIDNAVSEIMSIISAEHCRINPRSIEL"
FT   gene            complement(32099..32389)
FT                   /locus_tag="DET0036"
FT   CDS_pept        complement(32099..32389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39119"
FT                   /db_xref="GOA:Q3ZAF8"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAF8"
FT                   /protein_id="AAW39119.1"
FT                   /translation="MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLID
FT                   MTNGRKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL"
FT   gene            32598..33446
FT                   /locus_tag="DET0037"
FT   CDS_pept        32598..33446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0037"
FT                   /product="PyrK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39118"
FT                   /db_xref="GOA:Q3ZAF7"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF7"
FT                   /protein_id="AAW39118.1"
FT                   /translation="MYTIVERQDLLPRVHLLKIQAPKVAAAAAAGQFVILRIDAEGERF
FT                   PLTIADWDAQAGTVTVIYMEIGASTRKLAKLGEGDAILDFAGPLGKPTEIENFGTVVCV
FT                   SGGFAMATIAPIARAMKEAGNRVISVVGARSKDLFFWHDRLTKYSDEMIVCTDDGSAGI
FT                   KGVVTEPLRDLLASSTKVDRVIVIGPSVMMKFCSKTTQPFGVKTIVSLNPIMIDGTGMC
FT                   GCCRVSLDGQTRFACVDGPEFDGHKVDWDGLLVRQKSYVAEEAVAAERCRCKEEGCGNH
FT                   G"
FT   gene            33439..34836
FT                   /gene="gltA"
FT                   /locus_tag="DET0038"
FT   CDS_pept        33439..34836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="DET0038"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM TIGR01316"
FT                   /db_xref="EnsemblGenomes-Gn:DET0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39117"
FT                   /db_xref="GOA:Q3ZAF6"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF6"
FT                   /protein_id="AAW39117.1"
FT                   /translation="MAKAGLNRMDMPKQAVSDRIQNFSEVATGYTPADAHTEAARCLQC
FT                   KKRYCVEGCPVNIDIPEFILALRDGNMPEAARVLKKTNSLPGVCGRVCPQETQCEQACI
FT                   LNKKEAPIAIGRLERFVADWERGHSAEVNLPKSLKPKSGKKAAVVGAGPAGLTAAAELA
FT                   RLGHDVTLFESLHTAGGVLMYGIPEFRLPKDIVQGEIEYVKSLGVTLELNSVAGRLFSL
FT                   EDLFKQGFQAVFLATGAGLPLFLNVQGENLSGVYSANEFLTRVNLMKAHNFPSSDTPVK
FT                   KGRKVAVIGGGNVAMDAARCALRLGAEEVSIVYRRSELELPARKEEVDNAREEGIKFHF
FT                   LTSPVRFLANEQGQVRAMECQKMALGEPDASGRRRPIPVGGSEFEMDIDLAVIALGTRP
FT                   NPLVMQSAPDLQVNSNGTVLADINGQTSHRAVWAGGDIVTGSDTVISAMGAAKRSAVVI
FT                   DEYLRSL"
FT   gene            complement(34833..35045)
FT                   /locus_tag="DET0039"
FT   CDS_pept        complement(34833..35045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0039"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:12248364"
FT                   /db_xref="EnsemblGenomes-Gn:DET0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39116"
FT                   /db_xref="GOA:Q3ZAF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF5"
FT                   /protein_id="AAW39116.1"
FT                   /translation="MNVFRSALLFYVFAMLVLCFIPAWHSFISQITAPLDQNLSLVIKL
FT                   TADPLEYVWKWVLVIFIMLLLSRRN"
FT   gene            complement(35156..35689)
FT                   /locus_tag="DET0040"
FT   CDS_pept        complement(35156..35689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39115"
FT                   /db_xref="GOA:Q3ZAF4"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF4"
FT                   /protein_id="AAW39115.1"
FT                   /translation="MKIDPEVRKEINQVLDAMKEAVEAKNIEALVAQVDSEPNILTVGP
FT                   CPDNVGLGQNGFRRWMQALLDKATPVKFKLGFTTIKGNGPVVWLDTHVTYTCKNGDNQK
FT                   EFDFYLSGVMENIKDEWRWSQMHLSAPAELEFPEGPTPPPEAEQATPETTGASQNETPN
FT                   SEPGEDAPPEWNYM"
FT   gene            complement(35760..36266)
FT                   /locus_tag="DET0041"
FT   CDS_pept        complement(35760..36266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0041"
FT                   /product="quinone methlytransferase, UbiE family"
FT                   /note="identified by similarity to SP:P31113"
FT                   /db_xref="EnsemblGenomes-Gn:DET0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39114"
FT                   /db_xref="GOA:Q3ZAF3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF3"
FT                   /protein_id="AAW39114.1"
FT                   /translation="MLDVCSGSGAQVGEYRRRGILGFGLDLSPDMLRLSRRLYDPDKAG
FT                   YFTGADARHLPFADASFDYTSITLALHDKPAQTRLEILAEMKRVVKPQSYILIADYSYP
FT                   LPASFPGQVIRFIERIAGGEHYRNFRHFLKNGGVPALLEELGIKAENTQSTSYGLITVT
FT                   KAKVS"
FT   gene            complement(36271..36363)
FT                   /locus_tag="DET0042"
FT   CDS_pept        complement(36271..36363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39113"
FT                   /db_xref="GOA:Q3ZAF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF2"
FT                   /protein_id="AAW39113.1"
FT                   /translation="MLGIDYSTVIDPFLRGVRRFTTRIRGYKAG"
FT   gene            complement(36374..36568)
FT                   /locus_tag="DET0043"
FT   CDS_pept        complement(36374..36568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0043"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to SP:P08986"
FT                   /db_xref="EnsemblGenomes-Gn:DET0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39104"
FT                   /db_xref="GOA:Q3ZAF1"
FT                   /db_xref="InterPro:IPR016410"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF1"
FT                   /protein_id="AAW39104.1"
FT                   /translation="MFDFFFSGIFGLISFAISLALYFLPSIIALANHRRNTLAIFLLNL
FT                   LLGWTFIGWVVALVWSVKK"
FT   gene            36711..37082
FT                   /locus_tag="DET0044"
FT   CDS_pept        36711..37082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:29607780"
FT                   /db_xref="EnsemblGenomes-Gn:DET0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39103"
FT                   /db_xref="GOA:Q3ZAF0"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAF0"
FT                   /protein_id="AAW39103.1"
FT                   /translation="MDTEQFKQIVAEAVDSLPEEFLALLDNVEIMVADRPSRIQRRNLD
FT                   MHRGEELLGLYEGVPLTERHASYGMVTPDRITIFRLAILDMVKTEEDIKNEVRRVVKHE
FT                   VAHHFGISDERLEEMGGPV"
FT   gene            37216..37662
FT                   /locus_tag="DET0045"
FT   CDS_pept        37216..37662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0045"
FT                   /product="redox family protein"
FT                   /note="identified by similarity to OMNI:CT0642; match to
FT                   protein family HMM TIGR01909"
FT                   /db_xref="EnsemblGenomes-Gn:DET0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39102"
FT                   /db_xref="GOA:Q3ZAE9"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE9"
FT                   /protein_id="AAW39102.1"
FT                   /translation="MSDTAVSAQSLHEQGFNCAQSILGAFAPSLGIETGTAFKLASAFG
FT                   GGMAGRGDSCGVISGGLMVIGLKFGQTSAEDKAAREKCNRLGREYIKQFETRFGATACR
FT                   ELIKCNIGTPEGAKLVKEKGLREGLCSNLVYSGAQMLSALIEQA"
FT   gene            complement(37659..38762)
FT                   /locus_tag="DET0046"
FT   CDS_pept        complement(37659..38762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0046"
FT                   /product="GTP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39101"
FT                   /db_xref="GOA:Q3ZAE8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE8"
FT                   /protein_id="AAW39101.1"
FT                   /translation="MAVTIGIIGLAKSGRTTIFNAATRSNAATGSYSQSSSANVGIVKV
FT                   PDARLTPLEEMFHPKKLTPAEIKYFDVGASLKGGTKDSSFSGELLTQLQNVDALLNVIR
FT                   AFEDTAIPLPAGGLNAERDLTTMNAELIFSDLTIIEKRLNRIGSQMKGAKPPERAALER
FT                   EKELMARIKEAMEKDIPARDIELDEEEAKILSGYQFLSSKPVLMVINIGEDDLPKAAEM
FT                   EAELNGRYGGKNYRVIVMCGKLEAELINMDEAEAAEFRSSYGLKETGLDRTIRASYELL
FT                   DLISFFTVGPDEVRAWTITRGTIAQKAAGKIHSDIERGFIRAEIVHVNDLLAAGSLAEV
FT                   RKRGQLRLEGKTYLVQDGDTANFLFNV"
FT   gene            38985..40184
FT                   /locus_tag="DET0047"
FT   CDS_pept        38985..40184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0047"
FT                   /product="DNA polymerase III delta subunit-related protein"
FT                   /note="identified by similarity to SP:P28630"
FT                   /db_xref="EnsemblGenomes-Gn:DET0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39100"
FT                   /db_xref="GOA:Q3ZAE7"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE7"
FT                   /protein_id="AAW39100.1"
FT                   /translation="MFAEFVGHYNFFGHCFKSSKCSLRADCNILPGIFALNFKGYAPVS
FT                   LCYNISRRWLLNLLYIFTGSDDFSLKERLKQIKLALGDESLSSANTTMLEGKNLTAAEL
FT                   QNYVQTIPFLAPARLVMVNGLLERFEGSKGKAAAKDKADKNSPDEFARALSNLPPTTLA
FT                   VLLDYTTAKDGDYREKEKVSALASNPLFKLVSPGAEVKHFAPLSAQNLPGWVMQRAKQS
FT                   SIQMSVPAARLLARFVGADLWALSSEIEKLGLYAQGRAVEEADVENMVGYSQEVNIFGL
FT                   VDAVLDRKVKDAQQSLAAFTAGGGSPGFLLFMLVRQLRLMVRYTALKKRGLKEAEIFKA
FT                   MGGSEYALRKTASQAACQNMDSLKAIYSKLLETDFNIKTGRFEPELAMGLLVAELCGRK
FT                   "
FT   gene            40186..40797
FT                   /locus_tag="DET0048"
FT   CDS_pept        40186..40797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0048"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GP:10198137"
FT                   /db_xref="EnsemblGenomes-Gn:DET0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39099"
FT                   /db_xref="GOA:Q3ZAE6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE6"
FT                   /protein_id="AAW39099.1"
FT                   /translation="MEEKRKQSLKEQLKAVNWGSLLLTFGALIALSFLLAWGLNSLVDN
FT                   LEVPLDEYAWLTYVLVFVMSILANATVIAPVPFAISIMVAAATNFNPVMVALFGALGGS
FT                   LGEMSGYFAGRLGKKLAIPEGLVGYSRVESWIQKYGAWAIAFLAAQPVVPFDVGGLIAG
FT                   LARMPVHKFLPALFLGKFPKYIVMVYAGIGLIDWLPFLKS"
FT   gene            40831..41841
FT                   /locus_tag="DET0049"
FT   CDS_pept        40831..41841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0049"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:DET0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39098"
FT                   /db_xref="GOA:Q3ZAE5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE5"
FT                   /protein_id="AAW39098.1"
FT                   /translation="MNRSNLEAILKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCAR
FT                   NGAEGVFENICRVLERLLERNNLCISQFEALSAAVAGGIDMPNGLVTQSPHLPVWRDVP
FT                   LRDMLAERYLKTFLINDASAAALAEHKLGAGRGVKNLVYLTVSTGIGGGIIINDELYLG
FT                   QSGCAGEIGHMCLDINGTEDVCGNVGCLETLASGTAIVRRVQAELAGGEFSLLSERFKA
FT                   DYSALTAEDIGRAASEGDRLCQGVIRRAGEYLGIGLAGIANIFNPELIILGGGVSKLGE
FT                   IFIEPARKMLFKRAFRLAGDDVRLVASFLGDNAGVTGAALYAYGCLGGGGKPSQG"
FT   gene            41957..44572
FT                   /gene="alaS"
FT                   /locus_tag="DET0050"
FT   CDS_pept        41957..44572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="DET0050"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:DET0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39097"
FT                   /db_xref="GOA:Q3ZAE4"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAE4"
FT                   /protein_id="AAW39097.1"
FT                   /translation="MFSSDELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMVQ
FT                   FKPYYLGVAKPENSRMTSCQKCFRTTDIESVGDASHLTMFEMLGNFSIGNYFKKEAIAW
FT                   AWEYVTQRLNIPAEKLWVTVYLDDDEAIALWKEQGVPEGRIVRLGAADNFWGPAGDSGP
FT                   CGPCSEIHYDFGQEMGCGKADCNPSCKCGRFCEIWNLVFVQFNQDKSGKRQNLPAPSID
FT                   TGMGLERLTILMQFRKNVYETDIFAPVIEKACQLSGRQYGIDAETDKALRIVSEHSRGI
FT                   TFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRLGLEKPFLVDMAGAVIARMSGIYPELN
FT                   KRQAYVLEMIASEEARFSETLATGLELLEEIVRQTKGGQISGQDAFKLYDTYGFPVEMT
FT                   TEIAAERGLSVDLGGFEAEMEVQRTKARSSRKFSFDAAATAEAVKNMRHGEKTCFVGYE
FT                   LTRQKSTIMDILTEGGSVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEIITGGGRFEV
FT                   KNTLHLPNGVFLHQGRVISGCLKIAETAAAHIDEERRRDIARNHTATHILQTALRQVLG
FT                   EQVQQRGSVVTPERLRFDFSHLKPMTKDEIRRAEEFVNDKIRRNLPVYAEEMPYRHALE
FT                   EGVTALFGEKYGDRVRVLRVGRPAVSAELCGGTHVSASGEISLFKIVSESSVGAGLRRI
FT                   EAVTGREAEAYINLQQDSLSELSGMLEAAPEESPRKLAELKEEIDTLKKTVQNLERQMS
FT                   RGEAEELLSKAEDYKGIKLLVSRMTSVNADTLHETADFLRDKLGSGIIVLGTVSEDKPF
FT                   FLCMVTPDLIEKGYHAGNIVKKLSQIAGGGGGGKPNMAQGGGRDKAKLDEALQAVKGML
FT                   "
FT   gene            44619..45020
FT                   /locus_tag="DET0051"
FT   CDS_pept        44619..45020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0051"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="identified by similarity to GP:28203196; match to
FT                   protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:DET0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39087"
FT                   /db_xref="GOA:Q3ZAE3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAE3"
FT                   /protein_id="AAW39087.1"
FT                   /translation="MGDKWIGVALSDPLRILASPLVILRRDDDAKTVENIEALVKTHQP
FT                   DLLVIGLPVSLNGTIGPQAEKVKAFSGLLSQSLNTEIIFRDERFSTDEARRKMNDSGKN
FT                   NKTVRDDAAAAAVILQDYLDETNPPCFQP"
FT   gene            45042..46220
FT                   /gene="tgt"
FT                   /locus_tag="DET0052"
FT   CDS_pept        45042..46220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="DET0052"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM TIGR00430;
FT                   match to protein family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:DET0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39086"
FT                   /db_xref="GOA:Q3ZAE2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAE2"
FT                   /protein_id="AAW39086.1"
FT                   /translation="MDKSFILNKTSPRSSARRGQLLTAHGQVETPVFCPVGSQATVKTL
FT                   TPEDLKSVNVNMILSNTYHLYLRPGIPVVKEMGGLHKFMNWDGVILTDSGGYQIFSLAN
FT                   LRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAM
FT                   ERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPVLRQQSAEYLASLDFPGYALGGLSLGEP
FT                   KDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFS
FT                   RLGRLNIRNASFATQKGPVDPECNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFL
FT                   SNLMQEVRTSIEKDCFEEFKGDFLTRYQPTNESVRIEQKQKWLSARSGETSS"
FT   gene            46311..47453
FT                   /locus_tag="DET0053"
FT   CDS_pept        46311..47453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0053"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:DET0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39085"
FT                   /db_xref="GOA:Q3ZAE1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE1"
FT                   /protein_id="AAW39085.1"
FT                   /translation="MITTFELSTRIIFGVGSISSLNHEASLLGRHALLVTGKNSVRRLG
FT                   ILERAAFLLKEACIQTTLFDRVEPNPRSSTVDEAIALAREKGIDLIIALGGGSAMDAAK
FT                   AIAFGLACEGPVWDYIKQGEYPEGDFLPLIMIPTVAASGSEANGNAVISNWEKHEKRVI
FT                   SDSRLQPKVSLVDPLLTLSLPSRQTAQGGVDIFCHLAEPYLTAADDAPLRDGMAELAMR
FT                   LVTEYLPKAVKTPHDLQARTQLSWLSTIACSQFMSLGGRSGGMTMHGLEHALSGYYDIA
FT                   HADGLAALLPAYMRNLYPVRRHRIEMLGEKVFGQTDGIAAVENWLKKNNMGFSLKELGV
FT                   SEAKIDEMAAAAIVMSPWVKNHPGLLDKRVAASLYSDAFN"
FT   gene            47719..50667
FT                   /locus_tag="DET_De23S"
FT   rRNA            47719..50667
FT                   /locus_tag="DET_De23S"
FT                   /product="23S ribosomal RNA"
FT   gene            50767..50889
FT                   /locus_tag="DET_De5S"
FT   rRNA            50767..50889
FT                   /locus_tag="DET_De5S"
FT                   /product="5S ribosomal RNA"
FT   gene            50873..51034
FT                   /locus_tag="DET0056"
FT   CDS_pept        50873..51034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39084"
FT                   /db_xref="GOA:Q3ZAE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAE0"
FT                   /protein_id="AAW39084.1"
FT                   /translation="MPLPGELCFFIHLKAGSIFPLAAPIKNKACRGPFFYFKADTPCLL
FT                   YTFFLAEL"
FT   gene            51068..53542
FT                   /gene="clpC"
FT                   /locus_tag="DET0057"
FT   CDS_pept        51068..53542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="DET0057"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpC"
FT                   /note="identified by similarity to SP:P37571; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02861"
FT                   /db_xref="EnsemblGenomes-Gn:DET0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39083"
FT                   /db_xref="GOA:Q3ZAD9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD9"
FT                   /protein_id="AAW39083.1"
FT                   /translation="MSSRFDKFSERARRVLTYAQEEAQSLNHNYIGTEHILLGLVREEE
FT                   GVAARVLVNMDVNLAKVRSAVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLGHN
FT                   YIGTEHLLLGLLREGEGAAAGVLESFGVTVEKVRTEVGRILNQGLNKPKAGRATPSRTP
FT                   QLDQLGFDLTAAARTGKLDPVIGRAKEIERVVQILSRRTKNNPALIGEPGVGKTSIVEG
FT                   LAQRIVSGDVPETLEQKHIISLDVASLVAGTKYRGEFEERLKKVIEEIKTAGNIILFID
FT                   EFHTMVGAGAAEGAVDAANILKPSLARGEVQVIGATTLDDFRKYVERDAAFERRFQPVL
FT                   VEEPAIEDTLSILRGIKERYEEHHKLIISEEAIVAAANMAARYIPDRFLPDKAIDLVDE
FT                   AASRVRIKKRTKPVSLKEMKAIEDSYRRDKEAALATQQYDYASELRERELQIAEKIRRM
FT                   EDEWQNEQAMDKPVVGEEDIAQVVSMWTGVPLVQLTGDETERLLHMEEALHERIIGQEE
FT                   AIVTISKAVRRARAGLKDPRHPIGNFVFLGPTGVGKTELARALAQFMFGSEDALVRLDM
FT                   SEFMEKFAVSRLVGAPPGYVGYDEGGQLTEAVRRKSYCLILLDEIEKAHPDVFNILLQI
FT                   FDDGHLTDTKGRRVDFRNTIIIMTSNIGAELIRKGSGTIGFATQTDESKAQQTNFEHMK
FT                   DKLLGELKKSFRPEFLNRIDSVVVFHSLNKEQIRSIVDLMLKSVIKQMSEKGIGLEVTD
FT                   SAKDLLGKKGYDEVYGARPLRRTIQTMLEDRLSEDLLRAKFEAGDKVIVDTAEDEIIVR
FT                   LAEPAELSQATS"
FT   gene            53762..55150
FT                   /gene="radA"
FT                   /locus_tag="DET0058"
FT   CDS_pept        53762..55150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="DET0058"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:DET0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39082"
FT                   /db_xref="GOA:Q3ZAD8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD8"
FT                   /protein_id="AAW39082.1"
FT                   /translation="MEKSRRVYVCSNCGRESLKWLGRCPACQEWNTFEEKTVVSPIGRK
FT                   NEPARVISPAAELSSLQASETTRRSLSISEFNRVLGGGIVPGSLMLLGGEPGIGKSTLL
FT                   LQVAASVAQSGGKVVYVSGEENPAQIKMRAQRLGISGEGLFLMAETDLNAILAQLSVLC
FT                   PLLVVIDSIQTVFLPELEAAPGAINQVRESALRLMQWAKSSGASVFITAHVTKEGNIAG
FT                   PRILEHIVDVVMYFEGESQSAYRLVRSVKNRFGSTNEVGIFEMKSEGLVEVANPSQIFL
FT                   SNRQANTVGSAVTAVLEGSRPLLVEVQALTNTTSFGQPRRTANGVDFNRTLMIAAVLSK
FT                   RLSMRLGTQDIIVNATGGIRLDEPAADLAIALAIASSYRDTGVCPETIALGEIGLSGEL
FT                   RTIPHLERRLSEASRLGFKRALVPAGANCHNVHNIQIIPVSTVKEAVKLALTGVKTETE
FT                   DVFE"
FT   gene            55137..55820
FT                   /gene="ispD"
FT                   /locus_tag="DET0059"
FT   CDS_pept        55137..55820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="DET0059"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by similarity to GP:12697583; match to
FT                   protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:DET0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39081"
FT                   /db_xref="GOA:Q3ZAD7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAD7"
FT                   /protein_id="AAW39081.1"
FT                   /translation="MFLNEKVGAVIVAAGQSRRMGGQDKIFARLSGKPVLAHTLSVFQQ
FT                   SPEIDDIALVVSEHNLKKAKELVKEYNFSKVIAICSGGELRQDSVSSGLTALCDCGWVL
FT                   IHDGARPLLDPVSIPEGLEAAKLCGSAVAAVPLKDTVKEISPEGLVEKTLPREKLISVQ
FT                   TPQVFRADIIQKAYRRVGITATDDAQLVEKLKLPVKIFSGAYANIKITTPEDLLMAEIL
FT                   LKKGR"
FT   gene            55826..56299
FT                   /gene="ispF"
FT                   /locus_tag="DET0060"
FT   CDS_pept        55826..56299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="DET0060"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:DET0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39073"
FT                   /db_xref="GOA:Q3ZAD6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAD6"
FT                   /protein_id="AAW39073.1"
FT                   /translation="MRIGNGYDVHRLAPGQKLVLGGVEIPFECGLIGWSDADVLTHAIM
FT                   DSLLGAAALGDIGLYFPPGDPKFKGISSLKLLEQVTALLAEKGFGIINVDSVIVAEEPK
FT                   LRGHVDTMRKHLAKAMGIDPGRVGIKASTSEQLGFVGREEGMAAWAVALVDEK"
FT   gene            56303..57679
FT                   /gene="cysS"
FT                   /locus_tag="DET0061"
FT   CDS_pept        56303..57679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="DET0061"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:DET0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39072"
FT                   /db_xref="GOA:Q3ZAD5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZAD5"
FT                   /protein_id="AAW39072.1"
FT                   /translation="MKIYNTLSGKLEEFVPLEDGKVKMYVCGITPQSEPHIGHAMSYIN
FT                   FDVIRRYLSYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNI
FT                   TPADYYPRATQEVPKIIEMVSGLIEKGYAYEAGGSVYLRVQKVEGYGKLSHRTLEQMMA
FT                   GARIEPGEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQIDIH
FT                   GGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALS
FT                   RYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARQDNPRLQEINVDVKTY
FT                   RERFTQYMDNDFNTSAALATIFDLGRELNRIEAEGGKSTQGQELFKELAGILGLSLIIA
FT                   EPTTSADAAPFIDMLIELRKDLRLAKQYQLADKIRTSLDAAGILLEDSAGGTIWKIKTK
FT                   "
FT   gene            complement(57770..59398)
FT                   /locus_tag="DET0063"
FT   CDS_pept        complement(57770..59398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0063"
FT                   /product="resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40602"
FT                   /db_xref="GOA:Q3ZAD4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD4"
FT                   /protein_id="AAW40602.1"
FT                   /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAGKNNYQITYEFIDE
FT                   AESGRTAARPEFKRMIAMSKSSIPPFEAILVWKLNRFARNRADSITYKLLLQKKGIKVI
FT                   SINEPLDDSPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFYNGSQPPLGYELV
FT                   KVKDGPKQRNKLAPEADTSPGVKTVRYIFALADKGKGCKEIANILNREEYITKAGKPWG
FT                   RTTVHKILCNEAYTGTLVWGARPSQGLAKNEEAVRLENAWPGIIDKETFQRIQQSMVSR
FT                   QPKNTHPRTVPSQYLLSGMAFCSCGAALTGHSAKSGQYAYYQCNRKFKQGNGVCNCQAI
FT                   PKTKLESAVIKQIKSKVLTEENLEELVKQVNEELESTSSHHKEKLAVLDAELDDIRQRL
FT                   NRLYEAIESGKLNYDDLAPRIRELRERQSKLEKSRVLAEAEMVADSDDNFNLGMVKAYA
FT                   NDLKQLLNESEITDCKTFLKTFVKKIETDSRNVSLKYTLPLPGTNRRREVLPIDTFGGA
FT                   GGIRTLYLLTASQTFSQVNYGPSNR"
FT   gene            57782..57857
FT                   /locus_tag="DET_tRNA-Ala-1"
FT   tRNA            57782..57857
FT                   /locus_tag="DET_tRNA-Ala-1"
FT                   /product="tRNA-Ala"
FT   gene            complement(59395..60327)
FT                   /locus_tag="DET0064"
FT   CDS_pept        complement(59395..60327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39071"
FT                   /db_xref="GOA:Q3Z699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z699"
FT                   /protein_id="AAW39071.1"
FT                   /translation="MPRKKAPSIKETREWLDLYESGWSEAHLAQRKGRDIRTIRKYITE
FT                   AQAERRFDQAELEVLKTALTKHQEQLLATLNELDAAIALPEPDTRFYFDQDTYKIEFNA
FT                   GKVVATQPESSTDIIVNLELENSLLFTLVEQHLNHNLTFFSLKGWKAACENYINRCIFF
FT                   RKELVEGMDRMGREVGIEVCAEARDEKGILLDFICKNSFKFILLNDRTILEKAVERLQI
FT                   NKNRGEIIIKPGTTLLSCPGAEEACLEAITKLLSIDNLKKFTYIREAYKQLGMETQTLK
FT                   RDIQTLILTNFLPGECDVCRRLKGQRSGK"
FT   gene            complement(60943..61803)
FT                   /locus_tag="DET0065"
FT   CDS_pept        complement(60943..61803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0065"
FT                   /product="virulence-related protein"
FT                   /note="identified by similarity to GP:3482866"
FT                   /db_xref="EnsemblGenomes-Gn:DET0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39070"
FT                   /db_xref="GOA:Q3ZAD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD2"
FT                   /protein_id="AAW39070.1"
FT                   /translation="MKNKDFELRYNLTGSDRKRLVTAIAEILNSPAKYKGAPSFTYEVD
FT                   YFTIDKNGTISFDDRADSEEIEKLIERLHEQGFEAETRFEDLRMTEAEELGLGRQHRDP
FT                   VGEDGMQASDVPDESIGLVIEMPRSSFTDTALENLKRLVESKKSLISKALGCQDIDIDI
FT                   VDEKVRFPWFEDGTDPDAVKAYTLFITALCEMAKTQKRVTAKEKDTDNDKYAFRCFLLR
FT                   LGFIGDEYKAARKILLRNLSGSGAFKSGNPKVQELVECINADAGLYDDVMSLQDKEVSD
FT                   DEVSK"
FT   gene            complement(61934..63169)
FT                   /locus_tag="DET0066"
FT   CDS_pept        complement(61934..63169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0066"
FT                   /product="DNA methylase"
FT                   /note="identified by match to protein family HMM PF01555;
FT                   match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:DET0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39069"
FT                   /db_xref="GOA:Q3ZAD1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD1"
FT                   /protein_id="AAW39069.1"
FT                   /translation="MQIEKLKIEQLIPSDYNPRKDLKPGDNEYDKLKRSIEQFGYVEPV
FT                   IWNKATGRVVGGHQRLKVLIDMGITEVECVVVELTETKEKALNVALNKISGDWDKDKLA
FT                   LLIADLQGSDFDVSLTGFDPSELDDLFKSSIKDGLHDDNFDVDEELKQPPVTKLGDLWT
FT                   LGRHRLVCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNF
FT                   LLAAFQNTEAVMADDASIYVFHSDTEGLNFRRAFSDAGFYLSGCCIWKKQSLVLGRSPY
FT                   QWQHEPVLYGWKKSGKHQWYSGRKETTIWEFDKPKKNGDHPTMKPIPLLAYPIMNSSMT
FT                   NTLVLDPFGGSGSTLMACEQADRSCATIELDEKFCDVIVKRYIEQVGAAEKVFVQRDGL
FT                   TYSYAEVAVKSD"
FT   gene            complement(63144..64328)
FT                   /gene="metK-1"
FT                   /locus_tag="DET0067"
FT   CDS_pept        complement(63144..64328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK-1"
FT                   /locus_tag="DET0067"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P54419; match to
FT                   protein family HMM PF00438; match to protein family HMM
FT                   PF02772; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:DET0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39068"
FT                   /db_xref="GOA:Q3ZAD0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAD0"
FT                   /protein_id="AAW39068.1"
FT                   /translation="MTTYKTAESVCMGHPDKLCDLIADSILDACLRKDKSARVACEVMA
FT                   TKGKIIVAGEITCDGKVDIRWEVREVLRKVGYNPWKFTVFVFVHKQSADISAGVTTALE
FT                   ARNGSEERYASIGAGDQGTVYGYATNETREMLPLPLVLAHRICKRVDTVRKDKIVKGIL
FT                   PDGKAQVTVEYEDEKPKRVKTIVVSVQHEASKTQEQLYSDIKQNVLWQCFEDFPFDDDT
FT                   EIFVNPSGRFVEGGPAADTGLTGRKMMVDTYGGLALHGGGAFSGKDPTKVDRSGAYMAR
FT                   YIAKNIVWSGLADKCGVALSYAIGKADPVAVDIDTFGTSALSNETLREIVMSVFNLRPA
FT                   AIIEKLVLRNAIYEDTATYGHFNSCLFPWEDTSMRLYNELRKAAEAYADRKTEN"
FT   gene            complement(64901..64999)
FT                   /locus_tag="DET0068"
FT   CDS_pept        complement(64901..64999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39067"
FT                   /db_xref="GOA:Q3ZAC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC9"
FT                   /protein_id="AAW39067.1"
FT                   /translation="MGVVKSLKLFKTDSGVGLRVEKRSFKGLNSPS"
FT   gene            complement(64990..65346)
FT                   /locus_tag="DET0069"
FT   CDS_pept        complement(64990..65346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0069"
FT                   /product="HNH endonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39066"
FT                   /db_xref="GOA:Q3ZAC8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC8"
FT                   /protein_id="AAW39066.1"
FT                   /translation="MPYKPKRPCAYPGCGRLAEREQYCAEHQKVVDKQYNQYERDPKSN
FT                   KRYGRSWKRIRDRYIKLHPLCEECDKQGKLTPAEEVHHILPLSKGGSNEKSNLMALCKS
FT                   CHSRITAESGDRWG"
FT   gene            complement(65454..65888)
FT                   /locus_tag="DET0070"
FT   CDS_pept        complement(65454..65888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39065"
FT                   /db_xref="GOA:Q3ZAC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC7"
FT                   /protein_id="AAW39065.1"
FT                   /translation="MNTKTYLSQARYLDMRIKSKLQQVDSLNDLATTCTSVMTGMPRNP
FT                   SGSTSRMADAICKIVDLQNDINHDIDMLVDLKKEIMSVIKAVVNPEHQTLLEKRYLCFL
FT                   SWEKIAVDMGYDLRYIHKLHTRALDDCRIPAPNEVDTKRH"
FT   gene            complement(66131..67672)
FT                   /locus_tag="DET0071"
FT   CDS_pept        complement(66131..67672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0071"
FT                   /product="SNF2 family helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39048"
FT                   /db_xref="GOA:Q3ZAC6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC6"
FT                   /protein_id="AAW39048.1"
FT                   /translation="MTGCLTASCFYRVVTSLLLKLKLQAKSPDHFSWQGTNYYACLASR
FT                   FMSLMTSSRLEGFLMKYEPHNYQIYATRYIEEHPISAVLLDMGLGKTSITLTALNDLLF
FT                   DSFEAHRILVIAPLRVARDTWPAEADKWDHLQNLICSVAVGTEAERRAALIKPADIYII
FT                   NRENVQWLIEESKLPFNFDTLVVDELSSFKNYQAKRFRALMKVRPKVKRIIGLTGTPSA
FT                   NGLMDLWAEFRLLDMGARLGRFISHYRLDYFQPDKRNGQVIFSYKPLSGAEQRIYDKIS
FT                   DITISMKSTDLLKMPELVSSEYTVRLSDEERQRYDELKQDLVLQLPDGDITAANAAALT
FT                   GKLCQLANGAIYTDDGDTFTIHDRKLDALENIIEAASGKPILVAYWFKHDLARITERLQ
FT                   KLHIPFSKLDSADSIRKWNAGELPVALIHPASAGHGLNLQSGGSCIVWFGLTWSLELYQ
FT                   QTNARLWRQGQNAETVVVQHIVAKDTIDERILKVLSKKDSTQAALIAAVKADLQV"
FT   gene            complement(67896..70169)
FT                   /locus_tag="DET0072"
FT   CDS_pept        complement(67896..70169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0072"
FT                   /product="phage/plasmid DNA primase, putative"
FT                   /note="identified by match to protein family HMM TIGR01613"
FT                   /db_xref="EnsemblGenomes-Gn:DET0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39076"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC5"
FT                   /protein_id="AAW39076.1"
FT                   /translation="MFTLYHADFIGNPGNCSYPHMVEVIDASSLIAAVGHDYVCAEYRN
FT                   SYRNGENFIGSNCLPVDCDNDHSEQPEDWVLPADVMEAFPGVTFAVHYSRYNMREKNGK
FT                   PARPKYHVLFPIDHLTNAACYSDMKKLVNAIFPYFDTKALDAARFFFGTTSPEVEIYTG
FT                   SMNLSEFLEGEEFDTDMAGGHRSTQVIPEGSRNATMSRFAGRVIKKYGDSDAAFQCFLE
FT                   EAAKCSPPLEEAELMTIWHSAQRFFSKVQQQDGYVSPEVYNDPTSYMPGDFSDVGQAEV
FT                   LAKYFSGELRYSPATHFIRYTSHYWQESEPGAQAVAHELTRRQLEEATKDLQSAMRLLT
FT                   ENGAQDILENASKAKAESLMNETQLEAYRAFLSAKAYQSFAIRRRDSKNITATLKESRP
FT                   MLEISPRDLDADCFLLCTPAATYDLRKGMTGAREHSPDDFITKMTSVSPSSKGEQIWQN
FT                   SLGLIFCGNQELIDYVQMICGLAAIGKVYVEALIIAYGGGRNGKSTFWNAISRVLGLYS
FT                   GNISADTLTVGCRRNIKPEMAEVKGKRLLIAAEIQEGARLNDSTVKQLCSTDDVFAEKK
FT                   YKDPFSFTPCHTLVLYTNHLPKVSASDDGIWRRLVVIPFDAKIEGSSDIKNYGEYLYQN
FT                   AGESILAWVIEGAKKVIALDYKIPVPVCVQQAITEYRSQNDWFGHFLEEKCELDASYRE
FT                   SSSSLYRAYRNYCVDTNEYIRSTTDFYSALEAAGYGRINVKNKRFFAGLRLKIDDGDFE
FT                   DFLN"
FT   gene            complement(70495..70914)
FT                   /locus_tag="DET0073"
FT   CDS_pept        complement(70495..70914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:AF2353"
FT                   /db_xref="EnsemblGenomes-Gn:DET0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39075"
FT                   /db_xref="GOA:Q3ZAC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC4"
FT                   /protein_id="AAW39075.1"
FT                   /translation="MSIDKFNSEGYYDPTAYEALSAVEKEEQALRAFRPIVYICSPFSG
FT                   DVEGNVKAAQRYSRFAVDKGFIPIAPHLLFPQFLNENIPAERQLGLFFGNALMSKCTEV
FT                   WVFGSTISAGMSAEIKRAKWKNYRLRYFNENCEEV"
FT   gene            complement(70995..72935)
FT                   /locus_tag="DET0074"
FT   CDS_pept        complement(70995..72935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0074"
FT                   /product="DNA-dependent DNA polymerase, family A"
FT                   /note="identified by similarity to SP:P06225"
FT                   /db_xref="EnsemblGenomes-Gn:DET0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39074"
FT                   /db_xref="GOA:Q3ZAC3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC3"
FT                   /protein_id="AAW39074.1"
FT                   /translation="MKSLSIDIETYSSANLAKSGVYRYVESPDFEILLFGYSVDGGEVQ
FT                   VVDLTSGEKLPSDVITALTDETVIKWAFNANFERICLSRFLGLPTGKYINPASWKCSMV
FT                   WAATMGLPLSLEGVGSVLKLDKQKLTEGKDLIKYFSQPCAPTKSNGQRTRNHLYHAPDK
FT                   WSAFKKYNIRDIETEMSIQEKLTRFPVQDSIWDEYHLDQEINDRGVALDMTLVQEAIAM
FT                   DGRSRSELTTAMKHLTELDNPNSVQQMKQWLADNGMETDTLGKKIVAELLKTAPLDLAD
FT                   VLSLRQQLAKSSVRKYQAMENAVCTDGRARGMFQFFGANRTGRWAGRLIQMQNLPQNHL
FT                   EDLAEARALVRFGDFDALEMLYEDVPDTLSQLIRTAFVPKAGARLIVSDFSAIEARVIA
FT                   WMAGEEWRQDVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGA
FT                   LKAMGALDMGLEEDELPQLVDAWRQANPCIVKFWWDVDKAAMEAVRYKRTNSTHGITFS
FT                   CQSGMLFITLPSGRRLAYVKPRIGENKFGGQCITYEGVGATKKWERLDSYGPKFVENIV
FT                   QATARDILCNAMQTLQHCSIVMHVHDEIVIEADPRMSLKAVCEQMGRTPSWAKGLLLRA
FT                   DGYETDFYKKD"
FT   gene            73164..74357
FT                   /locus_tag="DET0075"
FT   CDS_pept        73164..74357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39064"
FT                   /db_xref="GOA:Q3ZAC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC2"
FT                   /protein_id="AAW39064.1"
FT                   /translation="MSLVYRPFLRQKVVIIVCCEIGLGSFKSTLTSLALCHFGDFDSRH
FT                   IPASWVDTDNALEKLMFLCKDAPLLIDDWAPGQDAGKARQLETRAERIVRAQGNRQGKG
FT                   RLRSDTSARPSYIPRGMLITSGEQLPSGHSHTARLYTVELEREDIDINNLTTAQQNTPY
FT                   YRQAMAHYLTWLSGKWDSIKKSIPDDFLALRGQVMNKGLHARLPEVIALLCLGLKYGLD
FT                   FAVECGALTLEESNEVWEEGMSAFISQATDQGSRVEEERPAKRFIEILNSLKESGSAIL
FT                   GDRNDDCIRQVGPAQTLVGWNDQQNGHVLILGQTAYKAVKDHCRRTDEPYTIKYNAVIK
FT                   DLRRMGYIDCPSQKIATHNVCIANGQKRVLKLRKVLLNERENNDENNAFSAPGPLML"
FT   gene            75226..75843
FT                   /locus_tag="DET0076"
FT   CDS_pept        75226..75843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0076"
FT                   /product="resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39063"
FT                   /db_xref="GOA:Q3ZAC1"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC1"
FT                   /protein_id="AAW39063.1"
FT                   /translation="MKVALYARVSTKDKEQNPELQLAALRKYCADNGWEIYREYTDEAS
FT                   ASDFTGRKAWTALMKEAQLKKFNVLLVWKLDRAFRSVIHAVNSMQMLNSYNVGFKSYMD
FT                   SGIDTTTPMGNFVFSIMTAAAELEQSTIRQRVNAGIAYAKENGTKSGKAIGRPRKSIDF
FT                   TKVLEAFNRVEMNYTRAARLLTEQTGVKVTPGYVYNQIKRGG"
FT   gene            76009..76266
FT                   /locus_tag="DET0077"
FT   CDS_pept        76009..76266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39062"
FT                   /db_xref="GOA:Q3ZAC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAC0"
FT                   /protein_id="AAW39062.1"
FT                   /translation="MVLAAKARKALMEFNIALDDLHDPLFAGLIEQVEKCSGPAGCDNC
FT                   PMKNKCQGLWDQAVSRINGGMKIDDFLYYYNEFKNMEGQK"
FT   gene            complement(76921..77205)
FT                   /locus_tag="DET0078"
FT   CDS_pept        complement(76921..77205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0078"
FT                   /product="trichloroethene reductive dehalogenase anchoring
FT                   protein, putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39061"
FT                   /db_xref="GOA:Q3ZAB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB9"
FT                   /protein_id="AAW39061.1"
FT                   /translation="MGGALYYFLVGMLIGGAAIWFITYTQFKNISFKWWEWSLMALSLL
FT                   LVSSIFQHMYSSMSVEMEYQSAFMYLGVFGTLAVILNLIVWRTYSGRKE"
FT   gene            complement(77229..78893)
FT                   /gene="tceA"
FT                   /locus_tag="DET0079"
FT   CDS_pept        complement(77229..78893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tceA"
FT                   /locus_tag="DET0079"
FT                   /product="trichloroethene reductive dehalogenase"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39060"
FT                   /db_xref="GOA:Q3ZAB8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB8"
FT                   /protein_id="AAW39060.1"
FT                   /translation="MSEKYHSTVTRRDFMKRLGLAGAGAGALGAAVLAENNLPHEFKDV
FT                   DDLLSAGKALEGDHANKVNNHPWWVTTRDHEDPTCNIDWSLIKRYSGWNNQGAYFLPED
FT                   YLSPTYTGRRHTIVDSKLEIELQGKKYRDSAFIKSGIDWMKENIDPDYDPGELGYGDRR
FT                   EDALIYAATNGSHNCWENPLYGRYEGSRPYLSMRTMNGINGLHEFGHADIKTTNYPKWE
FT                   GTPEENLLIMRTAARYFGASSVGAIKITDNVKKIFYAKVQPFCLGPWYTITNMAEYIEY
FT                   PVPVDNYAIPIVFEDIPADQGHYSYKRFGGDDKIAVPNALDNIFTYTIMLPEKRFKYAH
FT                   SIPMDPCSCIAYPLFTEVEARIQQFIAGLGYNSMGGGVEAWGPGSAFGNLSGLGEQSRV
FT                   SSIIEPRYGSNTKGSLRMLTDLPLAPTKPIDAGIREFCKTCGICAEHCPTQAISHEGPR
FT                   YDSPHWDCVSGYEGWHLDYHKCINCTICEAVCPFFTMSNNSWVHNLVKSTVATTPVFNG
FT                   FFKNMEGAFGYGPRYSPSRDEWWASENPIRGASVDIF"
FT   gene            79177..79710
FT                   /locus_tag="DET0080"
FT   CDS_pept        79177..79710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39059"
FT                   /db_xref="GOA:Q3ZAB7"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB7"
FT                   /protein_id="AAW39059.1"
FT                   /translation="MGNERDMDLNNIKQQEDRINTYGEEYVNLSLMSIITLIGTIAMRN
FT                   YKYTMGEYSENLTPNESSLLMEVYFREEIGIIDACRATGLSTENVLHLFSNIYNKGYLK
FT                   KVKKGKKTYYSIADNPPGDWQDVLEGYQKATDACNYFCKDLSDEKKQEIWDMLLDIRHN
FT                   VNDYHVRMSGISFL"
FT   gene            complement(79906..80883)
FT                   /locus_tag="DET0081"
FT   CDS_pept        complement(79906..80883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39058"
FT                   /db_xref="GOA:Q3ZAB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB6"
FT                   /protein_id="AAW39058.1"
FT                   /translation="MPRDKNEGKILEQVKVDHHKIAIAKAFILGIPRNNEYNPEDICKQ
FT                   FLQQQHAEQPGEVIIHPSFTETDVLVKEVAESLSFTLAFHEALNALIYSGIVMPTSSYR
FT                   TEGFHQAWTTVYQRGGGHSGGWSFDEYRYTFPNRFIFSVSSRTNDDFALMDADLYLLEA
FT                   GVAGADEEIIEAIKDSIACFKGNLYRPAVVMLGKAMEGAWLELGVSIMQYMVKLGSKSE
FT                   EDVARFKASDKPITIMSKISKIVEMYNRKELKTVRDKTGISNGALNSIMVWSDILRDSR
FT                   NAIHFSVKPTLPNTYEKVAILLIAASKYFKSMYCIKKATDEEVI"
FT   gene            complement(80934..81706)
FT                   /pseudo
FT                   /locus_tag="DET0082"
FT                   /note="ISDet1, transposase orfB, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to OMNI:CC0515"
FT   gene            complement(81781..82047)
FT                   /locus_tag="DET0083"
FT   CDS_pept        complement(81781..82047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0083"
FT                   /product="ISDet1, transposase orfA"
FT                   /note="identified by similarity to GP:2645860"
FT                   /db_xref="EnsemblGenomes-Gn:DET0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39057"
FT                   /db_xref="GOA:Q3ZAB5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB5"
FT                   /protein_id="AAW39057.1"
FT                   /translation="MKARKYTEEQIIAVMKEGEAGAKVADLCRKHGMSEATYYNWKAKY
FT                   AGMTVSDLKRLKSLEAENRRLKQLVADQALDNLALKELLSKNF"
FT   gene            82185..82475
FT                   /locus_tag="DET0084"
FT   CDS_pept        82185..82475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0084"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:P21891"
FT                   /db_xref="EnsemblGenomes-Gn:DET0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40601"
FT                   /db_xref="GOA:Q3ZAB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB4"
FT                   /protein_id="AAW40601.1"
FT                   /translation="MLLTTPIKSMASPITTPPLTTNICYRANIIDAKPGPHTFRHTAAI
FT                   NYLRNGGDEFTLQIMLGHTTLAMTRRYTSTLGTEDMMRVHKKVSPVDNLKL"
FT   gene            complement(82975..83436)
FT                   /locus_tag="DET0085"
FT   CDS_pept        complement(82975..83436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39056"
FT                   /db_xref="GOA:Q3ZAB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB3"
FT                   /protein_id="AAW39056.1"
FT                   /translation="MWDLIGWVFVGVLALSIIAGILSLDTRGRSLLGLVLIIAAIICMI
FT                   TGVANSWTPILLYFISGSAFIIYNLIKWGQLRDYYWLWCMETDEFFGPFNNDIEMKLFQ
FT                   PPHYLPGGWQIFWIPAKDPLKATKIIRKWVKDAEKVLRKDPKYKDRMPK"
FT   gene            complement(83436..83621)
FT                   /locus_tag="DET0086"
FT   CDS_pept        complement(83436..83621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0086"
FT                   /product="hipB protein, putative"
FT                   /note="identified by similarity to SP:P23873"
FT                   /db_xref="EnsemblGenomes-Gn:DET0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39055"
FT                   /db_xref="GOA:Q3ZAB2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB2"
FT                   /protein_id="AAW39055.1"
FT                   /translation="MIKALRDHRLDNFWSQAELAKQAGIGADTVNRLENGKQNPSFITI
FT                   RKLAKALNIKPEEIEF"
FT   gene            complement(83691..85808)
FT                   /locus_tag="DET0087"
FT   CDS_pept        complement(83691..85808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39054"
FT                   /db_xref="GOA:Q3ZAB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB1"
FT                   /protein_id="AAW39054.1"
FT                   /translation="MPHGNVIGKASPNVVGFLPSGTKVYGEGRVVVGQIKETPTFAIFY
FT                   NSGLSRLPNAISDARSMDEMASKAWSYVKSDKSTGEIYPVFKQYAKYIEDEALMTPGSR
FT                   AIPVLDDRGKPVVLNTVGPDGKKINVPLLQMVTPDWFEKSLEITRALAGKADTLKPRPL
FT                   SQVIGKVESLPRGMDEDFIAYMRKNPDNVLYGSTAEYTFTGGRKPGDLDIQSPTPEKTA
FT                   NDIADISRRYTANDVKVSKVSSHYTVSQLKNGLWKNIADISELGWKKADAGFKRLNAPI
FT                   NTVKVEGITMEAPSTQLYSLLNRTVVSFEKQDRFTAMVSKLGGELDLGIGAKAPTLADL
FT                   YKLKARGIYNTVRDIFVPNLQKKINYEALTKSNPELAGKIEKVFTSEADTQKALLAEIR
FT                   EKSPKLAEKLEELLDERNMSNAARLEAARQIAPDLVPEVRELLRAEQQSIAAARSAAMT
FT                   AGKDGRASALIVAGRLTKAFDTERRRLEGEIERRAKVIQRELRKLPVRMPNFGDMSKTK
FT                   ITAKTLERKLHTGGGDYTSLRSRIPPSRGERVPPPRVPTLNPPDNPPPRVDPQRIKPPD
FT                   FDYRHENRRNDSDETSSTARPKLKNGDVAWRQGALGSGDDQRPVWYIKRANGKVDIVFQ
FT                   PPEDAPRLEGTPEETFFTRGKKPPTNLTQNMGVTTAKINLKDDPEIKFVQTKAPKFKPY
FT                   IPKSVRRSIGM"
FT   gene            85832..86293
FT                   /locus_tag="DET0088"
FT   CDS_pept        85832..86293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0088"
FT                   /product="reductive dehalogenase domain protein"
FT                   /note="identified by similarity to GP:8163916"
FT                   /db_xref="EnsemblGenomes-Gn:DET0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39053"
FT                   /db_xref="GOA:Q3ZAB0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAB0"
FT                   /protein_id="AAW39053.1"
FT                   /translation="MQLVCMDMLITDMPLTPTKPIDAGINKFCYTYKICAESCPSGALS
FT                   MDTDPVYDVDPEWRPGALDVPYAHKAWHMNNYRCYFCAQCHAVCPFSTTRDASIHNFVM
FT                   GTVTTTSILNGFFANMERTMGYGLKNPDSWWDHDIPLFGISTKFTEKRG"
FT   gene            86386..87237
FT                   /locus_tag="DET0089"
FT   CDS_pept        86386..87237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0089"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39052"
FT                   /db_xref="GOA:Q3ZAA9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA9"
FT                   /protein_id="AAW39052.1"
FT                   /translation="MSLTDIPKKAGSFSEMGYKLPVPDNNPAGGIRKSSPGTNIYHISY
FT                   TPQTKEVSLFFWGCNFSCRGCLSKKGTGNYLLPENIHLFRDNPAETVQPPVHFLSVADV
FT                   LSILGGLDIQTVLFEGQEPSLDESLPQLAKLIHTEFRTQNILCSNINKLVLLDDIDCIQ
FT                   LSLKAVTDSLHLDYTGKSNRNVLNNLKYLHAAGKKLSIASVLIPGYIDKDEIELIAGFI
FT                   SDINQGLPFNILPYFKAGQNKWRCPTISEMEDSERIARKYLTHVYAWRGDEEIKYEVMK
FT                   IY"
FT   gene            87234..88049
FT                   /locus_tag="DET0090"
FT   CDS_pept        87234..88049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0090"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39051"
FT                   /db_xref="GOA:Q3ZAA8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA8"
FT                   /protein_id="AAW39051.1"
FT                   /translation="MMNTQVFHIGYCPELKEATLHYWGCNFKCRGCSCQKLIWDWMLEE
FT                   FLDARDAEPLEIADAPHRFLSISEISAALEKLELRRVLHMGQEAILDPAYPVLAEMIHR
FT                   RFGCKNVLLTNGYEMPDLRHTDKVEFGIKAITNGLHRHYTGKSNKRVLRNFKEIYNSGV
FT                   EMVIESVFIPGYIDVAETERIVDFIAGVDKKLTYVLLPYFKAGNNPWRRPTPAEMEMAA
FT                   NIARKKLTNVYFFRGDEDLQYKVISIFPEAGSNTELEISETHCGVLNPV"
FT   gene            88197..88715
FT                   /locus_tag="DET0091"
FT   CDS_pept        88197..88715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39050"
FT                   /db_xref="GOA:Q3ZAA7"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA7"
FT                   /protein_id="AAW39050.1"
FT                   /translation="MEKTLNNKLVRALLITSPLIIIALVSVGFSLNESITSLNNEDSSA
FT                   TAVISQPEPAEVITPPVQIAARVLYEEYISNQTAADIKYKGSLVVVQGVLSGICPATST
FT                   LQWVTLETDGQNAFVKCQLSGDFTFLSSINDLIGQTVTIAGICQGFSGSYLIIDEIYTN
FT                   DLPTHTDLG"
FT   gene            88814..89524
FT                   /locus_tag="DET0092"
FT   CDS_pept        88814..89524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0092"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by similarity to GP:29899002"
FT                   /db_xref="EnsemblGenomes-Gn:DET0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39049"
FT                   /db_xref="GOA:Q3ZAA6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA6"
FT                   /protein_id="AAW39049.1"
FT                   /translation="METLDCPNKIDTNLDGYIISVVIIDDHEIVRQGLMAMLRREDGLC
FT                   LVGDASDAVTGLKLIDATNPDVVLLDIQLNNSDMDGFSLAKQIKSKSPDKIVIMLTGFD
FT                   SALYLIESLRTRLDGFVLKEQSGAIIAGAIRMAYAGVGAWDTRILHRALVNRLKAHTGD
FT                   TIDNLGIKADIDLNDKERMVFNLLARGYSNKDIESTLKYTASTVKKYVYTCMKKFGVSN
FT                   RTQLALIANSTGVK"
FT   gene            89695..89820
FT                   /locus_tag="DET0093"
FT   CDS_pept        89695..89820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39047"
FT                   /db_xref="GOA:Q3ZAA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA5"
FT                   /protein_id="AAW39047.1"
FT                   /translation="MGTYSLRRAGIYVCLPGPKILIDSNLSRLADCKEFFLGFTF"
FT   gene            complement(89828..90022)
FT                   /locus_tag="DET0094"
FT   CDS_pept        complement(89828..90022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39046"
FT                   /db_xref="GOA:Q3ZAA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA4"
FT                   /protein_id="AAW39046.1"
FT                   /translation="METVVIVIIGLLVTGIIIRQVTSSAKSGGCTCCELGGKDKTCSQC
FT                   EAAKQPDSFTKKQSDGGLI"
FT   gene            complement(90038..92068)
FT                   /gene="feoB"
FT                   /locus_tag="DET0095"
FT   CDS_pept        complement(90038..92068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="DET0095"
FT                   /product="ferrous iron transport protein B"
FT                   /note="identified by similarity to SP:P33650; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00437"
FT                   /db_xref="EnsemblGenomes-Gn:DET0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39045"
FT                   /db_xref="GOA:Q3ZAA3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA3"
FT                   /protein_id="AAW39045.1"
FT                   /translation="MINSKSIVVALAGNPNCGKTTVFNNLTGARQHVGNWPGKTVEKKE
FT                   GRFSFGGREIQVVDLPGAYSLGAYSEDEIIARDFVLLEKPDIVVNVLDSTNLERNLYLS
FT                   VQMMEMGARVVLALNMYDEVSAKQIKIDTAELSKRLDIPVIPTTACRKEGMKELVTAAL
FT                   NQSGSNNREPLKIDYGREVEAELSALAQTIKTIPSLADKFIPRWLAIKILEGDQNIWKV
FT                   IGKYGQTGQLVAQRDASVKRLEDKLGEDMASLIAARRYQFISQVLTGIVVKPSSQKQSF
FT                   SDKLDRILTHRLLGIPVFFLAMFAVFQLTFALGSPLADLVDQLFGWLGGVVSTGLTAIS
FT                   APDFVTSLAVDGIIGGVGSVIVFLPNIILLFLALSLLEDSGYMARATYVMDRFMHKLGL
FT                   HGKSFMPLILGFGCNVPAIMATRTLGNRNDRLITILINPLMSCTARLPVYVLFAGAFFS
FT                   ANQGIIIFSLYLLGIILAIIMGMLFKKFLFKGESSHFVMELPPYRIPTLRSTLTNMWDR
FT                   SYTFLRKMGTIILAVVVLVWVLSNLPFGVEYASQESILGRIGSFIAPVFAPAGFGFWEA
FT                   GIALLFGILAKEVVVGTLGVVYGVEEAGLTAAIAGSWTALSAYSFMTMTLLYIPCIAAI
FT                   AAIKRETNSWKWTSFAIGYSIILGWVVAVLIYQVGRLLGLG"
FT   gene            complement(92065..92373)
FT                   /locus_tag="DET0096"
FT   CDS_pept        complement(92065..92373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0096"
FT                   /product="feoA family protein"
FT                   /note="identified by match to protein family HMM PF04023"
FT                   /db_xref="EnsemblGenomes-Gn:DET0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39044"
FT                   /db_xref="GOA:Q3ZAA2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA2"
FT                   /protein_id="AAW39044.1"
FT                   /translation="MERLPLGLVKSGLTAVIRDIHGSEHLKQELLEQGLVDGCRVKVVK
FT                   NDTGGPLIISVNDTRLALGRGVALQVLVEEADSIKKFSHELGITNLCGTALCKEVGK"
FT   gene            complement(92373..93089)
FT                   /locus_tag="DET0097"
FT   CDS_pept        complement(92373..93089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0097"
FT                   /product="iron dependent repressor, putative"
FT                   /note="identified by match to protein family HMM PF02742"
FT                   /db_xref="EnsemblGenomes-Gn:DET0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39043"
FT                   /db_xref="GOA:Q3ZAA1"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA1"
FT                   /protein_id="AAW39043.1"
FT                   /translation="MTDISAITPAMQDYLETMLSLSESVNEIRVTDIAAKLSIAKATVT
FT                   QGIEYLKKHGLVLQEKYGPVELTASGKAMAVEVRWRHRKLKQFLTEVLSVDAKIAEKDA
FT                   CLMEHVVSKHTMNRLMHFLESTDCMNCAKNVSQKHTPAINNLSRVQSNKETNPMETKPI
FT                   RALNELKVGERGRVIRIASDKALKSRVLDMGVTPGAEIKMEGHAPMGDPVEVDVKGYHL
FT                   TLRKDEAAQIYVEVGA"
FT   gene            complement(93341..93646)
FT                   /locus_tag="DET0098"
FT   CDS_pept        complement(93341..93646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01PH01780"
FT                   /db_xref="EnsemblGenomes-Gn:DET0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39042"
FT                   /db_xref="GOA:Q3ZAA0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAA0"
FT                   /protein_id="AAW39042.1"
FT                   /translation="MPEFGTPFSGLAKSQPLSNEELIRAIRFMVAAEYEAIQLYLQLAE
FT                   STTNRLAIEVLRDIANEEKVHAGEFLRLLKELAPDEESFYADGAKEVEEEIEKHKK"
FT   gene            complement(93748..94902)
FT                   /locus_tag="DET0099"
FT   CDS_pept        complement(93748..94902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0099"
FT                   /product="mobA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39041"
FT                   /db_xref="GOA:Q3ZA99"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA99"
FT                   /protein_id="AAW39041.1"
FT                   /translation="MNLIITGEVGSGKSSHCQRYARYLREYGFKTGGIICHPVFQEDTK
FT                   TGYTVTDIRTSAEAVFSLTNPPADFQGEKVGRYSILQSGLDFACNAIKEALRTGYEVIF
FT                   LDEMGHLEIAGKGLAGQARLAYRKAPYTVSVVRKSLLQKFLAAFAPEESENIFVIQDIE
FT                   ADPDIHPAFFKTPPAKTDISCIILAGGKSKRMGRDKISATLDSQTLLERAVANLNGYGR
FT                   EILVVTAYGQADAKIQPLPGIKIVRDILPEKGPLAGIYSGLKASKSQFNLVVGCDMPFL
FT                   NRALLEYMKDQVAGFEAVVPRLGQKPEPLHAIYSKSAGEKALSLLSQGKLAVSDLLARL
FT                   HTRYIEEPEINRFDPEHRSFFNINRPEDLDTARDIAANKKAVSG"
FT   gene            complement(94903..95592)
FT                   /locus_tag="DET0100"
FT   CDS_pept        complement(94903..95592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0100"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39040"
FT                   /db_xref="GOA:Q3ZA98"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA98"
FT                   /protein_id="AAW39040.1"
FT                   /translation="MSIYLNPEKNRIPALLTLAVIGSVWGLLEMALGGFLHAIHFTYQG
FT                   AVMGGLAISLMAIFMSITRKPALIPLLGVIAAAFKPFSALIFGEPVFSAYVINPAVAII
FT                   MEAVAFGAVAFIFKKAMEKHLLAQITTGFLSGALGIVLYAVIASVFGMGKWPMLDMAGK
FT                   IDTIISTGWPVALAGSITLAIGYYLGKFGMPKLANFKTSYPRAYYITSAVTVISCWVIP
FT                   AVFHLGG"
FT   gene            complement(95615..98716)
FT                   /locus_tag="DET0101"
FT   CDS_pept        complement(95615..98716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0101"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:DET0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39039"
FT                   /db_xref="GOA:Q3ZA97"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037946"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA97"
FT                   /protein_id="AAW39039.1"
FT                   /translation="MTHPRKILGDNDYSLSRPEDIIYSTCQQCATQCSIKVKLVDGVIA
FT                   KVDGNPFSPWNMMPQLDYKTPVTTSALTDASICPKGHSGAQTSYDPFRLVKVIKRDGPR
FT                   GSNKWKSIPFDQAVEEIASGGKLFSNVPGEENRNVEGLKDIWALRSPEVTKAINTDIKA
FT                   IWAEKDETKKTALVEAFKEKYRDYLDKFIDPNHPDLGLKNNGFCYMFGRTQGGRVDFIK
FT                   RFTHDAMGSINAHGHTTVCQGSLFQSAKALSAKFDSATGEFIEGDKFYWMADIGKSEFV
FT                   IFTGASPFEASFGPTSRAMRIADGLDSGRMKYAVADPRFSKAASKAWKWLPAKPGTEGA
FT                   LALALIRWIFDNNRYNAKYLANANKAAADADGEPTWSGSTWLVKIDAEGKAERFLRASD
FT                   IGLEQGSFGFDTPLIMKNGEPARFDPNDTVNAAEGELLIDTVINGLRVKSSLQILRDEA
FT                   SSHTLEEWAEICGVKADDLAETASEFTSHGKKAAADVHRGVSQHTNGFYNALAWWNLNM
FT                   LIGNYDWQGGMLKGSAYDISGSKAGGPFNLGKMKLGALTPSGINIVRYGHIYEDTTLFK
FT                   SQGYPAKRNWYPLSEDVYQEVIPSAGDAYPYPIKALFLHMGSPVYVVPAGHTALEFLSD
FT                   PEKLPLLVVTDIVVGETSMYADYIFPDLTNMERWEFAGSQNTIPFKSQPVRQPAIAPLV
FT                   EIVKVFGQDMPLSMETMLLGLAEKMGLPGFGPDGLGNGIPLNHFDDLYIRMAANLAFGE
FT                   KADGSDAVPDADEEEIRIFTQARRHLPDNIYNLERWSSLAGENWPKVVYMLNRGGRFQD
FT                   YEGGYPANQQLGNKYGRLFNVFLEKTTEVKNSQTGEPIPGHACYITAGRDCYGQELNDE
FT                   KNGYDLNLITYREIARTPTTAGNYYLNPLLPENTILINQADADRLGLTKTDIVRVVSES
FT                   NPRGVWNLRNGQEWPMNAKLNIMQGIRPGVVAFSLGYGHFAYGGLDITIDGELIPGEAK
FT                   RTKGVNANAAMRVDPHLKNTCLVDTIGGSAVFYDTKVRLEKVNT"
FT   gene            complement(98820..100001)
FT                   /locus_tag="DET0102"
FT   CDS_pept        complement(98820..100001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0102"
FT                   /product="molybdopterin oxidoreductase, membrane subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39038"
FT                   /db_xref="GOA:Q3ZA96"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA96"
FT                   /protein_id="AAW39038.1"
FT                   /translation="MNWKRIALGILILSLAAGVWGFLMLLNNGQQMLGLGSFVVWGLWM
FT                   ALYVFFASTAAGMFFIASLDLLFKVKTFTGTGKIFMLASLTSLGAGLVHILINEGRPER
FT                   VMNVFLHPNFDSVLAWSVWIYTLIALATAAILFVLFMPQKRLPFPKEPVVKWLMILGFP
FT                   VAVIASGAVGFTLSTQSSHSFWSVGLFPVLFPIFGMSAGFALSRIIVALYGDKKSPGYP
FT                   RLARTMVISTMILLLAITYIIGSVLFVGIYDATPPTIEAANYIMFGQYWYGFWIVQMGL
FT                   GIVVAMAALITILVKPGLSKKPAWGLSVGVLVLLGAAVARLNFIIPAQVVAGADFLSSP
FT                   IIDSRYIDSYIPTLPEWALSAGVTAAAILVFYMVARMMKLIPVRIGDEETGNE"
FT   gene            complement(100022..100960)
FT                   /locus_tag="DET0103"
FT   CDS_pept        complement(100022..100960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0103"
FT                   /product="molybdopterin oxidoreductase, iron-sulfur binding
FT                   subunit, putative"
FT                   /note="identified by similarity to SP:P32708"
FT                   /db_xref="EnsemblGenomes-Gn:DET0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39037"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA95"
FT                   /protein_id="AAW39037.1"
FT                   /translation="MTDKRKQGNSQSTPPPTRRDFIKSSGGVLGLAAIIKLDEGTQNFK
FT                   AAVAPPSAASFPPEETTFLPSPVKEDPLIRMQEDLRRAMQKPAAERHWAMVINLRKCVG
FT                   CHACTEACISENKLPPGVIYRFVMDEEMGQYPNVSRRFTPRPCMHCDNPPCTKVCPVGA
FT                   TFKQPDGIVVIDYHRCIGCRFCIVACPYVARTMDYGDNYLEDEPEDSGLVLGYEQGGVW
FT                   QSAPSFEYGYQHSRTPKRDSPIGNARKCHFCLHRLEKGMLPACVTTCIGRVNYFGDAND
FT                   PDSLVSELIANPGIIQLKSELGTDPSVYYLF"
FT   gene            101430..102416
FT                   /locus_tag="DET0104"
FT   CDS_pept        101430..102416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAW39036"
FT                   /db_xref="GOA:Q3ZA94"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA94"
FT                   /protein_id="AAW39036.1"
FT                   /translation="MSTEAEIREILGKVKVAAAGTTLAELNLLREVTVQPDKIAVKVAS
FT                   AGLSEDSRQILRQEIELALKPVLKKQTLEIEYITVPLKDLNRVKKVVAVMSGKGGVGKS
FT                   LITGLCAVALNRQGYRVGILDADITGSSIPKMFGANQKIIGNEEAILPVQSRGGISLVS
FT                   TSLLLTNQDDAVIWRGPLISKMINQFWDDVLWGELDYMVVDLPPGTSDAALTVLQALPI
FT                   SGILVVFTPQGLVEMVARKAVSMAKKMEKPIIGLVENMAYLKVPELDKKIEVFGAGHGE
FT                   ELAKSIGVPFIGQMPLDPALAALCDNGNIEKYQHPLLDELEKAISRS"
FT   gene            complement(103037..103876)
FT                   /locus_tag="DET0105"
FT   CDS_pept        complement(103037..103876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0105"
FT                   /product="degV family protein"
FT                   /note="identified by similarity to GP:28202560; match to
FT                   protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:DET0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40594"
FT                   /db_xref="GOA:Q3ZA93"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA93"
FT                   /protein_id="AAW40594.1"
FT                   /translation="MTIKIVTDSTADLPADLVKNLGITVVPLYVHFGTEVFRDGVDINK
FT                   ETFFHRLIHGGIHPKTSQPSPEDFANVYRELAKDNTTGIVSIHISSKFSGTYQSAIEGA
FT                   KLSGVSCPIEVIDSRLLSMGMGLIIKAAAVASRSGKKLGEIVEDCKNSIPKIKLMGFFD
FT                   TLRYVQVGGRLGKAKILMGSLLGVKPVLTVADGEYQPCGRVRNTAKGLERLVEFAKTGK
FT                   NIADFSVIHSTTPETAHKLADMLSDIFPKDQTILAQLGAVLGTHGGPGTLWVAYRES"
FT   gene            104074..105375
FT                   /locus_tag="DET0106"
FT   CDS_pept        104074..105375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0106"
FT                   /product="lemA family domain protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:DET0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40585"
FT                   /db_xref="GOA:Q3ZA92"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA92"
FT                   /protein_id="AAW40585.1"
FT                   /translation="MEFQIWGYLVFALSLVALVLAFRVMRRKRLVDDIPTSRTQEVFIG
FT                   LVELKGRAESENPFTGFLSAKKCVYYHYKVEEHWSRLVTETYTDAKGHVGVRTRQESGW
FT                   TQVASGKEMQPFYLKDETGIILIQPEGADIQPQTLFDQTCGRSDPLYYAKGPQGSIANS
FT                   DHRRRFTEEAIPLHAELYIMGQSRERGDIVAPEIAKDKSAPMYVISTRTEKQISRSYSG
FT                   WFWFWIILGLLVSLGSGLLLSQQGAEGFNPGWGAVWWLGFYLFGWLLGWLWAGYNSLVG
FT                   LRNRVCQGYAQVDIQLKRRFDLIPNLAKSVAGFSKHEHELQEMLAEVRTISKVNGQDTT
FT                   DIRSASAILVFNMEKYPELKADTLFLKLQEELAATESRIALARDYYNSIATFYNTRREI
FT                   FPDRLLAGIFGFKERVLINASDLERTAPEVKLAE"
FT   gene            105422..105559
FT                   /locus_tag="DET0107"
FT   CDS_pept        105422..105559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40584"
FT                   /db_xref="GOA:Q3ZA91"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA91"
FT                   /protein_id="AAW40584.1"
FT                   /translation="MRYGRHEEIFSGKAGCSGIFVAGNGFYPGGESVSAIQFRYDLDTG
FT                   "
FT   gene            105582..107357
FT                   /locus_tag="DET0108"
FT   CDS_pept        105582..107357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0108"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:DET0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40583"
FT                   /db_xref="GOA:Q3ZA90"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA90"
FT                   /protein_id="AAW40583.1"
FT                   /translation="MLGLIALVIFGLSFLAKPLRGLLCSYKAIIFSAGGVAILSLLAQI
FT                   GFAEPLINFICSALGLSLFAVFLAVYLDSARVRGASSVGHFGAGVVFGLLLNAALSAGF
FT                   GTYDLVNQPSVFPLLISAVIAAFILFLLSVHMPLAEGPAASNNGLGWLVIGPFLFLELV
FT                   VFGNIARLSALSGFSSPVASLFVLGALSLGLVGILWVFSLNQRHIRLLSMIASLFLILS
FT                   LTGISGGVAAISLAQHFLGQLALILLFGVILRYIGGRMAEGQPESLNLPNGLGMILFVV
FT                   LLLGYYAVYQVAVPYDNTVLELVAGLMVVVLGLYSGRECLPLLDFKGERFILPTMSILL
FT                   LTLPLLGLLTYKTPPAAPQFSGTLRIMTYNLHNGFNTQGKLDLEALARVIEDSGADVVA
FT                   LQEISRGWVISGRVDMLEWLAQRLNMHFAFGATAGEYWGNAILSKYPILDTHNVSLESE
FT                   GLPIKRGYLNAVLDLGVRYLYLAATHLHHVPEEGEVRVIQAEELADFWHHAPSTVIMGD
FT                   FNAEPDSAEIAILRQAGFSDSLEGQTSVLTYHAADLYQRIDYIWASPDIEYLDSYTVFS
FT                   LASDHLAIIADIRLS"
FT   gene            complement(107426..107908)
FT                   /locus_tag="DET0109"
FT   CDS_pept        complement(107426..107908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0109"
FT                   /product="hydrogenase maturation protease"
FT                   /note="identified by similarity to SP:P37182; match to
FT                   protein family HMM TIGR00072"
FT                   /db_xref="EnsemblGenomes-Gn:DET0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40582"
FT                   /db_xref="GOA:Q3ZA89"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA89"
FT                   /protein_id="AAW40582.1"
FT                   /translation="MFFNPGSESPKPILVLGTGNILLSDEGAGVRCIERLSRFPVPEDV
FT                   ELYDGGTAAMDLLDVISGREKIFILDAVHGGDEPGMIYRFRPEDIKTEQKIDISFHQMG
FT                   LMEILNLAKYHDALPKDIIIYGIQPGSMAPGFELTPAVDKAVNRVVEMMKAELDIK"
FT   gene            complement(107911..109491)
FT                   /locus_tag="DET0110"
FT   CDS_pept        complement(107911..109491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0110"
FT                   /product="[Ni/Fe] hydrogenase, group 1, large subunit,
FT                   putative"
FT                   /note="identified by similarity to SP:P21852"
FT                   /db_xref="EnsemblGenomes-Gn:DET0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40581"
FT                   /db_xref="GOA:Q3ZA88"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA88"
FT                   /protein_id="AAW40581.1"
FT                   /translation="MQKIVIDPITRIEGHLKIEATVDGGEVKDAKCVGTLFRGFEIFMK
FT                   DRDPRDAVHITQRICGVCPTSHGTTAALNLDSAFGVADKIPNNGRILRNLIQGANYIAS
FT                   HIVHFYHLAALDYVDVTEVADYDGTDPELLKVKDFIARALAAGDMSMLAPFYPRYEGDY
FT                   RLPKKVAQAAVAHYVEGLNMRRLAHEMSAIYSGRLPHSVAVVAGGVTSHPSIDSISNFM
FT                   SKLNTLRNFIDNVYIPDVIAVAESYPDYFGIGVGCGNLLSYGVFDLEASGTNLATRQRL
FT                   FTQGVVSASDLAHRTFDPSKITESIKYSWFKGDTTEYPLNEVTEPEFTKADGYSWLKAP
FT                   RYDGTPYEVGPLARMVVNYVSGDPLVQQMVNDTLSHFGAGPAALFSTLGRHAARALECK
FT                   IVADEMVKWLMELKIGEPVIADYEIPETAEGMGLWEAPRGALGHWIKIENHKISNYQCV
FT                   VPTTWNCSPKDNQGVYGPVEQALIGTKVRDNDNPFELVRIVRSFDPCLACAVHLVSPTG
FT                   NEISRFRVY"
FT   gene            complement(109522..110586)
FT                   /locus_tag="DET0111"
FT   CDS_pept        complement(109522..110586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0111"
FT                   /product="[Ni/Fe] hydrogenase, group 1, small subunit,
FT                   putative"
FT                   /note="identified by similarity to SP:P12943; match to
FT                   protein family HMM PF01058; match to protein family HMM
FT                   TIGR00391; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40580"
FT                   /db_xref="GOA:Q3ZA87"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA87"
FT                   /protein_id="AAW40580.1"
FT                   /translation="MFNTKLTRRDFVQLAAGSTAALSLGALKLPEFEKMFAEALKEIPV
FT                   IWLQGAGCNGCTISTINVVSPTIQDLLLTSVVPGTHVSMQYHPTIMAAQGDLAMSTITD
FT                   TVAKGPFVLVLEGSVPLKDNGIYAEVGEENGEGITILEHVLNLAPKALAIVAAGTCAAF
FT                   GGITAAAPNPTGAKALEEILKDHNITTPVVNLPGCPPHPDWVVGTLATILMSGLDALDL
FT                   DKMGRPKAYYGKLLHDQCPRRGHYEKGLFATKLSEPYCLFLVGCKGPVTYADCSDRLWN
FT                   NKTRWCVEADSPCIGCAHPGFPDAVSPMFEAPPVINSTDKLAIGIAGTAVVLTAGVAAV
FT                   ELAKKAKRNAAKKG"
FT   gene            complement(110640..111443)
FT                   /locus_tag="DET0112"
FT   CDS_pept        complement(110640..111443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0112"
FT                   /product="[Ni/Fe] hydrogenase, iron-sulfur cluster-binding
FT                   subunit, putative"
FT                   /note="identified by similarity to SP:P33389"
FT                   /db_xref="EnsemblGenomes-Gn:DET0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40579"
FT                   /db_xref="GOA:Q3ZA86"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA86"
FT                   /protein_id="AAW40579.1"
FT                   /translation="MPNGMLIDTTRCTGCRGCQVACKQWNENPAVKTTFSPEVTNPLEQ
FT                   NAFNYNLLECREIEEDGKLNWIFAHKRCLHCYEPACVSVCPVGALHKRPTGAVVWDQDK
FT                   CFGCRYCQNACPFQIPKFEWDDNWAKITKCTMCWNRVENGVEPACAATCPTGAIKFGER
FT                   ADLLAEAYERLANDPDRYYPYVYGEKEAGGTHVLYLSSVEPEKIGFDMHENEFFPSFTR
FT                   EFLGNIPLEISIVASLMVGIWYFRGRRIQAQAHDAEHAENKAGKH"
FT   gene            111908..112024
FT                   /locus_tag="DET0113"
FT   CDS_pept        111908..112024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40570"
FT                   /db_xref="GOA:Q3ZA85"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA85"
FT                   /protein_id="AAW40570.1"
FT                   /translation="MSYAAGRKYKDELTTKMKVSGQVRGNLRDKREGTPLVR"
FT   gene            complement(112188..113261)
FT                   /locus_tag="DET0114"
FT   CDS_pept        complement(112188..113261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0114"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /note="identified by similarity to SP:P46904"
FT                   /db_xref="EnsemblGenomes-Gn:DET0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40569"
FT                   /db_xref="GOA:Q3ZA84"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA84"
FT                   /protein_id="AAW40569.1"
FT                   /translation="MSIKHIITLFNREVIHGPKDVTFIMVVVTPILISLFISLAFGNIF
FT                   SEKPKLGLTDLGSSQLVSLLKENSTLLIKEYPDEATLKEAATSGAVDMGLVLPADFDTA
FT                   LIQTNTLKASAYVWGESLAKNRMIIPAVLADTARQITGAEVPVEINSISLGDEQNVPWS
FT                   DRLFPFVVLMAMFFSGLMLPASSLIDEKQKRTLEAVNITPATLGEIFTAKGAIGTLLGL
FT                   IMGLIILGMNSAFGNAPLPLVLMLILGSLMASLLGLLAGAFIKDMNTLFAVWKFGGLLL
FT                   FGPAFIYLFPQIPQWIGYFFPTYYILKPVVDLSIYDAGWSDIALNAGITVILVAILLAV
FT                   VSNVVKRMSNSALRLYT"
FT   gene            complement(113258..114316)
FT                   /locus_tag="DET0115"
FT   CDS_pept        complement(113258..114316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0115"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="identified by similarity to SP:P75774; similarity to
FT                   OMNI:NTL01BMA0802"
FT                   /db_xref="EnsemblGenomes-Gn:DET0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40568"
FT                   /db_xref="GOA:Q3ZA83"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA83"
FT                   /protein_id="AAW40568.1"
FT                   /translation="MNFRIIKALLRKDFSLFLQNRFYMLMTIVGLVFYIIIFFIMPNKV
FT                   DEQLKAGIYAPVMPPAFSVLVADPANSLSNYDSLEDAKTAVENGDTQAVIALPEDIMQV
FT                   WASGGKPEIDIYYSSSAPLELRDAIISLVKELSYIQTGQSITFDTNEQVMGQDMLGEQI
FT                   PMRNRMVPLLAIFILMMEILSLASLIAEENEQGTARALLVTPMSVPELFAAKGIIGVGM
FT                   ALGQVVLFMLLVGGFSSQPLITLSVLILGSLMVTGLGFLLASLTKSLMSVTAWGMLLFI
FT                   ILAIPGMGIMFPGLISSWAKVIPSYYLTDTVNRVVNYGADLSVVGGNLLILLGFTAVIV
FT                   AAGIVVLRRRYQ"
FT   gene            complement(114313..115179)
FT                   /pseudo
FT                   /locus_tag="DET0116"
FT                   /note="ABC transporter, ATP-binding protein, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error; identified by
FT                   similarity to OMNI:NTL01PF0577"
FT   gene            complement(115191..115763)
FT                   /locus_tag="DET0117"
FT   CDS_pept        complement(115191..115763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0117"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to GB:AAN59033.1"
FT                   /db_xref="EnsemblGenomes-Gn:DET0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40567"
FT                   /db_xref="GOA:Q3ZA82"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA82"
FT                   /protein_id="AAW40567.1"
FT                   /translation="MNSHDAGKVSMEDIARKARVSPTTIYNNFGGRKALVQGVVKKIID
FT                   DNIAQAKSIMAGSLPFPDKIQLILSNKNDMAGKMPEEILKKLVYMDDDVAALIQEIYQK
FT                   EIQPMWQKLIADGKAEGYVDPSISEETAFIYLKIMRDGFNANAALFEPSKDKINLMMGL
FT                   SRIMMYGFFKNDACPIPTRQNIQAKTG"
FT   gene            complement(116009..116551)
FT                   /locus_tag="DET0118"
FT   CDS_pept        complement(116009..116551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0118"
FT                   /product="DJ-1 family protein"
FT                   /note="identified by match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:DET0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40566"
FT                   /db_xref="GOA:Q3ZA81"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA81"
FT                   /protein_id="AAW40566.1"
FT                   /translation="MSRFAVLLAEGFEEIEFCTITDILRRADLEVKIVGLKNGLTGGSR
FT                   GIRIMPDLGIDELKSSDYEVLVLPGGNPGFINMGKDQRVLELIRSAHAEGKYLAAICAG
FT                   PAVLSRAGVINGKEVAIYPGVKHLLKGCTACDLRVKVEGKLITGRSPQAAMDFALTLMD
FT                   MFAKPQAAKVVRDEMLV"
FT   gene            116845..118599
FT                   /gene="oadA"
FT                   /locus_tag="DET0119"
FT   CDS_pept        116845..118599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="DET0119"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by similarity to SP:Q03030; match to
FT                   protein family HMM PF02436; match to protein family HMM
FT                   TIGR01108"
FT                   /db_xref="EnsemblGenomes-Gn:DET0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40565"
FT                   /db_xref="GOA:Q3ZA80"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA80"
FT                   /protein_id="AAW40565.1"
FT                   /translation="MGIKITDTTLRDAHQSLIATRMRTRDMIDIAAKLDKVGFYSLEVW
FT                   GGATFDSCIRFLNEDPWERLRLIRQKAPNTPLQMLLRGQNLVGYCHYADDVVREFVRLS
FT                   VKNGIDIFRVFDALNDTRNMEVSVQAAKELKAHVQGTICYTTSPIHTVENLAEMAVELE
FT                   KMGCDSICIKDMAGLITPTAAAQLVKSIKAKVKLPVDLHSHCTSGMAPLAYYAAAEAGV
FT                   DIIDTAFSAFAWGTSQPTTESFVAAFQGTKLDTGLNLELMSEIGEEFNKISSTYRCLYT
FT                   CEATQPSIGVLLHQIPGGMISNLVSQLRQQNAFDKLPQVLAEVPKVRADLGYPPLVTPS
FT                   SQIVGTQAILNVLSGARYKQVTKETKNYLLGYYGKIPGAVNEEIRKAIIGDEKPISVRP
FT                   GALLEPELPKMKAEGEKLGILKTEEDLLTYAMYPEVAAKFLKGECKEECLLPSTPEAAK
FT                   VEAKTEAKSAPVFNGSAEYSVEVDGEVFTVKVSAKAGAVGEAPKAAKPTASHPGAVVSP
FT                   MQGMLLSLKVKEGDKVSEGEVVATIEAMKMENDVTAAVSGVVSEIYAYEGEVVGSKDVI
FT                   MVIEPDAK"
FT   gene            118589..120085
FT                   /gene="accC"
FT                   /locus_tag="DET0120"
FT   CDS_pept        118589..120085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="DET0120"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by similarity to SP:P49787; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF02785; match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:DET0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40557"
FT                   /db_xref="GOA:Q3ZA79"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA79"
FT                   /protein_id="AAW40557.1"
FT                   /translation="MLNKILVANRGEIAIRIMRACRELGIKTVAVYSDADKGALFVKYA
FT                   DEAYHIGPSQLSESYLNIKKIVSAAKKAGVDGVHPGYGFLSENPGFALALEKAGIKFIG
FT                   PSSRVIELMGNKIAARREMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPSGGG
FT                   GGIGMRVANGPDELKDAIESSQKVAGNTFGLAEVYIEKYISNPRHIEIQIMGDSQGNVV
FT                   YLGERECSIQRRYQKLIEEAPSPVITPELRKKMGEVAIKAGKWVNYEGAGTIEFIFSNG
FT                   QFYFLEANTRVQVEHPVTEMVTGIDIVKEQIMVASGDELSFKQEDVQMRGWAIECRINA
FT                   EDPLNEFAPSAAKLKGYRSPGGIGVRVDSGVHTRYNIPYLYDPMISKLIVWGRTREEAI
FT                   ARMRRALYEYIIVGVKTNIPFHKAVLVNPNFVAGNLHTHFIEKETTLLDEMKRIMSEEQ
FT                   PLEEKLSEIFDDTRRIAAIAAVAALTQLPAEIDEDEITGV"
FT   gene            complement(120082..120369)
FT                   /locus_tag="DET0121"
FT   CDS_pept        complement(120082..120369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01MT01686"
FT                   /db_xref="EnsemblGenomes-Gn:DET0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40556"
FT                   /db_xref="GOA:Q3ZA78"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA78"
FT                   /protein_id="AAW40556.1"
FT                   /translation="MKQLTDDEIYRIAQKRVKEKKDFYNHLSVYIVINLMLIGIWAFTG
FT                   SSYPWFIFPLGGWGIGLIFHFLSVFGFMRDESDWENKEIQKEIGRLKKNL"
FT   gene            120397..120492
FT                   /locus_tag="DET0122"
FT   CDS_pept        120397..120492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40555"
FT                   /db_xref="GOA:Q3ZA77"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA77"
FT                   /protein_id="AAW40555.1"
FT                   /translation="MLYFTGVIKPLELNPGTKKLPGFKAGSLQML"
FT   gene            complement(120504..122435)
FT                   /locus_tag="DET0123"
FT   CDS_pept        complement(120504..122435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0123"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40554"
FT                   /db_xref="GOA:Q3ZA76"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA76"
FT                   /protein_id="AAW40554.1"
FT                   /translation="MGGRIEQFGSQVSLQIDNVLYVASIISGTRSFKYRLKYFVEETYM
FT                   AKTKAPADKMEPAEEIKQDGKVVSTKRTAGSEFFWTQSRCTGCNRCASICPVDAIKLDR
FT                   DKTPTKRVGTAPCTRACPAGLDIPRYVRFVAEGNAPAATAVMREKIPFPSVCGYVCFHP
FT                   CELECQRQKFDEPIAIRALKRYAAENDDGSWKNNLKIAPSTGKKVAIIGSGPAGLTSAY
FT                   FLTLLGHEATIFESMEYAGGKMFYSIPEHQLPKDILNKEIKAITDLGVTIHTSCQVQSV
FT                   QTLLKQGYDSVLLSTGVLGLDEGLLLPCDETVESDLMQGSDFLKNIKSSTKESLGDKVV
FT                   IIGGGSEAYNSAFAAKSLGVSEVHLVCSRHAGSKEASPEEVDRAIDAGVTVHPSLDFAK
FT                   LVRLDGKIEGVELFRIRSYGYDKENKLHYEIINDTRRFIAADTVITTVTPNEKPGADYL
FT                   SVVQPGVFAAGDGISGARSVIEAMAAGRSVAGLIDKYLGGEGNLDETLAPPEKNIKPLN
FT                   EPKGQNRSQVELSLVKQAGGDKVEIEKTLSPEAAKKEAQRCLRCDIVHQVHDYSLDTSS
FT                   CTYCGRCVDACYWDAITSGYGYEAAAKKRKAEITALEEKNGVYNYAIRILPVAIGLMII
FT                   AAAVAKLF"
FT   gene            complement(122655..122798)
FT                   /locus_tag="DET0124"
FT   CDS_pept        complement(122655..122798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40553"
FT                   /db_xref="GOA:Q3ZA75"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA75"
FT                   /protein_id="AAW40553.1"
FT                   /translation="MRIKKNKTPNLSAQGFTISHGHFPRNSIPADILAYGSTYSPGLPA
FT                   SF"
FT   gene            122839..123864
FT                   /locus_tag="DET0125"
FT   CDS_pept        122839..123864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0125"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by similarity to SP:P39400"
FT                   /db_xref="EnsemblGenomes-Gn:DET0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40552"
FT                   /db_xref="GOA:Q3ZA74"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA74"
FT                   /protein_id="AAW40552.1"
FT                   /translation="MKAVLLEEPAKLSLAEVDTPSCPKGGVLLEVACCAICGTDVKMFR
FT                   RGHRDLKYPRILGHEIAAVVACSEHPDFKAGDRVQVYPGIACGVCPLCLQGRENLCGQV
FT                   KIIGFNYDGGLAEYMALPPESLPGGLNIIPENVSDEEASLAEPLASCIHSQSVSRVGDG
FT                   DRVLVLGAGPLGLLQAMLARHNGAEKVLMAEVLPDRVCGAELACPDGVIDLAKTSLRQG
FT                   VFEQTGGAGVDVILIASSGVEVGELPSVLSPGGRINFFSGLPKDRSEFSLDANTIHYRE
FT                   LALSGSYGSTPADNTRALSLITDGIIPVKRLISRVTGISDIEEAFLGVEKLKGLKTIIK
FT                   F"
FT   gene            123885..125009
FT                   /gene="trpD-1"
FT                   /locus_tag="DET0126"
FT   CDS_pept        123885..125009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD-1"
FT                   /locus_tag="DET0126"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by similarity to SP:P22096; match to
FT                   protein family HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:DET0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40551"
FT                   /db_xref="GOA:Q3ZA73"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA73"
FT                   /protein_id="AAW40551.1"
FT                   /translation="MDENRVKNFGAVISRLISKENLNREEVKDCFCQIMRNEQPDLQQG
FT                   AFMAALTAKGETAPEIAGVWEAIYEQDTVRVKPLVNKPLVDNCGTGMDSLKTFNISTAA
FT                   SIVAAAGGVVLAKHGARALSGSLGTIDMLESLGVDVETDVETVRRSIETAGIGIFNGMS
FT                   AKVHPQALFRILSQIRFGTTLNIAGSLANPALPRYAVRGVYSAELLQPVAEVMREIGYK
FT                   KALVIYGSAPGGRGMDELSVLGESRIAELGEDGQIINYSLSPADFGLKPGRTEDILTSG
FT                   DKQRETLRLLRILSGGENGAAFNAVCLNAAPVFYIAGEADSLQQGYAKAAEIIRSGAAI
FT                   AKLRQWVQTQNSNPQAGLARLDSLLAELDGTKVS"
FT   gene            complement(125140..128325)
FT                   /locus_tag="DET0127"
FT   CDS_pept        complement(125140..128325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0127"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40550"
FT                   /db_xref="GOA:Q3ZA72"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA72"
FT                   /protein_id="AAW40550.1"
FT                   /translation="MKNQQSPPLFKDKYFTYVTGLSVLVIILGLYSVLSPQDFVQNANW
FT                   KLFATMVEASTTIIIIAIATWRWGLKVSIIWVSSILIPGMLLMVGMDLFEPVIFFVMLL
FT                   TLGAGSLVGLIINNHRRVISHEEELNQILSMIRDINHHITHIDNEEELMERVCERLVYA
FT                   GRYQVAWIGYATPDQQTVEPRYHAASGQPSQLPAGECPAPHCLYLPGEPIQQAIKSRSL
FT                   IVVPDIQTCPGDDICCQHCCSLLCSPIDFGDELLGVLCVYSNNPDVFGREEISLLREVS
FT                   QDISLGVEKIRHRQELARTEIRLKEERDKAQLYLDIAGVIIVVLSENEIVLQINKRGCE
FT                   ILGYEYQEIVGRNWFESFVPGYRRLIKHSMYKQIISGKADLPERYMDVVLTKDGQEKVI
FT                   LWHSTAIRSQDGKLNSILYSGEDVTELKHIEEALRMSEEKYHTLFETMAQGAIYIDDKG
FT                   IIIETNPAANTIFGRHESELLGTNIADPVWTYVQENGSIMPPEENPVITALKTGKAVRN
FT                   VFMGIKNNLSGEVRWVNLFALPLFRLNQENSYMVYTTFTDISRLKNARDALTRSENRYR
FT                   SIFETAASIIISFDQNGIINDCNMRVQEILGYTPAELVGMSFLEIVEEPFRHEVRRHIA
FT                   SLNRGEIIYNKDCRMLHKDGKYRDVMVNCSTLLDENGSVTNAICIISDITEQKQTHNAL
FT                   IASEEKIRGMFNGVNEGIIVMDTQGYITEVNQTILKMNNYTSKDQMIGRHGLEFIAPKD
FT                   REEARAYLAQADSLNEVRNLELLCVRPDGTEYFCQISGAVLRDYSGEIQGIIILSADIT
FT                   EHKKLEQQLIMTDRMASVGELASGLAHEINNPLTGIVGFSELLLMNELEESIKEDVQTI
FT                   HREALRAAEVVRNLLTFARQQTPTREAGDINLSIQKVLELRKHDHRINNIRCITELDPD
FT                   LPRVMLDVFQIQQVLINIIINAEFFLRLKEHPQITIKTSRRKGYAVISISDNGPGISPE
FT                   NIKRIFDPFFTTKEVGKGTGLGLSICHGIIEEHHGRISAESTPGNGATFRIELPFADIK
FT                   PASTADSISPSTG"
FT   gene            complement(128406..129797)
FT                   /gene="cobB"
FT                   /locus_tag="DET0128"
FT   CDS_pept        complement(128406..129797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="DET0128"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="identified by similarity to SP:P29946; match to
FT                   protein family HMM TIGR00379"
FT                   /db_xref="EnsemblGenomes-Gn:DET0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40541"
FT                   /db_xref="GOA:Q3ZA71"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZA71"
FT                   /protein_id="AAW40541.1"
FT                   /translation="MNFPRIVIAGISSSSGKTTISSGITAALTKRGHKVAAYKCGPDYI
FT                   DPGYLTLAADNPCHNLDSWMLGKDAMTEVFFHGLKNREIALVEGVMGLYDGYSGERPGG
FT                   STAEIARLLSAPVILLLNISHMAESAAAIVLGYKNLDPRINIAGVILNQAGSLRHYEIC
FT                   RKAIEKYTSTPVVGYLLRNKELAIPERHLGLKTTSEGGELASFIQNLAAHIESTIDIDR
FT                   ILNIARNAPPLPERPCPYLFPETPARPVTRIAIARDEAFSFYYQANLDMLSDWGAELCY
FT                   FSPVHDTCLPENIGGIYIGGGFPEIMAAELSANQAMKTALTKAAEDGMPIYAECGGLMY
FT                   LSEAIEDFDNNKYLMLGLLPGVSVMQKKLHRLGYTRAAVQNDNILSGKGTELRGHIFHW
FT                   SKLPSPKTKPAYTLLEPAEYAGQNEGFIIGNSTNVLASYLHLHFGTNPDLAKNFIRVSK
FT                   GFYAI"
FT   gene            complement(129837..130253)
FT                   /locus_tag="DET0129"
FT   CDS_pept        complement(129837..130253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0129"
FT                   /product="conserved hypothetical protein TIGR00149"
FT                   /note="identified by similarity to OMNI:TM1872; match to
FT                   protein family HMM PF01894"
FT                   /db_xref="EnsemblGenomes-Gn:DET0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40540"
FT                   /db_xref="GOA:Q3ZA70"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA70"
FT                   /protein_id="AAW40540.1"
FT                   /translation="MPDSLPLYRLEIPSRSQTEFIDITSRISSLITQSGVTSGLCQVFV
FT                   PHTTAGLTINENADPDVITDIKAQLERIVPAVTPFLHSEGNSAAHVKTSLMGSSLNLII
FT                   EEGRLLLGTWQGIYLAEFDGPRRRTVYIKVLKEN"
FT   gene            complement(130246..130617)
FT                   /locus_tag="DET0130"
FT   CDS_pept        complement(130246..130617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0130"
FT                   /product="response regulator"
FT                   /note="identified by similarity to SP:P13792"
FT                   /db_xref="EnsemblGenomes-Gn:DET0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40539"
FT                   /db_xref="GOA:Q3ZA69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA69"
FT                   /protein_id="AAW40539.1"
FT                   /translation="MPKMKILIADDEEHVRQLVCGILDKDYQIVQAKNGEEAVKESREQ
FT                   DFDLILMDIMMPKLDGLAACCMLKGDKQTSAIPIVMLTGVGYELNKKLSQQLGADGYIT
FT                   KPFSPRELRTKINEFIKRA"
FT   gene            complement(130704..131096)
FT                   /locus_tag="DET0131"
FT   CDS_pept        complement(130704..131096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0131"
FT                   /product="response regulator"
FT                   /note="identified by similarity to SP:Q00934"
FT                   /db_xref="EnsemblGenomes-Gn:DET0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40538"
FT                   /db_xref="GOA:Q3ZA68"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA68"
FT                   /protein_id="AAW40538.1"
FT                   /translation="MTDKKYRVLVVEDKPSICQVCLRTLESMGLDVTIAINGQIGQSLI
FT                   QQEKFDLCLVDIRTPIINGKNLYTYALNYYPETAKRMVFTTGDLMDESTQGFLDATGQP
FT                   FLPKPFTPSDLKKIVSETLEKLKAQN"
FT   gene            complement(131241..131813)
FT                   /locus_tag="DET0132"
FT   CDS_pept        complement(131241..131813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0132"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40537"
FT                   /db_xref="GOA:Q3ZA67"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA67"
FT                   /protein_id="AAW40537.1"
FT                   /translation="MRYSNYRNQPDIILLIIITCVVVFFGVNFAPQIGPYLALQPATAL
FT                   SHPWTILTSLFVHANLWHLFANMLTLYFFGNALLQMVSQRSWLIIFFGGGLAGSLLFIL
FT                   LNAGSYGYVIGASGAVFALGGALAVLRPNSKVMVFPLPIPIPLWIAVLGSFAILSFLPS
FT                   VAWQGHLGGLLVGLACGYLIQRGKFRF"
FT   gene            complement(132044..132256)
FT                   /locus_tag="DET0133"
FT   CDS_pept        complement(132044..132256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0133"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:TM1786"
FT                   /db_xref="EnsemblGenomes-Gn:DET0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40536"
FT                   /db_xref="GOA:Q3ZA66"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA66"
FT                   /protein_id="AAW40536.1"
FT                   /translation="MQIPEARCTRCGGHYHGWALLNARHQTCAQCGGKLEIITEGEIIQ
FT                   GYSPFSAEEVNLKAPKQTPSKKTTS"
FT   gene            complement(132330..132749)
FT                   /locus_tag="DET0134"
FT   CDS_pept        complement(132330..132749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40535"
FT                   /db_xref="GOA:Q3ZA65"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA65"
FT                   /protein_id="AAW40535.1"
FT                   /translation="MKIPGNIFKREHGFTLIEILVVVAILGVLAGVVIPNVVKFMHEGK
FT                   VESANTELANVRLAVLSAMVDAEINTLNDGGTVGSGHTSNVSYGSPSVSLAVHNFVMGE
FT                   VIGIYTLNEKGLIVSALMPEGSDWANLTFVNGAWQ"
FT   gene            132882..133574
FT                   /locus_tag="DET0135"
FT   CDS_pept        132882..133574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0135"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to GB:BAA02453.1"
FT                   /db_xref="EnsemblGenomes-Gn:DET0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40534"
FT                   /db_xref="GOA:Q3ZA64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA64"
FT                   /protein_id="AAW40534.1"
FT                   /translation="MPEHKILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALGMYRR
FT                   FKPSLVILDVMLPGMDGFELCRLIRAESSVPILMLTARSSETDKVNGLEVGADDYLSKP
FT                   FGMKELLARMRALLRRSQMQNSQPEPVSGLKIDNLEIFFERHLVMRDGEALDFSPKEFD
FT                   LLSFMVQNRCRVFSREQLLEKVWGYDYPGGTRTVDVHISWLRQKIETDPSRPRHLITVR
FT                   GTGYKFEE"
FT   gene            133577..135322
FT                   /locus_tag="DET0136"
FT   CDS_pept        133577..135322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0136"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by similarity to OMNI:NTL01BH3159; match
FT                   to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40533"
FT                   /db_xref="GOA:Q3ZA63"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA63"
FT                   /protein_id="AAW40533.1"
FT                   /translation="MARSLKWRLISLFCLLIAASVGLLSIFLSNHLENSYLDNLQSRLV
FT                   QEATLLSEIVPEHISEDPDSFDAYIKELGASLDIRLTVIDPGGQVLADSLQSPSDMENH
FT                   STRVEFIDALKNGLGTSVHQSASLGYEMLYVAIPVKSGTEVLAVVRVALPVEEVYAAVG
FT                   DVDRTILLSALISILAAGLLAVWVAASLTRPIKELTAIARRIARGQMDAVQIEVSGKGE
FT                   MEELAHAFRLMTERLRDSINAVSSERDRLSAVLERMGDGIFLLDCEGTISLLNPAAERI
FT                   FKLEAEHVIGHSFVEAIRDHEIHSIFEHSKSSGKQEMGFVELASGRRFLGIIATPLVSQ
FT                   SGYLVLVQDLSELRRLEKVRRDFVANISHELRTPISSLKLLTETLQEGAASDAAVAAGF
FT                   IEKIHLEVDKLAQLVTELSDLSAIESGQAVLNLQPGDISTAIKLAAARLSPQAERAGIS
FT                   LGVELPETLPQVKLDENRIEQVLVNLVHNAIKFTPKGGRIKIGARTQGQILVVYVSDSG
FT                   IGIPEDDLTRVFERFYKVDKARSGGGTGLGLAISKHIVQAHGGNIWAESRYGKGATFSF
FT                   SLPLG"
FT   gene            135505..135939
FT                   /gene="mgsA"
FT                   /locus_tag="DET0137"
FT   CDS_pept        135505..135939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="DET0137"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="identified by match to protein family HMM TIGR00160"
FT                   /db_xref="EnsemblGenomes-Gn:DET0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40526"
FT                   /db_xref="GOA:Q3ZA62"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA62"
FT                   /protein_id="AAW40526.1"
FT                   /translation="MERITLALVAHDNKKQEIVDLVKKHETDLAGLNLVATRTTGKLIQ
FT                   ASTDLNVNLLQSGPLGGDQQIGAMVASGVVTAIIFLRDPLTAQPHEPDISALMRVCDVH
FT                   NVPLATNVSTAEAVLHLIFEHPEELKEHRLKSQLLNSLNS"
FT   gene            136010..136846
FT                   /locus_tag="DET0138"
FT   CDS_pept        136010..136846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0138"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR02136"
FT                   /db_xref="EnsemblGenomes-Gn:DET0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40525"
FT                   /db_xref="GOA:Q3ZA61"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA61"
FT                   /protein_id="AAW40525.1"
FT                   /translation="MLPVTAVMLLALGVAGCSNDDEADNNDDNNDNTPTLSGTINEAGS
FT                   TTVQPLAEKLAAAFKVLYPNVNVVIGGGGSSVGVKSATDGTVEIGAVSRELKDTETGLT
FT                   KYLLAKDGIAIVVHPDNTAVANLTVDQVRDIFSGVITNWSQVGGPDKAIHVMAREEGSG
FT                   TRTAFEELVMGEDVRIVANAVLQNSNGALKTALAGDKDAIGFISFGYIDSSVKALSING
FT                   IAATSENGKNGTYPIIRPLYFLTKGTPSELVQAFLDYCMSDAVQQIITEEGYLSVN"
FT   gene            136921..137781
FT                   /locus_tag="DET0139"
FT   CDS_pept        136921..137781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0139"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:4530448"
FT                   /db_xref="EnsemblGenomes-Gn:DET0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40524"
FT                   /db_xref="GOA:Q3ZA60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA60"
FT                   /protein_id="AAW40524.1"
FT                   /translation="MLPRYFTDKLAKYGVLITALVSILVLLAIAVFIIQGGLPLFSAVN
FT                   PFDFLFGQSWSPTYDEYGILSMIVGSLLVTLGSMVIAVPLGIACAILLAEVAPQRVRNL
FT                   LRPAVELLVGIPSVVYGLVGIMVIVPAIRNLGGTGYSVLAAVLVLSIMVLPTIISISED
FT                   SLRAVPRTYRDGSLALGASQWQTIWHMLLPAARSGVGASIVLGMGRAIGETMAMIMVIG
FT                   NAVIIPTSPLDPARTLTGNIAVEINYAAGLHENALFATGLVLLILILILNSLATLALKR
FT                   GEQHA"
FT   gene            137774..138625
FT                   /locus_tag="DET0140"
FT   CDS_pept        137774..138625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0140"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40523"
FT                   /db_xref="GOA:Q3ZA59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA59"
FT                   /protein_id="AAW40523.1"
FT                   /translation="MLKFSSRSTQKVAFTILWAAGIITLLVLLLIIGYIIVRGLPGFSW
FT                   DFLITPPAGGLAGEGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRLTRFI
FT                   RYGVQTLAGVPSILFGLFGFALFVTALHFRFSILSGALTLACLLLPVLITATEEALKAV
FT                   PRSYRAGAMALGATKWQAVTHVILPAALPGIATGVILCAGRALGETACLYVTMGGSAAM
FT                   PESLLSGGRSLALHVFYLATETNAMDKAMATAAVLIVIIVGLNGLTNFISRRFQKRICG
FT                   GV"
FT   gene            138626..139381
FT                   /gene="pstB"
FT                   /locus_tag="DET0141"
FT   CDS_pept        138626..139381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="DET0141"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to OMNI:NTL02SP1895"
FT                   /db_xref="EnsemblGenomes-Gn:DET0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40522"
FT                   /db_xref="GOA:Q3ZA58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZA58"
FT                   /protein_id="AAW40522.1"
FT                   /translation="MEPKIKIRGVNFFYHRHQVLKNINMDFPDRQITAIIGPSGCGKST
FT                   LLRALNRMNDLVSGARLEGEVLLDNENVYSPNLDVVNLRKRVGMVFQQPNPFPKSIFDN
FT                   VAFGPRMLGITAQSRLNEIVEKSLHQAALWDEVKDNLHKSGMALSGGQQQRLCIARVLA
FT                   VEPEVILMDEPCSALDPVSTMRIEELMQELKQNYTIAIVTHNMQQAARASDWTGFLLTG
FT                   DLIEYGRTGEIFSRPKDKRTEDYITGRFG"
FT   gene            139394..140059
FT                   /gene="phoU"
FT                   /locus_tag="DET0142"
FT   CDS_pept        139394..140059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="DET0142"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by similarity to SP:P07656; match to
FT                   protein family HMM PF01895; match to protein family HMM
FT                   TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:DET0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40521"
FT                   /db_xref="GOA:Q3ZA57"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA57"
FT                   /protein_id="AAW40521.1"
FT                   /translation="MPRMGFDRHLRELEDDMLLLGSMVGKAVDRSMQSMKERDLELAKQ
FT                   VIEEDKLINQKRFEIEEKSVELMATQQPMARDLRIIVAVLNIIVDLERIGDHAEGNAKI
FT                   ALMLGEEPPLKPLIDLPRMASKTEEMLNRALGAFVRRDSAEALRVIDEDDEVDGLYNQI
FT                   FRELLVFMAEDPHTISRATRLIWAAHNLERSADRVTNICERVLFVITGKSEEFGSSKY"
FT   gene            140040..140480
FT                   /gene="arsC"
FT                   /locus_tag="DET0143"
FT   CDS_pept        140040..140480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="DET0143"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="identified by similarity to SP:P30330"
FT                   /db_xref="EnsemblGenomes-Gn:DET0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40520"
FT                   /db_xref="GOA:Q3ZA56"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA56"
FT                   /protein_id="AAW40520.1"
FT                   /translation="MVHQSTNMENKKQILFVCLHNAGRSQAAEVIFNHLAGGKALAVSA
FT                   GTEPSAALNPEVVTVLKEDYGINAGGLKPKMLSQDMLDSASRVISMGCDVTLSCPGHLY
FT                   GKEDWGITDPRGKNLAEVRLIVGSIRQKVEKLLDELGIKYQV"
FT   gene            complement(140534..141088)
FT                   /locus_tag="DET0144"
FT   CDS_pept        complement(140534..141088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0144"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:PSPTO1011"
FT                   /db_xref="EnsemblGenomes-Gn:DET0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40511"
FT                   /db_xref="GOA:Q3ZA55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA55"
FT                   /protein_id="AAW40511.1"
FT                   /translation="MVLYKTTLRTPRLVLRPFSRADADMVAELAGDALIADTTLNIPHP
FT                   YLPEMAVKWINSQPKKLAANTEQHFAVTEKDSGYLLGACGLVFCFSHQRAELGYWIGRP
FT                   YWNQGYATEALQALVRYAFLDLNLHRLQAYYLTRNPASGRVMAKAGFKHEGSFPKHLLK
FT                   NGVFEDVEYCGLLRNDYLLFR"
FT   gene            141401..141868
FT                   /locus_tag="DET0145"
FT   CDS_pept        141401..141868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0145"
FT                   /product="[Fe] hydrogenase, HymA subunit, putative"
FT                   /note="identified by similarity to GP:2865515"
FT                   /db_xref="EnsemblGenomes-Gn:DET0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40510"
FT                   /db_xref="GOA:Q3ZA54"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA54"
FT                   /protein_id="AAW40510.1"
FT                   /translation="MESIWKEKVDGVITQSGSSRLSLLPCLEAVQEECGYIPHEAVNYL
FT                   RECLSIPSIDIYGMITFYSLLSTNQKGKYVIRLCNSLPCYLNGTENILDTLVDNLGIEP
FT                   GQTTLDQRFTLELVPCLGLCDQSPAMVINGVVYGKLTAQLVTEVLDELRTY"
FT   gene            141870..143123
FT                   /locus_tag="DET0146"
FT   CDS_pept        141870..143123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0146"
FT                   /product="[Fe] hydrogenase, HymB subunit, putative"
FT                   /note="identified by similarity to GP:5650749; match to
FT                   protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:DET0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40509"
FT                   /db_xref="GOA:Q3ZA53"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA53"
FT                   /protein_id="AAW40509.1"
FT                   /translation="MQDIKIITRHLNTASSADIDVYMADGGYQALKKALSMTPDEVIAE
FT                   VKRSKLVGRGGAAFPTGLKWELTRKEKANPKYIVCNASEGEPGTFKDRLILKNDPHMVL
FT                   EGFIIAAYAVGTSQGFIHAREVYTEEIELFQKAIDQATERGFLGQNIMGSNFSLDIQFY
FT                   KSAGAYICGEETALFESLEGHRGIPAARPPYPVQVGLMDKPTTVNNVETLCNVPAIINN
FT                   GADWFAAIGHPDYPGTKLFCLSGNVKEPGVFEMPLGTNLKDLLEAGGGVDGKFKAVLPG
FT                   GISSSLLTEMDVNLDFKTLAKAGTMLGSGAVIVINSDTSMVNVASNVAHFFDEEGCGKC
FT                   SICREGTRRAAEILSRFSRGQGNRNELEWLLELHEVMKDTASCGLGQVALNVAASAIRN
FT                   FKGEFLAQVRKEEGVWLR"
FT   gene            143111..144832
FT                   /locus_tag="DET0147"
FT   CDS_pept        143111..144832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0147"
FT                   /product="[Fe] hydrogenase, large subunit HymC, putative"
FT                   /note="identified by similarity to GP:14250935; match to
FT                   protein family HMM PF02256"
FT                   /db_xref="EnsemblGenomes-Gn:DET0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40508"
FT                   /db_xref="GOA:Q3ZA52"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA52"
FT                   /protein_id="AAW40508.1"
FT                   /translation="MVTLNIDNKQISVPEGTTIMQAAKQANINIPHLCYFEGLKSYSGC
FT                   RVCVVEIEGEPRLATSCSRKVAEGMKVNTHSARVRRARRTILEILLANHPQDCFNCERN
FT                   QNCDLLRLAFECGVKKLRFEESEKRVLPIDSTSPSIIRDPNKCIACGRCVRVCHDIQTV
FT                   NAIGFINKGPDTMVATSMDRGMGNVACANCGQCILVCPVGAIKERSAVDAVWAAIADPT
FT                   KHVVVQEAPSVRVSLGEELGLPAGTLVAKKMYAALRRLGFDAVFDTNFTADLTIMEEGS
FT                   ELVERVKDGGVLPQITSCCPGWVKFMEHYYPELAPNVSSAKSPQQMFGAVCKTYYAEKS
FT                   GIDPKDIINVSVMPCTAKKFECQRPEMNDSGFKDVDYVLTTRELARMIKEAGLDFASLD
FT                   EEPAEDLLGLYTGAATIFGATGGVMEAAIRSAYTLITGRELENLDIEPVRGLEGIKTAS
FT                   VNIDGLEVKVAVAHGLGNARHLLDEIKEGVSPYHFIEIMACPGGCVGGGGQPIRFDSTL
FT                   KKKRGEALYEEDRNMAKRCSHHNPSVEKIYKDYLEKPLGKRSHKLLHTEYTSRPVV"
FT   gene            144873..145376
FT                   /locus_tag="DET0148"
FT   CDS_pept        144873..145376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0148"
FT                   /product="[Fe] hydrogenase, HymD subunit, putative"
FT                   /note="identified by similarity to GP:14250936"
FT                   /db_xref="EnsemblGenomes-Gn:DET0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40507"
FT                   /db_xref="GOA:Q3ZA51"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA51"
FT                   /protein_id="AAW40507.1"
FT                   /translation="MFNIQSISLRKELVIAFLVMLGLATAAPLIGNQYLTGSLVNAVLF
FT                   ISAVILGWKNAVAIGLISSSIALATGLLPIVMAPMVPFIIAGNALLVVSFHALRSKGFW
FT                   LGAGVAAFLKFAFLWATFNLVLNLFIEQNVADKIAGMMGLTQLFTALMGAVIAYGALRL
FT                   GKKI"
FT   gene            complement(145482..146315)
FT                   /locus_tag="DET0149"
FT   CDS_pept        complement(145482..146315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0149"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by similarity to OMNI:MT0192"
FT                   /db_xref="EnsemblGenomes-Gn:DET0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40506"
FT                   /db_xref="GOA:Q3ZA50"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA50"
FT                   /protein_id="AAW40506.1"
FT                   /translation="MRFTEGHFKGCQDYNCYYQALLPNGSPKAIVLVVHGLGEHSGRYS
FT                   ELAHYLADRSYAVYAYDHFGHGKTDGKAGYVSSYDVYIYDLISAFSMVQAKHPTSKIFI
FT                   FGHSMGGLVTAAYASKHQYDASGLIFSSIALKPYTGMPGILNQLVKPISKIAPMLGIRK
FT                   IDAATISHNKEIVKAYDEDPLVLHQRMSAQMAAEFLRICQDLPDFLKNISLPSLIIHGE
FT                   EDHLVSISGSRELVQKISSKDKTLITYPGMYHEVFNEPDCPQVWNDLFFWLENHL"
FT   gene            complement(146322..146582)
FT                   /locus_tag="DET0150"
FT   CDS_pept        complement(146322..146582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01MM2721"
FT                   /db_xref="EnsemblGenomes-Gn:DET0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40505"
FT                   /db_xref="GOA:Q3ZA49"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA49"
FT                   /protein_id="AAW40505.1"
FT                   /translation="MSKKSFSSDEAEAVAEILGITFEKFDIEQFRMGMDVELEHGTRDP
FT                   KTNVTNDDPVMTGKIALAHLNEIEDYYTRLSKMEAEAGVED"
FT   gene            complement(146722..147444)
FT                   /locus_tag="DET0151"
FT   CDS_pept        complement(146722..147444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:DET0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40504"
FT                   /db_xref="GOA:Q3ZA48"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA48"
FT                   /protein_id="AAW40504.1"
FT                   /translation="MSPRNIYSRPEVIGKKSIVLEGKEVHYTLRKSRFSDLIRLAIRST
FT                   TGLVVTVPHHYNMSGLDDILLKRSSWILKHQTKMNANRFILEDGLHDGQQVPYLGKLYT
FT                   LRIREGGERGHVSLERSNLHLLSGGKGAAEVMEKWYRHQAAEAVKASLEKNAAQMGLSF
FT                   GKLSIRAQKTRWGSCTSRGDLSFNWKLVTMPPSLMDYVIIHELAHRLEMNHTDRFWAVV
FT                   EKYCPNWKTLRKQLKTYE"
FT   gene            complement(147441..148334)
FT                   /locus_tag="DET0152"
FT   CDS_pept        complement(147441..148334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0152"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40496"
FT                   /db_xref="GOA:Q3ZA47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA47"
FT                   /protein_id="AAW40496.1"
FT                   /translation="MKAKTYLLLLLGVFGIAAASVFTRLADAPPIIITSLRMLAATCLL
FT                   LPFAAKPVYLAIKRLSRRNLLLIILAGFLVGIDQLFWVSSLEYTSIASSVILVTAHPVL
FT                   VAIMSYVMWREKLSPKAIGGVLSAFGGMALINLATSQVGEQAFLGNMLALAATIPTTGY
FT                   LIIGRQMRSHIDFLPYITLLYGSAAITLLAGAFLSGESFSGYTSTTYLMIFLLAVVSQL
FT                   VGHSCLNMALRLVSALVVSVAILGEPVGAIILGYIFLGEGLTLNEFLGGMLVLAGIFIV
FT                   MLNQPRTKKMEAETPR"
FT   gene            148436..148987
FT                   /locus_tag="DET0153"
FT   CDS_pept        148436..148987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0153"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:560723"
FT                   /db_xref="EnsemblGenomes-Gn:DET0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40495"
FT                   /db_xref="GOA:Q3ZA46"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA46"
FT                   /protein_id="AAW40495.1"
FT                   /translation="MAVAGFICEKTAVKLKLADMKKFPKRTYSNPAQFLSDIGFILKNR
FT                   RKLKESRLSGFPSPAFRERLMLAVTGVNECRFCTYAHTKMALESGISQPEVKALLDGDF
FT                   GNCPSGELNAVLYAQHWADTAAKPSAEMQSKLEADYGAEKAGFIHLYLRMIRIGNLSGN
FT                   TADKFLYYLTFGKIGLNRQP"
FT   gene            149037..149112
FT                   /locus_tag="DET_tRNA-Val-1"
FT   tRNA            149037..149112
FT                   /locus_tag="DET_tRNA-Val-1"
FT                   /product="tRNA-Val"
FT   gene            complement(149100..150632)
FT                   /locus_tag="DET0155"
FT   CDS_pept        complement(149100..150632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0155"
FT                   /product="resolvase domain protein"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:DET0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40494"
FT                   /db_xref="GOA:Q3ZA45"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA45"
FT                   /protein_id="AAW40494.1"
FT                   /translation="MKVVLYARVSSEKQDVDLSLSAQLKAMRLFAQGREYQVLREYIDE
FT                   AETGRTTARPAFREMIVAARRPGKPFEAILVWKYSRFARSREDSIVYKTMLRKNGVQVI
FT                   SINEPTENTPVGRLMEGMIEGLDEFYSDNLGEEVTRGMRESASRGFYLSYRAPYGYSKV
FT                   KVADGGKIRTKLELDPVRAPITHSIFKSVISGKGVVEVARELNSKGIASAKGKSWTKGT
FT                   IYSMLNNELYTGTVVWGRNSKRGLEPIKVTGACPAIVDIETFDAVQQMMASRAPKLIHP
FT                   RVVSSRFLLSGLARCGYCGRSLTGQDAKSGKFAYYVCGSLTKKGAGSCDFKYLNAPKFE
FT                   KAIIDEIKKSVLTKENLLDLAKAVTEEWNESLTGFRQEIDSIDDSIKDTQFRLSNIYDA
FT                   IESGKIELSDLALRIKELRMRQEKLIARKSEIEAQYSEHRYEIMDPAQMAVYVEDLKAL
FT                   LDEGEVCERKAFIKGFVKGIRVKGDEVTVEYTPPLPDGTGESVLSIEGHGGR"
FT   gene            complement(150830..151645)
FT                   /locus_tag="DET0156"
FT   CDS_pept        complement(150830..151645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0156"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40493"
FT                   /db_xref="GOA:Q3ZA44"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA44"
FT                   /protein_id="AAW40493.1"
FT                   /translation="MARGRKPEVSIEQANEWLRRVDNGESIKEIGKDDNFVERTVKKYV
FT                   DQARERQETTQARTMVYKDALERHYKDLVSMAKKLDQAVSSSKSIAGETKDPLYSALKE
FT                   HQPNSKLWVHISEWNTLLTEVDSLRDNFKVAIKNDAANNPLLQTSFIGGAMDTENIGQA
FT                   MIRVADSLLGGYPGIRAVNSLTPVPIGDPDLVIAQYGGFNLGNFQPDNLSDLVLRLTDL
FT                   ENQLPGFSQFQSLKTLAERQLKLKEAIHDLLTVFILKRVISGHCWYCPF"
FT   gene            151916..152620
FT                   /locus_tag="DET0157"
FT   CDS_pept        151916..152620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0157"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:DET0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40492"
FT                   /db_xref="GOA:Q3ZA43"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA43"
FT                   /protein_id="AAW40492.1"
FT                   /translation="MNKVYLDYQEIERMIEAAENLRDRLLLLLLAHLGCRISEALSISV
FT                   DDVDLANGTVTIKHLKSRLKLKCPNCQAGLGLTSVYCPKCGEKVESALKELKDFRRQRI
FT                   LPVDKALLVHLRDYITRGGPVIRNGKRLLFGVNRHRAWQIIKTLGEKAGLPRIINTETG
FT                   KVHNISPHKLRDAFAVHAVKHDDTGDGLRMLQEHLGHQSFNTTAKYRKVAGEEHRKWYD
FT                   DLWKSDGNSAKT"
FT   gene            complement(152967..153140)
FT                   /locus_tag="DET0158"
FT   CDS_pept        complement(152967..153140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40491"
FT                   /db_xref="GOA:Q3ZA42"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA42"
FT                   /protein_id="AAW40491.1"
FT                   /translation="MPNAVRFQATNGSAPFRSLGICPGAVSGSEPYPRQPVVYPRRTFD
FT                   EIILEGRRFFIA"
FT   gene            153584..154099
FT                   /locus_tag="DET0159"
FT   CDS_pept        153584..154099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40490"
FT                   /db_xref="GOA:Q3ZA41"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA41"
FT                   /protein_id="AAW40490.1"
FT                   /translation="MRTTLGCHDDQNNLPLSYNRLTGDWLLYYAVAKRFEWRVPPQDRP
FT                   DVRHSMMMELADAQNRKGGLPLPEAAMYRIASFEVADYWRKKKRQPDLISLDDETADND
FT                   TGLSSVLPDDSALDLDAWVDARTFLLSCPKRLIQIAFKRVNGVTLDGAERKYLCHFRKR
FT                   EQKLVFCG"
FT   gene            154245..155522
FT                   /locus_tag="DET0160"
FT   CDS_pept        154245..155522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0160"
FT                   /product="DNA polymerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40489"
FT                   /db_xref="GOA:Q3ZA40"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA40"
FT                   /protein_id="AAW40489.1"
FT                   /translation="MNIEGKRSGEGFIAQRESVISALNRALADKVSISGFTLGRKGFLS
FT                   YLRALGGSNVIKVVPSNGDASVSRVTGKCLKVVCGANQAYLTNNEWTGDKTSSGYCELK
FT                   VSPRYSVIPNLGALEISEALEQVLTFTSSQSSRPVLQGVCFKAANGKLDLVSADGYRLA
FT                   IVTLDYQGEGTAVIHRDELKGVAQALRRARRVRLAFETDEATKRTYLVLETELIRYRWS
FT                   GMSGDYPDYHPLIPTGFKTAVSLESTETLRAIASLKVLTDVKGCPVDLAIGDGKVVISA
FT                   TDDKGVTELSAETAGEPVRLRLDGGFFTDALKACGGIVELNITEPSLPTLFKADGFQLV
FT                   VMPMAIGKPQPKPEIKAEAKAPEPVKGEPPKETAATEPVKVEAPRVAEAKPDTDKVEAV
FT                   AEAEAITEKPKMPRITKKIAREAVAV"
FT   gene            156341..156820
FT                   /locus_tag="DET0161"
FT   CDS_pept        156341..156820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0161"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:27360617"
FT                   /db_xref="EnsemblGenomes-Gn:DET0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40488"
FT                   /db_xref="GOA:Q3ZA39"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA39"
FT                   /protein_id="AAW40488.1"
FT                   /translation="MVKALLLKREKALIDDWISRFMDFSDIIALASGSDVAPSEQDEIR
FT                   YYRFREWFMRRESAFLPLWWKYIEDQNAESGGRTGNDFEPDAKESAAFVNNPFGNYYHP
FT                   KSLVQTFVHLGLQKANTNWESCDDQAGDMRTVLIGVIGVAVEFHQWAFGTTRSVD"
FT   gene            157817..159280
FT                   /pseudo
FT                   /locus_tag="DET0162"
FT                   /note="reductive dehalogenase, putative, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAF73916.1"
FT   gene            159312..159542
FT                   /locus_tag="DET0163"
FT   CDS_pept        159312..159542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0163"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40600"
FT                   /db_xref="GOA:Q3ZA38"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA38"
FT                   /protein_id="AAW40600.1"
FT                   /translation="MKINLDIKWYQWIFGMLSSALAVLFVHDGFATFTEQEPQAIGVIA
FT                   LLVGGALLTTLCLTFGLRWSIRKIGRNTNQK"
FT   gene            159517..159852
FT                   /locus_tag="DET0164"
FT   CDS_pept        159517..159852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40599"
FT                   /db_xref="GOA:Q3ZA37"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA37"
FT                   /protein_id="AAW40599.1"
FT                   /translation="MAVIQIKNNCLKIIDNQVRELVSAIELGPKWLEEVLSIISMKDDV
FT                   ERIHKERDEVKARLLRLGRAYVDNVMPEEEYKQQKRLLDLSLESLVVPDYNAAEVDPPP
FT                   VISIAEM"
FT   gene            159891..160157
FT                   /locus_tag="DET0165"
FT   CDS_pept        159891..160157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0165"
FT                   /product="ISDet2, transposase orfA"
FT                   /note="identified by similarity to SP:P24580"
FT                   /db_xref="EnsemblGenomes-Gn:DET0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40478"
FT                   /db_xref="GOA:Q3ZA36"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA36"
FT                   /protein_id="AAW40478.1"
FT                   /translation="MIRKKFTEEQIITVLKEAEAGAKISELCRKHGVSDATYYKWKAKY
FT                   AGLSISELKRLKTLEDENRRLKQIVADQALDNWALKELLAKNF"
FT   gene            160181..161005
FT                   /locus_tag="DET0166"
FT   CDS_pept        160181..161005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0166"
FT                   /product="ISDet2, transposase orfB"
FT                   /note="identified by similarity to GP:2645861; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:DET0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40477"
FT                   /db_xref="GOA:Q3ZA35"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA35"
FT                   /protein_id="AAW40477.1"
FT                   /translation="MEFARGNLGLSERRACLLVGISPSAYRYKPKLDDDLALRQRLRDL
FT                   AGERKRFGSPRLHIMLKREGLVINHKRTERIYKEEGLALRRKRKRKGTAVNRIILPVPD
FT                   RPNQRWSMDFVSDSTVTGRRFRTLTIVDDFTRECPAIEVDTSLGGARVVSVLERLAETR
FT                   GLPEVITIDNGPEFAGRALDEWAYRRGVKLNFIRPGKPIENAFAESFNGRFRDECLNEN
FT                   WFMSLKQAREIIEDWRIDYNEVRPHTSLKGQTPQEYAEANSGLYSGMLLKVG"
FT   gene            complement(161375..162187)
FT                   /locus_tag="DET0167"
FT   CDS_pept        complement(161375..162187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02SC5407"
FT                   /db_xref="EnsemblGenomes-Gn:DET0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40609"
FT                   /db_xref="GOA:Q3ZA34"
FT                   /db_xref="InterPro:IPR040884"
FT                   /db_xref="InterPro:IPR041116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA34"
FT                   /protein_id="AAW40609.1"
FT                   /translation="MSVQAQNNYLRLMRFSLAFLILGSLTSLFSGSSEVFAIVSACILS
FT                   LVVFISLILARKRYDITWYLTRAIAESVKTITWRYVMKAKPFNQSDPIARTNFLKDLNK
FT                   ILSQNRSGCCTVDDNEQITQKMIEIRNGTYQERLSIYLEKRVKDQSSWYIKKARYNATK
FT                   TDQWFYAIIGMQFLAVLSALVRISEPQWNSIPTSVLTTMAASSLSWMQTKRYQELSSSY
FT                   GLTANEIGIIKSDVPSVVNEVTLCKFVGDAENAFSREHTQWQARRDYN"
FT   gene            complement(162819..163640)
FT                   /locus_tag="DET0168"
FT   CDS_pept        complement(162819..163640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40593"
FT                   /db_xref="GOA:Q3ZA33"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA33"
FT                   /protein_id="AAW40593.1"
FT                   /translation="MTTEELIRVLAKRKYLEVESSKFRTHLRTALMEQHHKERTRVGNF
FT                   VGRWAHNTKLTGVLGVGLLLCVTVIVVSVLLPFSSADFDGKKAVAAVMASADVKAALQG
FT                   DTITEVLITGVFDYETEATITTSTGRTYKVLIDNKGNIVAINPGTPRLSHTFFPLFTSP
FT                   HYSSFFEQGCPVALNEDEKVRLIEVAKNSDPIRVLLEQGATISGLSIAYAKTTTVFDMK
FT                   TKTWTAIVHEKLAQVLIKSSDQSHVFLIDFAEGTTYASFDEFCRSKGIPYP"
FT   gene            complement(163656..164207)
FT                   /locus_tag="DET0169"
FT   CDS_pept        complement(163656..164207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0169"
FT                   /product="RNA polymerase sigma factor SigW, putative"
FT                   /note="identified by similarity to SP:Q45585"
FT                   /db_xref="EnsemblGenomes-Gn:DET0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40610"
FT                   /db_xref="GOA:Q3ZA32"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA32"
FT                   /protein_id="AAW40610.1"
FT                   /translation="MDVSGLNEKNLVEKAKTDSSAFGELYELHYARIFGYVLRRTANLY
FT                   QAQDVTSEVFFKALKGLKSFNWNGTPFSAWLYRIASHEIVNNCRHNSRYSYEISLNGLE
FT                   SIAPVENVLQHERDVEESLDLQSSFLKLPAKYQEIIALRYFEDMEISQIAAITGKSENT
FT                   VKSLIFRGISCLKELNEKSM"
FT   gene            complement(165258..165956)
FT                   /locus_tag="DET0170"
FT   CDS_pept        complement(165258..165956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0170"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40592"
FT                   /db_xref="GOA:Q3ZA31"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA31"
FT                   /protein_id="AAW40592.1"
FT                   /translation="MKILIIEDDAQTTEIVKLSFKLGWPDVRLLEASSGESGLAMVETA
FT                   KPDAIILDIGLPDISGYEVLRQIRLFSELPVIILTIRNEESDIVKALSLGADDYLVKPF
FT                   RQMELLARIKAISRRLHSPEVDLEFECGPFHFGQSVTKLYKNDKPIRLTNIEGQILYYL
FT                   MRSNGRYIYNETIAQKIWGENAYERIRVNIRHLREKIEDNPSNPKFLINIPGKGYMFIC
FT                   QDSPKAESSS"
FT   gene            complement(165964..167475)
FT                   /locus_tag="DET0171"
FT   CDS_pept        complement(165964..167475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0171"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40591"
FT                   /db_xref="GOA:Q3ZA30"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA30"
FT                   /protein_id="AAW40591.1"
FT                   /translation="MTGYSAKELAQLDICQISSDFSRPQWESYWNRLKKSGANIRSAIL
FT                   LSKSGHKIPVNINDSYLRYSDTDYDCAFLNKADSEQITQVNTVTPQPHLKEIARQKTDE
FT                   AVTFNKLIQTLIERQTLTEKALYESEKKFRTIFNKARDAIILWEWDAHKEGFKIIEVND
FT                   MACQRFEYTRQEMFGKYADFFQPNSKESKAKFLAGTKATVNKEDGATYELLHQSKSGKI
FT                   MQNEVSGLRFELNGKPVILSVIRDISLRKEYEIKLKNMYEREKLLNTRLENESQKRAEF
FT                   TRILVHELKTPLTPIIAASDMLIKMLPPDISHELASQINKGAEELNNRMNDLFDLVRGE
FT                   LGILSLNTESIDCTRLLGDIIEFIRPQAQAKNQTLEAGFQPNLPLIEVDPVRFKQIVMN
FT                   ILGNALKFTSQGGFIKMSVFQKGRCLVICIKDNGRGISKVKQRRLLTSYDDRLISRESS
FT                   GGLGLGLALSKTFVDLHQGQITIHSKEGHGTTCDIILPIKQNGGS"
FT   gene            complement(167587..167838)
FT                   /locus_tag="DET0172"
FT   CDS_pept        complement(167587..167838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40590"
FT                   /db_xref="GOA:Q3ZA29"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA29"
FT                   /protein_id="AAW40590.1"
FT                   /translation="MVFPKVTRSLPEVSLKPSPPLKQIVTPLKIIMLIFIIYLLIGVKI
FT                   INTATNGWAGQKEIGSVFLDFYSYNLVQRFDTYVIKDN"
FT   gene            167859..169391
FT                   /locus_tag="DET0173"
FT   CDS_pept        167859..169391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0173"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40589"
FT                   /db_xref="GOA:Q3ZA28"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA28"
FT                   /protein_id="AAW40589.1"
FT                   /translation="MSKFHSAVTRRDFMKGLGLAGAGIGTAAAVSPLYRDLDEMIGSKT
FT                   AQWKRPWWVKELELEEPTTEIDWDMVERFDARYSAHSPAEVCRFVGLDEYNRVRALSNA
FT                   KQDMLDNKPGSTLRDNALNIGAGTGQYMSGYKTDYVFPAAGTCCGSFSVYWTGQKGVAT
FT                   PESMGVPKWSGTPEENTQMVRAAMRFFGATDVSVGELNERTKKFVSTYPQGGDVKYLDN
FT                   WPPPDTYIKKIVFEDVDQGYSTDTKYVIPNKPLYCITYTVPMSKDLFRTGPGSQLRSAA
FT                   NISRYRLRAAIDTCTKGFLTALGYQGLEEPYPCFPSQAGAVLDGLAKMGRNSNVCISPE
FT                   YGSVHGYFDIITDLPMAPTHPIDAGIFRFCHTCHKCADECPAKCIDQGSEPTWDFPASM
FT                   YKPEMPVDYHAPGKRLFWNDPIACQMYSNSVAGACGVCMATCTFNTNGASMIHDVVKAT
FT                   LAKTSLLNGFLWNADKAFGYGLVEGDEKEKFWEIGLPAYGFDTTVGSTVGGY"
FT   gene            169416..169616
FT                   /locus_tag="DET0174"
FT   CDS_pept        169416..169616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0174"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40588"
FT                   /db_xref="GOA:Q3ZA27"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA27"
FT                   /protein_id="AAW40588.1"
FT                   /translation="MKRLMVLITGLLIVGCLSLLASCASNVEAEDTQGDIPMEHGYPAK
FT                   DPNVPYLPVQDPLPTDSCGCG"
FT   gene            169666..169938
FT                   /locus_tag="DET0175"
FT   CDS_pept        169666..169938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0175"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27462922"
FT                   /db_xref="EnsemblGenomes-Gn:DET0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40587"
FT                   /db_xref="GOA:Q3ZA26"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA26"
FT                   /protein_id="AAW40587.1"
FT                   /translation="MWFIIGLIVGALILGVVWMLKRNNASLSWYEWVIGLAGLALLLFT
FT                   IQNFIGSFAELESKAASMFLLVTGLPSLILLALAWQLAARRTKKA"
FT   gene            169953..170072
FT                   /locus_tag="DET0176"
FT   CDS_pept        169953..170072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40586"
FT                   /db_xref="GOA:Q3ZA25"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA25"
FT                   /protein_id="AAW40586.1"
FT                   /translation="MYLEGEGVNPLPFGITGRKPACLFCRRFRVLREPAKKRV"
FT   gene            complement(170109..170789)
FT                   /locus_tag="DET0177"
FT   CDS_pept        complement(170109..170789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0177"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40578"
FT                   /db_xref="GOA:Q3ZA24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA24"
FT                   /protein_id="AAW40578.1"
FT                   /translation="MNILIVEDNDAAASTISSILRLSYHDAKITVCRTGYEAVESVNSD
FT                   KADLVLLDLGLPDMNGLKVLDEIHPITGAPIIVVTACEDEENVLKALEQGADEYITKPF
FT                   RHLEFLARVKKALSKNISQNTAIIKSGDITIDCAKHELSFRNDRVFLTRVETMIMSLLL
FT                   QRNGQIVDYRDISDALWGHAYPGSDESIRVYISRLRLKIEKNLKAGCIIKNEAGIGYRL
FT                   SLAE"
FT   gene            complement(170770..172560)
FT                   /locus_tag="DET0178"
FT   CDS_pept        complement(170770..172560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0178"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by similarity to SP:P35164"
FT                   /db_xref="EnsemblGenomes-Gn:DET0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40577"
FT                   /db_xref="GOA:Q3ZA23"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA23"
FT                   /protein_id="AAW40577.1"
FT                   /translation="MKTENNKVGIVTCVSMSNFVKNWAQHRNLDVRIYPITNFCFYSVK
FT                   IEMLSYYIERAILENGYCILNYGMCNESISQLKDHYAGRLSVVELDNCYEAAIGTAIYQ
FT                   ERIEQGHIFRNPTTMTCWQNMPTLEVMQPVETGLYPAPITFILENGEEEKAASYVNKLK
FT                   SVTALDYSVEVLNPQPHFLEDKLDQAYAKIQLASYEEDATRRLIFPFSFHNSDEYLYIL
FT                   DKHDNLVFSPYVAPTTPNQICEKLLEFILGHQTDSSFKVIDFDCLLKQRGLYLDKCKRF
FT                   ANRSSLTTEYEIIQDGQSTWIKEILWVSYDDSCSISSICGRMEDITKVKTSEKSIAESY
FT                   TKECLLRQALQDETKKRQAHLKALVHEIRTPLTPLLAASDALVNVSEKGTELYNLASSI
FT                   REGAETLNNRIHDLIELERGKIGMLKLKMAQYSVEDILDELQMRYTPIFQKQHKHLTFC
FT                   DETPKAYIYCDKERLLQILTNLIDNALKYTKAEDSVSVAAGVEKGFLRFRVTDSGAGVS
FT                   ACMIPDLFTEYGKLSGGNNLSGLGLGLPIAKLYVEAHGGQITYNPAEPKGSEFAFTIPL
FT                   KTISENELSDLRIVNEHSNS"
FT   gene            complement(172550..173143)
FT                   /locus_tag="DET0179"
FT   CDS_pept        complement(172550..173143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40576"
FT                   /db_xref="GOA:Q3ZA22"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA22"
FT                   /protein_id="AAW40576.1"
FT                   /translation="MAYQNLLSESSMITRTQSAELEKAIRAVLPSETAKLIDLAEQMFD
FT                   DYKQGLIQHNEARNLIGIIQNKAEEAQIIDRDCAPVAIFSPVSYIPPGITLLKAYLKLN
FT                   GFRPLVLELDEHNIRQMAGQIYPKAVVSLTLFHHIDKLAKLQSCFKDAGLGVIAGGVPF
FT                   IYQHQNKDRLSFCYFPESLRELICKLSEDLPNED"
FT   gene            173382..174749
FT                   /locus_tag="DET0180"
FT   CDS_pept        173382..174749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0180"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:3002555; similarity
FT                   to GP:5531941; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40575"
FT                   /db_xref="GOA:Q3ZA21"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA21"
FT                   /protein_id="AAW40575.1"
FT                   /translation="MDGKINRRDFVKGAGIASAATVATIMATASTVSAEELVNPSIKAM
FT                   DEMGSASLTRDLPESFYKRIENKDGYIGTTRVIAPTQRLDAREHGFSQIVRRGSTGDWS
FT                   GEPGDWGPVLFAAVQEKKKHAAEITPLEAADYTWSNAFQIAMDRWHITLEPGRYQQAPI
FT                   AATKVELSPEEMTARIKKICRWFGCEQVGICEVTEDMKPFFYSVGRTKGTYTTGHANYV
FT                   DEGREIPWPYPYKYCIVMADKCDTDTLSAMTGPLVEASAKIACSQSDFAPHYLESIIRS
FT                   LGHDAKANIFSDTDIMDTPFAVKAGLGELGRSGLVISPWGAQMRIMEVFTNLPLVPDKP
FT                   IDFGLQEFCKVCKKCADNCPASAISMDDEPSEVDTVVKSIRWFQDGKKCLSQRLAYGCS
FT                   KCQSVCPWSKPDTLIHEIGRMVGQNPAFAPFLVKLDDFFYNRYPEGHATGEWAPWR"
FT   gene            174799..175086
FT                   /locus_tag="DET0181"
FT   CDS_pept        174799..175086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0181"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40574"
FT                   /db_xref="GOA:Q3ZA20"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA20"
FT                   /protein_id="AAW40574.1"
FT                   /translation="MTAIIFLFGLLVGIFGSWLWHAAKEHNIKLIWVDYLMMALFVLLV
FT                   GSGIVFVNTFNEESVASAARSSGLIFGLLALLVLGITWQLIWRRNRKSGI"
FT   gene            complement(175181..175342)
FT                   /locus_tag="DET0182"
FT   CDS_pept        complement(175181..175342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40573"
FT                   /db_xref="GOA:Q3ZA19"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA19"
FT                   /protein_id="AAW40573.1"
FT                   /translation="MKSYPALGFFPARARPCETGAKPELLYFLICVALLMQLTKDITIW
FT                   FLCQIYPN"
FT   gene            175537..177219
FT                   /locus_tag="DET0183"
FT   CDS_pept        175537..177219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0183"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by similarity to SP:P25888"
FT                   /db_xref="EnsemblGenomes-Gn:DET0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40572"
FT                   /db_xref="GOA:Q3ZA18"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA18"
FT                   /protein_id="AAW40572.1"
FT                   /translation="MSFESFNFAPAVMAGVRACGYQEPTPIQAQAIPPILEGHDVIGLA
FT                   QTGTGKTAAYALPVIQKMLSTPRGRVRTLVLAPTRELACQIAESFRSLGQRARIRECSI
FT                   YGGVNMDQQIRRLRSGVDVVVACPGRLLDHIWRGTIDICGVETLIIDEADRMFDMGFQP
FT                   DIQSILKCLVQPHQTLLFSATMPPEVRKLTLETQTNPVTIQIGTQAPASSVSHSVYPVK
FT                   NHQKTPLLIEILKTTETKSVLIFARTKYGAENLADEISRAGFTTASLQGNLSQNRRHAV
FT                   MEGFRRGNFKILVATDIAARGLDIDHISHVINYDMPDTPEDYTHRIGRTGRFDRTGQAL
FT                   SLVTGRDGDMVRDIQKLINSPIQRLRVDGFDYATTRNDGQNHSQRRGFAPRRGYSAEGY
FT                   NRSEMPAAETSPNSLTAEMPSGNVRPFSQAVRSGRPADSAPRFRREGYSAPRFGGRPSF
FT                   EDAPMAAKPVARFNARPAFRKEDDAQAAAKAYPSFGRETGVTSAENTRSVSENPEQFSS
FT                   RRPARFNGKASFANRPARPGNKVGKPPFFRRSKPPVSENNPTY"
FT   gene            177388..178353
FT                   /locus_tag="DET0184"
FT   CDS_pept        177388..178353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0184"
FT                   /product="membrane protein, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40571"
FT                   /db_xref="GOA:Q3ZA17"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA17"
FT                   /protein_id="AAW40571.1"
FT                   /translation="MSLTVLWIIFAVMVLCMLALDLGVFHRRAHEVKTKEALIWSGVWI
FT                   LLALIFGGLIYFSMGSEFGLNYLSGYIIELSLSVDNLFVFIMIFSYFCIKREYQHKVLF
FT                   WGILGAIIMRAVFIAAGITLIENLSWVLYIFGAFLIYTGIRMVKDQNQEIHPDKNPLVN
FT                   FVCRILPMTNKLHGDHFFIKENGRKLATPLILVLVTIEAMDLVFAIDSIPAVMAITLDP
FT                   FIVFTSNIFAVMGLRAMYMALSGIIQKLHYLHYGLAAILSFLGIKMLISEFVHLPVALS
FT                   LSVVAVILAVSVAASLLKPPKEIKPVEVPHPECPVDEGDK"
FT   gene            complement(178514..179362)
FT                   /locus_tag="DET0185"
FT   CDS_pept        complement(178514..179362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0185"
FT                   /product="formate dehydrogenase accessory protein FdhE,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40564"
FT                   /db_xref="GOA:Q3ZA16"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA16"
FT                   /protein_id="AAW40564.1"
FT                   /translation="MNTNRLERINSEIERYRAAQPELETILALYQKVFAIQESASSQEE
FT                   PAPLISEEDAIAKLASGEYILKGIPLSPPAELFHQTGLKLGRTFTQTAGEKFPAPALLK
FT                   LIESHPEGLSGFISALLADNLDYLAEFAQKTSFNPETLLFFVTNLVSPFLVAQAKYYQP
FT                   QVDLLGWDKNTCPVCGSSPRYSRLDKDTGARRLFCSLCHTQWNYRRIKCAYCTNANTEK
FT                   LRHFYSAVFPYQRADVCEKCKSYIKTTDERRLGRECLPEVEDAVSIHLDNIAQNEGYQP
FT                   G"
FT   gene            complement(179363..180574)
FT                   /locus_tag="DET0186"
FT   CDS_pept        complement(179363..180574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0186"
FT                   /product="formate dehydrogenase, membrane subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40563"
FT                   /db_xref="GOA:Q3ZA15"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA15"
FT                   /protein_id="AAW40563.1"
FT                   /translation="MFSAIKGWVNKLEQTGNPNVPLFGKWGLLQIILALGALTVAGLKL
FT                   AYGLGPITNLSDNWPWGLWVAFDVGAYIASAAGGFTMAAIVYIFGFEKFRPLVRPAILI
FT                   GALCYTIGAIGIMIDLARSIRIVHPIWMWNHESIMFEVGWCVMMYLTVLYLEFSNNIFE
FT                   RIGWKKLGNLQHSFIIPLVIFGIMLSFLHQSSLGALFLINPAQQPLWHGPLMGHLFLVS
FT                   AMALGLAVLTYFSIILSRSWKMTLRMDILSKLGLVIAWILLVYLAARGVDYAITGNLAA
FT                   GLNGDWYTVLWVAEVGIGMLLPMILLFIKKVRTSRTGLLWSTGLIIMGVVLNRINTLVI
FT                   SQAPNREGSYFPHILEFVFTFGLIAGAMYVFRLCAKYLPLYSDHMKGLTPEQVKKAPEV
FT                   IPAS"
FT   gene            complement(180662..183643)
FT                   /locus_tag="DET0187"
FT   CDS_pept        complement(180662..183643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0187"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by match to protein family HMM TIGR01409;
FT                   match to protein family HMM TIGR01553"
FT                   /db_xref="EnsemblGenomes-Gn:DET0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40562"
FT                   /db_xref="GOA:Q3ZA14"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA14"
FT                   /protein_id="AAW40562.1"
FT                   /translation="MRSQFSRRDFLKISGGTAGLFATAGLFRGPIKGVEPTMVDTRPRW
FT                   VKETTTICPFDASGCGFICYTDSAGNLTNMEGDPDNPVNRGSACSKGASLIQLHNNKHR
FT                   LEKVLYRAAGASDWEEKSWDWALGEIANKVKASRDSGFVATNAAGKTVNRTEAIASLGG
FT                   ATLDNEECYLLSKMLRALGIVYLDSQARLSTASSLEALAASFGHHAMNNSWTDISNANV
FT                   ILDMGGNPAENYPACFSHLGEAMGKGTELISVDCRLTRTAAKAGTFVAARSGSEIAFTG
FT                   GLIKYVIADIEAHPANYNLTYITEYTTAGMVVNSNFKGPADLDGMFTGYNSASHSYDQS
FT                   NWSFAKASNGDPIIDKTLTNPNCVFQLLKKQYARYTPEMVAATCGCSQADFAKVCASFA
FT                   STGKADKAGAIIYAMSSTQHTSGAQTVRAYAILQMLLGNIGVSGGGLFALGGESNVQGA
FT                   ADNGVAWNKLPGYLSAPTEDDTNFAAFAAKSSEQNAASLLKAWYGSNASSSNGFGFSFL
FT                   PKTDTNTDYSYVNAIKQMAAGTIKGAFAWGANPVVESAAAAQATQALAKLDWLVVTDMF
FT                   ESETAAFWKKEGISSQTEVFLLPAACSYEKEGSVTNADRWVQWRNQAVNAPGEAKSELE
FT                   VISSLFSRIQSLYQGESALNAEAITKLSWTYSTNPSAADVAKEMNGYKVSSLQQLESPE
FT                   ELRTDGTVACGNNLYVGSFTDAGNQMARREQTGVFHAGWAWSWPVNIRILNNRASVDLS
FT                   GQPFNAAKPVVSWNGMGWSGDIVDGNNPPVNQSGGLPFKGTSGSQGQLFAAMADGPMPE
FT                   HYEPWESPVDNALSGTQNNPAAMVFEGDTKGSAGEYPVICTTVRTVEHSLGGELTRNMP
FT                   FLVELAPAAYVEISEQLASEKGIKAGDIVKLTSARGSVSVAAAVTKRLKPFSIGGKTVH
FT                   QVAIPYHWGFMGIAQGDSANTLAPNTADSNSSTPEFKAFLVKVEKEADGTVPTITGRYK
FT                   VLED"
FT   gene            complement(183782..183889)
FT                   /locus_tag="DET0188"
FT   CDS_pept        complement(183782..183889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40561"
FT                   /db_xref="GOA:Q3ZA13"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA13"
FT                   /protein_id="AAW40561.1"
FT                   /translation="MPVVREEPKIFWNILPHFQFKDRLVYRVFQAKEYF"
FT   gene            184012..184590
FT                   /locus_tag="DET0189"
FT   CDS_pept        184012..184590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0189"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:DET0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40560"
FT                   /db_xref="GOA:Q3ZA12"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA12"
FT                   /protein_id="AAW40560.1"
FT                   /translation="MRIIAGDAKGKNIIVPQRKATRPATELVRGAMMSMLEAIAEDWSE
FT                   VLDIYSGSGSLGLEALSRGAGHVDFVEHERACCDIIKQNLETIGCAGQAHVYCLDVPKA
FT                   MSLLGKQYDVILADPPYRNQQIGEVLEKLGNSSLIGENTVMAVTHSAHLTLAERYGRLT
FT                   MLKEHRHGDSLIAIYRKDSRFDSHLPGPV"
FT   gene            184562..185041
FT                   /gene="coaD"
FT                   /locus_tag="DET0190"
FT   CDS_pept        184562..185041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="DET0190"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by similarity to GP:29726926; match to
FT                   protein family HMM TIGR00125; match to protein family HMM
FT                   TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:DET0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40559"
FT                   /db_xref="GOA:Q3ZA11"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZA11"
FT                   /protein_id="AAW40559.1"
FT                   /translation="MIAIYPGRFDPVTLGHLSVARRASGFCDRLIIAVFDNPAKPGLFT
FT                   AAERVDLIKQSVKDLPNVEVHSFSGLMVNFARRMGVSLIIRGLRVGADFEREMEMYVMN
FT                   RRLDEGIELCCLFSEPQYQYLSASLIKEVVMLGGDSSGLISEHVADALKNKLASA"
FT   gene            185130..185384
FT                   /locus_tag="DET0191"
FT   CDS_pept        185130..185384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0191"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40558"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA10"
FT                   /protein_id="AAW40558.1"
FT                   /translation="MSFKITDDCISCGACEPECPNKAISEGETIYIIDPERCSECVGAF
FT                   ETPQCVEICPVDSCVKCCNESHEELLAKWQKLHPGESPK"
FT   gene            complement(185493..185981)
FT                   /locus_tag="DET0192"
FT   CDS_pept        complement(185493..185981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0192"
FT                   /product="cvpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40549"
FT                   /db_xref="GOA:Q3ZA09"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA09"
FT                   /protein_id="AAW40549.1"
FT                   /translation="MNWLDIVLLIVLGIQTVSGFFTGLIRNFLHLVGLIIGIILAGRFY
FT                   PTVAEWLSFISSPEWANIVAFLLVLMVIWAATTIIAKLLDAIIKPTFLNWINRLGGAIF
FT                   GLLVSGIFTAALLAIWVKFFGSASVITDSAIAQILLDKFPLILSLLPDEFGVIRDFFN"
FT   gene            complement(186078..186881)
FT                   /gene="proC"
FT                   /locus_tag="DET0193"
FT   CDS_pept        complement(186078..186881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="DET0193"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:DET0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40548"
FT                   /db_xref="GOA:Q3ZA08"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA08"
FT                   /protein_id="AAW40548.1"
FT                   /translation="MKIAFIGGGNMGEAILGALIQKNICPPKDITVSEIKAERRTFLEN
FT                   TYGIKTTPSNPEAIKNAEVVLLAIKPQNLAELSAGLKGKLAETQLVISIIAGATLSKLS
FT                   GGLEHKAVVRVMPNTPAMIGMGMSVWTALPAVSPAQKEQAKSILSAMGKEIYTGKETML
FT                   DAATAISGSGPAYFFLFMESLEKAAQEMGFTPEEATVLVSQTAAGSAVYAEKSGLPLAQ
FT                   LRKNVTSPGGTTAEAIKVFEQAGLETTVIKAAKAAFDRSVELGKG"
FT   gene            complement(186883..189324)
FT                   /gene="leuS"
FT                   /locus_tag="DET0194"
FT   CDS_pept        complement(186883..189324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="DET0194"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by similarity to SP:P36430"
FT                   /db_xref="EnsemblGenomes-Gn:DET0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40547"
FT                   /db_xref="GOA:Q3ZA07"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ZA07"
FT                   /protein_id="AAW40547.1"
FT                   /translation="MAEKYNPQETEKKWQDKWAADRLYHAGEDSPKPKWYSLTMFPYTS
FT                   GNLHIGHWYAEVPADCFARYKRLNGFNVMRPVGFDSFGLPAENAAIKHHIHPRIWTLNN
FT                   VENMRRQLKTIGAMFDWDREVITCLPEYYKWTQWFFLKLYEAGLAYRAKAPVNWCPSCQ
FT                   AVLANEQVVDGTCWRCETPTTRRDLEQWFFRITNYADELKDHDGLDWPEKITAMQRNWV
FT                   GKSYGAEVSFALDCPAAPEQEIKVFTTRPDTIYGVTFMVLAPEHPLVEKITTPENKAAV
FT                   DEYIKKSRACTEIERLSTEREKDGVFTGAYVTNRVNGHKVPVWIGDYVLQSYGTGAVMG
FT                   VPAHDERDFVFAQKYDLPVITVIAPPDYDGQPLEAAYINEGVMQNSGPFNGLPNTEGKE
FT                   KVCDYLAEHGWGKKTVNYKLRDWLISRQRYWGAPIPMIYCEKCGIVPVPEKDLPVLLPE
FT                   DVEFRSGGESPLKYNEGFVNTTCPVCGGKAKRETDTMDTFMCSSWYFLRYTSPGYDKGP
FT                   FDPEKLRYWMPVDLYTGGAEHAVMHLFYSRFFTKALRDMGIIDFGEPFKKLFNQGIIVS
FT                   NHQKMSKSKGNVVTPDNLVAEVGTDAVRAYLMFVGPWDQGGEWNDSGLSGMSRWLNRVW
FT                   NLFTEEYTPQTASAEAERELKRTLHQTIKKITMDIERLRFNTVVAALMELSNSLAKFKE
FT                   AAAVSAESWQNSLKTFALMLAPVAPHIAEELWANLDMEYSIHNQSWPKWDEELAKDEVI
FT                   TLIIQVNGKLRERLEMPAGISEDEAKETALNSTRVKPHLQGKTPASVIYVPGKLVNIVV
FT                   K"
FT   gene            189504..190811
FT                   /locus_tag="DET0195"
FT   CDS_pept        189504..190811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40546"
FT                   /db_xref="GOA:Q3ZA06"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA06"
FT                   /protein_id="AAW40546.1"
FT                   /translation="MTVKEIVVIGAGAGGLMAAGRAAECGGKVILLEKTEQPGKKMLIS
FT                   GQGRCNISNSRDIAEFITAFGPNGRFLYSAFSRFFRQELVDLLARYGVETKTERGGRLF
FT                   PVSDKAHDVVAALTEYASGAALVSGQKVSQILVSEGRVVGVKTEKETFRADAAVIATGG
FT                   ASYPGTGSSGDGFRLAEALGHTIVKLRPALVPLVVKEIDLAKSMQGVALKNIRLTAYRC
FT                   EADKIPADLTLQDWGRGIAGKKPPKAVIESRMGELMITHFGLGGPLTMLMGLPVAEALE
FT                   QGAVSVAIDLKPALSLDKLRLRLQRDFDTFGKRSFQNLLSELLPQKMIRPFVDLTGIDP
FT                   FKCGGQITAAEREVILANLKCLRFNITSTLPLSAAVVTAGGVDLKEINPRTMESKLVKG
FT                   LYFCGEVMDIDADTGGYNLQAAFSTGYLAGESAAGA"
FT   gene            complement(190794..190886)
FT                   /locus_tag="DET0196"
FT   CDS_pept        complement(190794..190886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40545"
FT                   /db_xref="GOA:Q3ZA05"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA05"
FT                   /protein_id="AAW40545.1"
FT                   /translation="MFYIRQTAKEGVKQRAGYYPARPFPLSPRR"
FT   gene            191008..191316
FT                   /locus_tag="DET0197"
FT   CDS_pept        191008..191316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01MT00097"
FT                   /db_xref="EnsemblGenomes-Gn:DET0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40544"
FT                   /db_xref="GOA:Q3ZA04"
FT                   /db_xref="InterPro:IPR020075"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA04"
FT                   /protein_id="AAW40544.1"
FT                   /translation="MKVSMQISFNLDIINKCVCHKCPVQNQSECVRTQMAGLKTSFREI
FT                   PLNPHKIPKAYCLNGKSVCKGIDRSKPCICGSCEIYAKHQLSEAEPGGFYCIEGKSA"
FT   gene            191505..191780
FT                   /locus_tag="DET0198"
FT   CDS_pept        191505..191780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0198"
FT                   /product="glutaredoxin family protein"
FT                   /note="identified by similarity to SP:P23171"
FT                   /db_xref="EnsemblGenomes-Gn:DET0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40543"
FT                   /db_xref="GOA:Q3ZA03"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA03"
FT                   /protein_id="AAW40543.1"
FT                   /translation="MEKVTGKNAGEIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDLL
FT                   TGSERDKAVTELSALNPSKSFPTMLIGGSKVIIGYKEAEIREALKA"
FT   gene            191777..192283
FT                   /locus_tag="DET0199"
FT   CDS_pept        191777..192283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0199"
FT                   /product="ferredoxin-thioredoxin reductase, catalytic
FT                   subunit, putative/rubredoxin"
FT                   /note="identified by similarity to SP:P51386"
FT                   /db_xref="EnsemblGenomes-Gn:DET0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40542"
FT                   /db_xref="GOA:Q3ZA02"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA02"
FT                   /protein_id="AAW40542.1"
FT                   /translation="MSQQLPEPAEDLALFQLRLRSEAEASGYHLNPDNAFVKMLAEGLL
FT                   ANRQRYGYQSCPCRLAEGNRKADLDIICPCDYRDADINEFGSCYCALYVDSQIAKGEKK
FT                   PQPVPERRHAPKTLPKAKTAQAPASLAYPVWRCRVCGYLCGRDEAPDQCPICKADKERF
FT                   ELFMQ"
FT   gene            192371..193282
FT                   /locus_tag="DET0200"
FT   CDS_pept        192371..193282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0200"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to OMNI:NTL01MM1194"
FT                   /db_xref="EnsemblGenomes-Gn:DET0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40532"
FT                   /db_xref="GOA:Q3ZA01"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA01"
FT                   /protein_id="AAW40532.1"
FT                   /translation="MNFLRRYDFYLLILFIGLGVLAFNGGWVLPLRLLFGLPLVLIVPG
FT                   YALASVLYPSKLSLSRSSRLMVSLALSLSVSMLAGLVLNYTAGLNQESVFYTLGGFSLV
FT                   FCLAAIARRQHLPPDEKPGLILVPPDTKKQTPKSTAQVFLNVLLAVCLLGAGGFAVQRL
FT                   VQAYSPAEFTQFYLLGIDDTAENFPELFILSNGQVSAVKYGNQPAVEADLARLKLVISN
FT                   NGQSGTLYRVEAFINGQLYIFSLADGGEFDGLVDVAAGAAESLELYFAPPEAGDNQILE
FT                   IWLYAGEEAVFSQPLKLVFSAA"
FT   gene            complement(193284..194462)
FT                   /locus_tag="DET0201"
FT   CDS_pept        complement(193284..194462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0201"
FT                   /product="glycosyl hydrolase domain protein"
FT                   /note="identified by similarity to SP:P71243"
FT                   /db_xref="EnsemblGenomes-Gn:DET0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40531"
FT                   /db_xref="GOA:Q3ZA00"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZA00"
FT                   /protein_id="AAW40531.1"
FT                   /translation="MPFVNSFCLNITLCHGHLAYLAITQTSLSFAIKNALTNSQKWLTL
FT                   SSGYLREPNMIKICLIGDFKTCPDRSIYKMAAQLADSLSKEKGISLLPCPREHFTRPRS
FT                   LNRIRRFQPDIIHLLGKPDPAELFRLKMAKLSAPRAKTVISAQQPVKTRTVRNMLSYVK
FT                   PDLAICLSQKSAGFFGECGVKTVILPNGVDMTNFRPVSPETKAELRRRYCLPPNKLLLL
FT                   HVGPVRAGRGVDLLRRLQNPDTQVIMAVSNPGIFNRTLLESLRKSGCMILTSFRPNIAD
FT                   LYALADCYIYPMLPEEDANYQIFSSEMPLSVLEAMAANLPVITTPFGALPEMFPEGDGL
FT                   YYAQDDFEFLKAFQAYTQGTPVKTRTKAEMCSWPEVINRLKEVYTKLLNEKI"
FT   gene            194508..195740
FT                   /locus_tag="DET0202"
FT   CDS_pept        194508..195740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0202"
FT                   /product="histidinol-phosphate phosphatase family
FT                   protein/glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM TIGR01656;
FT                   match to protein family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:DET0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40530"
FT                   /db_xref="GOA:Q3Z9Z9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z9"
FT                   /protein_id="AAW40530.1"
FT                   /translation="MNQKAVFIDRDGTIVEDVPYCNSPRKIRLLEGAGKAIRRLNDQGF
FT                   LVILITNQSGVARGYFSEETLGEIHNKLKEDLGYFGAHLDDIFYCPHHPAQSCTCRKPA
FT                   TGLIDQAVAKYGLDISGSYFIGDRLIDIQAANRSGCQAVLVPYTLPETDYFKLEISVDS
FT                   RPSFLAGDISAAVDWVLADALGKASVSVVIPTLNEEKNICSVLPRLRCVPGIAEVILVD
FT                   GRSTDKTVENALRLWPEIKVINQPGRGKGDAMRAGFEAACGDIVVTLDADGSLAPEEIP
FT                   CYVGPLFDGYQMVKGSRFCRGGGTSDMPLFRRFGNFVFTKMANLVCGCRYTDLVYGYHA
FT                   FRRQILGSLCLKSDGFEIDTEMYIRATRKGLKVKEVPSYEAKRLEGAGKLRSFHDGARI
FT                   LRTILRESVNG"
FT   gene            195733..196728
FT                   /locus_tag="DET0203"
FT   CDS_pept        195733..196728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0203"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40529"
FT                   /db_xref="GOA:Q3Z9Z8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z8"
FT                   /protein_id="AAW40529.1"
FT                   /translation="MADPFISVVVSAYSMERYTDLLSLIDSLKSQAYTNFEVILVIEKS
FT                   SQLFSNLNRCLSQHPYSRNFKLFFNDGLPGLASARNLGVEKSQGEIIAFIDDDAAASPE
FT                   WLGCIACCFREDKKIIGLTGPALPWWEHPGLSWFPAEFNWVISTMPCLPRSRGYIRNAW
FT                   GTNMAFRRQAFSNGQGFDTELGAKGGGKKGKSELVGEDTEFCLRICRQSGLNILYAPEV
FT                   KVMHRVYRYRLKPGFIAKRAYWEGYTKAVFKYRLGKETSGAGVLSEELGLLRRIFLRLL
FT                   PLSLLNLPLKPRRSALTILTTLNILGSTGWGYIRGMASARFISVKEAVNA"
FT   gene            196721..197659
FT                   /locus_tag="DET0204"
FT   CDS_pept        196721..197659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0204"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40528"
FT                   /db_xref="GOA:Q3Z9Z7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z7"
FT                   /protein_id="AAW40528.1"
FT                   /translation="MPEVLVTGGCGFIGSHLVDALLSQGFKVRVMDNLSNGSLENLKCG
FT                   QRDKLEIINGNLTDKFLLDSAVKGCETVFHLAAHANVQNSAKDTGIDLENNTLATHNLL
FT                   EAMRRNRVDRLVFASSAAVYGESGLTVLDEDYGPLLPISLYGASKLAGEGLISAYSHLY
FT                   GLKATMFRFANIVGSRRHSGVIYDFVSRLRQNPSSLLVLGDGSQSKPYLHVSDCVAGML
FT                   LGFEKSTKNLGLYNLGTPDSVAVRDIACLVASEMGLKNVCYSYSGGERGWQGDAPQVRF
FT                   DISRIRTLGFKPKFTSLQAVKLAIKETLKEI"
FT   gene            197662..198372
FT                   /locus_tag="DET0205"
FT   CDS_pept        197662..198372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0205"
FT                   /product="D-glycero-D-manno-heptose 1-phosphate
FT                   guanosyltransferase"
FT                   /note="identified by similarity to GP:13491145"
FT                   /db_xref="EnsemblGenomes-Gn:DET0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40527"
FT                   /db_xref="GOA:Q3Z9Z6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z6"
FT                   /protein_id="AAW40527.1"
FT                   /translation="MQAVILCGGLATRLRPITENIPKCLLPMAGRPFLHHQFRLLKSQG
FT                   FDRVVLCIGHLGEMVKDCFGSGDEYGLKLAYSQETEKLLGTAGALKNAEDYLEEEFFVI
FT                   NGDTYLDMDYRQAWQTYSQNNCDALMTVYDNRHGRINARNDVALDENMLVSCYEKDSHL
FT                   PELKFVNAGALILRKSLFATLEKDKPYSLERAILPVLAHNQRMLAYPVKECFYDVGTVE
FT                   GIYTFCNYLENQPV"
FT   gene            198369..199346
FT                   /locus_tag="DET0206"
FT   CDS_pept        198369..199346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0206"
FT                   /product="D-glycero-D-manno-heptose 7-phosphate kinase,
FT                   putative"
FT                   /note="identified by similarity to GP:13491143"
FT                   /db_xref="EnsemblGenomes-Gn:DET0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40519"
FT                   /db_xref="GOA:Q3Z9Z5"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z5"
FT                   /protein_id="AAW40519.1"
FT                   /translation="MIISRTPFRISFAGGGTDLKAFYSLKAGEVVSTAINKYMYITVNK
FT                   RFDSTIRVSYSSTEIVNTVDEICHPIVREALKLTGISGGIEIVSIADIPAGTGLGSSST
FT                   FTVGLLNALYAYQGKLLSAEELARQACRIEIDCLKEPIGKQDQYIAAYGGICYFRFEAD
FT                   EYVGVSPLPLKAELKANLNKSLLLFYTGSCRQAGSILAEQQSNTTRPANFKNLTCLTRL
FT                   AASCRECLLDHALPEDMGNILHKGWLAKKNLSSGISNPYIDQCYQSALSAGAYGGKLLG
FT                   AGGGGFLLVCAPPKSHDSVRRALSDLPQVDFEFEPEGSKIIYVL"
FT   gene            199374..200024
FT                   /gene="gmhA"
FT                   /locus_tag="DET0207"
FT   CDS_pept        199374..200024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="DET0207"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by similarity to SP:Q9AGY7"
FT                   /db_xref="EnsemblGenomes-Gn:DET0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40518"
FT                   /db_xref="GOA:Q3Z9Z4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z4"
FT                   /protein_id="AAW40518.1"
FT                   /translation="MIISKPDVANGKGHKPELPETSLVSDMDCLFREYLGGLSHCLEEL
FT                   AAQDISGVAELIYQAYSRRRQIFIVGNGGSAFTASHMARDLRIGTALRGKPRLRTCSLA
FT                   DNVAFITSLANDVNYESIFTEQLIGQIEPGDVLIAISCSGNSANVVRAVEYANECGAST
FT                   VGLTGFGGGKLLELCDRCIVLSSCDYGQVEDVHLSLGHIFSCMVKARIEKETV"
FT   gene            200051..200962
FT                   /locus_tag="DET0208"
FT   CDS_pept        200051..200962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0208"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40517"
FT                   /db_xref="GOA:Q3Z9Z3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z3"
FT                   /protein_id="AAW40517.1"
FT                   /translation="MSLSVVICTRNSASTIKDCLDSLMPAYRSSLIREIIIVDAQSTDA
FT                   TCHIAGDYPVRIYFEPGKGVYFGYQYALGIASGEYVLFLDSDAYLDNTSLTSVLNTFTD
FT                   PEIGLVGVYSFSPDKSRLGRCAGQWWDYHRMRLLAHSSSSLFGRLYHRVVGFGAVYTSG
FT                   PCFIASRQCLEATGGFAPELYLYYLHPKLAYPGDIMLSKRAVNAGYKAVWANCGRVGHY
FT                   PPANALELWRQRVNWGRGDAAYLKICRTGFTKRATCVLSRLGSPFMALYLAFRYCNPVH
FT                   LWYLPLAQLAWLGGYFNFRLKR"
FT   gene            200959..202578
FT                   /locus_tag="DET0209"
FT   CDS_pept        200959..202578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0209"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40516"
FT                   /db_xref="GOA:Q3Z9Z2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z2"
FT                   /protein_id="AAW40516.1"
FT                   /translation="MKNEALLLSFSKLFGILALVLWGFSLAGSTFSPDTENILKPPLLL
FT                   FVLAVASLCIGSAFLWKMRTPQTRLLCLYTFIMLIMLWLSPVILQSSPVSAQWTYGIYY
FT                   PNTQFISQTGGIDPAAYTFHNWPGFFILDYSLSAVSGTSCLDFLAFYGPFLMQILMFVP
FT                   LYCLFKNIIPNPNHRFAAIWVFYLANWVAQIYFVPQGVGVFFLICLLALITSPGFSLAQ
FT                   GNAVSHRVVVILVLAALTVTHLLTSVAALLCVAALILSRLVKGFNLGILAIVMVGCWTI
FT                   YGAATQFDSQLPEFVNRAFELENLFQFSSAGSGGEAGAAFLQISQVRFIFSGLFAGLAV
FT                   LGVLLSLKYRHRFDFPLLALEGVAAVILCSMLYGSEFWTRAFLFSLVPIAYFTVKLLRN
FT                   RLTTLIMVAVLLVAIPGHLLAHYGAVSDMVSRFDVSAWQYLENYTQRGYISGGISYIKP
FT                   DYLNLSLKKLNWQDGLLVGQDYTGRYPQYLQIGRSTDVDWVYYYGDSQHVPALETVLED
FT                   SPGYGLIYQNREMNIYFNQGAN"
FT   gene            202664..203434
FT                   /locus_tag="DET0210"
FT   CDS_pept        202664..203434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0210"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40515"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z1"
FT                   /protein_id="AAW40515.1"
FT                   /translation="MNNPWEIILVDGNSTDKTVALAAGFTRNILSDQGRGTSFAHQIGS
FT                   EIASQDYIMFVDADVELPPEAFSRMFAELKKSGLEGIYAQTEGAGRGNFWEKAASDFLS
FT                   CRPSPAGIWFGAGLVKREIVLKYGFDSFISPGDDVDFNRRALSGGCVFGVSAVQVKHHH
FT                   RTTFQNVVRQYIWYGKGRSRLAWKNGLLILRFWPPFPAVYGLVYSLGHFKFRPLSLHLL
FT                   ALVFQSWGMICGLAELVFSPPPDRPPRPCWKWGI"
FT   gene            203434..204648
FT                   /locus_tag="DET0211"
FT   CDS_pept        203434..204648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0211"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40514"
FT                   /db_xref="GOA:Q3Z9Z0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Z0"
FT                   /protein_id="AAW40514.1"
FT                   /translation="MNILHLGSGSLKIPPEGYGGIEKYVFESARCLAARGNKVVIFDIR
FT                   PDKADAKSERIEGVEIVRIHRMSTNRSSSLWLANIYSVLNLLVFSLRARSYIKRNRFEI
FT                   IHIHRTLVGLILVLVLPSQRQKMIYTLHSPVWVMEKGSFKDRMSRKLDIFVIRHIKRVL
FT                   VQSAQIKAILEMERVKSAKIGLLPCGVDTEAFNPAHRSNLIRSKYGIGERLLVLFVGRI
FT                   VPYKGVEYLVRAANLVVNKAGFRECAFLLAGPIAEHGLDALEHAGYPGRVKGLIKEYKL
FT                   EDFVFLTGSLPQDELQTAFASADIFVLPSLAESSPAVVLQALASGCGVIASNISGIREQ
FT                   VIDGVNGVLVKAADEAELAKQILEFLQSPGRRFAMGANGIALVKEQFSWEVLCGRLEGI
FT                   YRESV"
FT   gene            204645..205340
FT                   /locus_tag="DET0212"
FT   CDS_pept        204645..205340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0212"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:SO3266"
FT                   /db_xref="EnsemblGenomes-Gn:DET0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40513"
FT                   /db_xref="GOA:Q3Z9Y9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y9"
FT                   /protein_id="AAW40513.1"
FT                   /translation="MNKIFIRKLLSLSHRYGGYIPLSRLNTVSRWLGNEKGEVLDIGCG
FT                   GGSAMLFLNRRKSFSACGVDINPALIADAKSKKSHQQYFCQDILSLNLDDKSFDTVICL
FT                   ELIEHLPKDEGLALILRLEKIARRRVILSTPVGFSEVEGNHDGDGSAHQCGYLPAELRE
FT                   RGYLVRGNRLRLERAWWPYLLKHSPALASVHWAFWLVTGVIFSPLAYFFPDQVASGMVC
FT                   LKEVGCERK"
FT   gene            205327..206622
FT                   /locus_tag="DET0213"
FT   CDS_pept        205327..206622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0213"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01MT00337"
FT                   /db_xref="EnsemblGenomes-Gn:DET0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40512"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y8"
FT                   /protein_id="AAW40512.1"
FT                   /translation="MKENKAGSPPSILVLSNADFESRGFQAIVRGLENCLGESLPGLTF
FT                   DYFSFAPKRYNYLESNSLRLIPHPWAKGSSETLNIFSYMVLMPKSLLKAVYYKLRPAKN
FT                   PYRRYAALLHINVDCLNETDYGFSCVCLNLLKSWAGLRAFGCPLLTAPVDIGPFNTPVS
FT                   RFLGRYILSKAKLVALRDELSYDYLIKLGLKPENLYLGADMAFLMPPAPPRVMEEVLTA
FT                   EKAVKDNRLIIGISPSLFQMELGNIFAGSAADKPEIYLGLIASLADFAADTLAARIYLI
FT                   PHVHPDDSRVCREVYSRMHRKDSVQVFNGDYPSEIIKGLIGECNIFVSCRMHASIAALS
FT                   QAIPTLTLGYQEKYWKLLGDYLGQSDYLVDIKMPKAEDIQATLRQKLAYMAANRPEISE
FT                   RIKERLEVINQRAALYGQKVAEIISRGKPASR"
FT   gene            complement(206594..207880)
FT                   /locus_tag="DET0214"
FT   CDS_pept        complement(206594..207880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0214"
FT                   /product="iron-sulfur cluster-binding protein/coenzyme
FT                   F420-reducing hydrogenase, beta subunit, putative"
FT                   /note="identified by similarity to SP:P19499; match to
FT                   protein family HMM PF04422"
FT                   /db_xref="EnsemblGenomes-Gn:DET0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40503"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y7"
FT                   /protein_id="AAW40503.1"
FT                   /translation="MANLKAPKSILVTLRQKLCCGCGICQAVCPAGAIKMQIDPQKGIY
FT                   LPKLNEALCQNCGKCLKACPGTGINLDEYTESLFGGKSPFLIKNSCYTAFSSDSLQRHL
FT                   STSGGIATTLLAYALETGLIDGALVSIAPPFSPLTPTGFIARTAEELKQAAGSKYCPVA
FT                   ANTAISEIAARPGRYAVAGLPCHIQAIRKAERQNPVLQERIVLHLGIVCSSTMSFKGTE
FT                   YILKKQGINKDSVTSLSYRTNGWPGNMRLETCGGTTLRLPLKAYHPYHGHGFFTPRRCL
FT                   ICNDQLNELADISLGDAWLKELENDHEGTSAVIVRGSTGQGFYQSAVKNGCIKSQPLAA
FT                   KRVMEWRNKRQDYAAKKAVLPLLGWKLPEYPAPHPPARRIAYLYTIEQVINYHLGRTNS
FT                   SLIIEPAKHFWTGLSGLAERLIGKRASRG"
FT   gene            complement(207873..209195)
FT                   /locus_tag="DET0215"
FT   CDS_pept        complement(207873..209195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0215"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40502"
FT                   /db_xref="GOA:Q3Z9Y6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y6"
FT                   /protein_id="AAW40502.1"
FT                   /translation="MFNKIHPDAAADTRPANLQPYRFFDKIRSPLYINAIFLMIAGGAG
FT                   AALSFVFWILAARFFPPAAVGLAGAAISAMSLLGTISHLGLGFGIIRFLPQKAYPTKSI
FT                   INSSISLTFIVSILAGVIFLLGLGLWSPELVFLRQNLLLAVAFTAFTAATALNSIADDS
FT                   LIAQRHSGYSTLRVITASGLRLILVVILASLFPENGIILAWGLALIAALLVAIFGFIPR
FT                   VSEGFRPGFELCTPYIKSSFGFSLGNNLSQFLGSAPALLLPLLVLGILGAESNAYFYIG
FT                   WSTAAALTTIPASVSTSLFSEGSHDENGLSTHIKKSLKLSLGLILPLVIIFFLLADKIL
FT                   LFFGQEYALSSAGLLRIMIIGLLPQTLNVIYMGSLKVKKRLKGLIAMNCLIAGLSLILS
FT                   FGLIPSMGINGAGLAWVIAQSVCAVYVSSRLFAKRSAPLNG"
FT   gene            209328..210161
FT                   /locus_tag="DET0216"
FT   CDS_pept        209328..210161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0216"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:DRA0063; match to
FT                   protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:DET0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40501"
FT                   /db_xref="GOA:Q3Z9Y5"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y5"
FT                   /protein_id="AAW40501.1"
FT                   /translation="MYLAAIFSKLIKMNYFKKKRSGLLFSLMFICLAGVTFFFWAVPDV
FT                   LGQQYIKQLDYLPSPQAGEKILIFSPHPDDETIALGGYIASACQAGAEVEIVLVTDGSK
FT                   FVNKDIRYQEFENACRLLGVPADNLVFLGFKDGSLQSVPLTRLVDSFNLLINEFSPDIV
FT                   FYPHHKDAHDDHAAISRAVGQSLKVSPGIRCYEYLVHYRIFFPQPRVYNSNLYLLPPLT
FT                   LVNEDQNWLRFDLSEGVLEQKTLALEAYESQLKNPFLKPLIQSFIRQNELVCLPN"
FT   gene            210340..211314
FT                   /locus_tag="DET0217"
FT   CDS_pept        210340..211314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0217"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:DET0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40500"
FT                   /db_xref="GOA:Q3Z9Y4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y4"
FT                   /protein_id="AAW40500.1"
FT                   /translation="MDNILDKKWAYRELGQTGIGLSPLGLGSWQFSRGKGAAIGVWGML
FT                   NQAKVNEIVLNSLAGGINWFDTAEAYGMGQSEESLAEALKQAGIRPGECFIATKWQPTM
FT                   RSASSLKTLLPIREGFLSPYKVDLYQVHFPGLFASIDAQMDNMAALYKEGRIRAIGVSN
FT                   FNASQMRIAQKRLNKHGLSLASNQVKYNLLDRQIETNGVLETARELGISLIAYSPLAMG
FT                   VLSGKYQRNPEYLEMVPFIRRKTIRRALEKSMPVIAKLSEISARYNADIAQVALAWVIY
FT                   GQGDTVFALAGASTPVQARENLRALDIKLTAAEIAELNSVSGS"
FT   gene            complement(211311..211664)
FT                   /locus_tag="DET0218"
FT   CDS_pept        complement(211311..211664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0218"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF02001"
FT                   /db_xref="EnsemblGenomes-Gn:DET0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40499"
FT                   /db_xref="GOA:Q3Z9Y3"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9Y3"
FT                   /protein_id="AAW40499.1"
FT                   /translation="MPRPYKCRRISEIPKVAYYKPAGIPLSLLEENQLSTEEAEALRLK
FT                   DLLGLEQAEAARQMNISRPTFQRMLYSARYKVADALLKGKALRIEGGVFELDARPCCQR
FT                   QIPPSQTDPPGQT"
FT   gene            211817..212311
FT                   /locus_tag="DET0219"
FT   CDS_pept        211817..212311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0219"
FT                   /product="PBS lyase HEAT-like repeat domain protein"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:DET0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40498"
FT                   /db_xref="GOA:Q3Z9Y2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y2"
FT                   /protein_id="AAW40498.1"
FT                   /translation="MADTNFINQQLELLKDPDGLKRQSARLELEDLGSASVPYLVAKLD
FT                   EYQGEALWESVKALSRIGDAASAPALVKLLSHEVSDIRWLASLGLIKIGREAVGPVLRA
FT                   LSLSDARSPFLREEAHHVLTSLRDKALKDDLSGVISALESNSPRSAVPVAAEEALLKLK
FT                   L"
FT   gene            212513..212605
FT                   /locus_tag="DET0220"
FT   CDS_pept        212513..212605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40497"
FT                   /db_xref="GOA:Q3Z9Y1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y1"
FT                   /protein_id="AAW40497.1"
FT                   /translation="MSLQSEKIYLNIVLVTRYKTGFIPGPFRCF"
FT   gene            212825..214951
FT                   /locus_tag="DET0221"
FT   CDS_pept        212825..214951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0221"
FT                   /product="L-lysine 2,3-aminomutase,
FT                   putative/acetyltransferase, GNAT family"
FT                   /note="identified by similarity to GP:5410603; match to
FT                   protein family HMM TIGR00238"
FT                   /db_xref="EnsemblGenomes-Gn:DET0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40487"
FT                   /db_xref="GOA:Q3Z9Y0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Y0"
FT                   /protein_id="AAW40487.1"
FT                   /translation="MAHKISSDYSEEEWGNWKWHVSHTIKDLATVEKLLGVKFSVEKRR
FT                   SLEDTIRNFPMSITPYYFSLIDPKNFENDPVFIQSVPSAAELNFSCHDKEDPLAEDVDS
FT                   PAPGITHRYPDRVLFHVSNRCAMYCRHCTRKRKVGDVDKTLSRDDLVKGLEYIKNTPQV
FT                   RDVLLSGGDPLLLSDSMLEWLLSELKAIPHVQVIRIGTRVPVVLPQRITPHLVKIIKKY
FT                   HPVWVNTHFNHPREITATSIRALRLLADAGIPLGNQTVLLAKVNDCPRVMKALVHKLVE
FT                   NRVRPYYLYQCDPAQGLSHFRTSIGKGIEIIENLIGHTSGFAVPTYVIDAPNGGGKIPI
FT                   MPNYLISQSSSKVILRNYEGIITAYYQPEDYHPPKCGQDCSACNLELDLNGAAEGSLVG
FT                   IARLLSNHEDTDYLVPTECDRMDRRKSGYDQIVTLGTSLIQHGKNSDRIYLMRLAAEET
FT                   ATLLPEMQSLAAENGYTKLFAKVPGDVKTLFEADGFETEAVIPCFYGGTKAGYFMGKFI
FT                   DEGRKTEENAELLEDVLKVAHSKAGKALSFKLPRGYTLRKCTADDTAAMAEVFSTVFAS
FT                   YPFPIYEPEYISRTMTESITYYGIWHGQKLAALASAEQYPLEGHVELTDFATLPDYRRR
FT                   KLAGILLHTMETEMKQKGFGVSYTSAVAESYGMNISFARQGYEFAGRLKNNTQINGGLK
FT                   SMNIWYKCLKKQTK"
FT   gene            complement(215032..216312)
FT                   /locus_tag="DET0222"
FT   CDS_pept        complement(215032..216312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0222"
FT                   /product="serine protease inhibitor family protein"
FT                   /note="identified by match to protein family HMM PF00079"
FT                   /db_xref="EnsemblGenomes-Gn:DET0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40486"
FT                   /db_xref="GOA:Q3Z9X9"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X9"
FT                   /protein_id="AAW40486.1"
FT                   /translation="MKTKLALSLLAVVSLFTFTACAGGVSAEELKSDKDRILSPNVSQQ
FT                   NLNTQVQANNDLAFKLYRYLKGTEEGNFFYSPFSISIALAMTYAGADTATKTEMQNTLN
FT                   YLLPDADLHAFFNFIDQELNKREAQAKEADEGTFELKLVNAIWGQKDYTFLSDFLDTLA
FT                   QNYGAGLRVLDFAANSEEARKVINDWVSDATKDKIKDLIPADGIDATTRLVLTNAIYFN
FT                   AAWAAPFDEENTQSGLFYLQNGTSVNVQMLRQIENHGYYSGDDFQAVELAYAGNGLSMV
FT                   IILPDEGKFAQVEDALSGQMLAEILSSIKSNQINLSLPKFSFESKFTLKDALSSLGMPT
FT                   AFGSQADFSKMDGGYNLMIGDVFHKSFISVSEDGTEAAAATAVSMNLTSAPTELVTLSI
FT                   DRAFIFCIVDMATGTTLFTGRVIDPTA"
FT   gene            216499..217086
FT                   /locus_tag="DET0223"
FT   CDS_pept        216499..217086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0223"
FT                   /product="hemolysin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40485"
FT                   /db_xref="GOA:Q3Z9X8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X8"
FT                   /protein_id="AAW40485.1"
FT                   /translation="MGGVLALIVLVILSWGNWDIMAVSVIYALAVISLFSFSTIYHALK
FT                   KQENEINVWRKLDHIAIFIMIAGTYTPMAYIYLDGGWRLGMLIATWAFVLIGVFQKVFF
FT                   LNAPRWLSPVTYLGMGWMAVFPLREFWLNMPSLVFWLIACGGLAYSIGAVIYGIKKPNP
FT                   VPGVFGFHEIFHALILLGWAFHLAAVILAILG"
FT   gene            complement(217083..219074)
FT                   /locus_tag="DET0224"
FT   CDS_pept        complement(217083..219074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0224"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P45535"
FT                   /db_xref="EnsemblGenomes-Gn:DET0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40484"
FT                   /db_xref="GOA:Q3Z9X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X7"
FT                   /protein_id="AAW40484.1"
FT                   /translation="MLNIQNLSKSFGVRSLYTGVNLNIGARDRLALLGPNGSGKTTLFE
FT                   MIAGRLEADEGKIILRRGTTVGYLEQDIKPSSKQPLLKAVSSASDRLSSLSHKISLLQG
FT                   ELAEEKDGSENNRLMNELGELQHSFEALGGYNAEQEAKLILAGLGFKPVDFDRPLHEFS
FT                   GGWLMRAELAKLLFLSPDILILDEPTNHLDLESTRWFESYLKQYSGSVLFTSHDRAFLN
FT                   SIATKILSLEDQKARLYSGNYDSYLRERELRLNQLESQARRQQELIDKETKFIERFRYK
FT                   ATKASQVQSRIKKLDKLSAVAIPRQTKKIHFNFPEPERSGHDVIKLRNLTKSYGDLVIY
FT                   QGLELVLARGDKAALVGPNGAGKTTLLKILAGVMPFDSGYRNLGANVNTAYFAQYYVES
FT                   LSPANNLIEELETILPDAPEQQLRGMLGAFLFSGDDVKKRISVLSGGEKTRLAIAKMLL
FT                   KPANLVLMDEPTNHLDIPAREILADALQAYKGTLCFITHDRTLIREVANKIIEVRNGKI
FT                   RVFEGDYDAYLEFAAANPFKGEAPKNPAPVISHRPSPVPAALSQKQRKTLEGQIRNQHY
FT                   KETGALKKEISDTEAEITSLEQRKQELETLLADPDLYRSGQKAADTSAEYKNCKEQLVT
FT                   LGDKWLRLCQQNDALKQKLEDALKALDN"
FT   gene            complement(219207..220073)
FT                   /locus_tag="DET0225"
FT   CDS_pept        complement(219207..220073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0225"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40483"
FT                   /db_xref="GOA:Q3Z9X6"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X6"
FT                   /protein_id="AAW40483.1"
FT                   /translation="MKSGKFLATLLSLLMLLSLALGGCSSATDDTDSPDTNNNNPPASE
FT                   TPTTPTGSQLIASILAASPNITSFNTTSVIEMTIQVSGMSVRTVMTTNGQEDLSNQKAH
FT                   LTTSTIMTGELESTLEMEMYLIDSIQYFKITNSDQYTGIQLNTWYKMLMDAQTQNQNWD
FT                   SQTQQNDYLFSKSTLTVDGSETINGVSCWKVTITPDLEELIQYLNEQQAVDDPSSITNP
FT                   ADSLKNVKMTAWIAKDTSFVVKMDMSMDIVTEGQTLSLVMSISIDNINQPVTITLPPDA
FT                   VNAIQLG"
FT   gene            complement(220167..221306)
FT                   /locus_tag="DET0226"
FT   CDS_pept        complement(220167..221306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01CA3526; match
FT                   to protein family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:DET0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40482"
FT                   /db_xref="GOA:Q3Z9X5"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X5"
FT                   /protein_id="AAW40482.1"
FT                   /translation="MTAAISKARRGDPVIILEKTVQLGKKILASGNGRCNLLNEQLDSS
FT                   FYNPEARPLVNSVFSRFGRNEILNFFSELGLHYYSQDGRIFPFTNQAASVLKVLEMEIR
FT                   RLGVKVEYGFDCLSIRKTQNGFSLQAADGRQQTGQNLILTGGGCTYPAFGSDGSGYKLA
FT                   ASLGHRIIKPIPSTVPLVVKDPICHLLQGQRIIARAQSRIRDKVGTPVDGELLFTKYGL
FT                   SGSLILDISQEISLAINRLNIKDVSLGIDLIPFIEPKQMETELLKRRKTGLSPEEMLTG
FT                   ILPNKLCVAFKQLFEKDNPAKAAAKLKNWRFEVSGTRGWNEAEFTAGGIDTGEIDIQTL
FT                   ESKLVKGLYLAGEVLDVNGVRGGYNLGWAWASGYIAGLN"
FT   gene            221293..221490
FT                   /locus_tag="DET0227"
FT   CDS_pept        221293..221490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0227"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40481"
FT                   /db_xref="GOA:Q3Z9X4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X4"
FT                   /protein_id="AAW40481.1"
FT                   /translation="MAAVMPAAPPPIIRVVFWGISKRPLWEICHAGVKRQKLLYTRLRI
FT                   SCWLKGSFVNDGEGGQRVIF"
FT   gene            complement(221528..221869)
FT                   /locus_tag="DET0228"
FT   CDS_pept        complement(221528..221869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40596"
FT                   /db_xref="GOA:Q3Z9X3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X3"
FT                   /protein_id="AAW40596.1"
FT                   /translation="MVRLIIGILLGLWGLPLLVFSAQNLIGSLNESESNAALMFFFVTG
FT                   FPALIMLLGSFFLIRSYLKNPPKLTKAEKPGLAADNTPTTPGRYCPKCGSGLSADASFC
FT                   PACGQKVTP"
FT   gene            complement(221882..222157)
FT                   /locus_tag="DET0229"
FT   CDS_pept        complement(221882..222157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40595"
FT                   /db_xref="GOA:Q3Z9X2"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X2"
FT                   /protein_id="AAW40595.1"
FT                   /translation="MLHWKGSAMPKIGPMELLILIVVIMIPVALIWGLIHLFRKLDKKP
FT                   VRNQPLDTEELNRGVQYCTRCGQKLEAEAEFCPVCGTKKLCTPEKQ"
FT   gene            complement(222217..222540)
FT                   /locus_tag="DET0230"
FT   CDS_pept        complement(222217..222540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0230"
FT                   /product="TM2 domain protein"
FT                   /note="identified by similarity to OMNI:NTL02LI0782; match
FT                   to protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:DET0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40480"
FT                   /db_xref="GOA:Q3Z9X1"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X1"
FT                   /protein_id="AAW40480.1"
FT                   /translation="MYCSKCGKQVAENASFCPACGSQIRQSSLTAEEYQERKSRIAAGL
FT                   LGIFLGSIGVHRFYLGYVGIGIAQIIVTIVTLGIGSIWGFIEGILILTGSFQYDAKGIP
FT                   LRD"
FT   gene            complement(222594..222689)
FT                   /locus_tag="DET0231"
FT   CDS_pept        complement(222594..222689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40479"
FT                   /db_xref="GOA:Q3Z9X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9X0"
FT                   /protein_id="AAW40479.1"
FT                   /translation="MFFLGSGGQPDIPKVFILIKSRLIYYLLRTC"
FT   gene            complement(222756..223439)
FT                   /locus_tag="DET0232"
FT   CDS_pept        complement(222756..223439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0232"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40471"
FT                   /db_xref="GOA:Q3Z9W9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W9"
FT                   /protein_id="AAW40471.1"
FT                   /translation="MKLLLIEDDAEIVDVISTIFQISCPNSRVISASSGRKGIESVESV
FT                   NPDIILLDLGLPDMNGFDVLKQIRNFSDVPIIILTVRGDESDVVRGLTLGANDYITKPF
FT                   RQMELLARVRRLLTKKQINGEDLSVTCGKMHFGSSIRELWIGDTLINLTVSEGRIMYML
FT                   MKNHDKTVSYEELSELLWGDYYPEARSNLKTHILRLRNKIEENASNPKLLINSPNRGYI
FT                   LKTTD"
FT   gene            complement(223420..225243)
FT                   /locus_tag="DET0233"
FT   CDS_pept        complement(223420..225243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0233"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by similarity to OMNI:NTL02MA3318; match
FT                   to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40470"
FT                   /db_xref="GOA:Q3Z9W8"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR012437"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W8"
FT                   /protein_id="AAW40470.1"
FT                   /translation="MKIGLVTCASMLDQVRQIVPLIPQDQFVIYPVLPCCLFAISGDTI
FT                   RNQVDKSVLANEATIIIYGSCHPELNSLLDMYCDSNIRKIEGNNCWEMLLGPERVEKYL
FT                   SQNSWLGNNSFLTKWNREVSKSFGSETRNGQVASSCGIEELTAFRFESNQPDEEIVKRE
FT                   AQKAGLPYSIHNESLDYLKNLIQSAIDKAHIENEARITSGLSPKAELIPLSLLETMKEI
FT                   IYIIDNSGSTVTFISPIIEKLLSITTKEFKMTFLSTQNKGGYLYKKRSQIISKRSAFIT
FT                   DCLERGFEDPLKIEYQIINGKGECRWIRETLNPQFKADGSIGAFAGRIEDITEWKTTEQ
FT                   QLTDLYQNEASLRHELETQIQNRIEFTRALVHELKTPLTPIMAASDTLSSGLKQEPWLN
FT                   LAQNINKGAFNLNKRIDELLDLARGEIGVLQIKKIPIECIELSADIIQYIDAKLRKANL
FT                   RLVFEHDENTIFIEADPDRLRQVLLNLLSNAIKYTPGSGLIKIKCFRTSTDVVFQIIDS
FT                   GIGISSSDMAYLFEPYHRLERDRERFDGMGLGLALSKRFVELHGGRIWVENANEHGSIF
FT                   TFTIPTLTPVKPEHLKLGYKNKRKPYEAAVN"
FT   gene            complement(225245..225847)
FT                   /locus_tag="DET0234"
FT   CDS_pept        complement(225245..225847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40469"
FT                   /db_xref="GOA:Q3Z9W7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W7"
FT                   /protein_id="AAW40469.1"
FT                   /translation="MPAMCKNSLPLYANLLEADYTQVPALSLDELRNFTYSTIEKWEEG
FT                   NCLSAADLTAALEFIKYNIPLAGIKYRDNQAIPICYFSKVIPKSAEVLQSLLQIEGIKS
FT                   YQMPILQKPDGSLDLELDDRHKILIVTIPLYNHLNSFKNFLQFMQPKKLTILAGGNVFY
FT                   LKPSLKLNFGSCIFPENIKDIIWLINKINPSASEEKV"
FT   gene            226290..227762
FT                   /locus_tag="DET0235"
FT   CDS_pept        226290..227762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0235"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40468"
FT                   /db_xref="GOA:Q3Z9W6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W6"
FT                   /protein_id="AAW40468.1"
FT                   /translation="MQNFHSTLSRRDFMKGIGLAGAGFGAAAATAPVFRDLDEGASIAA
FT                   NTYKKNPWWVKERNYCDPTTPIDWDVWKAFDATHYDYIGGQYSEEYLAQIGVPSVLNES
FT                   VAKRHERITSRLGKPGFSMQDWAFCQGAKNVTSSMCYNEFGQSRSMFLGDKKMMDEVMT
FT                   PEQIGLSKYEGTPEYNALMLKSAIRFLGGTDIRCLPVDDKTKRVLNVGENQHPDQPYVW
FT                   EDGISWPYETMTKRAIPTKDAHILVFSYNGSFDGTVRSPSWISNGVAFNQCLSGDSIQL
FT                   YLQRFLKGLGYWLVGGDDFPGIASYPGAGALSGFGEIGRIGHAVGWDKWMRCTRLMVTN
FT                   LPLPADNPIDFGVVSFCTTACKKCAEFCPVSAIKMDSEPSWELATDPSNPYLKPQNFNN
FT                   PGRKTWYLNQAGCFSNWCLTDTFCGICMGECVFNKLADSSIHEVVKPVIANTTLLDGFF
FT                   FNMDKAFGYGCLPEDQWEDWWTLGEKMPIHGI"
FT   gene            227801..228079
FT                   /locus_tag="DET0236"
FT   CDS_pept        227801..228079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0236"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27462922"
FT                   /db_xref="EnsemblGenomes-Gn:DET0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40467"
FT                   /db_xref="GOA:Q3Z9W5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W5"
FT                   /protein_id="AAW40467.1"
FT                   /translation="MFWPIVMVILTIVVGALLMWGKNKGLSFKMYEWLLFIAGIALFIF
FT                   TLENIQGSFQENVPKAALMFVLVTGIPSIILLAIPAIGTFRRGSGRS"
FT   gene            228256..229476
FT                   /locus_tag="DET0237"
FT   CDS_pept        228256..229476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0237"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to GP:7710206"
FT                   /db_xref="EnsemblGenomes-Gn:DET0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40466"
FT                   /db_xref="GOA:Q3Z9W4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W4"
FT                   /protein_id="AAW40466.1"
FT                   /translation="MEYMKTKIGIKQVVISLVVVTLVGSFIVGQLPKETRIESYLPDNG
FT                   TGCTYDLVKYIPPQDYIFKSVDAEGNVTGYITLTEGKGYGGILLVEIEWTPDGTILSIS
FT                   VPQQQEGDAWWDKLKTHEFFEQYVGRQFNTGLLLGEDIDAVSGATISSNGVALGVYEGR
FT                   ALVAAELGEPYPAPVETVKFGLGEILLVTGLLMAVVFRTMAVFQKRKWLRYITLGLGLV
FT                   VLGFWLSRPLSLTNIAAWLIGSPPNMANNLFLYILVIGVVGLALLTGKNFYCFWLCPFA
FT                   AVQEVTHRIGGQIGLRPKPKVYRFLRNIRYLLLWATLVMVFWFTNPSLSVFEPWGTLFS
FT                   QVGTYDQWLLLIVTITFGFFIFSPWCFYLCPVGAFMDVVLKIRKGGIGLWNRLRNPAEK
FT                   KLAGDKT"
FT   gene            229609..230361
FT                   /locus_tag="DET0238"
FT   CDS_pept        229609..230361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03CP1044; match
FT                   to protein family HMM TIGR00290"
FT                   /db_xref="EnsemblGenomes-Gn:DET0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40465"
FT                   /db_xref="GOA:Q3Z9W3"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W3"
FT                   /protein_id="AAW40465.1"
FT                   /translation="MEKAFVSWSGGKDCSLSLYRALKDGYDVRYLASMFTEGTGRLYPH
FT                   HFTPELLISQAEAIGIPLEVTWTSGQEYTNNYIKMLKGFREEGITVAVFGDVSVGNPDA
FT                   LEHRMWVERVCQAAGMRVVLPLWDEDRESIIGDLIDSGFETLIVAADNTNLGKGWLGRK
FT                   LDNELFEELKLLNASSPDGKVGLYHTLTVDGPIFRKKLEIADKKIIYKECGLYDGKPAV
FT                   APFWYLELEDCFLVDKPVLIAESAAGLE"
FT   gene            230439..231110
FT                   /locus_tag="DET0239"
FT   CDS_pept        230439..231110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0239"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40464"
FT                   /db_xref="GOA:Q3Z9W2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W2"
FT                   /protein_id="AAW40464.1"
FT                   /translation="MSCHGCLCKEGIYDHLLKENRLGNLPQTENAFKPRRLLELDEVLA
FT                   RLDELKPQKVFLTGEEASLDPNYAAITRAFHERYGCKNVLYTNGFKMPALGDTDAVEVG
FT                   IKAISEELHQWYTERSVEPIKQNFIRYAHSEVKLTAASILIPGLVEIDEIERIAQFIAG
FT                   VNPDIPYFVLPYFPAGNNSWRKTSPYEVAEAVERVSRYLTNVSGCQGVEQEILHEVERV
FT                   V"
FT   gene            231115..231837
FT                   /locus_tag="DET0240"
FT   CDS_pept        231115..231837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0240"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40454"
FT                   /db_xref="GOA:Q3Z9W1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W1"
FT                   /protein_id="AAW40454.1"
FT                   /translation="MAGTVSRIYYPRVFVTGVGTGGRAFLTPAAEETVKSCGIIVGWPE
FT                   VIKNLGFGLENKLVLEQNCLNYQQLLAEAAGLARAKLEDVALLVMDDPLVYSAGLGGYS
FT                   DIFKDFRIEFIPAVSSLQLLAASARLSLEDCLQVVYRPDASGNIDQSDLALKRERMLKA
FT                   LKAGYHILVLSDLEQTLAQTACFLIEKGLAVETGVIVGEQMGTDSQKITEKSILEVSRD
FT                   TSHWMSCMAVRQGKILKK"
FT   gene            231907..232677
FT                   /locus_tag="DET0241"
FT   CDS_pept        231907..232677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0241"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40453"
FT                   /db_xref="GOA:Q3Z9W0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9W0"
FT                   /protein_id="AAW40453.1"
FT                   /translation="MDRQTNVYHVAYAPAIKKAYLFHWGCNLECRGCLCKKEINCMALE
FT                   ENLDVVFRDPRFCPPQTPSAPLSFGKLISLLQDIELTEVAFEGQEASLDPMLPDICRWL
FT                   KERGCKVILHTNGVAMADASHIDDVIVSLKAITPEIYAGYTCRSNSSLLENFKEYYQAG
FT                   VNLKAESVFIPGYIDLEETEKIARFIASVDENIPYRMDAYFESGDNPWRPPTPEEMQTA
FT                   LEVARKHLKNVYCTQQTKQNLSKADLLYEVVRLY"
FT   gene            232708..233487
FT                   /locus_tag="DET0242"
FT   CDS_pept        232708..233487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40452"
FT                   /db_xref="GOA:Q3Z9V9"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V9"
FT                   /protein_id="AAW40452.1"
FT                   /translation="MTTKSELKKISLGSFEGFTADTVYYTAIGYPNNVFALRFNEMRDV
FT                   ISSRHGIMKSDFLTICHIPDELGLYMHDQSKSHFYYYGQLLADVLKEYDVEIENTAFLS
FT                   TGVQMRNLAFAVERYEELWVVCFTTAGVRHNAVRIGKDAAVGIERNGEFKGFGTICHVV
FT                   VTNASFDHGALVSSIITVTEAKNVALQEMDIRSSHNPDWLATGTGTDQVIVASGFGEKC
FT                   KYVQGHTVIGKMMADAVIKSTKEAVANCIRDTAGQPD"
FT   gene            233493..234233
FT                   /locus_tag="DET0243"
FT   CDS_pept        233493..234233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0243"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40451"
FT                   /db_xref="GOA:Q3Z9V8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V8"
FT                   /protein_id="AAW40451.1"
FT                   /translation="MNIYQITYEPNYRVLGLHFWGCNLFCRGCYKNYRIDDLSLPGSSV
FT                   EQLKDAPRAKNPARFLTLEEVLEKTEGLTPRDIFFMGKEASLDLELPLLAARLHARHKS
FT                   FHTLLTNGRKLTDLSDIDEAVFGFKSASESVHREYTGLSNTGILANFKKVYQSGKKVQA
FT                   EIAFIPDLVEEEEIGALAKTISEIDRRLLFRVTAYFAVPGAPWPSACREQVEDAASVAR
FT                   RYLDNVVTMASDSRDNGWKPEVIF"
FT   gene            234242..235999
FT                   /gene="nrd-1"
FT                   /locus_tag="DET0244"
FT   CDS_pept        234242..235999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrd-1"
FT                   /locus_tag="DET0244"
FT                   /product="ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to OMNI:TM0118; match to
FT                   protein family HMM PF00317; match to protein family HMM
FT                   PF02867"
FT                   /db_xref="EnsemblGenomes-Gn:DET0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40450"
FT                   /db_xref="GOA:Q3Z9V7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V7"
FT                   /protein_id="AAW40450.1"
FT                   /translation="MKLSQNARIVLEKRYLKRDGDGNIAESSEDMFRRVADTVAAAENA
FT                   YNPPGKAACMAEEFYGMMTGFEFLPNSPTLLNAGRELGLLSSCFVLPVADSVAGIAKAV
FT                   GEAMVIHQYGGGTGFAFDAIRPEDDPVKSGHKVAGGPVRLVGVFSEAVNYIKQAGVRCG
FT                   CNSASLPVNHPDILKFIRAKDEGSHSANFGINIALTDDFIRKVRRGEDYELVNPRTGRV
FT                   SGSLSAAEVFYRIARSSWETGDPGIMFIDRINKDNPTPRLGEFITTDPCGGQPLLPYES
FT                   ATLGTINLSGMLLKEGNCCRVDYPRLGGLIAKAVRFLDDVLEVNRYPSAEVEKAARATR
FT                   KIGLGFMGFAEMLIKLGIRYDSAEAVSAADELMAFVKEAACQATEELALERGAFPAFAG
FT                   SIYAQKGAKPRRNATCLTFTNTGTTSIIADTSVGIHPIYSLVMVRNILDGQRLLDINHA
FT                   FEETARERGFFSPALIEKLLTGESPCNCPEIPEDYRRLLVTARDIQPEWCIRVQAAFQK
FT                   YTDNAISQTVNFPADASVEDIADLFLKAHELGLKGVTAYRDSSRELQVLCTGADCRDIA
FT                   RKYFEDCCV"
FT   gene            235992..236531
FT                   /gene="cobA-1"
FT                   /locus_tag="DET0245"
FT   CDS_pept        235992..236531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA-1"
FT                   /locus_tag="DET0245"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by similarity to SP:P13040"
FT                   /db_xref="EnsemblGenomes-Gn:DET0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40449"
FT                   /db_xref="GOA:Q3Z9V6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V6"
FT                   /protein_id="AAW40449.1"
FT                   /translation="MFKVSGKPQPGLVQVFYGDGRGKTSAAMGEIVRAVSAGLRVTVVF
FT                   FMKGERRNAEYSSLKALGVEYAVFGRSSFLSGADARAEDARLCRQALKFAEGQISSGKW
FT                   DLVVLDEINNARYYGFIETEDILKLLSVKPARTSLVLTGKTADKEVAAKADLVAEFRKL
FT                   KHPYDRGILARAGIDY"
FT   gene            236546..237502
FT                   /gene="cobD-1"
FT                   /locus_tag="DET0246"
FT   CDS_pept        236546..237502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD-1"
FT                   /locus_tag="DET0246"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="identified by match to protein family HMM TIGR00380"
FT                   /db_xref="EnsemblGenomes-Gn:DET0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40448"
FT                   /db_xref="GOA:Q3Z9V5"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V5"
FT                   /protein_id="AAW40448.1"
FT                   /translation="MNEYILILILAVLWDLALAEPPAAIHLTVWIGRVISLVEKAGLKI
FT                   RSRALQYIFGMAASLFLIALFGWLTYLLLDYLGGLSFALYLIAAFLILKTTFCLRFNAR
FT                   MSLLVEKYLKGGDYRIESAAPEIRYLLTTVERDKEDGFAPPMISSTIRSLAENASDFLV
FT                   APLFYFLILGVPGAVAYRVCNTLDGMLGHRGEYEYLGKFAACLDDIINYLPSRLTGLMF
FT                   ILAAFVSGMDGQNAWRIALRDQSKTESPNAGWPMASVAGALGVRLERAGHYALGDAAKP
FT                   LSPGHIGQAVRLFGVMSAISIAISTGILLAVYLISLN"
FT   gene            237518..237778
FT                   /locus_tag="DET0247"
FT   CDS_pept        237518..237778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:CT0027"
FT                   /db_xref="EnsemblGenomes-Gn:DET0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40447"
FT                   /db_xref="GOA:Q3Z9V4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V4"
FT                   /protein_id="AAW40447.1"
FT                   /translation="MAREMTHCYVKIPVKPLDDTAMEKLRQLEQKLGLPLIAFSARSDE
FT                   YARLSAEELAELDKLGAELDASIVAYSRGKTARPAGQSCRI"
FT   gene            237790..238941
FT                   /locus_tag="DET0248"
FT   CDS_pept        237790..238941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0248"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="4.4.1.-"
FT                   /note="identified by similarity to SP:O54055"
FT                   /db_xref="EnsemblGenomes-Gn:DET0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40476"
FT                   /db_xref="GOA:Q3Z9V3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V3"
FT                   /protein_id="AAW40476.1"
FT                   /translation="MDELIYLDNAASTPVDPRVVTAMLPYFTWHYGNPSAIHPMGRRAD
FT                   EALETAREQVAALINCQPEEVIFTSGGTESDNLAISGAAMAGRGRHIITSEIEHHAVLL
FT                   ACHALEKKGFEVTYLPVDSFGQVSPKDVEAAITPQTALVSIMAANNVIGTLQPVAEIGA
FT                   VCRRQGVIFHTDAVQMAGHLPLDVKRDNIDLLSLSAHKFNGPKGVGILYAKGDVPLAPL
FT                   ILGGGQESGLRSGTENVPGIAGLGLAAGIAALEMQEEAGRVSSLRKKLAEAILGSIPGS
FT                   RLNGHPQKRLPGNLNISFEGVEGEYLSKELAKQGICVSTGSACSSASHEAPYVLLATGL
FT                   ERDLANCSIRLSLGKMTTPEHIQKTADTLSAVVSQIRRQTPVW"
FT   gene            238955..239761
FT                   /locus_tag="DET0249"
FT   CDS_pept        238955..239761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MJ1613"
FT                   /db_xref="EnsemblGenomes-Gn:DET0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40475"
FT                   /db_xref="GOA:Q3Z9V2"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V2"
FT                   /protein_id="AAW40475.1"
FT                   /translation="MQLKNTGYSPVTLEREVCSLPGVKAEVFSTRVWDAPANLLAVFFD
FT                   EDHAALSGTDGYGSIRLVCNCYLPKDLCDYLHFNHKDYDDYLKDLKQEMASFYSLETQE
FT                   IFMLSTGVSMDEVCYTLESGDKLWVCAWVTAGFKHNAMRIGVDKGAGLEVEGECQPCGT
FT                   INIITATNARLDSAALASSFVTVTEAKVVALQDLNIHSSFNPALQATGTGTDQIVAVSG
FT                   WDFGCRYVGGHTRLGEMTARAVTSACRKALSIQLAKDPNYHSGGKK"
FT   gene            239758..240828
FT                   /locus_tag="DET0250"
FT   CDS_pept        239758..240828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0250"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein, putative"
FT                   /note="identified by similarity to OMNI:NTL01TT0342"
FT                   /db_xref="EnsemblGenomes-Gn:DET0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40474"
FT                   /db_xref="GOA:Q3Z9V1"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9V1"
FT                   /protein_id="AAW40474.1"
FT                   /translation="MSTAAKYATRQITDQAGRQVHFGCLPQRIISLAPSLTEIVYALGA
FT                   EDLLKGVTDYCDYPPEAKNKPRAGGYSTVDVDQIGKIQPDLILAGQIHLKDIVPRLEAL
FT                   GYPVLVLEPSTVEGLLETIRIVGKCTGRAKAAELLAESLGRRTDFITAKIASLSPENRP
FT                   LVYVLHECQTWKTFGSDTIGDTLIEMAGGYNIGRDFGRYYPYPAKEDIKLKNPDIIIAE
FT                   TGYGDNPREPLNIALGEPVLAEVTARRTGRVFGIHSDLVSRAGPRMVDGLECLAHLIHP
FT                   ELFPAKPAVCCGRVYIAGVGPGLAKWVSPRVKELVAEADILVGWKQDLQPVKGLIKSQK
FT                   LKNQAEPLSFALCYVY"
FT   gene            complement(240825..241478)
FT                   /locus_tag="DET0251"
FT   CDS_pept        complement(240825..241478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0251"
FT                   /product="transcriptional repressor LexA, putative"
FT                   /note="identified by similarity to SP:P31080"
FT                   /db_xref="EnsemblGenomes-Gn:DET0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40473"
FT                   /db_xref="GOA:Q3Z9S7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S7"
FT                   /protein_id="AAW40473.1"
FT                   /translation="MEDKSSIGITLKELRKKIGMTQSELARRSGVDRAYISQLESGKTY
FT                   SATLGIAQKLARGLDISTSALLGEKEESLGNLLSRAQAISRRMDDIEFIPVIGYIPAGY
FT                   PELVDEEAASDYVPVPKELLKNASKRVYALRVSGESLKGDGIENGDIIIVDKDSEMFEG
FT                   KIYAVRTAHNEVTAKHLYLNNGQIILRSSNGDYKDLVMTNADILGRVIASIKRF"
FT   gene            241589..241819
FT                   /locus_tag="DET0252"
FT   CDS_pept        241589..241819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40472"
FT                   /db_xref="GOA:Q3Z9S8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S8"
FT                   /protein_id="AAW40472.1"
FT                   /translation="MSNKIVDIIKQYLGKNSISGNQFSRTIGFDPAIWCRIKHKKMQPS
FT                   PAFLTSVARTYPELRLQIQESMFGTEENDGN"
FT   gene            242312..244918
FT                   /locus_tag="DET0253"
FT   CDS_pept        242312..244918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0253"
FT                   /product="DNA primase domain protein"
FT                   /note="identified by similarity to SP:Q08346"
FT                   /db_xref="EnsemblGenomes-Gn:DET0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40463"
FT                   /db_xref="GOA:Q3Z9S5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S5"
FT                   /protein_id="AAW40463.1"
FT                   /translation="MTTATRKYTIDDILAKLQGVKKNGSGWMACCPAHADKNPSLSVCE
FT                   KSGKILIKCFAGCSYETIMSALDMPVNDAMPKTAKSSKKNSPLGRIVMAYPYEQKDGSI
FT                   YYEHVRYQPKTFRFRRPDQNGYYINNMDGIDHILYRLPNLVRGIAEGKSVYIAEGEKDV
FT                   DNIRGLNLVATCNDCGAGKWEDKYSDELKGAPQVIIIADKDEPGRKHASEVALSVHNRG
FT                   VPVKIIEMPGEFQKTEDGYTGVKDFSDWLNAGGTASQLEKLVAEAPVYVPPLIQDSLRE
FT                   ISGERYCVENGRVCLIKGGRDGSLTLPLCNFTARVTEEITRDNGVEVSKFFRILGHDYA
FT                   GNNLPAIEVSASSFPGLNWVVSEWGMRAIIGAGQSVKDCLREAMQLLSQNAQSRHIYTH
FT                   TGWRHINGQDIFLSQGGAIGCDGVDVDLEPQLQRYFLGTPDPEKLRESVRASLNFLYIA
FT                   DLSVTLPLWTTMYLSPLAEALEPAFTLWLVAVSGSYKSTLSALALCHFGDFDNNHLPAS
FT                   WRDTGNQLEKLLFTAKDLPLVIDDWAPGQDNNKKRELEAKAEHIIRAQGNHQGRGRMRS
FT                   DTTSRLSYYPRGMLVTSGEHTPSGHSHTARIISVRLEKEMVDLGLMTEAQTKDRHLYRQ
FT                   AMANYIAWLQPNWLERKCELRQKFTQLRAEITNELSDCKIHSRLPDVVAILLIALSTAL
FT                   EFAKSTGELKADEYDLFMNEGRRYFMDMAKEQGEMVEEQRPGQRAIEAIQASLRIGTAV
FT                   LRNKNDAALTELPSGKTAIGWRDYMNGHTLLDPAATYQVIVQHCAKSNNPYTINELETW
FT                   RDLNRMGFTEASNDGRPTVMARVTAIPKSFRVVKVKNEAIGLAKTTSLPLEGMENV"
FT   gene            245244..245879
FT                   /locus_tag="DET0254"
FT   CDS_pept        245244..245879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0254"
FT                   /product="resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40462"
FT                   /db_xref="GOA:Q3Z9S4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S4"
FT                   /protein_id="AAW40462.1"
FT                   /translation="MKVALYARVSTRDKNQDPEVQLMELRKYCQENGMEITREYIDHAS
FT                   ANDFVRRTAWKQLLVDASARKFRGLLVWKLDRAFRDITVATSSVKMLRNAGIDFIVTTV
FT                   PVLSVQGPAGDLMFNIYAAFAQFEKDTIIERVNAGLSRAKAKGKAFGRPRKAIDFNKVL
FT                   EAHEIACSRVNRITKENQGYSETARILSEQTGLRITAGWVYNRIKAGN"
FT   gene            complement(245933..246118)
FT                   /locus_tag="DET0255"
FT   CDS_pept        complement(245933..246118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40461"
FT                   /db_xref="GOA:Q3Z9S3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S3"
FT                   /protein_id="AAW40461.1"
FT                   /translation="MQDITANEGFDYAYNHRCKCSGITGIIKPHSAGFYFEPFGCHAVT
FT                   STIPSKIICFLKPPIR"
FT   gene            246601..247194
FT                   /locus_tag="DET0256"
FT   CDS_pept        246601..247194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40460"
FT                   /db_xref="GOA:Q3Z9S2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S2"
FT                   /protein_id="AAW40460.1"
FT                   /translation="MMAYLNKNCAKGKERKSMKTVLTKIKGITPLLMHRFPMAGADDTS
FT                   KRRTGVPDWKAEAELSLYKDDHGQIYQPASHIEASLKEASKTLKIPGKRGATYSKLIGS
FT                   AVSVSPDAITHLIQNYETDSRPVVIQKARIVRYRPIFKEWELEFEINIGDEQIPIEVVK
FT                   QALDHAGLYVGIGDFRPGRGGKFGKFIVTKFIEQ"
FT   gene            complement(247482..247718)
FT                   /locus_tag="DET0257"
FT   CDS_pept        complement(247482..247718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40459"
FT                   /db_xref="GOA:Q3Z9S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S1"
FT                   /protein_id="AAW40459.1"
FT                   /translation="MKSIGYLILLISSSSFSSYCSKNASNSISSQTGSPSSIICLDLND
FT                   RIWPNVTTLGQFTIAFSMLFTPLFCVYSITTQY"
FT   gene            248008..248277
FT                   /locus_tag="DET0258"
FT   CDS_pept        248008..248277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40458"
FT                   /db_xref="GOA:Q3Z9S0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S0"
FT                   /protein_id="AAW40458.1"
FT                   /translation="MSRTGVVERGEDDFNLRMLQNELDICAEEMGSAGCEGCSCQRLCD
FT                   RLWASIKPARDNMLSVDEYFDYSRKFKELRAARYCRQYLPLIIA"
FT   gene            complement(248267..248611)
FT                   /locus_tag="DET0259"
FT   CDS_pept        complement(248267..248611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0259"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40457"
FT                   /db_xref="GOA:Q3Z9R9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R9"
FT                   /protein_id="AAW40457.1"
FT                   /translation="MRPQWLVWVVFAFVIGNAMCLILDGVWIGTAEQNFFNALLGFQVM
FT                   SYTDSTMANIGITIANFTNGLIGFFTHALPKLVAWDYSFLDGGWSVIKWFLLWPISAGT
FT                   VLGVILSFRR"
FT   gene            complement(248611..250371)
FT                   /locus_tag="DET0260"
FT   CDS_pept        complement(248611..250371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40456"
FT                   /db_xref="GOA:Q3Z9R8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R8"
FT                   /protein_id="AAW40456.1"
FT                   /translation="MKKFIIAVSMFVMSVLIGPGTILASDITDAIYRADIRATNSSYTA
FT                   MKVSAPFTWSTQSLLDGYYINSGFTNLALRDSIGNDIPFMPGQGSDPWIMWIDQIAQNS
FT                   VLNYSLYTGGETAMGGKLAYFPDTAGMSVVDSASLELGSDFEIELSGYINTSSGTSKLI
FT                   IDKGGAYICYPNNAGEIVALIGSAANISQATYYSATTSRVYGANWYGQTFIPISDIYVN
FT                   SITLWCQKILAPSGNFNVYIYAVSGGVPTGTALATGSISASTISGSAGAQTFYLSQSAK
FT                   LSSGTSYALAFSCPTGDASNYIKVWSENSDAYASGTKCSSSDSGVTWSADSYDYYFVVG
FT                   GYTPAVTLTATGIISSDHTVKTVLSGGTFSLYVDNILADSAAYAGSITDNANNWVIGAN
FT                   GSMPYLYYAKITIGGVLKGSWEWQYATTFTDLSGNSNDATPSFRTTTTDADVSAAIISY
FT                   NAYNLSALVVSGDDKGIQIIDDDEISDTPAGFFGALDPDRLEFLSPINEIISEAGIPLE
FT                   FVWYPFIFGGGAAITMISFGVTRKLLPCIIAGGIWTGFLSAALGADLWTVLPFVVVAAT
FT                   ELVNRKTVSL"
FT   gene            complement(250368..251357)
FT                   /locus_tag="DET0261"
FT   CDS_pept        complement(250368..251357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40455"
FT                   /db_xref="GOA:Q3Z9R7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R7"
FT                   /protein_id="AAW40455.1"
FT                   /translation="MKKVLCGLLLAVVLVLGSPAAQVMAADPTTPTTFSIDDVQVVHNI
FT                   VEAGDSLYAFKYTIAYDSGQPTTPANKLFHFRLMDTDGVTQLGAVEPYAYADSGYGMGY
FT                   SAFYFTADNSPVWEAALIVKMVGSPQYWGSPPEVNYTLTGSDYSQLDTKSENQVLMGNW
FT                   VIEVCRTLEINWAVKLLTETNQGTILNDTGAAYGKGTIPGLQTMCPKIFSVQNQTIDTS
FT                   DRDWNPIKIDEWKLQWDGTVVGAFLAGLAELFSMDWQIVTSFGVGVLVILLFVWGQSKW
FT                   SDNQAAMIAGIHVLNGSTLMGFLHPAILAILTLLNALYLGYLLMGKHA"
FT   gene            complement(251354..252163)
FT                   /locus_tag="DET0262"
FT   CDS_pept        complement(251354..252163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40446"
FT                   /db_xref="GOA:Q3Z9R6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R6"
FT                   /protein_id="AAW40446.1"
FT                   /translation="MPFNWGFIGPEGSGKSIGMTYLDVLHLAKDGQVATFPGYNIYLRQ
FT                   ERDSEGQRILLSHPVTMEQMIMTPIENFRGHIVSIDEIDNFMDSSRSMSMFNLLMSYIA
FT                   KQRRKSGMGFNYTIQEWGDLYYRMRNKTHLLTLCWDLYWSPWGKDRKLERGEIIRWVTF
FT                   DCLGFFTGKPWSQLKTKLLTAKPIREYYDTFAAVDIFEGMKKFEIIKPTTRIDLRPGQL
FT                   EEEPLSPKDEVEHREMDRRIMDDLIEQGVSPKTMGVLHKRLARDKSL"
FT   gene            complement(252173..252601)
FT                   /locus_tag="DET0263"
FT   CDS_pept        complement(252173..252601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40445"
FT                   /db_xref="GOA:Q3Z9R5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R5"
FT                   /protein_id="AAW40445.1"
FT                   /translation="MARKTPFGTENGFTPFQSSSNHNGNGSGINVDDVQNLIGDAQVPS
FT                   VIKELVDPGETPLKLLMRTCFKNEGQVNSAVEYLSRCKATNDKEGEEKLLFKMAANVSI
FT                   DGMARKEVVMALSQRIAPELYTSKKLAANRDAKDDRGP"
FT   gene            complement(252602..252964)
FT                   /locus_tag="DET0264"
FT   CDS_pept        complement(252602..252964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40444"
FT                   /db_xref="GOA:Q3Z9R4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R4"
FT                   /protein_id="AAW40444.1"
FT                   /translation="MKNKNNNNLKPNTLVLDRENGFSLQHIENAAGRRWRFRGQTVFLY
FT                   QSVNGVLSEYRVPAEMKEPPERTYRYLDWTYLVKELFSRTNPWPERIKIGLQVAIVLAL
FT                   LFFIYLIYSSFTGTGA"
FT   gene            complement(252970..253419)
FT                   /locus_tag="DET0265"
FT   CDS_pept        complement(252970..253419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40443"
FT                   /db_xref="GOA:Q3Z9R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R3"
FT                   /protein_id="AAW40443.1"
FT                   /translation="MSMPWQKTKRIQPSLKLTEDSRILEPDLPVYKGVAVDEDTREAWV
FT                   LFPDALIPGENGIGPSTLVINERDTAPVLLGGTKENIRDAKSIRELVNAISHECREEAH
FT                   VSLDKEHKQSWLNNWLPITILSITLLFILMVIVGLISNGTLHLPG"
FT   gene            complement(253435..253695)
FT                   /locus_tag="DET0266"
FT   CDS_pept        complement(253435..253695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40442"
FT                   /db_xref="GOA:Q3Z9R2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R2"
FT                   /protein_id="AAW40442.1"
FT                   /translation="MGNIWKVVLGVAAIAVSLVIYPIILDGVAAITGDANIADYTGLEP
FT                   FANVLPLLILVAMIFGGGLLTFQGVRGARSSSKSKSGKKYS"
FT   gene            complement(253760..254215)
FT                   /locus_tag="DET0267"
FT   CDS_pept        complement(253760..254215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40441"
FT                   /db_xref="GOA:Q3Z9R1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R1"
FT                   /protein_id="AAW40441.1"
FT                   /translation="MQKIFGVVIGIIGIAVVFIIFPMVMDSTHDVQTDRYVETEAAVAT
FT                   GAGETSAGVVLTYELYNNVNTSVISITSDEVTDVPVAGTWTQATKTLTVTGLAAEDSRT
FT                   LTITYEHDALTGFTGMGAFAGIIPLLILVAIISVLVAGIWSSVKGRG"
FT   gene            254362..254658
FT                   /locus_tag="DET0268"
FT   CDS_pept        254362..254658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40440"
FT                   /db_xref="GOA:Q3Z9R0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R0"
FT                   /protein_id="AAW40440.1"
FT                   /translation="MYTVTMNAEKPERQRMPGKTHAVLGLKESSHEVLSFVDDIKYLRK
FT                   KVGPRSLARSLGVSKMTELYWSRGERLPSNPMLYESVKGWAERERAIDAAAVS"
FT   gene            254639..256909
FT                   /locus_tag="DET0269"
FT   CDS_pept        254639..256909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0269"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL02MA0434"
FT                   /db_xref="EnsemblGenomes-Gn:DET0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40439"
FT                   /db_xref="GOA:Q3Z9Q9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q9"
FT                   /protein_id="AAW40439.1"
FT                   /translation="MLRRLVKFISVIVLLAGLIIQPAASVTAADQLTVHFERIYESPVS
FT                   VTFRVTITNEGKALPDLPLEVLFDGLNVSDLSRLTITELTINEYQVSYPTQFETIEESY
FT                   TATGKLVLSIDASGQTLYQDVSLPVMDKSGNLVSSGGEIIKSGAYDRIDQKTGTVYWFT
FT                   DIPVAWQTSTIQEIIPIELADWTAKSKSLKDNKLKTSISLPEKSLEKNPKGDTGWGSGT
FT                   RVWDVTLSLPLLTTDSGWGSQGLMKWDLAGTIYYDDTNSSWWNNNWLYRRFIALDMTTI
FT                   SETLTNFPVYIKLDSTNFDFSRAQDNGEDIRFTDGVSNLDYEIVSWDSVSETAEIYVKN
FT                   PVQLANVATDGIYMYYGNKAVSDGQNPAGVWSNGYVAVYHMSDASSTLINSSVGSLPGT
FT                   KSGDMAAQTAGLLGYAQYFDGINDQIIVAYNAILDITSGSVEAIILPDSAGTDGYIFAK
FT                   GNPALGYYCNTRYIGSINRIEWAGPSAVQSNNVFTDTDWTYISFTCNGRAISFYHNGTA
FT                   AGSQTLSSDPDTNTDGLYIGNRMGGSSGSTYFDGLIDELRISGVVRSAAWLAATNLNLM
FT                   SPDTFLIFGTEEGKPADPANLSADISGNNIELTWVKGDLSLSTVIVRGSLHYPESPDDG
FT                   LVVYDGPAESFTDTGAAGELSTHYYRAWGYSGWGYSDGYSQDRTEGIMIGVIITLGLIA
FT                   IAYIKRDIIMTIIAGISLLLLGYGIIDPDIGGNAIIQALPIILMSVYMIIRAAIYATNR
FT                   REV"
FT   gene            256911..261284
FT                   /locus_tag="DET0270"
FT   CDS_pept        256911..261284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0270"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:DET0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40438"
FT                   /db_xref="GOA:Q3Z9Q8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q8"
FT                   /protein_id="AAW40438.1"
FT                   /translation="MSILYDPSNPVSGSSSRAKLIENVSGRDAVIIKAAEKQRNGQAIQ
FT                   KNTTGQSDVSVKVANDIWTITAPGGLKYEINTKNAEGDVAQYINNFLVNAQAPDNIIQG
FT                   AAEQVPVIKSSGRAITVESEAAGSSKGVAEQEPKVGDKKFTAITEESLAAGSGKTYTYE
FT                   PVNDSDAGTDNSSDTTGTDNNVKVTVDNSTAWTFTTPNGTVYTVPMAGLAWSDPAKMHE
FT                   YITEYLASIGAPANVILAAVERTPDVLQNAQLRTDDIDELKNTLAGMDKSTATAKALAA
FT                   FIDAKGFSSLSPEEQFKKAIEYGLIPADSVYVPPDSGYNVGQNAPPGMPDDVAVSLGLL
FT                   PSNEQIEYNAPNFDWAYMPKNEADKYFAELKEIVGYDVSSDNLKQAMREANEIVTRQNL
FT                   QASSKSISDAVLENIAKQKLSGQLRMADLLGMKPSDIYNKDGSLNSARIATILGGQPSD
FT                   YKTIDDVLRKSADQDSGLARDIIKEIFTFGQAQTKTFNRDDLSKEYDKAAWQAGIKGME
FT                   MAESKEEFITRIIKQQNTGEVLKDFTIYMIPIVGTLYSIGKGDSGGQIALSAAIDVATF
FT                   IPFIGQAAAIARAGARPAAALGKAILAEVKAPLTSVLHPLATAKVALSPFETMIMPRKI
FT                   PLSSAELSFHTVRLPVVDVGGKKALAMALRDEITKKAIAGKTAKATKEGVTAEIQTTAL
FT                   NKTIAPAVISATPDVRPFLDGLTVGVVKDDVKGAASVGKGRDLFVSPSLHTKFSMSTAA
FT                   GVSGSKGALKGAIIIRDPELLSKLKISGKTWAGTAEIEMRLPAGTVLPKPDQLLYSRDA
FT                   YGDLLHILVINGKASPLTQTEINQMKIIGSADTLKNIFNPGTKAKVSKKAGKTTPYDEL
FT                   VEAQKNVTQIKKQLEQLKKTGRISPLSEGTYALGDLHGKYNQVMHTLTREGFVDEAGNW
FT                   IAKDTTLVQAGDIVDRGYGGTKLINKMQVLDAQASKMGSRITTLMGNHDIVFGAVAREL
FT                   KTLPPELLSQAGKVRSKELLGKYAEYFRSTGNETSAKLMELFADGRGHVAEALSADSKT
FT                   LEWLKDRPAMYVKDGVLYVHADSPNVYMQLLKEAKIKGFKGSNLEIVNKYTKELAKTTE
FT                   GSKHFYDLMVKNRYQMTKESAMEMLKTFDAERLVHGHTPQGGRITSKYDGLVTNIDSGS
FT                   GTNGVSKIHHIGEQNIKLVRNKARAITRAEMEAEYARAMEEFRMRDMAVRRGYTVPYTV
FT                   GGFVGKAVAISARPQQSSRRIATSKEARATSELRRPIPNNRRIDTLPRRGGTGIRVTDN
FT                   LSRYTNTSQRISTSATRVPSEGRVNPPETRVNPPVSNPPPRPPIGTYTPKEPDKKRQVT
FT                   TEITRPKLKNGDVAWRQGALGSGGDQRPVWYIKRADGHVEIVFQPPEDAPRLEGTPEET
FT                   FFTRGKKPPTNLTQEMGVTTAKIDIERNPEIRFVQAKAPKIKQSIPRHIRRSIGM"
FT   gene            261335..261679
FT                   /locus_tag="DET0271"
FT   CDS_pept        261335..261679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40429"
FT                   /db_xref="GOA:Q3Z9Q7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q7"
FT                   /protein_id="AAW40429.1"
FT                   /translation="MDIVLALIIGAVGVGFLFALAYLFGSLQGHIDNLRRRYYYIGYHN
FT                   IVDNSKMIVSGPYETSEESLEFVIGKPYIAYAFQYKLKTLDVTTAANQISNGAKYAQLY
FT                   ELTRPPNINN"
FT   gene            complement(262087..263046)
FT                   /locus_tag="DET0272"
FT   CDS_pept        complement(262087..263046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0272"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40428"
FT                   /db_xref="GOA:Q3Z9Q6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q6"
FT                   /protein_id="AAW40428.1"
FT                   /translation="MKDTLIAPQAHDRTIRKLDTLIVSTGLRRHLEAFLLACRVEDLSR
FT                   RTIFDYRQKIGQIIDYMVALGLTDPKEVTASHIRGFLLTKQETCQPVSVHGYYRSIKVF
FT                   FNWLTREGVISFSPMAPIRPPKVPKKIIRPYYPDELRSLLLACEGRGILSLRDRAIMLV
FT                   LIDNGIRLGELANINISDIDVDRETISVWGKGRKQRVVGISKRTQMAVYKYLHARVDNN
FT                   PSLWVTTDSKTLTPKGIYLAIHRLGERAGLKDVRNSPHTFRHTAATLSIKNGGDLFQVQ
FT                   SMLGHTTLAMTRRYAASLQSEAAAEAHKKFSPVDNLKL"
FT   gene            complement(263326..263556)
FT                   /locus_tag="DET0273"
FT   CDS_pept        complement(263326..263556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40427"
FT                   /db_xref="GOA:Q3Z9S8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S8"
FT                   /protein_id="AAW40427.1"
FT                   /translation="MSNKIVDIIKQYLGKNSISGNQFSRTIGFDPAIWCRIKHKKMQPS
FT                   PAFLTSVARTYPELRLQIQESMFGTEENDGN"
FT   gene            263667..264320
FT                   /locus_tag="DET0274"
FT   CDS_pept        263667..264320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0274"
FT                   /product="transcriptional repressor LexA, putative"
FT                   /note="identified by similarity to SP:P31080"
FT                   /db_xref="EnsemblGenomes-Gn:DET0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40426"
FT                   /db_xref="GOA:Q3Z9S7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S7"
FT                   /protein_id="AAW40426.1"
FT                   /translation="MEDKSSIGITLKELRKKIGMTQSELARRSGVDRAYISQLESGKTY
FT                   SATLGIAQKLARGLDISTSALLGEKEESLGNLLSRAQAISRRMDDIEFIPVIGYIPAGY
FT                   PELVDEEAASDYVPVPKELLKNASKRVYALRVSGESLKGDGIENGDIIIVDKDSEMFEG
FT                   KIYAVRTAHNEVTAKHLYLNNGQIILRSSNGDYKDLVMTNADILGRVIASIKRF"
FT   gene            264395..264661
FT                   /locus_tag="DET0275"
FT   CDS_pept        264395..264661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40425"
FT                   /db_xref="GOA:Q3Z9S6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S6"
FT                   /protein_id="AAW40425.1"
FT                   /translation="MDSRRSENLGQLKRLIRLKYFGAKCELRPRKGNEAMPQQQVAYRI
FT                   KNERTGQWWEGKADSPIDAMRKAGNEFPVRNPKFGYFHLTSLK"
FT   gene            264670..267276
FT                   /locus_tag="DET0276"
FT   CDS_pept        264670..267276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0276"
FT                   /product="DNA primase domain protein"
FT                   /note="identified by similarity to SP:Q08346"
FT                   /db_xref="EnsemblGenomes-Gn:DET0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40424"
FT                   /db_xref="GOA:Q3Z9S5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S5"
FT                   /protein_id="AAW40424.1"
FT                   /translation="MTTATRKYTIDDILAKLQGVKKNGSGWMACCPAHADKNPSLSVCE
FT                   KSGKILIKCFAGCSYETIMSALDMPVNDAMPKTAKSSKKNSPLGRIVMAYPYEQKDGSI
FT                   YYEHVRYQPKTFRFRRPDQNGYYINNMDGIDHILYRLPNLVRGIAEGKSVYIAEGEKDV
FT                   DNIRGLNLVATCNDCGAGKWEDKYSDELKGAPQVIIIADKDEPGRKHASEVALSVHNRG
FT                   VPVKIIEMPGEFQKTEDGYTGVKDFSDWLNAGGTASQLEKLVAEAPVYVPPLIQDSLRE
FT                   ISGERYCVENGRVCLIKGGRDGSLTLPLCNFTARVTEEITRDNGVEVSKFFRILGHDYA
FT                   GNNLPAIEVSASSFPGLNWVVSEWGMRAIIGAGQSVKDCLREAMQLLSQNAQSRHIYTH
FT                   TGWRHINGQDIFLSQGGAIGCDGVDVDLEPQLQRYFLGTPDPEKLRESVRASLNFLYIA
FT                   DLSVTLPLWTTMYLSPLAEALEPAFTLWLVAVSGSYKSTLSALALCHFGDFDNNHLPAS
FT                   WRDTGNQLEKLLFTAKDLPLVIDDWAPGQDNNKKRELEAKAEHIIRAQGNHQGRGRMRS
FT                   DTTSRLSYYPRGMLVTSGEHTPSGHSHTARIISVRLEKEMVDLGLMTEAQTKDRHLYRQ
FT                   AMANYIAWLQPNWLERKCELRQKFTQLRAEITNELSDCKIHSRLPDVVAILLIALSTAL
FT                   EFAKSTGELKADEYDLFMNEGRRYFMDMAKEQGEMVEEQRPGQRAIEAIQASLRIGTAV
FT                   LRNKNDAALTELPSGKTAIGWRDYMNGHTLLDPAATYQVIVQHCAKSNNPYTINELETW
FT                   RDLNRMGFTEASNDGRPTVMARVTAIPKSFRVVKVKNEAIGLAKTTSLPLEGMENV"
FT   gene            267602..268237
FT                   /locus_tag="DET0277"
FT   CDS_pept        267602..268237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0277"
FT                   /product="resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40423"
FT                   /db_xref="GOA:Q3Z9S4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S4"
FT                   /protein_id="AAW40423.1"
FT                   /translation="MKVALYARVSTRDKNQDPEVQLMELRKYCQENGMEITREYIDHAS
FT                   ANDFVRRTAWKQLLVDASARKFRGLLVWKLDRAFRDITVATSSVKMLRNAGIDFIVTTV
FT                   PVLSVQGPAGDLMFNIYAAFAQFEKDTIIERVNAGLSRAKAKGKAFGRPRKAIDFNKVL
FT                   EAHEIACSRVNRITKENQGYSETARILSEQTGLRITAGWVYNRIKAGN"
FT   gene            complement(268291..268476)
FT                   /locus_tag="DET0278"
FT   CDS_pept        complement(268291..268476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40422"
FT                   /db_xref="GOA:Q3Z9S3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S3"
FT                   /protein_id="AAW40422.1"
FT                   /translation="MQDITANEGFDYAYNHRCKCSGITGIIKPHSAGFYFEPFGCHAVT
FT                   STIPSKIICFLKPPIR"
FT   gene            268959..269552
FT                   /locus_tag="DET0279"
FT   CDS_pept        268959..269552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40421"
FT                   /db_xref="GOA:Q3Z9S2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S2"
FT                   /protein_id="AAW40421.1"
FT                   /translation="MMAYLNKNCAKGKERKSMKTVLTKIKGITPLLMHRFPMAGADDTS
FT                   KRRTGVPDWKAEAELSLYKDDHGQIYQPASHIEASLKEASKTLKIPGKRGATYSKLIGS
FT                   AVSVSPDAITHLIQNYETDSRPVVIQKARIVRYRPIFKEWELEFEINIGDEQIPIEVVK
FT                   QALDHAGLYVGIGDFRPGRGGKFGKFIVTKFIEQ"
FT   gene            complement(269840..270076)
FT                   /locus_tag="DET0280"
FT   CDS_pept        complement(269840..270076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40412"
FT                   /db_xref="GOA:Q3Z9S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S1"
FT                   /protein_id="AAW40412.1"
FT                   /translation="MKSIGYLILLISSSSFSSYCSKNASNSISSQTGSPSSIICLDLND
FT                   RIWPNVTTLGQFTIAFSMLFTPLFCVYSITTQY"
FT   gene            270366..270635
FT                   /locus_tag="DET0281"
FT   CDS_pept        270366..270635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40411"
FT                   /db_xref="GOA:Q3Z9S0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9S0"
FT                   /protein_id="AAW40411.1"
FT                   /translation="MSRTGVVERGEDDFNLRMLQNELDICAEEMGSAGCEGCSCQRLCD
FT                   RLWASIKPARDNMLSVDEYFDYSRKFKELRAARYCRQYLPLIIA"
FT   gene            complement(270625..270969)
FT                   /locus_tag="DET0282"
FT   CDS_pept        complement(270625..270969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0282"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to OMNI:NTL03SA2242"
FT                   /db_xref="EnsemblGenomes-Gn:DET0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40410"
FT                   /db_xref="GOA:Q3Z9R9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R9"
FT                   /protein_id="AAW40410.1"
FT                   /translation="MRPQWLVWVVFAFVIGNAMCLILDGVWIGTAEQNFFNALLGFQVM
FT                   SYTDSTMANIGITIANFTNGLIGFFTHALPKLVAWDYSFLDGGWSVIKWFLLWPISAGT
FT                   VLGVILSFRR"
FT   gene            complement(270969..272729)
FT                   /locus_tag="DET0283"
FT   CDS_pept        complement(270969..272729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40409"
FT                   /db_xref="GOA:Q3Z9R8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R8"
FT                   /protein_id="AAW40409.1"
FT                   /translation="MKKFIIAVSMFVMSVLIGPGTILASDITDAIYRADIRATNSSYTA
FT                   MKVSAPFTWSTQSLLDGYYINSGFTNLALRDSIGNDIPFMPGQGSDPWIMWIDQIAQNS
FT                   VLNYSLYTGGETAMGGKLAYFPDTAGMSVVDSASLELGSDFEIELSGYINTSSGTSKLI
FT                   IDKGGAYICYPNNAGEIVALIGSAANISQATYYSATTSRVYGANWYGQTFIPISDIYVN
FT                   SITLWCQKILAPSGNFNVYIYAVSGGVPTGTALATGSISASTISGSAGAQTFYLSQSAK
FT                   LSSGTSYALAFSCPTGDASNYIKVWSENSDAYASGTKCSSSDSGVTWSADSYDYYFVVG
FT                   GYTPAVTLTATGIISSDHTVKTVLSGGTFSLYVDNILADSAAYAGSITDNANNWVIGAN
FT                   GSMPYLYYAKITIGGVLKGSWEWQYATTFTDLSGNSNDATPSFRTTTTDADVSAAIISY
FT                   NAYNLSALVVSGDDKGIQIIDDDEISDTPAGFFGALDPDRLEFLSPINEIISEAGIPLE
FT                   FVWYPFIFGGGAAITMISFGVTRKLLPCIIAGGIWTGFLSAALGADLWTVLPFVVVAAT
FT                   ELVNRKTVSL"
FT   gene            complement(272726..273715)
FT                   /locus_tag="DET0284"
FT   CDS_pept        complement(272726..273715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40408"
FT                   /db_xref="GOA:Q3Z9R7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R7"
FT                   /protein_id="AAW40408.1"
FT                   /translation="MKKVLCGLLLAVVLVLGSPAAQVMAADPTTPTTFSIDDVQVVHNI
FT                   VEAGDSLYAFKYTIAYDSGQPTTPANKLFHFRLMDTDGVTQLGAVEPYAYADSGYGMGY
FT                   SAFYFTADNSPVWEAALIVKMVGSPQYWGSPPEVNYTLTGSDYSQLDTKSENQVLMGNW
FT                   VIEVCRTLEINWAVKLLTETNQGTILNDTGAAYGKGTIPGLQTMCPKIFSVQNQTIDTS
FT                   DRDWNPIKIDEWKLQWDGTVVGAFLAGLAELFSMDWQIVTSFGVGVLVILLFVWGQSKW
FT                   SDNQAAMIAGIHVLNGSTLMGFLHPAILAILTLLNALYLGYLLMGKHA"
FT   gene            complement(273712..274521)
FT                   /locus_tag="DET0285"
FT   CDS_pept        complement(273712..274521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40407"
FT                   /db_xref="GOA:Q3Z9R6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R6"
FT                   /protein_id="AAW40407.1"
FT                   /translation="MPFNWGFIGPEGSGKSIGMTYLDVLHLAKDGQVATFPGYNIYLRQ
FT                   ERDSEGQRILLSHPVTMEQMIMTPIENFRGHIVSIDEIDNFMDSSRSMSMFNLLMSYIA
FT                   KQRRKSGMGFNYTIQEWGDLYYRMRNKTHLLTLCWDLYWSPWGKDRKLERGEIIRWVTF
FT                   DCLGFFTGKPWSQLKTKLLTAKPIREYYDTFAAVDIFEGMKKFEIIKPTTRIDLRPGQL
FT                   EEEPLSPKDEVEHREMDRRIMDDLIEQGVSPKTMGVLHKRLARDKSL"
FT   gene            complement(274531..274959)
FT                   /locus_tag="DET0286"
FT   CDS_pept        complement(274531..274959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40406"
FT                   /db_xref="GOA:Q3Z9R5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R5"
FT                   /protein_id="AAW40406.1"
FT                   /translation="MARKTPFGTENGFTPFQSSSNHNGNGSGINVDDVQNLIGDAQVPS
FT                   VIKELVDPGETPLKLLMRTCFKNEGQVNSAVEYLSRCKATNDKEGEEKLLFKMAANVSI
FT                   DGMARKEVVMALSQRIAPELYTSKKLAANRDAKDDRGP"
FT   gene            complement(274960..275322)
FT                   /locus_tag="DET0287"
FT   CDS_pept        complement(274960..275322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40405"
FT                   /db_xref="GOA:Q3Z9R4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R4"
FT                   /protein_id="AAW40405.1"
FT                   /translation="MKNKNNNNLKPNTLVLDRENGFSLQHIENAAGRRWRFRGQTVFLY
FT                   QSVNGVLSEYRVPAEMKEPPERTYRYLDWTYLVKELFSRTNPWPERIKIGLQVAIVLAL
FT                   LFFIYLIYSSFTGTGA"
FT   gene            complement(275328..275777)
FT                   /locus_tag="DET0288"
FT   CDS_pept        complement(275328..275777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40404"
FT                   /db_xref="GOA:Q3Z9R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R3"
FT                   /protein_id="AAW40404.1"
FT                   /translation="MSMPWQKTKRIQPSLKLTEDSRILEPDLPVYKGVAVDEDTREAWV
FT                   LFPDALIPGENGIGPSTLVINERDTAPVLLGGTKENIRDAKSIRELVNAISHECREEAH
FT                   VSLDKEHKQSWLNNWLPITILSITLLFILMVIVGLISNGTLHLPG"
FT   gene            complement(275793..276053)
FT                   /locus_tag="DET0289"
FT   CDS_pept        complement(275793..276053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40403"
FT                   /db_xref="GOA:Q3Z9R2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R2"
FT                   /protein_id="AAW40403.1"
FT                   /translation="MGNIWKVVLGVAAIAVSLVIYPIILDGVAAITGDANIADYTGLEP
FT                   FANVLPLLILVAMIFGGGLLTFQGVRGARSSSKSKSGKKYS"
FT   gene            complement(276118..276573)
FT                   /locus_tag="DET0290"
FT   CDS_pept        complement(276118..276573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40394"
FT                   /db_xref="GOA:Q3Z9R1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R1"
FT                   /protein_id="AAW40394.1"
FT                   /translation="MQKIFGVVIGIIGIAVVFIIFPMVMDSTHDVQTDRYVETEAAVAT
FT                   GAGETSAGVVLTYELYNNVNTSVISITSDEVTDVPVAGTWTQATKTLTVTGLAAEDSRT
FT                   LTITYEHDALTGFTGMGAFAGIIPLLILVAIISVLVAGIWSSVKGRG"
FT   gene            276720..277016
FT                   /locus_tag="DET0291"
FT   CDS_pept        276720..277016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40393"
FT                   /db_xref="GOA:Q3Z9R0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9R0"
FT                   /protein_id="AAW40393.1"
FT                   /translation="MYTVTMNAEKPERQRMPGKTHAVLGLKESSHEVLSFVDDIKYLRK
FT                   KVGPRSLARSLGVSKMTELYWSRGERLPSNPMLYESVKGWAERERAIDAAAVS"
FT   gene            276997..279267
FT                   /locus_tag="DET0292"
FT   CDS_pept        276997..279267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0292"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00694"
FT                   /db_xref="EnsemblGenomes-Gn:DET0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40392"
FT                   /db_xref="GOA:Q3Z9Q9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q9"
FT                   /protein_id="AAW40392.1"
FT                   /translation="MLRRLVKFISVIVLLAGLIIQPAASVTAADQLTVHFERIYESPVS
FT                   VTFRVTITNEGKALPDLPLEVLFDGLNVSDLSRLTITELTINEYQVSYPTQFETIEESY
FT                   TATGKLVLSIDASGQTLYQDVSLPVMDKSGNLVSSGGEIIKSGAYDRIDQKTGTVYWFT
FT                   DIPVAWQTSTIQEIIPIELADWTAKSKSLKDNKLKTSISLPEKSLEKNPKGDTGWGSGT
FT                   RVWDVTLSLPLLTTDSGWGSQGLMKWDLAGTIYYDDTNSSWWNNNWLYRRFIALDMTTI
FT                   SETLTNFPVYIKLDSTNFDFSRAQDNGEDIRFTDGVSNLDYEIVSWDSVSETAEIYVKN
FT                   PVQLANVATDGIYMYYGNKAVSDGQNPAGVWSNGYVAVYHMSDASSTLINSSVGSLPGT
FT                   KSGDMAAQTAGLLGYAQYFDGINDQIIVAYNAILDITSGSVEAIILPDSAGTDGYIFAK
FT                   GNPALGYYCNTRYIGSINRIEWAGPSAVQSNNVFTDTDWTYISFTCNGRAISFYHNGTA
FT                   AGSQTLSSDPDTNTDGLYIGNRMGGSSGSTYFDGLIDELRISGVVRSAAWLAATNLNLM
FT                   SPDTFLIFGTEEGKPADPANLSADISGNNIELTWVKGDLSLSTVIVRGSLHYPESPDDG
FT                   LVVYDGPAESFTDTGAAGELSTHYYRAWGYSGWGYSDGYSQDRTEGIMIGVIITLGLIA
FT                   IAYIKRDIIMTIIAGISLLLLGYGIIDPDIGGNAIIQALPIILMSVYMIIRAAIYATNR
FT                   REV"
FT   gene            279269..283642
FT                   /locus_tag="DET0293"
FT   CDS_pept        279269..283642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0293"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:DET0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40391"
FT                   /db_xref="GOA:Q3Z9Q8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q8"
FT                   /protein_id="AAW40391.1"
FT                   /translation="MSILYDPSNPVSGSSSRAKLIENVSGRDAVIIKAAEKQRNGQAIQ
FT                   KNTTGQSDVSVKVANDIWTITAPGGLKYEINTKNAEGDVAQYINNFLVNAQAPDNIIQG
FT                   AAEQVPVIKSSGRAITVESEAAGSSKGVAEQEPKVGDKKFTAITEESLAAGSGKTYTYE
FT                   PVNDSDAGTDNSSDTTGTDNNVKVTVDNSTAWTFTTPNGTVYTVPMAGLAWSDPAKMHE
FT                   YITEYLASIGAPANVILAAVERTPDVLQNAQLRTDDIDELKNTLAGMDKSTATAKALAA
FT                   FIDAKGFSSLSPEEQFKKAIEYGLIPADSVYVPPDSGYNVGQNAPPGMPDDVAVSLGLL
FT                   PSNEQIEYNAPNFDWAYMPKNEADKYFAELKEIVGYDVSSDNLKQAMREANEIVTRQNL
FT                   QASSKSISDAVLENIAKQKLSGQLRMADLLGMKPSDIYNKDGSLNSARIATILGGQPSD
FT                   YKTIDDVLRKSADQDSGLARDIIKEIFTFGQAQTKTFNRDDLSKEYDKAAWQAGIKGME
FT                   MAESKEEFITRIIKQQNTGEVLKDFTIYMIPIVGTLYSIGKGDSGGQIALSAAIDVATF
FT                   IPFIGQAAAIARAGARPAAALGKAILAEVKAPLTSVLHPLATAKVALSPFETMIMPRKI
FT                   PLSSAELSFHTVRLPVVDVGGKKALAMALRDEITKKAIAGKTAKATKEGVTAEIQTTAL
FT                   NKTIAPAVISATPDVRPFLDGLTVGVVKDDVKGAASVGKGRDLFVSPSLHTKFSMSTAA
FT                   GVSGSKGALKGAIIIRDPELLSKLKISGKTWAGTAEIEMRLPAGTVLPKPDQLLYSRDA
FT                   YGDLLHILVINGKASPLTQTEINQMKIIGSADTLKNIFNPGTKAKVSKKAGKTTPYDEL
FT                   VEAQKNVTQIKKQLEQLKKTGRISPLSEGTYALGDLHGKYNQVMHTLTREGFVDEAGNW
FT                   IAKDTTLVQAGDIVDRGYGGTKLINKMQVLDAQASKMGSRITTLMGNHDIVFGAVAREL
FT                   KTLPPELLSQAGKVRSKELLGKYAEYFRSTGNETSAKLMELFADGRGHVAEALSADSKT
FT                   LEWLKDRPAMYVKDGVLYVHADSPNVYMQLLKEAKIKGFKGSNLEIVNKYTKELAKTTE
FT                   GSKHFYDLMVKNRYQMTKESAMEMLKTFDAERLVHGHTPQGGRITSKYDGLVTNIDSGS
FT                   GTNGVSKIHHIGEQNIKLVRNKARAITRAEMEAEYARAMEEFRMRDMAVRRGYTVPYTV
FT                   GGFVGKAVAISARPQQSSRRIATSKEARATSELRRPIPNNRRIDTLPRRGGTGIRVTDN
FT                   LSRYTNTSQRISTSATRVPSEGRVNPPETRVNPPVSNPPPRPPIGTYTPKEPDKKRQVT
FT                   TEITRPKLKNGDVAWRQGALGSGGDQRPVWYIKRADGHVEIVFQPPEDAPRLEGTPEET
FT                   FFTRGKKPPTNLTQEMGVTTAKIDIERNPEIRFVQAKAPKIKQSIPRHIRRSIGM"
FT   gene            283693..284037
FT                   /locus_tag="DET0294"
FT   CDS_pept        283693..284037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40390"
FT                   /db_xref="GOA:Q3Z9Q7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q7"
FT                   /protein_id="AAW40390.1"
FT                   /translation="MDIVLALIIGAVGVGFLFALAYLFGSLQGHIDNLRRRYYYIGYHN
FT                   IVDNSKMIVSGPYETSEESLEFVIGKPYIAYAFQYKLKTLDVTTAANQISNGAKYAQLY
FT                   ELTRPPNINN"
FT   gene            complement(284445..285404)
FT                   /locus_tag="DET0295"
FT   CDS_pept        complement(284445..285404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0295"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40389"
FT                   /db_xref="GOA:Q3Z9Q6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q6"
FT                   /protein_id="AAW40389.1"
FT                   /translation="MKDTLIAPQAHDRTIRKLDTLIVSTGLRRHLEAFLLACRVEDLSR
FT                   RTIFDYRQKIGQIIDYMVALGLTDPKEVTASHIRGFLLTKQETCQPVSVHGYYRSIKVF
FT                   FNWLTREGVISFSPMAPIRPPKVPKKIIRPYYPDELRSLLLACEGRGILSLRDRAIMLV
FT                   LIDNGIRLGELANINISDIDVDRETISVWGKGRKQRVVGISKRTQMAVYKYLHARVDNN
FT                   PSLWVTTDSKTLTPKGIYLAIHRLGERAGLKDVRNSPHTFRHTAATLSIKNGGDLFQVQ
FT                   SMLGHTTLAMTRRYAASLQSEAAAEAHKKFSPVDNLKL"
FT   gene            285527..286027
FT                   /locus_tag="DET0296"
FT   CDS_pept        285527..286027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0296"
FT                   /product="precorrin-6Y C5,15-methyltransferase, putative"
FT                   /note="identified by similarity to SP:P21921; similarity to
FT                   SP:Q10671; match to protein family HMM PF00590"
FT                   /db_xref="EnsemblGenomes-Gn:DET0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40388"
FT                   /db_xref="GOA:Q3Z9Q5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q5"
FT                   /protein_id="AAW40388.1"
FT                   /translation="MPKLAALEAQKNGDTVVVLKTGDPLVAPAGLDGITSTFNGFEVEI
FT                   IPGISSVQLAAAKAGISLYDAAIITYHPLPHDGGKDLRKKRRRMLDALSWGLHLIVLTG
FT                   VRQMPNATARCLLDRGIAPDSRVMVIENPACPDEKITSCSLADVSSQRFGWFSVMVVFN
FT                   KPD"
FT   gene            complement(286081..286500)
FT                   /locus_tag="DET0297"
FT   CDS_pept        complement(286081..286500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01MM2691"
FT                   /db_xref="EnsemblGenomes-Gn:DET0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40387"
FT                   /db_xref="GOA:Q3Z9Q4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q4"
FT                   /protein_id="AAW40387.1"
FT                   /translation="MGKMSQEVINLFQDPSVPKMVATIDKKGELNVTPKTSMTAVDAET
FT                   LAFADLYGRTTRTFKNLEETKKVAIVAVKVPVAPPFTTYQVKGTFLKYHTSGPLFDQFA
FT                   KALKEAMGVDITGVGTVKVDAVYSQAPQDKGKLIS"
FT   gene            complement(286682..286849)
FT                   /locus_tag="DET0298"
FT   CDS_pept        complement(286682..286849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40377"
FT                   /db_xref="GOA:Q3Z9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q3"
FT                   /protein_id="AAW40377.1"
FT                   /translation="MSTWALIFILATGICGFTLKTPHNPLKGFITIKLFWVHLLLGITA
FT                   IVLAVLVLLS"
FT   gene            286986..287729
FT                   /locus_tag="DET0299"
FT   CDS_pept        286986..287729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0299"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:DET0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40376"
FT                   /db_xref="GOA:Q3Z9Q2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q2"
FT                   /protein_id="AAW40376.1"
FT                   /translation="MKYLNCMMDLWLFDSLNPQEKTEISRLFRRPEYLKNEYLFSEGEP
FT                   ASAVFVVAKGRVKLFKTAENGREIILAYLTQNQLFGEEILFNDAIRTITAVAMEDTRLC
FT                   ACYKSDFENLLSQNSQIAVKVIRTLSEKINNITETLADMAIYDIQNRLARTLARLAKEH
FT                   GEDVGDGRRLNFRLTHDDLGSLVGASRVMVTNVIKSLKKSGIIKDDIDHKLVVSQWFLN
FT                   DFSDEMPKFIRKDSSACKCFPKPGE"
FT   gene            complement(287810..288487)
FT                   /locus_tag="DET0300"
FT   CDS_pept        complement(287810..288487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0300"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40375"
FT                   /db_xref="GOA:Q3Z9Q1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q1"
FT                   /protein_id="AAW40375.1"
FT                   /translation="MKLLFIEDDKKIVESVFLLFKSFWPDMETKAVHLGKTGIEAVYKD
FT                   DFDIAIIDLGLPDIDGINVLKQIRAFSSLPILILTARNNEQEIFTAFELGADDYITKPF
FT                   QPLELIARVKSLLKRLNKTSQDLGIKYGHWRFGNSLKEISYKNNRVNLTVTEGQLLHIL
FT                   LSKTGSTVSYADISKSIWGRNEYYAKETIKTHIMRIRQKLSRIDGAKEFIINIPGVGYQ
FT                   ITE"
FT   gene            complement(288484..289764)
FT                   /locus_tag="DET0301"
FT   CDS_pept        complement(288484..289764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0301"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40374"
FT                   /db_xref="GOA:Q3Z9Q0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9Q0"
FT                   /protein_id="AAW40374.1"
FT                   /translation="MKMPSSERIGTADYCSQIVKIMQRNTLVGMAIVDQKMHQIIHVNQ
FT                   ALCKMLGYRKKELIGKTMFDLTHPDDLEISYQHAMRIWDDEHCYSKIVKRYSKKDGGFI
FT                   WAESEGFLLKDNSDNGILSITFIKDVTREISFSAAAPVNISGNPALSGQENLAIDVKKL
FT                   LSDEINKRKLVYNQLLASYENEKKLRKCIQTEMKSRLEFTRIVVHDLKTPLTSIISSSG
FT                   VLSNIAADGKYKALAANIYESTMNLNTRLDELLDMAQCEVRDPKLNRSRFNIKEMLDHI
FT                   ISIQHGMYNTNHIDFKIIIAPEVSFIIADEDRLRQILDNLIDNAIKYSPDSGLISINIS
FT                   RDQNNVLFSVSDSGIGIEPGEIKNIFKPYYRVESRQKKLQGLGLGLSIVRTYVKLHGGR
FT                   IWVESEYGKGTTFLFTIPQPPLKVSST"
FT   gene            290049..291593
FT                   /locus_tag="DET0302"
FT   CDS_pept        290049..291593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0302"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40373"
FT                   /db_xref="GOA:Q3Z9P9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P9"
FT                   /protein_id="AAW40373.1"
FT                   /translation="MNKFHSIVSRRDFMKGLGLAGAGLGAAAAAAPVFHDLDEAASAPV
FT                   AGGFRRPWWVKEREYEDPTCEVDWNQIERSDNSWTMHGVRNGVKGGYLFAGQKYLDWQK
FT                   EGSDLAFNGVKNNEPGLTLRDMALEGGASPLLMGLNKVVNFVLPEIDQNEVLAQFGFTA
FT                   AAWPNASSFWVASAPPDFWGVSKWQGTPEENSRMLRSAMRFFGASEVRFAELNEKTKKL
FT                   IFTHHVHNTPIVFEDVDRAYEVAGQKFVLPDKPLYIISVAIQMSKEMYRQGNAGIRFAA
FT                   NNMRYRLNNVVQVATQSFLKGIGYQGIGYPSESLFHGMMPSQADAILTGFAEMARNNNY
FT                   CISPEFGTVVGYYSILTDLPLAPDKPIDAGYFRFCHTCRKCAEACPSQAISFDSEPSWE
FT                   IPPSSVDPAKETKYSTPGKKVFHTDSPACYSRWIGLHGCARCMGTCVFNTNMKAMVHDV
FT                   VRATVGTTGLFNGFLWNADKAFGYGLVPPEKWEEWWDKDYPVLGQDSTIGSYYGGY"
FT   gene            291617..291889
FT                   /locus_tag="DET0303"
FT   CDS_pept        291617..291889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0303"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40372"
FT                   /db_xref="GOA:Q3Z9P8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P8"
FT                   /protein_id="AAW40372.1"
FT                   /translation="MWLLLGILLGIIALGLVWWSKKSNTSLQWYDWVIGLAGLAMLLFT
FT                   VQNYFASVAEGEPKASYMFLLVTGLPAVILLAVVWQLLARRAKQS"
FT   gene            complement(291965..292636)
FT                   /locus_tag="DET0304"
FT   CDS_pept        complement(291965..292636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0304"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40371"
FT                   /db_xref="GOA:Q3Z9P7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P7"
FT                   /protein_id="AAW40371.1"
FT                   /translation="MERILIVEDDFKTADAFVSIFKLTWPNAEIFTAQTGWEGIRLLEE
FT                   YSPHIIILDIGLPDINGFEVISEIRHFTDIPIMVITARTDELDVVKALELGANDFISKP
FT                   PRKMELIARIKALIRKKSVDDLSFGNINFDKIQRTIHINNSKVDLSVYESLLFEKLILA
FT                   APNTATYTQLTEHLWGEDNEENIKKLKVHIQYLRTKIEKSTGNSSVIINRSGLGYFLRN
FT                   P"
FT   gene            complement(292640..293917)
FT                   /locus_tag="DET0305"
FT   CDS_pept        complement(292640..293917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0305"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by similarity to OMNI:NTL01MM3099; match
FT                   to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40370"
FT                   /db_xref="GOA:Q3Z9P6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P6"
FT                   /protein_id="AAW40370.1"
FT                   /translation="MRISKLNTSPGSTAERHQTRPVSRLNSLATKYKMTRRMINLNLYR
FT                   QNKEQKSQKLNCQKLYRKYKTIFDLSSDPIVIAEVKGTGPHDRMIVEINEAAIKHFGYS
FT                   RSELLMHDTSFLHPPEEVDALLSWVGTEMNKNHHVFFEAKHLRKDGNVLDVEIHATQIA
FT                   IDNSPISIAVIRDISERKSLEKRAIKLHQAEQKFRIELESQIYQRTEFYKALVHELKTP
FT                   LTPIVLNSEMLEDNLEGKHKKLADNIKLSSLELLARINELYDMAKGEVGTLQINRTWIS
FT                   LFDLINEIASVLSPSLNSKQLRLHLFFRPHLPPVYADQNRLKQVLVNLLNNAITFSLPK
FT                   NKITMICGFNQKYVTIEIMDEGTGISEDDLHKLFKPYVLTKSDGLGLGLALSKKIIELH
FT                   SGKIRVKSIKDTGSKFSIILPANNTD"
FT   gene            294215..295732
FT                   /locus_tag="DET0306"
FT   CDS_pept        294215..295732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0306"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40361"
FT                   /db_xref="GOA:Q3Z9P5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P5"
FT                   /protein_id="AAW40361.1"
FT                   /translation="MSKQHSTVSRRDFLNGLGLTGAGIGLASAASPVFHDMDELLASSG
FT                   PINKRPWWVKERNIKDATTPIEWSAVQRRPYFWAYPMTAHQEAIIQGLMKPEDLPYQVQ
FT                   RILTAEELETRNQVVIDYCKNEFPGWEPGPDGFGDLRNTALAQVSEFFGFTRFPRRFQT
FT                   NGKIINLAQLVADAGGGDRIDGFLPPMYEGVKSPEEMGIPKWQGTPEENLMTLRSVARL
FT                   FGAEDVGCIELDDDIKKMVFDSEMDGKKYVFEDVDAAYETATKRVIPNNCKYVFTWSMR
FT                   QPPNMTRHQAGRKENAPTYIAYMRGHFLSCYIKDFVRGLGYTMVGAGGTGIGCIGPTGG
FT                   FAALSGLGELGRASYVIHPKYGLTNRAMWMHITNFPIVPTKPIDFGSREFCKTCKICAE
FT                   ACPFGAIKTGDPTWEDDTIYGNPGFLGWHCNYDLCPHCPVCQGTCPFNTIRDDKSFIHE
FT                   LVRISASHTTVFNTFFRNMDLNFDYGRKDQRDWWKEEDFPFGIDTSY"
FT   gene            295765..296040
FT                   /locus_tag="DET0307"
FT   CDS_pept        295765..296040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0307"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40360"
FT                   /db_xref="GOA:Q3Z9P4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P4"
FT                   /protein_id="AAW40360.1"
FT                   /translation="MLYWVGLIVGIALAVWIGWLVMQKQFKFRWYEVVLAALGFTSAFA
FT                   AVQHYFASVREYEHTSAWLGALVFGLLALIMLGVSLQLVRSHNRTR"
FT   gene            296108..296713
FT                   /locus_tag="DET0308"
FT   CDS_pept        296108..296713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0308"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:Q58075"
FT                   /db_xref="EnsemblGenomes-Gn:DET0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40359"
FT                   /db_xref="GOA:Q3Z9P3"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P3"
FT                   /protein_id="AAW40359.1"
FT                   /translation="MDALRPFSQSMSPESISYYRRLTAEYEAYCQQQMDNHFMAAKFNF
FT                   KSCQRCGYCCLCYPCIPRPDEIAPAARYLEMTISDFVNKYMVADTADCQIFFLRWAKEG
FT                   QEDITGARIPPWRTYDRGYCVLFDKEKKSCRIHPVRPSEAKLIKCWDNRQSRDKKLWGM
FT                   SGWGKDDIFAFLPDFDPKYFRNAKLNTSSLIFKGESNL"
FT   gene            complement(296773..296865)
FT                   /locus_tag="DET0309"
FT   CDS_pept        complement(296773..296865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40358"
FT                   /db_xref="GOA:Q3Z9P2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P2"
FT                   /protein_id="AAW40358.1"
FT                   /translation="MQNIIAGLYPVLCLNKITGIDRQNHQKGNH"
FT   gene            296875..298593
FT                   /locus_tag="DET0310"
FT   CDS_pept        296875..298593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0310"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to GP:7710206"
FT                   /db_xref="EnsemblGenomes-Gn:DET0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40357"
FT                   /db_xref="GOA:Q3Z9P1"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P1"
FT                   /protein_id="AAW40357.1"
FT                   /translation="MLFKFNLKRVLILLAGLSLLIAGLVGHLSESHGEDKSALYENYLA
FT                   DAFTGIADYSLLKVDPTNLGYIYAVEDNDDLLAGYVTITTGQGYGGLLTVVLNWSLDGE
FT                   IQSISIPQNSDDKAWWDQLITGDFFDQYIGRKFDDALVLGADINAISGSTISCNGVALG
FT                   VHAGRALVAEQLAKPYPIPEEKIKFGLSEALLIGGLCTVVLFRMLSVLARFRWVRYVTL
FT                   FFGLGVLGIWLARPLSLTNFAVWIMGSPPHLNTNLFLYILVIGVVLLALIFGKNFYCYW
FT                   LCPYSAVQEIAYKLGQVGLRPSAKWHKRLRNVRYFILWFALFFTILLGSVSITVFEPWG
FT                   TLFSMKGSFDQWVLLGISVASGFFIYNAWCFYVCPVGAFMDIVLIVRRKGRDLWNTIGI
FT                   PLIKRQVQVSRYDSDYCRVVNHLKNQVDIEGGVFGDVSIGNEEASLHESWVKNICHSTG
FT                   IQAHLPLWNINREDILKMLIYYGFEVLMIVTDDSKLGKEWLGKKLDLDVLAELKNRFEK
FT                   SEDGRVGYYHTLVVDGPIFQKRLNLEKVSAVFRRDEWGSNWYLDIEDYSLVSKYQ"
FT   gene            298706..300253
FT                   /locus_tag="DET0311"
FT   CDS_pept        298706..300253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0311"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40356"
FT                   /db_xref="GOA:Q3Z9P0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9P0"
FT                   /protein_id="AAW40356.1"
FT                   /translation="MDKFHSTLSRRDFMKAVGLAGAGVGAVTAASPVFHDLDEVSQIGG
FT                   VTEKRPWYVRELEYAKPTVEIDWNVIQRQTHYNNWEDHLDQAEKDKRAHMYYDNTKQMV
FT                   LENNPGNTMFDVAIRHPAWTAVRRNMDYFFGVEGIQQDTPPGFEMGFDPESGHCVISPV
FT                   WATDLFGIITPDNMGVPRWEGTPEQNAALIRMAARWCGGAEVGYLKADEYTKKLVHKTC
FT                   GVLPILADKNGKEVVWEDVDQPYETDKKMVIPEKCNNIIVVVIREARNPALMAPSYRAD
FT                   ATTAKSYARSIAFDIHFRGFIHAIGYTTAGSGWGPWNNVPFGVLSGIGELGRMRGQITP
FT                   SCGPLIRKVEVFFTDLPLPTTNPIDFGANRFCRDCGLCAKACPASAIPTFREPTYEITP
FT                   ADDANSNPTKLIPEYFNLSGKKVWPNNDFACHNFWVTSGKHGCAACVASCVFSKDIKSS
FT                   IHEVVKGVVSQTGIFNGFFANMDHAFGYGIVKDQNMWDNFWFEPDKYWPLEGIETNL"
FT   gene            300296..300592
FT                   /locus_tag="DET0312"
FT   CDS_pept        300296..300592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0312"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40355"
FT                   /db_xref="GOA:Q3Z9N9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N9"
FT                   /protein_id="AAW40355.1"
FT                   /translation="MWSLYTLIWMLIGIALGVGFTFLINKLGQKGISLRLYEWIIGIAG
FT                   LILFLFTIQNFYTAFQEFYSQAAYMFLLVTGLPAIILMLVSWQLVTRRIKAQS"
FT   gene            300678..300824
FT                   /locus_tag="DET0313"
FT   CDS_pept        300678..300824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40354"
FT                   /db_xref="GOA:Q3Z7B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z7B9"
FT                   /protein_id="AAW40354.1"
FT                   /translation="MSGEKSKPAKRPDSGTALPVTTERAGAELKIISPLLYSGGGIFYG
FT                   ERE"
FT   gene            300832..301614
FT                   /locus_tag="DET0314"
FT   CDS_pept        300832..301614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MJ1613"
FT                   /db_xref="EnsemblGenomes-Gn:DET0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40346"
FT                   /db_xref="GOA:Q3Z9N7"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N7"
FT                   /protein_id="AAW40346.1"
FT                   /translation="MEGTKVISELKTDTCYKELGSFHGVKAGIVYHKALGASTNTLVIE
FT                   LPEERNILSTRTGLGKARYILNTHIPPELWDFMHDNSSDWQTAYSVVLEEVLERYGTDL
FT                   DKVSFLSTGVDQDKIAWAEESYEEFWVLAFATAGVKTNAMRIGCDAASGIERNGKFEKI
FT                   GTINIILLTGSTLETPTLASSYITLTEAKNVALQELDIRSAVHPEWQATGTGTDQIISV
FT                   SGGDDKYTYVGGHTKLGEMMAKAATQAVKQAVRNCRGY"
FT   gene            302102..303706
FT                   /locus_tag="DET0315"
FT   CDS_pept        302102..303706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0315"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by similarity to OMNI:NTL02MA3318; match
FT                   to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40345"
FT                   /db_xref="GOA:Q3Z9N6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N6"
FT                   /protein_id="AAW40345.1"
FT                   /translation="MIDNLDTIQIDTLPVGIVVIDVLSRKIMNINQAAQNLIGAEASEI
FT                   IGHSCHKFICPAEEGKCPILDMGQSIDNAERQLLTSSSKLITILKTASKVTINGRDFLY
FT                   EVLQDVTDPVNLRKQLQIQVAERTKELAEINSKLVQEIKNHEKTERKLNELFTRYSMFF
FT                   NNCNDGLTLIDFSGGTPPGKYIEVNKAFCQMVNYSREELLQLTPIDLTASEMKDYALGN
FT                   TKLVLESEYAVLRFPNVYITKDGRRLDCEINASFVYLSGREVAVVVYRDISETKRLEQS
FT                   LREAYERELQAHAEVEDQLNQRNYFMRALVHELKTSLTPLLAASEYLVSELSDSALLGY
FT                   ARNMQNGAINLNNKIDDLMNLAKGEIGQLQTDPEYASIRKVIGDCVDYLQPQAQKMQKR
FT                   IALNVSVDIPLTLFDKKMIYQVVLNLLSNSLKFSRTGSEICIEAVKSGDKIKVSVKDQG
FT                   TGIPKNKQQGIFTPYYRIKTKRDRYGGLGLGLALSKMIIELHRGEIWFTSEYGHGSTFY
FT                   FTLPIRSEWDEDPDNRG"
FT   gene            303681..304358
FT                   /locus_tag="DET0316"
FT   CDS_pept        303681..304358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0316"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DET0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40344"
FT                   /db_xref="GOA:Q3Z9N5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N5"
FT                   /protein_id="AAW40344.1"
FT                   /translation="MKTLIIEDDLSIIDLVVLTLSVAWPDIQIVRTQLGKEGIELAETE
FT                   APDFIILDLGLPDMSGIEVLQEIRSFSKVPVLVLTVKKDEMDVVVALSKGADEFISKPF
FT                   RQMELISRVKNVLKRSHPSEGEVYAIGNLTYYPALNKIDSKGLELKLSPTENIIFLYLA
FT                   NQRPNYVTYRSLALAIWGDEYPGCHKAIRVMVNQLREKLDSSLNQPDLILTKYGLGYYL
FT                   GNW"
FT   gene            complement(304495..304614)
FT                   /locus_tag="DET0317"
FT   CDS_pept        complement(304495..304614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40343"
FT                   /db_xref="GOA:Q3Z9N4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N4"
FT                   /protein_id="AAW40343.1"
FT                   /translation="MLSVTSFQSLNHIIGEDIFDMGKDISFALNDSLMISEDR"
FT   gene            304666..306153
FT                   /locus_tag="DET0318"
FT   CDS_pept        304666..306153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0318"
FT                   /product="reductive dehalogenase, putative"
FT                   /note="identified by similarity to GP:8163916; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40342"
FT                   /db_xref="GOA:Q3Z9N3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N3"
FT                   /protein_id="AAW40342.1"
FT                   /translation="MLNFHSTLTRKDFLKGIGMAGAGLGAASAVAPMFHDLDELVASTP
FT                   STRNLPWFVKEREHGDPTTPIDWDMIQRRPYTWVRMDPTLPVYDNLKSIGAPVSRWLDW
FT                   EDKKAEDEILYAKAREDFPGWEPGLDGFGDIRTTALTHASEMFSFGNFPTRMNLGGNMV
FT                   DLVAAVRAAGGYLGSTDSYAGPKMVHTPEEMGGTKYQGTPEDNLRTLKAGIRYFGGEDV
FT                   GALELDDKLKKLIFTVDQYGKALEFGDVEECIETPKQVTIPNKCKYIFLWTMRQPYEWT
FT                   RRQSGRFEGAATETSYERAYNTKAHFQDFVRGLGYQMISAGNNSLSPAGAWAVLGGLGE
FT                   LSRASYVNHPLYGITVRVTWGFLTDMPLPPSRPIDFGARKFCETCGICAENCPFGAINP
FT                   GEPTWKDDNAFGNPGFLGWRCDYTKCPHCPICQGTCPFNSHPGSFIHDVVKGTVSTTPI
FT                   FNSFFKNMEKTFKYGRKNPATWWDEVDDYPYGVDTSY"
FT   gene            306183..306452
FT                   /locus_tag="DET0319"
FT   CDS_pept        306183..306452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0319"
FT                   /product="reductive dehalogenase anchoring protein,
FT                   putative"
FT                   /note="identified by similarity to GP:27228279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40341"
FT                   /db_xref="GOA:Q3Z9N2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N2"
FT                   /protein_id="AAW40341.1"
FT                   /translation="MIFWIGALFGAALTLLVNWLRAKVVVRWYEWLIGALGLLSGIGAV
FT                   QHYFGSLVENEPESAWMGFLVLFILSVLLLVITWTLLRRHKQSI"
FT   gene            306544..307098
FT                   /locus_tag="DET0320"
FT   CDS_pept        306544..307098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40340"
FT                   /db_xref="GOA:Q3Z9N1"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N1"
FT                   /protein_id="AAW40340.1"
FT                   /translation="MSDLSSGDISNYRALTAEYESYCREQAGKHFMASKFNFKKCQCCG
FT                   YCCLCYPCMPRPDEISPVAEYLNISVKELIDRYMVVDTADCQTFFLRWAKAGQEDITGA
FT                   RIPPRRTYDRGYCIFFDKDKKTCFIHPVRPDDAKIIKCWDDRQSRDKKLWGMSGWKQTD
FT                   IYRFIPDFSTNYFRKSKEKPI"
FT   gene            307095..307547
FT                   /locus_tag="DET0321"
FT   CDS_pept        307095..307547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0321"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40339"
FT                   /db_xref="GOA:Q3Z9N0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9N0"
FT                   /protein_id="AAW40339.1"
FT                   /translation="MIPALRIVNILLGLLALSGLLITGSGCSGSEEKIDDTPYVVDYTK
FT                   IFRSYTFSSIDADGLPADECSAFTTDTPIIYFTWQPRSLDVCCAATLVIWYFEGEEIQH
FT                   LSLMDPSTCVHTAFLERPEGGFELGNYQVALYIGISEYLRLDFMVK"
FT   gene            complement(307601..307732)
FT                   /locus_tag="DET0322"
FT   CDS_pept        complement(307601..307732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40331"
FT                   /db_xref="GOA:Q3Z9M9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M9"
FT                   /protein_id="AAW40331.1"
FT                   /translation="MDKNTEKFPDYDFWDFTQLIRSSFMNTRLFPSLYEGRPFLIRL"
FT   gene            complement(307887..308897)
FT                   /locus_tag="DET0323"
FT   CDS_pept        complement(307887..308897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0323"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40330"
FT                   /db_xref="GOA:Q3Z9M8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M8"
FT                   /protein_id="AAW40330.1"
FT                   /translation="MDEKTKRRLSHKKLTTDELFTGYYDLLKIRITPNQYLQYKALLDK
FT                   FQAFLGGMPPSQALALKFLGLYHHRAQATIFRYTGIIRGFMDWYGEGLDVKVKKPKHLP
FT                   EYVEPADIEKLVDAITCKHNHKDTIARDEMLIRFAQMTGLRRSELANLKVSDIQLEKRT
FT                   VFVRQGKGMKDRAVPIPLGLISKLTSFLAHKQPSDSLFNLTSRSITDKLSTWSKKAGVK
FT                   IHPHQLRHSYAEQLLEKGAALTSVQALLGHESLQTTSVYLGIRPNALREAVDKLDMVKP
FT                   MPEQTYLKIKIHDNDNNLADNIEIQGEIPINSVQNSVPNFFKQRIQFEKDNQENT"
FT   gene            complement(308964..309039)
FT                   /locus_tag="DET_tRNA-Ala-2"
FT   tRNA            complement(308964..309039)
FT                   /locus_tag="DET_tRNA-Ala-2"
FT                   /product="tRNA-Ala"
FT   gene            complement(309075..309902)
FT                   /locus_tag="DET0325"
FT   CDS_pept        complement(309075..309902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0325"
FT                   /product="patatin-like phospholipase family protein"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:DET0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40329"
FT                   /db_xref="GOA:Q3Z9M7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M7"
FT                   /protein_id="AAW40329.1"
FT                   /translation="MPASKPPKIGIALGGGAARGIIHIGVLEVLEKEAIPLDLVTGTSM
FT                   GAIIGALYASGHTPPEMKEIVSNLSWKQLMPLLDLAAPRAGFLSSRKIKDYLKGLIGDV
FT                   TFAELKKPFACVAADVKTGQEVLFREGPVIDGVIASMSLPIIFHPVKNKNRFLVDGGLI
FT                   TPIPAQIVRDMGADFVIAVNAIYHHDYIKPDKDSAPSIFDTAFQIVNIMSIHMAKENLQ
FT                   AADIAIEPDLSGIGPGDFLKAPEIVLRGELSATDAIPNLKHLLLRKYSYTPTI"
FT   gene            complement(309959..311551)
FT                   /locus_tag="DET0326"
FT   CDS_pept        complement(309959..311551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01TE2094; match
FT                   to protein family HMM PF01935"
FT                   /db_xref="EnsemblGenomes-Gn:DET0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40328"
FT                   /db_xref="GOA:Q3Z9M6"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M6"
FT                   /protein_id="AAW40328.1"
FT                   /translation="MTSENKLGIVIGGSLSGGIYVRLDGEALVEDMAVGRYVTIQGKTK
FT                   RFLGMITDVSLGVTDQRLTLTPPAADEKFLAEILSGTAAYGDLKVIPYLVLGNDEKSLL
FT                   DGPQPVKTIPSHYAPVDIASNEDIEMVFGKEDASHFYVGNPLDMETRLCLNLPELVKRS
FT                   NGIFGKSGTGKTFLTRTLLVGMLQKGSCVNLVFDMHSEYGWEGTSEKKHKVKALKQLFP
FT                   DRVAVFTLDGESSRKRKVSVDFEVKIGYDEIEPEDISLLRQTLNLTEQAVEAVYQLRKY
FT                   FKKNWIKEANNIGDEEDDKKLLDSLSIHESTFQNLKRGLNTLTRLPFIVENAPVKAVDR
FT                   VLEYLNRNINVVLEFGRYTDITAYILVANLLTRRIYTSYRDRMEQAMAEDAAKPTPLVI
FT                   TIEEAHKFLNPEVASRTIFGTIAREMRKYNVTLLIIDQRPSGIDTEVMSQLGTKITALL
FT                   DNEKDIDAVLSGISGKNELKGVLAKLASRQQALIFGAAVPMPVAFVPREYDQSIYNEVS
FT                   RKKISTEEIEELF"
FT   gene            complement(311548..312147)
FT                   /locus_tag="DET0327"
FT   CDS_pept        complement(311548..312147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SS00170"
FT                   /db_xref="EnsemblGenomes-Gn:DET0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40437"
FT                   /db_xref="GOA:Q3Z9M5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M5"
FT                   /protein_id="AAW40437.1"
FT                   /translation="MDNLNTNRIGEVIDTSTTDFTAQSYQLYNTPALGALVKTGEGENT
FT                   IYAAVYHATTSSIEPGRKPIARGQDAASEEDIYAQSPQLSKLLRSEFSCLILGYRGQGQ
FT                   ICHWLPPRPAHIHSFTETCTPEETAEFSRSFGFLNILINSELPVPADEVTAACLRQLAA
FT                   AAPDKQSFLVKAGKELARILPGQYQRLKVILERIQL"
FT   gene            complement(312219..313424)
FT                   /locus_tag="DET0328"
FT   CDS_pept        complement(312219..313424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NS3859"
FT                   /db_xref="EnsemblGenomes-Gn:DET0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40436"
FT                   /db_xref="GOA:Q3Z9M4"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M4"
FT                   /protein_id="AAW40436.1"
FT                   /translation="MSLNLDKTALQIQSMVSDLKGRDLEHQKHLEAGLNGMKRTPAEYQ
FT                   HLLDKAERSQTTFLLAHPEEIPDATHPPPALPQSYRILATDGSQIDVDRHQLSRCYLIN
FT                   IGRVRLEYGQSPSAALESLPALYARPEDMVISCGSKEVAVEGTLLGIKRSVEETRHLAE
FT                   MADAASPNLPTLALADGTLILWSLLSKEFPEYVVEDLLVNGYLKYLGKIQNLNTKDRQV
FT                   ALASYISYPGSTDVVNTLRLLYCPYEPADCTSQCDQLPNGKRPCDILSGVTDSMLFERI
FT                   LKPGERSALFASSSSILEKYYGEHRVYFYYLKTSEEIARVELPGWTARSEELLSLSHSL
FT                   ILEQCRLGHGYPVSLSEAHEQAVVSGQDRRIFNQLVEEMLTASKINPSSSAKSLSKKTR
FT                   WV"
FT   gene            313551..314171
FT                   /locus_tag="DET0329"
FT   CDS_pept        313551..314171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0329"
FT                   /product="transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40435"
FT                   /db_xref="GOA:Q3Z9M3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M3"
FT                   /protein_id="AAW40435.1"
FT                   /translation="MDFMLATLLSVTVISFSGVLMPGPMFALTLSRSYHTPWAGAQIVL
FT                   GHVLVELPIILLIYFGFAGFFELVWVQILLSLAGGIMIIYMGLGMIKARREAAQDKANF
FT                   KYNTVVSGAAMSALNPFFLVWWATVGAMLVMKVSDYGLGGLGALAATHWLVDLAWLCLV
FT                   SFIVYRTHRLWGSRVREIVFIGCGLLLAAFGVYFIVSGLKLWL"
FT   gene            314201..315226
FT                   /locus_tag="DET0330"
FT   CDS_pept        314201..315226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0330"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:DET0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40434"
FT                   /db_xref="GOA:Q3Z9M2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M2"
FT                   /protein_id="AAW40434.1"
FT                   /translation="MAVGLVYNHIYLNHETGTHVENPDRLLAIMEYINTHGLKDRLVHV
FT                   EPKRVGLGELEGFHTRKYISRVEEVGFSGGGWLDQDTVISVDSYETALYAVGGVLEGVD
FT                   KVLSGELESAFVMCRPPGHHALPEASMGFCIFNNVALGALHALNKHRLKRVAVVDFDVH
FT                   HGNGIQHVCLNDPRVTYISTHQIHHFPFTGDSCEDGPFQNILNIPLPAGCGDSHYQKVF
FT                   DQLICPYLRKLSPELILVCAGYDAHFADDMGEMCLSQQGFAGITRALKKTADEVCGGKM
FT                   VFSLEGGYHYLGLAESVGASLAVLLDEALPPPNTKAPEETADTPDISGLILELRGIFGI
FT                   S"
FT   gene            complement(315200..316135)
FT                   /locus_tag="DET0331"
FT   CDS_pept        complement(315200..316135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0331"
FT                   /product="cation efflux family protein"
FT                   /note="identified by similarity to GP:18378082; match to
FT                   protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:DET0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40433"
FT                   /db_xref="GOA:Q3Z9M1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M1"
FT                   /protein_id="AAW40433.1"
FT                   /translation="MATRKTRAASFSIASNSTLIVMKAAVGFVTGSVSILAEAIHSTLD
FT                   LVAAVIAFFGVKASDKPADATHPYGHGKWENVSGTVEAVLIFVAAIWIIYEAINRLIEG
FT                   SAPEMLEWGVVIMGVSVVANTLVSSYLKKIARETDSVALEADASHLTTDVITSAGVLLG
FT                   LLLAKLTGWSVLDPIVALLVALLIIKAAWDILNKSFGALVDARLPKEEVDAISSLINEH
FT                   TSKLVEFHNLRTRKAGSYRYVDLHLVMPKTLSVEKAHSICDHLEKDLKDKLKIDYVTIH
FT                   VEPCTEENCPECQINCKKRPSDLANPENTP"
FT   gene            complement(316155..317060)
FT                   /gene="secF"
FT                   /locus_tag="DET0332"
FT   CDS_pept        complement(316155..317060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="DET0332"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by similarity to GP:3220156"
FT                   /db_xref="EnsemblGenomes-Gn:DET0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40432"
FT                   /db_xref="GOA:Q3Z9M0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9M0"
FT                   /protein_id="AAW40432.1"
FT                   /translation="MNKIIQHRPLFIFISALIILAGLASLLIFGLKPGIDFSSGSILTI
FT                   KFDQTVSVDELTQELRSLGQSEAIVQVTGDGDFLIRTSELDISQKVTLETALEEAFGNL
FT                   TERGFENVDPLIAKQTTQMALIAIGAALVGILLYVTWAFRRMPKPFHYGTCAVIALFHD
FT                   ALVVLGIFALLAGIFGWEINLMFVIGIMAVIGYSINNTVVVFDRIRENQLKGIHPSFDV
FT                   VVNQSIMETIVRSINSSFTVIITVVALMLFLGASIQNLSVVLLIGLIAGTYDSLFVAPS
FT                   LLVTWENGDWGKLLKPFKRA"
FT   gene            complement(317053..318402)
FT                   /gene="secD"
FT                   /locus_tag="DET0333"
FT   CDS_pept        complement(317053..318402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="DET0333"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="identified by match to protein family HMM TIGR00916;
FT                   match to protein family HMM TIGR01129"
FT                   /db_xref="EnsemblGenomes-Gn:DET0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40431"
FT                   /db_xref="GOA:Q3Z9L9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L9"
FT                   /protein_id="AAW40431.1"
FT                   /translation="MRRKNGLVFLAILAAMILAFTIVLPTDKGALLGKGILFGLDLKGG
FT                   LHMVYQADLSNVDESNIDSVMDGVVEVISNRINPLGVTEASIQRQGDDRIVVELPGLDI
FT                   TDEQKARIGRTALLEFGELAAEGEDYKWENSLGKWKPATATIDGVEYALTSAYFKDSTY
FT                   VNRDQYGNILLVFEWDDIGAQLSKEITTRLLSQQLGIFEGDEALAGDDGVPIAPYINNV
FT                   IETSGVIEGLSYNEAEMLSNQLNAGRLPVPLEPIYEQTVSPTLGQNFVDLAVKAGLAGI
FT                   ILVMIFMIAFYRLPGLLASIALVFYGVIVLALFKLVPVTLTLAGIGGFIVSAGMAVDAN
FT                   ILIFARLKEELLAGKTLGAAVEAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAGAPV
FT                   KGFAVTLFLGVAVSMFTAIFVTRTLLRLFVGTKTAKKLALFTTQTRGKNE"
FT   gene            complement(318432..319913)
FT                   /locus_tag="DET0334"
FT   CDS_pept        complement(318432..319913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0334"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:DET0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40430"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L8"
FT                   /protein_id="AAW40430.1"
FT                   /translation="MTNKNLLLRIDKKTAALLEDLRRLFSEEASEVYLVGGFLRNLILK
FT                   KPTADIDLCITGSGQAASAKISGYFKAPQVVLDAGNDVFRVILPAFQLDISGTADITAN
FT                   LTRRDFKLNAMAAPLSAVHQGSLPVQAIIDPMQGLPDIENRVIRVTSADVFSADPIRLL
FT                   RAIRLSAELGFALDGQTQSLITTHAALISTVAGERIREELLKLLETSQPGIWEKCLELG
FT                   LLLNIFPELTPCCRHPQPYEHTWDVLEHSIKTIYALDAILGRSVWPYQNPEIITAIYRE
FT                   SGFKKYFAGKISGTSSIRTLTKLAALLHDIAKPQTRSTDPDGRIRFTGHPLEGSRLSSQ
FT                   ILTRLRFSKKEILMVEKMVCYHLRPVQMNPDGQLPSAKAIYRYFRDLGEAAESTLYLSL
FT                   ADHLATDGPNLMVANWQEHVNIVAHILSEQKKQLTRLVPKRLVTGTDLIERFNLRPGPR
FT                   IKTLLGEITEAQAAGEIKNRQEAFKFISQRLEGQA"
FT   gene            complement(319939..320052)
FT                   /locus_tag="DET0335"
FT   CDS_pept        complement(319939..320052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40420"
FT                   /db_xref="GOA:Q3Z9L7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L7"
FT                   /protein_id="AAW40420.1"
FT                   /translation="MSRKIQVCCYQPVKALPGGYPKLSKRNFLDIEDTFGV"
FT   gene            complement(320063..320464)
FT                   /locus_tag="DET0336"
FT   CDS_pept        complement(320063..320464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0336"
FT                   /product="DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40419"
FT                   /db_xref="GOA:Q3Z9L6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L6"
FT                   /protein_id="AAW40419.1"
FT                   /translation="MSKATSPNGWADLGEIIRQQRVKIPLTLQELASKTSVSPSHLGRI
FT                   ERGERFPSARILKRIARPLGFEEDELFTLAGYLTPQKDSISEMEAEYISTPRQLDPYVA
FT                   KVLAQEPIELQRAVIAILAMLKSISKSMT"
FT   gene            complement(320720..323167)
FT                   /gene="priA"
FT                   /locus_tag="DET0337"
FT   CDS_pept        complement(320720..323167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="DET0337"
FT                   /product="primosomal protein N'"
FT                   /note="identified by match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:DET0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40418"
FT                   /db_xref="GOA:Q3Z9L5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L5"
FT                   /protein_id="AAW40418.1"
FT                   /translation="MAFAELAVHTPVLRPGSFSYSIPAGLEIKPGQAVWAPFGPKIVQG
FT                   IVLEVTEEPAFGQTREICGVISDTPLLSFHQLNLAKWISQTYLSSIYEAVALMLPPSFE
FT                   RQSLAYISLESSPPAAAKNPSETLSPNMQKIFDRLKAKDITPQNELEKIFGKKTAQSAI
FT                   LKLINQGLVKRTYRISPVRAKTKFEKHFRLSVQALAFIKNQTLPKLPPRQTQVFNHIKE
FT                   NPGGISKSGLNLLVKNNSAVLKTLEQKGLVSTEERQIFRHPVDYSRIPPLPHLELSPPQ
FT                   KKCLEFITRSLNTPPEDDQNPRTFLLHGITGSGKTEIYLQALAESLRLGKKAIVLVPEI
FT                   SLTPQTIARFAGRFPGQIAVLHSRLSPGEQFDEWQRIKNGQADIVIGPRSALFAPLDKP
FT                   GIIIIDEEHEWTYKQQDPQPRYHTRTVANKMAEEYGAVLVLGSATPDVDSYFKAQKGIY
FT                   QLLELPERLTPYRGASLPKTELVDMRTELSEGNRSIFSRNLQTSIEKVLANHEQAILFI
FT                   NRRGGASFIQCRDCGYVAMCKSCDAPLTYHPDQENLVCHQCGRHYPNPLTCPVCGSRRI
FT                   KYLGMGTQKLEEETRLAFPQARLLRWDSDVIKGKNTHQQIMDRFSCHQADILIGTQMVA
FT                   KGLDLPDVTLVGVINADISLNLPDFRAGERTFQLLAQVAGRAGRGISGGKVVIQTYSPE
FT                   NYAIRSAVCHDYPGFYAKEIVYRQALNNPPFRKLACLVFSHLNHDFCQQQAKLMAKTLR
FT                   EKAEAVGLGNLEILGPAPAFIQRLRGRYRYQLILRSPNPSEFLREINPGQGWSIDIDPY
FT                   GLC"
FT   gene            complement(323189..323599)
FT                   /gene="rplS"
FT                   /locus_tag="DET0338"
FT   CDS_pept        complement(323189..323599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="DET0338"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by match to protein family HMM PF01245;
FT                   match to protein family HMM TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:DET0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40417"
FT                   /db_xref="GOA:Q3Z9L4"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9L4"
FT                   /protein_id="AAW40417.1"
FT                   /translation="MEETVNNQETPETSEEETADEETVAVENTAAGKVLPSFGPGDTIK
FT                   VHARIKEGDKERIQMFQGVVLKVKQAADGGNFTVRRISYGVGVERTFPFLSPNVTKVEV
FT                   IKRGRVRRARLFYLRKLSGKAARIKEVKQTPS"
FT   gene            complement(323723..324469)
FT                   /gene="trmD"
FT                   /locus_tag="DET0339"
FT   CDS_pept        complement(323723..324469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="DET0339"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:DET0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40416"
FT                   /db_xref="GOA:Q3Z9L3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9L3"
FT                   /protein_id="AAW40416.1"
FT                   /translation="MKIDVLTLFPEMFQSPFEESIFKRAADKNLVRLEIHNFRDFSHDK
FT                   HHAVDDTPYGGGAGMLLKPEPLFEAVEAVMEKDPTPAPVILLSPQGRTFNQSVARELAN
FT                   HQRLIIICGHYEGFDERVREHLATDEISIGDFVLTGGELAAMVVIDAVSRLIPGVLGSD
FT                   DSSESDSHSNGLLEHPHYTRPPVFRGWDIPEVLLSGNHARIDRWRRKESLRRTLKRRPD
FT                   MLEKITLSKADRKLIDEILAEENPKD"
FT   gene            324652..325080
FT                   /gene="mraZ"
FT                   /locus_tag="DET0340"
FT   CDS_pept        324652..325080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="DET0340"
FT                   /product="MraZ"
FT                   /note="identified by similarity to GP:27315315; match to
FT                   protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:DET0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40415"
FT                   /db_xref="GOA:Q3Z9L2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9L2"
FT                   /protein_id="AAW40415.1"
FT                   /translation="MFFGEFEYKLDEKGRFPLPPGIRPSMKDGLILAPGTGEKCIYAYP
FT                   LCEWKKLSESLKSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKSYAGVNIEV
FT                   IVAGVNNYIEIWDKETWESEKKASQEQAWQIIETLEGN"
FT   gene            325087..326136
FT                   /gene="mraW"
FT                   /locus_tag="DET0341"
FT   CDS_pept        325087..326136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="DET0341"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:Q97H81; match to
FT                   protein family HMM PF01795; match to protein family HMM
FT                   TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:DET0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40414"
FT                   /db_xref="GOA:Q3Z9L1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9L1"
FT                   /protein_id="AAW40414.1"
FT                   /translation="MTEYPHIPVMLEESIQGLGVIPGGRYVDCTLGAGGHSEAILEHSY
FT                   PGGQLLSIDADPKAIALAAERLKCFGSSVLLVNDNFANLKDICQRYEYMPVHGILFDLG
FT                   LSSMQLDREESGFSFQTEAPLDMRFSPGQELSAADIVNTYDLAGLSDLIWKYGEEPFSR
FT                   RIARAILEKRPFKTTTELASVIEKAVGGRHGRIHPATRTFQALRIAVNEELSHLESALA
FT                   QAQSLLGHGGRLVVISYHSLEDRIVKQYFQKEAKGCICPDDIPQCVCNHKPSLRLINRR
FT                   VITPSDEEISRNPRSRSAKMRVAERIIQPGEGRFFHSRAKGLVNHVSETGSVRYGQAKH
FT                   KGVVQRGGS"
FT   gene            326206..327432
FT                   /gene="ftsA-1"
FT                   /locus_tag="DET0342"
FT   CDS_pept        326206..327432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA-1"
FT                   /locus_tag="DET0342"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by similarity to SP:P06137; match to
FT                   protein family HMM TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:DET0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40413"
FT                   /db_xref="GOA:Q3Z9L0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9L0"
FT                   /protein_id="AAW40413.1"
FT                   /translation="MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKG
FT                   LVVNINDARESIRESIRKAEQASGYKVESAYVGVTGRHVASMNNRGVVAITRNDRLVRS
FT                   DDLKRVMATAQNISVPNDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAA
FT                   TSVQNLVKCIRGLGIDIDDLVLEPIASSEAVLTEDEKQVGVILADIGGGTTDICIFKDG
FT                   SIWHTAIIPVAGYQLTRDVAIGLGLPFDVAEEMKKRYGSVLPVYETKMESPSPICEDGH
FT                   GVSYQDLCDIIRARVEEVLRLIMLEIPNSDYDSLVPAGLVLTGGSSNLAGMETLGRDIL
FT                   RIPVRVGNPDKVYGIVDSLHDPAYATGVGLLIWGAKHQPVKKSWLDNIGFFGRMRNLLK
FT                   GFAGLFGSN"
FT   gene            327473..328603
FT                   /gene="ftsZ-1"
FT                   /locus_tag="DET0343"
FT   CDS_pept        327473..328603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ-1"
FT                   /locus_tag="DET0343"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by similarity to SP:P17865; match to
FT                   protein family HMM PF03953; match to protein family HMM
FT                   TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:DET0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40402"
FT                   /db_xref="GOA:Q3Z9K9"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K9"
FT                   /protein_id="AAW40402.1"
FT                   /translation="MAKTSFVPNPARIKVFGCGGGGCNAVTRMVREEIQGVEFIAINTD
FT                   AQALAITEAPIRLQIGERVTRGLGAGGDHNMGQKAAEESRDEIREIVNGADMVFVTAGM
FT                   GGGTGTGSAPIVAEESKKSGALTIAVVTKPFTFEGAHRVSTAKEGINRLLGKVDTLIII
FT                   PNDRLLDLCDQKTGVDAAFKMADDVLRHGVQAISEVITVPGLINLDFADVRAVMKDAGP
FT                   AWMSIGYGSGKNRASDAAKSALASPLLDVSITGSKGVLFNIVGGPDLSLMEVNEAADVI
FT                   KQAVDPDANIIFGVASDASMGSNVKITLIATGFVSKMGMAEEEGDDAITRQLKGIKTED
FT                   ELDVPSFLRRPLFNRARPVAPPVDSHSNKPSSRISW"
FT   gene            328749..329276
FT                   /locus_tag="DET0344"
FT   CDS_pept        328749..329276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0344"
FT                   /product="conserved hypothetical protein TIGR00244"
FT                   /note="identified by similarity to SP:Q8R9H6; match to
FT                   protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:DET0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40401"
FT                   /db_xref="GOA:Q3Z9K8"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9K8"
FT                   /protein_id="AAW40401.1"
FT                   /translation="MNCPYCSHPDTKVIDSRDVDDGVRRRRECVVCGQRFTTYERFQPA
FT                   GLFVVKKDQRREEFNKEKLLSGLRRACEKRPLPAGAVDKIAGDIEAELYNMGKAEIPST
FT                   LLGDMVMEKLKALDNIAYVRFASVYREFTDITQLKKVVDNLVSGQDEGIHKGQLSLLPE
FT                   DRVSPKTRYQRR"
FT   gene            329593..331878
FT                   /gene="nrd-2"
FT                   /locus_tag="DET0345"
FT   CDS_pept        329593..331878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrd-2"
FT                   /locus_tag="DET0345"
FT                   /product="ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to OMNI:TM0118"
FT                   /db_xref="EnsemblGenomes-Gn:DET0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40400"
FT                   /db_xref="GOA:Q3Z9K7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K7"
FT                   /protein_id="AAW40400.1"
FT                   /translation="MPVKVQVKSEIKADAKTEGLKLTDNAMCVLERRYLKKDKQGKPSE
FT                   TVEDMFRRVARTIAMGELIYNPKADVRSREDEFYNIMTRLEFLPNSPTLMNAGRELGQL
FT                   SACFVLPVDDSIESIFDAVKHTAMIHKSGGGTGFSFSRLRPEQDRVGTTGGVASGPVSF
FT                   MRAFDVATDVIKQGGTRRGANMAILSIDHPDIMKFIHAKDKAGVLTNFNLSVAITDKFM
FT                   QAVKDGVDYDLLNPHNGEVVSRLNATEVFNKIVHMAWKTGDPGIVFIDRINAYNPTPQL
FT                   GRIESTNPCGEQPLLPYESCNLGSINLSRMVTVSGGQAVVDYKKLSRVVKSAVRFLDNV
FT                   IDVNKFPLPQIEEMTKKSRKIGLGVMGFADMLLELGIPYNSENSIKLAEEIMCFVNEEA
FT                   HKFSSELAVERGVFPAYRGSIYEKSGRPMRNASCTTIAPTGTLSIIAGCSSGIEPHFAL
FT                   CFTRNILDGTKMIEVNPYFERAAKEGGYYSEELIKSLAEGAHLDEADVPAEAKELFVTA
FT                   HQIVPEWHVRIQAAFQKCTDNAVSKTVNFSREAVEGDVAEVYKMAHDSNLKGITIYRDG
FT                   SREDQPMSTGKAENKIETPAAVVNPNLAPRKRSKVTQGITERVTTGCGYIYVTVNSDEH
FT                   GICEVFSSLGKAGGCASAQLESTCRLISLALRSGMEVASVVKQLRGIRCPSIAWDDSKA
FT                   VLSCADAIASVLEKHVDGYTQPVAGSAKTVSANALVRNIAGQCPECGSILVYQEGCFIC
FT                   PGCGYTKC"
FT   gene            331885..331992
FT                   /locus_tag="DET0346"
FT   CDS_pept        331885..331992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40399"
FT                   /db_xref="GOA:Q3Z9K6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K6"
FT                   /protein_id="AAW40399.1"
FT                   /translation="MEEYKMENVKDMLALVLVAAGFMYLMIVMVAGLLA"
FT   gene            332109..332693
FT                   /locus_tag="DET0347"
FT   CDS_pept        332109..332693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02ML6114"
FT                   /db_xref="EnsemblGenomes-Gn:DET0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40398"
FT                   /db_xref="GOA:Q3Z9K5"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K5"
FT                   /protein_id="AAW40398.1"
FT                   /translation="MTDTLERVMIFIDGSNMYHYLKSHFQRTDIDFGCFCSKIAGRRRL
FT                   VRIYYYNAEVGRKEEPERFNDQKKFFSSPEKISYMELRLGRLVYSGWPSTPPYEKGVDV
FT                   LLSTDMLSHGFKNNFDTAILVAGDSDFVSALQAVKDNGKNVEVALFGKETTSMELRKVA
FT                   DKTITIDGRLLRNCWKQQRNNYGTQRPPQES"
FT   gene            332662..334296
FT                   /locus_tag="DET0348"
FT   CDS_pept        332662..334296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0348"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by similarity to OMNI:NTL01TT0848"
FT                   /db_xref="EnsemblGenomes-Gn:DET0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40397"
FT                   /db_xref="GOA:Q3Z9K4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K4"
FT                   /protein_id="AAW40397.1"
FT                   /translation="MARKDRLKNRKELSRTRVSYASSERVAGESGVVIKDWGGRLPLAV
FT                   AYPNSYYVGMSNLGLHTLYRLINNYPQYLAERFFWEGGAAKGRPTLSVESRRPFTDYVA
FT                   VLFTLSYELDFLNIPSMLADCGMPLYARERDETFPLVIGGGACIMSNPAPAADFFDVFC
FT                   IGEAEAILPELLPVLAETAGEPKGLVLERLAKIPGLYVPSVPPEKPVERVFPAELTQGA
FT                   GTAVFSKATELGEMYLMEVERGCGHQCRFCLVAGVFCPLRYHPLELLLKQAEEGMLERK
FT                   RIGLVGPVVSDHPQATELISRLRGMGVGLSISSLRIKPLPEKMLGELALSGVSSLAMAP
FT                   EAGSERLRRIIRKGITEDDIIRAAALVAEKGFRQLKFYFMLGLPGETDEDIEEMIKLAE
FT                   KAQQVMSAAGRGVRLSLNIAPFVPKPSTPFQWLGMEDAVLVKRRLDIIRLRLEGQGIEV
FT                   RAESPEMSQIQAVLSRGDVSLSKLLAAAGGDSLACWKRAAKLLEVDSPSLAKTRFDLAD
FT                   KLPWHMLENPKQRQRLEAEYKAATKEI"
FT   gene            complement(334345..334794)
FT                   /locus_tag="DET0349"
FT   CDS_pept        complement(334345..334794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0349"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="identified by similarity to OMNI:TM0690; match to
FT                   protein family HMM PF02637"
FT                   /db_xref="EnsemblGenomes-Gn:DET0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40396"
FT                   /db_xref="GOA:Q3Z9K3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K3"
FT                   /protein_id="AAW40396.1"
FT                   /translation="MPNLKEKLGEEVKLSLRQGEKLKCSVLRMLVSAISYAEIAKQKTF
FT                   TDEEIFGVIAKEIKQRRESIEAYKLANRPELVEKEQQEMEILQSYMPEQMGEAELTLII
FT                   KKVISETGASTPQDKGKVMGKLMPLVKGKADGQMVNNLVTALLNN"
FT   gene            complement(334797..334991)
FT                   /gene="rpsU"
FT                   /locus_tag="DET0350"
FT   CDS_pept        complement(334797..334991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="DET0350"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:DET0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40395"
FT                   /db_xref="GOA:Q3Z9K2"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9K2"
FT                   /protein_id="AAW40395.1"
FT                   /translation="MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTRR
FT                   KRKDAAKRRLAIKAARKAT"
FT   gene            complement(335166..335396)
FT                   /locus_tag="DET0351"
FT   CDS_pept        complement(335166..335396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40386"
FT                   /db_xref="GOA:Q3Z9K1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K1"
FT                   /protein_id="AAW40386.1"
FT                   /translation="MTDAQKLESVSSDSPYWWRVKAVDGAGNASAYTGAGSFTVGFSLD
FT                   LPTWATYVLIGIGGLLLLALGFWLGRRNADY"
FT   gene            complement(335508..336938)
FT                   /locus_tag="DET0352"
FT   CDS_pept        complement(335508..336938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC73118.1"
FT                   /db_xref="EnsemblGenomes-Gn:DET0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40385"
FT                   /db_xref="GOA:Q3Z9K0"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9K0"
FT                   /protein_id="AAW40385.1"
FT                   /translation="MKHKFLLRVLGVFSTLALLIAALPLAPVSAATLTLSPTSGPAGSM
FT                   VSVTGTSVASSGSLVYILFNGANVATATVGGSGVVSGTFTVPTNLTRGTYTVSFLFTGG
FT                   DSAASQAFTITPSITLASGTGYVGDSVAVTGSGFTPSTTVNFYLSGSTTPFATTSSSST
FT                   GTISTTITIPAAKKGTLSITANDGGATGTAPVNFIINPKITLSSSSPGVGDSITITGTG
FT                   FYDGAVQIAIDSGAAVNAGVSVGSNGSFTATYEIPALTRGSHTLKVNDAWNNNAQVTFD
FT                   IAQKITLTPNTGNVGTSVTVRGSGFNTTGTITLTYFGQSVTVTLSNGTFTTTFVIPGVQ
FT                   AGAYTISATDGSVTSTATLTVTTNITMSPTNNASTPGNVGQEITINGSGLKANDTVLVT
FT                   FDSAQVTITPSPIVDSNGDFSLKFNVPATTAGPHTITVISGTTSKTFTFFVEGTAPATP
FT                   APLTPEMGLKAKQPVVFD"
FT   gene            337146..337487
FT                   /locus_tag="DET0353"
FT   CDS_pept        337146..337487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40384"
FT                   /db_xref="GOA:Q3Z9J9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J9"
FT                   /protein_id="AAW40384.1"
FT                   /translation="MTLSDHDLKTEETDLLPELTSYPDQGCEFSKTCLDCPLPVCVFDQ
FT                   PRGRQRWLKRQRDKEIVSLFQGGQDERELADRFRLSIRTIQRVLKKSLAGVNINRKTEV
FT                   LENSNGTDF"
FT   gene            337471..338382
FT                   /locus_tag="DET0354"
FT   CDS_pept        337471..338382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0354"
FT                   /product="phage domain protein"
FT                   /note="identified by similarity to GP:29895579"
FT                   /db_xref="EnsemblGenomes-Gn:DET0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40383"
FT                   /db_xref="GOA:Q3Z9J8"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J8"
FT                   /protein_id="AAW40383.1"
FT                   /translation="MVQIFNPNELKSRDLDRLKRYVNLLDFYQGKQWDGRPSRNEKQLT
FT                   FNYARVIVDKLCSYLMSGVNFGAEALNEEDIEKAVTARSMLNEVYQQNNLEQLDLETEI
FT                   DCAVLGDGCFKVIWDAASGRVRVSAPDIQGIYAWWSPDDMSRIYRVASRYALNSEEAEV
FT                   SYGLELPSRQSFLTEVWTEETFELWQDEKLLESKPNPYGFIPFVIYPNLREPKRFWGVS
FT                   DLDEIMEPQRELNRALSQLSRILELSGNPIAVLENVEQSEDIAVRPGGFTATVRFLWTA
FT                   RMYSGCVIWKAIPAVWQINGHS"
FT   gene            338433..339533
FT                   /locus_tag="DET0355"
FT   CDS_pept        338433..339533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40382"
FT                   /db_xref="GOA:Q3Z9J7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J7"
FT                   /protein_id="AAW40382.1"
FT                   /translation="MPTSMSSEFGFAMEHDGQYVYLDGVNRIYRAKIAQSSLEIGADIL
FT                   KFETVCDSLSGSLTVELDNSSGRYNRAGSGELDMLTPGSEIQFSPGCGTDNGNEYGPGQ
FT                   LYVIQSLEKRISGGKSSLLIRAEDTFCRLKRWRATNQMRWNRSSSQLSVRGILGYVLSK
FT                   AGIRMEVLSASAQLDSFYPDFTIHVGDDGYELLEKLLSFVPDLVFLQGHCIYCVYPRET
FT                   DSPVYSYGLNHPVFSGVYADTFSEVNRVVLEGVDSSSRIFMVQGFLWDEIYQNHDRTLR
FT                   IYDRNINTLAQARERLDSYFRKAALKQQTGRIVTPVNCGQQLFDVVRISQPESGLEGLV
FT                   RRINGIRVVYEPGKGIYRQELSLGKV"
FT   gene            339545..339757
FT                   /locus_tag="DET0356"
FT   CDS_pept        339545..339757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40381"
FT                   /db_xref="GOA:Q3Z9J6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J6"
FT                   /protein_id="AAW40381.1"
FT                   /translation="MEIKRAVLKVFNSVAYTASIQLAGDYKSMLEEVKVARNIPAAEML
FT                   AGRNLGVWFFDDHNTKDTLVIAVYS"
FT   gene            complement(339868..341193)
FT                   /locus_tag="DET0357"
FT   CDS_pept        complement(339868..341193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40380"
FT                   /db_xref="GOA:Q3Z9J5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J5"
FT                   /protein_id="AAW40380.1"
FT                   /translation="MQSIFNRQGQTFSVEIARQGGKNELSSQLELLLLTLFMFEPKNLV
FT                   KCAPTFKPQLNISMMRLKDRLNEAGFGDIYQTEGGYIIRLNQARAVFLSAEPSANVVGN
FT                   TAHLLLEVDEAQDVNQEKYSKEFKPMGATTNVTTVLYGTTWDSSSLLEEIKRQNIEKEH
FT                   KDGLKRHFRYDWEEVAAHNPAYLAYALSEKDRLGENHPLFLTQYRLLPVSGGGGMFSSE
FT                   QLGLLKGSHPCQLYPENGKVYVAGLDLAGEDVQSAADLPTAVNLRRDSIVLTIAELDYT
FT                   FAKAPFNLPQVRLVCHCSWQGARHALLYEKLVELLGKVWKCRKVAVDATGLGQPVASFL
FT                   RESLGSRILPFVFQPSSKSRLGFNLLSAVNSGRLKMYAANGSAEYALFWQEMELARADY
FT                   RQSQQMNFYVETARGHDDYLMSLALCLEAAEAYHPRSAKGSS"
FT   gene            complement(341231..341614)
FT                   /locus_tag="DET0358"
FT   CDS_pept        complement(341231..341614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40379"
FT                   /db_xref="GOA:Q3Z9J4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J4"
FT                   /protein_id="AAW40379.1"
FT                   /translation="MCYYFATMTQEFVERKKGAPYGNQNARKHGFYSRVLDTAELEDYE
FT                   QATLAEGIDEEIALLRVKIKSVLRHDPDNLKLLMQAITTLSRLLSARYNISRQDKGGLK
FT                   EAIFNVLRDVAVPLGIIKATFDK"
FT   gene            341702..342397
FT                   /locus_tag="DET0359"
FT   CDS_pept        341702..342397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01CJ00668"
FT                   /db_xref="EnsemblGenomes-Gn:DET0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40378"
FT                   /db_xref="GOA:Q3Z9J3"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J3"
FT                   /protein_id="AAW40378.1"
FT                   /translation="MQLAKELYQLQELELDLESHLLQASKLQATLKDDSALRQAENSLA
FT                   EAALHLKDQQASLRALEDQSADLDAKVNEVKKSLYSGRISNPKELSNLSKEQELLEAKR
FT                   AQIDDQALQGMDNLEELQARCDQMMENLESVRTLWQQSQSQNTQALNAILSEIEKLKSE
FT                   RQEFISRFNPSDLELFQALRKSKGKAVSRVEQGNCRGCGLKLTPAWIQRARAGTLVQCS
FT                   GCQRILYLD"
FT   gene            342947..343207
FT                   /locus_tag="DET_DernpB1"
FT   misc_RNA        342947..343207
FT                   /locus_tag="DET_DernpB1"
FT                   /product="sRNA"
FT   gene            343205..343351
FT                   /locus_tag="DET0361"
FT   CDS_pept        343205..343351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40369"
FT                   /db_xref="GOA:Q3Z9J2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J2"
FT                   /protein_id="AAW40369.1"
FT                   /translation="MVIAFAFGQGYRTRLTGLLGLNFISKSLLFKGWFCYLKTIQAGFS
FT                   WYI"
FT   gene            complement(343335..344060)
FT                   /locus_tag="DET0362"
FT   CDS_pept        complement(343335..344060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40368"
FT                   /db_xref="GOA:Q3Z9J1"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J1"
FT                   /protein_id="AAW40368.1"
FT                   /translation="MIAIFVFLLYIYIYVSKQTGTDLLNTGQHKKLTRLKILGWLLPVL
FT                   LGLCVLSSIYLAAQQANLSSYLDDISRTGFVIPSYVHLCEEAIDQAIIGLDILLAASFV
FT                   CGMFYLHLSHAYYVNLYLITPRYRSNRAFSGFLIPVVNVVFPLLFTAETWQLSKLTPEA
FT                   QNALPEYKINLLLKIWWILCLLAVTFFILPQVLSLVLPDSAPAREYVANLFTAMTVMAA
FT                   SGSSLLLFSYLNTRLKYTS"
FT   gene            344252..344524
FT                   /locus_tag="DET0363"
FT   CDS_pept        344252..344524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40367"
FT                   /db_xref="GOA:Q3Z9J0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9J0"
FT                   /protein_id="AAW40367.1"
FT                   /translation="MPLSRWRWVIMGAVMEDLNVSALDFVSFCHRRCGQEWPELYDEMC
FT                   RVAGRRLYRGMGYYELNNLGIPLDLANLDSTLALVDQYKSNQKCS"
FT   gene            344622..345755
FT                   /locus_tag="DET0364"
FT   CDS_pept        344622..345755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0364"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to SP:Q44879; match to
FT                   protein family HMM PF03572; match to protein family HMM
FT                   TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:DET0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40366"
FT                   /db_xref="GOA:Q3Z9I9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I9"
FT                   /protein_id="AAW40366.1"
FT                   /translation="MTLRIKVLLGTILAMVGLLVSFGVGYLSGGIAALNSDENLSSIVN
FT                   AWQIITTEYVEPDSIDQAALAEAAIKGMMDELDDPHSVYLNAEDYQSSLEYDDGKYVGI
FT                   GATVQIEDEAIVLVPYDGSPAALAGIQAGDILLEVDGQSVAGFSLADLSPLVRGEKGTS
FT                   LTLLVERSSSDQPLLFEVTRDEILISSVTSEMMGDIAYIRISRFSERTDEELEQVLKNL
FT                   GSAEGIVLDLRGNPGGLVSSVINVTSRFVSSGVVLTTVDNEGNSSEYSVVPKTVTTSLP
FT                   MVVLVDQYSASGSEALSGALQDYGRATIAGKTTYGKGSVNRTFNVTPDTGIYLTIGRWY
FT                   TPNGRMIEGQGITPDIELELTGDEAVSWALGFLHGDT"
FT   gene            345870..346910
FT                   /gene="pheS"
FT                   /locus_tag="DET0365"
FT   CDS_pept        345870..346910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="DET0365"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by similarity to SP:P17921; match to
FT                   protein family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:DET0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40365"
FT                   /db_xref="GOA:Q3Z9I8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9I8"
FT                   /protein_id="AAW40365.1"
FT                   /translation="MEEIKNITEITQSALAELEAITELKDLEAWRVRYLGKKSLLTGAL
FT                   RNLASLPIEERKAAGAAANEAKAALEAAFLEKEQLSKEKQFASRSEGLDITLPGRPWPI
FT                   GRIHPLTQVTNEVTAIFSTLGFSVLEGPEIEDDYHNFEALNIPEDHPARENMQTFWIDR
FT                   PNEDGRLDTLLRTHTSPMQVRYMEKNKPPIRIVVPGKVYRYEATDATHIPMFTQVEGLV
FT                   VDEGISMAHLKGTLMEFCRRFFGANRKVRFRCDYFPFVEPGVEVAVSCTCGGKKECSVC
FT                   HGSGWLEILGAGMVHPRVLERVGIDSEKYTGFAFGMGLERLPMLRYGIDDIRLFYSNDT
FT                   RFLRQF"
FT   gene            346912..349341
FT                   /gene="pheT"
FT                   /locus_tag="DET0366"
FT   CDS_pept        346912..349341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="DET0366"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by similarity to SP:P17922; match to
FT                   protein family HMM PF01588; match to protein family HMM
FT                   PF03483; match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:DET0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40364"
FT                   /db_xref="GOA:Q3Z9I7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9I7"
FT                   /protein_id="AAW40364.1"
FT                   /translation="MKIPLKWLKEYLPTDMSPAELAERMTMAGTEVTVLNSRKDKWPNV
FT                   YVGQIMEVNRHPNADRLVLVKVDWGQGQETVVTGAPNCKAGDKVVFARTGAVLIDGHNG
FT                   KEMVLKPAVLRGVESCGMVCSERELGLSDEHEGILILPADAPVGMLASEYLGEIILDLE
FT                   LTPNRGDLMCVTGVARELGALIDRLPSISTPDFKATGKDIKDKINIEIKNTKLCTRYTA
FT                   SLIEGIKIGESPDWLKERLIACGMRPINNVVDATNYVMLEFGQPLHSFDYDQIKSKHII
FT                   VRPAAEGEVLTTLDGVERKLSPDMLLITEPDKIIALAGVMGGENTEVTEKTASVLLESA
FT                   TFDKHSIRRTAKALKLQSEASARFEKGLSFELAPVALKRATQLILEIAGGQAASGLMDV
FT                   MPVKKDRNSVVLSLSKVNRVLGLEGEKFDSCKIAKRLGFAWMPEYVPGMEEFGYGSVDD
FT                   KMRFFPGYWRMDIESDIDMIEEVARIAGYDTIPCLPLDKAIPKIETPPLPGIKRFLRQI
FT                   LSGYGFQELISYSFTSREMLSRVFSGAEPECLAISNPMSSEQEVMRTSLRPALYASLAA
FT                   NRRFEKNGLRLYELGRIYLPKENNKQDEPEMLCALIAGSASEAWWQRNTAGFDFFDAKG
FT                   IVESLVSRLGIAADFAVSDEPGLTPGYQAGILVGDMPVGVLGQLSPQTADKFGITEPVY
FT                   MFEINLSKLITRATVRRKFTQINRFPSVERDLALVLDRSITNRQVTDIISEFDLVKNVE
FT                   LFDMYQGKQVAEDKKSLAYHLLFQSDTHTLKDADVDSVMNQILKRLNTETGAVLRS"
FT   gene            349435..350070
FT                   /gene="ppa"
FT                   /locus_tag="DET0367"
FT   CDS_pept        349435..350070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="DET0367"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by similarity to SP:P37981; match to
FT                   protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:DET0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40363"
FT                   /db_xref="GOA:Q3Z9I6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I6"
FT                   /protein_id="AAW40363.1"
FT                   /translation="MLSDSSKQIKKEVEAINSDFKTIVGCGESKCPKLKRLKLASTPDI
FT                   ILKVMIEIPKGSQNKYEYDKERKVIKFDRMLFSAVHYPSDYGFIEDTLAEDGDPLDALV
FT                   LVWEPTFPGCLIETKPVGLFKMYDEKGPDAKLLCVPIGDPHFNFIRDLSDVPPHLLKEI
FT                   FHFFNIYKELEAKKTGVEGWEDRESAIKTYWESHQRYLDSLKNKPEQK"
FT   gene            complement(350138..351847)
FT                   /gene="proS"
FT                   /locus_tag="DET0368"
FT   CDS_pept        complement(350138..351847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="DET0368"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:DET0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40362"
FT                   /db_xref="GOA:Q3Z9I5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9I5"
FT                   /protein_id="AAW40362.1"
FT                   /translation="MRYSRLFGKTQREIPSDAETISHQLLLRSGMIAQLTAGVYSFMPL
FT                   AWRSIQKIENIIRQEMNKSGCQELAMPVLQPVEIWQQSGREAPFGQTLFHLKDRKDRNL
FT                   VLGPTHEEVITDLASRYIQSYRDLPQRLYQIQTKFRDEPRPRGGLIRVREFIMKDMYSF
FT                   DASPEGLDESYQTMKQAYENVYRRCGLESMVIDADSGAIGGKASHEFMIVAESGEDSII
FT                   YCPKCNYAANAEKAVFKKKTLPKEPPKDLEEVATPGQKTISEVAAFLSLKPENTLKAVF
FT                   YMADGKFVMAVIRGDLDINEIKLKNLLKCNDLRLAEDSEVKAAGIAAGFASPVGLKNSL
FT                   TVADDSVENGSNFVAGANKDGFHLKNVNFGRDFKADKMADIALAAEGAACPFCDGTFAS
FT                   KRGVEVGHIFKLGTFLSERFGANFTDAEGISHPIIMGCYGMGVGRLLAAAIEQNHDEKG
FT                   IIWPMPIAPYQIYICGLFLDNPAVSQAAEKIYTELEAQGVEVLFDDRELTAGVKFNDAD
FT                   LLGIPLRLTISPRNLDKGGVELKLRRNKESELVPLESIMERVITCIKSQSDL"
FT   gene            complement(351938..352903)
FT                   /gene="ispG"
FT                   /locus_tag="DET0369"
FT   CDS_pept        complement(351938..352903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="DET0369"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /note="identified by similarity to SP:P27433; match to
FT                   protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:DET0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40353"
FT                   /db_xref="GOA:Q3Z9I4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I4"
FT                   /protein_id="AAW40353.1"
FT                   /translation="MTKTDTRNIPATISQIKELEECGCEIIRLAIPDMEAATALKSIRK
FT                   EVRIPIVADIHFDYRLALAALLAGADGLRLNPGNIGDPERVKAVVRAAKEREIPIRIGV
FT                   NAGSLPKDLPPELTTAQKMVKAAMGHIKILEALDFSLIKVSLKAFDVPTTVEAYRQIAS
FT                   LIPYPLHVGITETGTPKTGLVRSAVGIGNLLYMGIGDTIRVSLTSPPQEEVFAAYEILK
FT                   SLNLRQRGPVLVSCPTCSRTEVDIVGIAARVQEALNKIDKPIRVAVMGCAVNGPGEAKE
FT                   ADLGIACGKGQGLLFRKGEKIASFPEDELVNALLREIASL"
FT   gene            complement(353021..354058)
FT                   /locus_tag="DET0370"
FT   CDS_pept        complement(353021..354058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0370"
FT                   /product="membrane-associated zinc metalloprotease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40352"
FT                   /db_xref="GOA:Q3Z9I3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I3"
FT                   /protein_id="AAW40352.1"
FT                   /translation="MLLTIVSFLIIFSIVVISHELGHFFSAKAIGVKVEEFGFGYPPKI
FT                   FGRKFGQTEYSLNWLPLGGFVKVEDDPVNNKGLSSKSAGKRLLFFSAGALVNAVLPIIL
FT                   FAFALMVPHDVLVGRVNVEEVVPDSPAALAGLVAGDTILSVNGTEIRNTSEFSRISQLN
FT                   LGQTIEITVLHADQTQSTVSLSPRWQPPAGEGPVGISLQTLDYQIISESESVLASIPLS
FT                   IQQNFETLVLFKNSILGLIMGSVPFDVVGPVGLAQMTGDVARAGIGPLLEFTAFLSLNL
FT                   AIINLLPLPALDGGRILFVFIEWIRGGRRISPRVENLIHMTGFFLLIGLMLAVTFQDII
FT                   RIAQG"
FT   gene            complement(354059..355192)
FT                   /gene="dxr"
FT                   /locus_tag="DET0371"
FT   CDS_pept        complement(354059..355192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="DET0371"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="identified by similarity to SP:Q9XFS9; match to
FT                   protein family HMM PF02670; match to protein family HMM
FT                   TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:DET0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40351"
FT                   /db_xref="GOA:Q3Z9I2"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I2"
FT                   /protein_id="AAW40351.1"
FT                   /translation="MVHSIKNIVILGSTGSIGRQTLEVIHSLPDRFKVLGLAGGTNANL
FT                   LKEQTEQFRPKYIYCQNCHDTNACTARFIPMEEMAALPEADIVVVATPGSAGLQPVLAA
FT                   ARAGKVIALANKESLVSAGEIVTATAQENRAKILPVDSEHSAIWQCLSGEVTPPARIIL
FT                   TASGGPFRSLTKDEIAKVTPEQALKHPSWKMGTKVTIDSASLMNKGLEIIEARWLFDMP
FT                   VRNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQCALTYPERLTNLTLPRLNWA
FT                   EIGKLDFEMPDMDRFPCLKLAISAGEEGKTFPAALCAADELAVEMFLKGEIGFGQIPQL
FT                   IAKVLDAHQAVASPSLDDILAADAWARRKVTELAGKL"
FT   gene            complement(355177..355980)
FT                   /gene="cdsA"
FT                   /locus_tag="DET0372"
FT   CDS_pept        complement(355177..355980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="DET0372"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by similarity to SP:O31752"
FT                   /db_xref="EnsemblGenomes-Gn:DET0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40350"
FT                   /db_xref="GOA:Q3Z9I1"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I1"
FT                   /protein_id="AAW40350.1"
FT                   /translation="MLKKRVLSGCLLAIIALAVIWIDQPIAWLTLAMAVVVALALNEFY
FT                   NAVTVYLKSQPFKALGIFWGMLIVISPHLQIESVLPFLLGSFSLTSLIYLLTLKDRTDA
FT                   FPRWAWTLSGVIYIGLLSSFWVALRELPMGREWVLWTLILTAATDTMAFFIGSRFGKQK
FT                   MAPSISPNKSWQGAIGGAVFSIIVAPIFADLLGLPINVFVAMLIGLLVSVAGQTGDIAE
FT                   SLFKRNMHCKDSGNLIPGHGGIMDRLDSLLFTGIVVYYYVIWFIQ"
FT   gene            complement(355984..356694)
FT                   /gene="uppS"
FT                   /locus_tag="DET0373"
FT   CDS_pept        complement(355984..356694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="DET0373"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to SP:O82827; match to
FT                   protein family HMM PF01255; match to protein family HMM
FT                   TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:DET0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40349"
FT                   /db_xref="GOA:Q3Z9I0"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9I0"
FT                   /protein_id="AAW40349.1"
FT                   /translation="MDTTVRINNTPPNHIAIIMDGNGRWAERRGLSRLDGHKAGLENAR
FT                   QIIRHLNSLGVKYVTLYSFSTENWKRPDTEIKGLFGLINDIMSSYIPELVENNVRLKHL
FT                   GHLDKLPSVLKDKLADLLSRTSRNTGLTLCLAFDYGGRDEIIQAVKKLVKDGLAADKIT
FT                   ENVFDGYLYTAGIPEADLVIRTGGEMRLSNFLLWQSAYSELYFSEVMWPDFGEKEIDNA
FT                   ISAFNQRQRRFGGL"
FT   gene            complement(356761..357318)
FT                   /gene="frr"
FT                   /locus_tag="DET0374"
FT   CDS_pept        complement(356761..357318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="DET0374"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:DET0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40348"
FT                   /db_xref="GOA:Q3Z9H9"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9H9"
FT                   /protein_id="AAW40348.1"
FT                   /translation="MINEILQKSEKKMAASLDVLSQELSGIRTGRSSPALVEHIKVEYA
FT                   GVPTPINHLASIAAPDPRYITIQPWDRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPP
FT                   LSEERRQEMIKMVSKRLEEDKIAMRNVRRDAMDEMKKLEKSKEISQDDLKRGSDQLQKI
FT                   TDSFIAKADKLGADKETELKQV"
FT   gene            complement(357320..358045)
FT                   /gene="pyrH"
FT                   /locus_tag="DET0375"
FT   CDS_pept        complement(357320..358045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="DET0375"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by similarity to SP:O31749; match to
FT                   protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:DET0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40347"
FT                   /db_xref="GOA:Q3Z9H8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9H8"
FT                   /protein_id="AAW40347.1"
FT                   /translation="MAEIKYKRILLKLSGEAFKGATGYGIDIPTVRSIAHEIKHICLMG
FT                   VEVAIVVGGGNIWRGATAAKEGIDRVSADYAGMLATIINALTLQDALEREGIVTRTQSA
FT                   LAVQQVAEPYICRRAIRHLEKGRVVIFAGGTGNPYMTTDTAAALRAIEIEADVLLMAKN
FT                   KVDGVYTADPKKHPEATLFQHLTHMEAINKRLQVMDATALSLCLDNKLPIIVFDLQSSE
FT                   SLVSAISGQPIGTLISSES"
FT   gene            complement(358060..358563)
FT                   /locus_tag="DET0376"
FT   CDS_pept        complement(358060..358563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0376"
FT                   /product="translation elongation factor Ts, putative"
FT                   /note="identified by match to protein family HMM PF00627"
FT                   /db_xref="EnsemblGenomes-Gn:DET0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40338"
FT                   /db_xref="GOA:Q3Z9H7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9H7"
FT                   /protein_id="AAW40338.1"
FT                   /translation="MAINAEQIKELREKCGAGVMECRNALMDSNGNVEKAQEILREKGL
FT                   VKAAKKAERETVQGIVESYIHTQGRIGALVELNCETDFVARTDAFKELAHNLAMQVAAM
FT                   CPLYLSEEDRPAECEVEAENACLLLQPYIKDLSKTINGLIIETVAKVGENIRLKRFARF
FT                   ELGG"
FT   gene            complement(358588..359325)
FT                   /gene="rpsB"
FT                   /locus_tag="DET0377"
FT   CDS_pept        complement(358588..359325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="DET0377"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by similarity to SP:P21464; match to
FT                   protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:DET0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40337"
FT                   /db_xref="GOA:Q3Z9H6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9H6"
FT                   /protein_id="AAW40337.1"
FT                   /translation="MPTTNIKELLEAGAHFGHQTSRWHPRMKKYIFTKRNGIHIIDLEK
FT                   TVVMLDKACNYINQVVSEGGKVLFVGTKKQAQEILAEEAKRCGMYFINQRWTGGILTNF
FT                   HSIQSRIDYLVRLEDQQARGDFNRLPKKEAQKLAEEIARLNRTMGGFKEMTRLPDVIFV
FT                   VDPTKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPIPSNDDAMRAIKLICSKMADSVI
FT                   EAQNALKVTEVETTGEAQAETAG"
FT   gene            complement(359510..360277)
FT                   /gene="purQ"
FT                   /locus_tag="DET0378"
FT   CDS_pept        complement(359510..360277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="DET0378"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by similarity to SP:O29008; match to
FT                   protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:DET0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40336"
FT                   /db_xref="GOA:Q3Z9H5"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9H5"
FT                   /protein_id="AAW40336.1"
FT                   /translation="MSKVKTLILRTPGTNCDIETSYAFELAGSETEMVHINELLAKPSR
FT                   LAEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKINRFHESGGLIIGICNGFQALVK
FT                   TGILPGPMKDGQKITLTENNSGRFECRWTYLAVNPFSTCVFTQGIDRLYLPVAHGEGKL
FT                   LGSPEVINKLNSVVYYTDKDGKRNSPYPANPAGTLMDIAGIADESGRIFALMPHPERFV
FT                   RGSQHPRWPAEGLKEEGDGLKIFTNAVKWARQV"
FT   gene            complement(360284..363145)
FT                   /gene="purL"
FT                   /locus_tag="DET0379"
FT   CDS_pept        complement(360284..363145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="DET0379"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by similarity to GB:AAA22679.1; match to
FT                   protein family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:DET0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40335"
FT                   /db_xref="GOA:Q3Z9H4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9H4"
FT                   /protein_id="AAW40335.1"
FT                   /translation="MHRIEVSLKPEWPDPKGNSICRDIQDLGITSVSEVRVIDVFWLEG
FT                   QLSDSEVLTISGELLSDKIIQTFKYDANCPQAEADGFSAIEVTYNAGVTDPVQETILKA
FT                   ISDLGIKGVTAAKTAKRYLLKGEISADELDTIGSKLLINPIVQHVVKSGSNPFPPNPKY
FT                   TFKLRKIDLLAEKLKDNMASLGKEFSLSHQELSAIYEHYLKLGRAPTDAELETLAQTWS
FT                   EHCCHKTFKAMLDYDGQIINNLLKQTIAKATAELNKPWCLSVFVDNSGVIEFDDKWGVC
FT                   FKAETHNHPSAVEPYGGAATGIGGVIRDILGTGLAAKPIANTDVFCFGQPDLPENELPP
FT                   GVLHPRRVFKGVRSGVADYGNRMGIPTVNGAVLFDERYTANPLVYCGTIGLIPKKYALP
FT                   GKQSAGDLVVLIGGRTGRDGIHGVTFASGELNDRSTELSFTAVQIGNPIVEKRMLDTLL
FT                   AARDRELFVRITDCGGGGLSSAIGEMAESTGVKVYLDKVPLKYSGLTYSEIWISESQER
FT                   MLLAVKKEKLSEIMALFESEGVEASVIGEFSNDRHLKLFYEDNPVADLQMDFLHNGRPQ
FT                   LELTATRHKHRHPEADFDCPEDLETELKNILSHWNVCSREWIIRQYDHEVQGGSVLKPM
FT                   AGAENDGPGDAAVIRPVLGSKKAVVISNGINPSYADVDAYNMAASAIDEALRQIIAVGG
FT                   NLDRVALLDNFSWGNASRPESLGDLVRACQACHDLSLVFETPFISGKDSLNNEFRYNDK
FT                   LITIPHTLLISAIGVMEDGEKAVSMDFKKAGNLIYLVGKTAEELGGSHYFKNHSFIGNR
FT                   APAVNAERAKENMQALSSATAKGLVAACHDLSEGGLGVAAAEMAFSGKLGANIRLADVP
FT                   LSEKIEREDYILFSESNSRFLAEVSPEHKAEFEKLMQAGDFGLIGEVTAEPRLKISGLG
FT                   GREIIINTPVSELKEAWQRPMRW"
FT   gene            complement(363149..364030)
FT                   /locus_tag="DET0380"
FT   CDS_pept        complement(363149..364030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0380"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:DET0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40334"
FT                   /db_xref="GOA:Q3Z9H3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9H3"
FT                   /protein_id="AAW40334.1"
FT                   /translation="METGTFKVKSGLAQMLKGGVIMDVTTPEQAKIAEEAGACAVMALE
FT                   RVPSDIRAAGGVARMADPTIIEKIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDESE
FT                   VLTPADESFHVWKHDFKVPFVCGCRDLGEALRRIGEGAAMIRTKGEAGTGNIVEAVRHM
FT                   RSVMGSVRRVQSMSADELSAYAKEINAPLELVLELHKTGKLPVVNFAAGGVATPADAAL
FT                   MMQLGADGVFVGSGIFKSSDPAAMAKAVVKAVTHYKDAKVLAEISKGLGDAMPGLDIKQ
FT                   IEPDKLISRRGW"
FT   gene            364234..364611
FT                   /locus_tag="DET0381"
FT   CDS_pept        364234..364611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0381"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:DET0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40333"
FT                   /db_xref="GOA:Q3Z9H2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9H2"
FT                   /protein_id="AAW40333.1"
FT                   /translation="MGKCDTAPLADDVWSVMDSQITLDLEKLPGLSLKGGAGYMAGKGL
FT                   AKPVLVVRGQDNNLYAYENACPHGGRKIDPVQGEARLRCCSVNHSTFDYNGKVLSGPAQ
FT                   HKHELRRLLTSQADGKLLISL"
FT   gene            364688..364762
FT                   /locus_tag="DET_tRNA-Thr-1"
FT   tRNA            364688..364762
FT                   /locus_tag="DET_tRNA-Thr-1"
FT                   /product="tRNA-Thr"
FT   gene            364790..365560
FT                   /locus_tag="DET0383"
FT   CDS_pept        364790..365560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40332"
FT                   /db_xref="GOA:Q3Z9H1"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9H1"
FT                   /protein_id="AAW40332.1"
FT                   /translation="MSKFVDRLKNVSKGYVRPMGFNAVASAPPPKMLLAAELDIENLTD
FT                   KEAFGGADVVLVSASKASAKKLKEAADLLGETVWGVMLGDKAADAAKMAKAGADFVVFS
FT                   PDAEVSPLTALEKTGKIIILETNLTDFMIRAADCLSVGAVIVGEQADTATLSWRKIMLY
FT                   QRFADILSKPFLVRVSSNITLSELQSLWALGIDGVLVSGSAGLKELHTLIDKAEWTPKR
FT                   KRGHMSAIVPSLKMPASESVAPEEPEEPDEGDEE"
FT   gene            complement(365645..366790)
FT                   /locus_tag="DET0384"
FT   CDS_pept        complement(365645..366790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0384"
FT                   /product="IMP dehydrogenase family protein"
FT                   /note="identified by similarity to SP:P50099; match to
FT                   protein family HMM TIGR01304"
FT                   /db_xref="EnsemblGenomes-Gn:DET0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40323"
FT                   /db_xref="GOA:Q3Z9H0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9H0"
FT                   /protein_id="AAW40323.1"
FT                   /translation="MTVPEFKTLRRTYGFDEVAIVPGGLTVNPEQVEIDFKIGNINFSI
FT                   PFIASAMDAVTNVDTAVAMSKMGGLSVLHLEGIYTRYENPQEILDQIISKPIDEVTAFM
FT                   QKVYTAEPIKEHLIAKRVSEIKAKGGICAVSIMPANAKKLAPVAVEAGADIISVASTVT
FT                   SARHVSKSSHGLIFEEFVKMIKVPVLVGNCVSYQACLELMRTGVHGVIIGVGPGAACTS
FT                   REVLGIGVPQITASMDCAAARETYYKETGRYVPIITDGGFKKGGDVCKAICAGADAVML
FT                   GSPFAKAAEAPGRGYHWGMSHPHPSLPRGTRIKVGTTGSLEQILFGPTSVTDGTQNMVG
FT                   ALKTSMGVCGASNIREMQQVEMVIAPAITTEGKSYQLSKCQ"
FT   gene            366875..367033
FT                   /locus_tag="DET0385"
FT   CDS_pept        366875..367033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40322"
FT                   /db_xref="GOA:Q3Z9G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G9"
FT                   /protein_id="AAW40322.1"
FT                   /translation="MHKAKKYIEMGIVSGPKYHGSQGGVLSPFYYTVFRDLVFFLASLA
FT                   FRLILLQ"
FT   gene            367041..367865
FT                   /locus_tag="DET0386"
FT   CDS_pept        367041..367865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0386"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by similarity to OMNI:NTL01NS4675; match
FT                   to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:DET0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40321"
FT                   /db_xref="GOA:Q3Z9G8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G8"
FT                   /protein_id="AAW40321.1"
FT                   /translation="MALYVVATPIGNLEDITLRALRVLSEVKLIAAEDTRRTRKLLSAH
FT                   NIKTPLTSYFEHNRLSKLDYILEVLGEGDVALVSDAGMPGISDPGYELIKAAHEHGIKV
FT                   VPVPGASAVITAVAVSGLDCASFSYLGFLPRQKTERRKALSEAASLGASIVILEAPHRL
FT                   QGCLLDIKDVLGDREIAVCRELTKIYEEIFRGSISQAISHFDQPRGEFVLVVEGCKVPV
FT                   SQPELTDDIIKELGMLKKQGKPAKEAVALVSQKSGLPKKEIYRAWLKINKTL"
FT   gene            367890..368105
FT                   /locus_tag="DET0387"
FT   CDS_pept        367890..368105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40320"
FT                   /db_xref="GOA:Q3Z9G7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G7"
FT                   /protein_id="AAW40320.1"
FT                   /translation="MRRGCISLGDVVCTGCNNNIPYPERYLAVDEEDGKEVDKGTTVHY
FT                   CVECALKKGYASYKEEKGERILTFLP"
FT   gene            368114..369775
FT                   /gene="metG"
FT                   /locus_tag="DET0388"
FT   CDS_pept        368114..369775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="DET0388"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM TIGR00398"
FT                   /db_xref="EnsemblGenomes-Gn:DET0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40319"
FT                   /db_xref="GOA:Q3Z9G6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9G6"
FT                   /protein_id="AAW40319.1"
FT                   /translation="MSERIFIGVAWPYANSQLHLGHVAGAYLPADIFARYHRTRGDEVL
FT                   MVSGSDMHGTPITIRAEQEGITAAEVAERYHRLFMASWPKLGISWDCYTSTATANHART
FT                   AQQMFLSLYEKGYIYKDTVCQPFCPHCNRFLPDRYVEGTCPHCKYEGARGDQCDNCGKP
FT                   LNAAELLNFRCKNCGNPPEFRETEHFFLKLSAFEEELTHWVETKTYWRTNVLNFTLRYL
FT                   KEGLKDRAITRDLDWGVPLPLPGYEGKRLYVWFEAVIGYLSASIEWAASKGQPDEWQKY
FT                   WGGDTKSYYFIGKDNIPFHTIIWPAMLMGRGGLDLPYDVPSNEYLTIEAQKFSKSRNKA
FT                   IWVDDVLSRYSVDTLRYLLSANMPESSDMDFSWREFVRRNNDELVATYGNLAQRVLTMV
FT                   CRNFDNKVPEYGELDERSLNLIEKTSAMLFETDKALHGCNFREAIKLAMSLAQEANRYL
FT                   DEKAPWKEIKVDKAAAARSLYVAMAALSGLRVAFYPFLPESSSRLSTYLGFGSEIEKDG
FT                   WVLKMPVAGQEMIPPEPLFKKLEDSVVEEETARMGL"
FT   gene            369797..370771
FT                   /gene="hepT"
FT                   /locus_tag="DET0389"
FT   CDS_pept        369797..370771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepT"
FT                   /locus_tag="DET0389"
FT                   /product="heptaprenyl diphosphate synthase component II"
FT                   /EC_number="2.5.1.30"
FT                   /note="identified by similarity to SP:P55785; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:DET0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40318"
FT                   /db_xref="GOA:Q3Z9G5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G5"
FT                   /protein_id="AAW40318.1"
FT                   /translation="MLKLSSIYAPINEGLKGVEDEFKLVSESRKQSFPEMAEMLDYILV
FT                   GGKVLRPALSMLSAMCFGTGIKKVLPLATSSEMLHIATLVHDDAIDKADTRRSRRTVNS
FT                   VWGLEKAILLGDFLFAHAAEVAAETDNMRIVTLFAQTLQIIASGELKQAYASFNPDQSY
FT                   ENYLERISGKTAALFVMATKGGAILADASPSDEEIMRSYGYNLGLSFQIVDDILDFVGN
FT                   AKDMGKPVGSDLNNGTVTLPALLLMDRYPENNPIKDMLGATDRSAHVARAVEMINSSDI
FT                   IDLSYKEAKRYADLACQDLSKLPKTAARESLYQLAEFIVERKN"
FT   gene            complement(370749..371045)
FT                   /locus_tag="DET0390"
FT   CDS_pept        complement(370749..371045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40317"
FT                   /db_xref="GOA:Q3Z9G4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G4"
FT                   /protein_id="AAW40317.1"
FT                   /translation="MFAVKNLPALSGENTFQPRPYFAQMGKDKDNHNKSQNTPQTTHQF
FT                   HLLSPCQILRLKIPSSQCQTSRKWVRTKITRIMPIIFIKSFTLNLLVSSCVQL"
FT   gene            complement(371093..372919)
FT                   /gene="ftsH"
FT                   /locus_tag="DET0391"
FT   CDS_pept        complement(371093..372919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="DET0391"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="identified by similarity to SP:P37476; match to
FT                   protein family HMM PF06480; match to protein family HMM
FT                   TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:DET0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40316"
FT                   /db_xref="GOA:Q3Z9G3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G3"
FT                   /protein_id="AAW40316.1"
FT                   /translation="MRYQMNSNWKRSTIIYIVMLVAIIAIFSFLVPNSQKPEEVPLSQI
FT                   ITLSQEHKIAEITVDSENIEVTTTDGTKLSTVKEYIASIYDIEGLDLTDVKVNIQPAGG
FT                   LDWGTMILTYLPFLIFGGLLIFIFTQARGANNQAVSFGRSKAKLFNMDKPTITFANVAG
FT                   VDEAKQEVGEVVEFLKSREKFQALGARIPKGILLIGPPGTGKTLLAKAIAGEAGVPFFS
FT                   ISGSEFVEMFVGVGASRVRDLFDQAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQT
FT                   LNQILVEMDGFDTDTSVIVIAATNRPDILDPALLRPGRFDRRVVLDKPDITGREAILKI
FT                   HAKGKPLADTVNLENLAKQTVGFSGADLANLLNEAAILAARKNRKVVETEDLEESIDRV
FT                   IAGPERKSRRISTQEKEVTAYHETGHGLVLRLVQGADPVHKISIVARGMTLGHTRQLPN
FT                   EDRYLMTRSQFKAMMAGLLAGYVAEELTFKELSTGASDDLRRATDIAHKMVTSYGMSDK
FT                   LGPRTFGNKEEMVFLGREISEQKDYGEKVADMIDEEVRGLIEEAHQKAKTILTENKNRL
FT                   KFIAEKLFEKETLEGAELENLFVGEFPVSESA"
FT   gene            complement(372979..373809)
FT                   /locus_tag="DET0392"
FT   CDS_pept        complement(372979..373809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0392"
FT                   /product="AP endonuclease, family 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40308"
FT                   /db_xref="GOA:Q3Z9G2"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G2"
FT                   /protein_id="AAW40308.1"
FT                   /translation="MAGLLFGTAGIPYSTPKHTTQNGIHRVAELGLDGMEIEFVRGVYM
FT                   KAPDTNPVRILSELLRIKLSAHAPYYLNFNAVEENKVKMSQHLLYQSAKTASLCGAGSL
FT                   VFHPGFYLTDSPSAAYEAIRDNIRPVAERLQKEGFPISLRPEVSGKVTQFGDLKETMAL
FT                   CSEIPGLLPTIDFSHYHARTGKFNSYSEFSFMLTTMADYLGESALKNMHIHISGIDYSP
FT                   RGERQHLNLAESDFNYKELLLCLRDKGCAGLVICESPNLEEDALLLKETYFSLA"
FT   gene            373929..374273
FT                   /locus_tag="DET0393"
FT   CDS_pept        373929..374273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0393"
FT                   /product="iojap-like protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:DET0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40307"
FT                   /db_xref="GOA:Q3Z9G1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9G1"
FT                   /protein_id="AAW40307.1"
FT                   /translation="MESIDIARQMVSIASEKQAEDIVLLDVRELVSYCDYFVLMSGASG
FT                   RQLSAIADTVEKTFKPLKIGPRHREGDADSGWILLDFGGVIAHIFTPEIRSYYKLDRLW
FT                   ENAPKLVSVQ"
FT   gene            complement(374274..374702)
FT                   /gene="ndk"
FT                   /locus_tag="DET0394"
FT   CDS_pept        complement(374274..374702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="DET0394"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by similarity to SP:Q59636"
FT                   /db_xref="EnsemblGenomes-Gn:DET0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40306"
FT                   /db_xref="GOA:Q3Z9G0"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9G0"
FT                   /protein_id="AAW40306.1"
FT                   /translation="MERTLLLVKPDGVNRGLSGEILGRMEKLGLKMIGLRMLQMDAVLA
FT                   DKHYAPHRERPFFKDLVTYITSGPIVAAVFEGENAVEKMRKAMGATDPAKSEKGTVRGD
FT                   LGINIEQNTVHGSDSAENAKHEISLFFSESELVNYDRR"
FT   gene            complement(374712..376082)
FT                   /locus_tag="DET0395"
FT   CDS_pept        complement(374712..376082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0395"
FT                   /product="glycoprotease family protein/hydrolase,
FT                   beta-phosphoglucomutase family"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549; match to protein family HMM
FT                   TIGR02009"
FT                   /db_xref="EnsemblGenomes-Gn:DET0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40305"
FT                   /db_xref="GOA:Q3Z9F9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F9"
FT                   /protein_id="AAW40305.1"
FT                   /translation="MPVLIAIDTATPDTGLAVLKDDEIVAQYNWLSHQNQTVELLPRLE
FT                   WLLESAGLSLKDASAIAVSIGPGSFNGLRVGLSTAKSLAFALDIPLCGIGTLELAAYPY
FT                   LASGLKVWALLPSGQQEYAAAIYQKNGDGLKEEVKPYITNLADLAAEVSEPCVICGPIS
FT                   QTSQTELKALLGDKKAVFAPADIRPSRAASLARLAKKRIEDGLTDSPAGLQPLYLRRPQ
FT                   ISPRKHRTGLPLSQNKAVIWDMDGVIADSAPFHMRAWQTTFAEIGYTFSEADFYRTFGL
FT                   RNDMIIYSVLGEKSDADTIHTLADRKEHLFREYAGQEIQLFPGVIELLKSLKTAGYRMA
FT                   IASSAPLANIKLVMTKLGIGDYFLATVSEKDVTKGKPNPQIFLLSAARLCASPEECLVI
FT                   EDAPAGVEAAKKAGMKCIAVTNSQQPQALSEADMIVDTLGKISVEDIAGFIGLAGAK"
FT   gene            complement(376060..376551)
FT                   /locus_tag="DET0396"
FT   CDS_pept        complement(376060..376551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0396"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by similarity to GP:29894046; match to
FT                   protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:DET0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40304"
FT                   /db_xref="GOA:Q3Z9F8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F8"
FT                   /protein_id="AAW40304.1"
FT                   /translation="MNQLELVSHSTRQTQDLGKIIGGLASAGDIIFLVGNLGAGKTNLT
FT                   QGIAKGLDVTENALSPSFVLVREMYGRLPLYHIDLYRLDLSEEIEELGLDDYFYGSRVT
FT                   VVEWADKADELLPTENLRIEIAYLDENKRKLTLSAWGIRYEELLNEIAQRVKDAGFNSH
FT                   "
FT   gene            complement(376548..377558)
FT                   /gene="thiL"
FT                   /locus_tag="DET0397"
FT   CDS_pept        complement(376548..377558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="DET0397"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by match to protein family HMM TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:DET0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40303"
FT                   /db_xref="GOA:Q3Z9F7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F7"
FT                   /protein_id="AAW40303.1"
FT                   /translation="MKVSDIGECQLIDQLNKLLHQGTDETTPARQNLILDIGDDAAVFR
FT                   PQGYQLVTVDSLIENVHFNRSMLNWADLGYKALAINLSDIAAMGGVPQYAIVNIDLPPD
FT                   TLVSSVTDCYNAMRSLADKYQTAIIAGDTNQSSLINLAVTLLGSAENPDKLLTRNTALP
FT                   GQKIAVTGYLGNAAAGLDMLLNQTKVPDESREIFCRSFYRPEPRINEARLLVKEGARCC
FT                   IDISDGLAADLLHILRQSRVSARIELERLPVHPSLRLCYPLQAQHMALYGGEDYELLFT
FT                   APAKVIEQISAQSGIPVTIIGEIIPGKPDELKLVDKDGRALQPEKNGWEHFKKPK"
FT   gene            377850..378626
FT                   /locus_tag="DET0398"
FT   CDS_pept        377850..378626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0398"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE, putative"
FT                   /note="identified by similarity to SP:P27851"
FT                   /db_xref="EnsemblGenomes-Gn:DET0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40302"
FT                   /db_xref="GOA:Q3Z9F6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F6"
FT                   /protein_id="AAW40302.1"
FT                   /translation="MSSLAEAPIHDPGFDSEEAHKRKQYMVDLFVVQAKNYDFHDDVFG
FT                   LYAHRFWMRTVLKIMGRFLKDRKHVDMLDLACGTGFVTFNTARNFDNVDIEAFDISPDM
FT                   LAVAKERYEKYFKGRNIKFWRGDAEVPFGEEKYDLVTTSFAYRNFANKGIATENVFNAL
FT                   KPGGLFIIQDLTKPERHPMRGLYIFYMKYILPVLTGILGTEKSAARWLYKSAMMMPTNG
FT                   QIVKLMESKGFEKCQYKSLSLGIACVIWGFKPEKSE"
FT   gene            378628..379395
FT                   /locus_tag="DET0399"
FT   CDS_pept        378628..379395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0399"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE, putative"
FT                   /note="identified by similarity to SP:P27851"
FT                   /db_xref="EnsemblGenomes-Gn:DET0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40294"
FT                   /db_xref="GOA:Q3Z9F5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F5"
FT                   /protein_id="AAW40294.1"
FT                   /translation="MSSVNVSVKDPGFESEEAQARKRYMLQLFGFQAKHYDLHDDIIGM
FT                   GIHRRWGKEMVLEILTYTRNMPQVKMLDLACGTGFVTFNTLRYMNNVDIDAFDITPEMV
FT                   EVAKGRLKKNYPDRNVKFWVGDAEVPYGDAKYDVIGTCFAFRNFANKNLAASNIFKALK
FT                   PGGLLVLQDMTKPEKQPFRGIYLFALKNLMPIMARIIGTERKSARYLANSVLAMPSNAE
FT                   IMSILQNQGFINIKSRYQSGGMGTLTVAYKPEN"
FT   gene            379397..380491
FT                   /locus_tag="DET0400"
FT   CDS_pept        379397..380491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0400"
FT                   /product="3-dehydroquinate synthase family protein"
FT                   /EC_number="4.2.3.-"
FT                   /note="identified by match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:DET0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40293"
FT                   /db_xref="GOA:Q3Z9F4"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F4"
FT                   /protein_id="AAW40293.1"
FT                   /translation="MGKVDTLAYDIGNNRTRHVYIGSDILGSLPEYAKQLNADKFFIIT
FT                   DSNLENILKDKIKDLLSGVTETHLLAFPAGEASKTLSTLEDIGSKILDLRATKSSVIVC
FT                   LGGGVVGNLGGLTAALLFRGLRFFHIPTTMVAQIDSAIGQKQAVNYKMGKNLFGQYYAP
FT                   EFVFIDFNFLRTLPERQIRAGLAESVKHGLCQESSFFDYIEEHAGDYSPEVIDYISRHT
FT                   IELKLELLKIDPFEGKLDPQLELGHTIGHAVEIIKNGQLLHGESIAIGMVAEAALSCEM
FT                   GYMKPELAAKIERIFKKLGLPTRIPADVPLEGVLEALRYDNKRRTARTDFFLLEDFTRF
FT                   HKENGKIGTKVSEEVLKKVLESAY"
FT   gene            380475..381395
FT                   /locus_tag="DET0401"
FT   CDS_pept        380475..381395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0401"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase,
FT                   putative"
FT                   /note="identified by similarity to SP:P32166"
FT                   /db_xref="EnsemblGenomes-Gn:DET0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40292"
FT                   /db_xref="GOA:Q3Z9F3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F3"
FT                   /protein_id="AAW40292.1"
FT                   /translation="MKALTSERPDFQDWIQAARLKFLPQGVMPVVIAGALAFSEDTFDV
FT                   VNFVVAFSAAAAVQIGLTMFNDTLDYVYGTDCKHADAKNPFSGGSGVFTCGVIKPRQSL
FT                   LVIFSLYFFALLCAIYMALDMGWGVMWIAVIGAAISILYSAKPMRLAYHGLGELMMLIG
FT                   YGPVLTAWGYFVHTGMVNRDVLLIGVIPGLCMWAMILINEIPDYQEDRAAGKRNLTYRL
FT                   GPKNAKNLFSISLAGLYTYILALVFTGVMPPLSAISLGGIPLAVMAVRIAHRYYNDPIK
FT                   VAMANKLMVIIYSVTTATVAIGMLT"
FT   gene            381395..381997
FT                   /locus_tag="DET0402"
FT   CDS_pept        381395..381997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0402"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40291"
FT                   /db_xref="GOA:Q3Z9F2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F2"
FT                   /protein_id="AAW40291.1"
FT                   /translation="MVAPSFFEKVAPVYEFLTRMFMLGTFESARDRMLNEDTSAFSVLD
FT                   LCTGTGYIANKIEAKRIVGLDQSVQMMALNDRTKRPNKTLVRGNAYHLPFEDGEFERIY
FT                   CSSASHEFKLFGKVLAECFRTLKPGGKVAVYDIYQPKNKFYSLIVNTIYRYPVEHNIMW
FT                   VHTLEEWRKLLTEAGFEVEELEAVRGVFVFVRARKPV"
FT   gene            382126..382857
FT                   /locus_tag="DET0403"
FT   CDS_pept        382126..382857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0403"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by similarity to OMNI:NTL01MK0801"
FT                   /db_xref="EnsemblGenomes-Gn:DET0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40290"
FT                   /db_xref="GOA:Q3Z9F1"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9F1"
FT                   /protein_id="AAW40290.1"
FT                   /translation="MRYAVMADIHANLEALNAVLEDADKRGAAGIWCLGDIVNYGPDPV
FT                   ACLEILKSRKHLAVAGNHDLAVAGKINHSLFALEAARALVWTRNQLSSAMIDYLASLPE
FT                   VVVEGDFTLVHGSLRRPDWEYISTPQIAAENFGLMSTPYCLVGHTHMPYVFTPGQRGIC
FT                   RGMPLMAGSMQPLRQTSLIINPGSVGQPRDGNPQASYGIYNEEARTFCLYRVSYNITAT
FT                   QKKMQKAKLPQFLSARLSKGS"
FT   gene            382877..383752
FT                   /gene="ksgA"
FT                   /locus_tag="DET0404"
FT   CDS_pept        382877..383752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="DET0404"
FT                   /product="dimethyladenosine transferase"
FT                   /note="identified by similarity to SP:P37468; match to
FT                   protein family HMM PF00398; match to protein family HMM
FT                   TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:DET0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40289"
FT                   /db_xref="GOA:Q3Z9F0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9F0"
FT                   /protein_id="AAW40289.1"
FT                   /translation="MEKDAPLAATGTPSLMAQAKEMMEGYTLRARKGLGQHFLISQGVL
FT                   NKILLAADLKPTDTVIEVGPGLGVLTEELIKRAGQVIAVELDDKLVTALTEKFKAYPNF
FT                   RIIHSDILKTSPAEILGQNIPYKLVANLPYYITSAVLRQFLEAEAKPELMVVMVQKEVA
FT                   KNMVAQTGDMGLLTLSVRFYGNPSLVSVVPGGAFYPPPEVDSAIVKVAIPQAAIMQGVS
FT                   EADFFKLARAGFGTRRKTLLNALAQGLGVSKQSVLALLNRAGIEPARRAETLSMEEWKM
FT                   LCLVYTENPC"
FT   gene            383746..384600
FT                   /gene="ispE"
FT                   /locus_tag="DET0405"
FT   CDS_pept        383746..384600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="DET0405"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:DET0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40288"
FT                   /db_xref="GOA:Q3Z9E9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9E9"
FT                   /protein_id="AAW40288.1"
FT                   /translation="MLTLLAPAKVNLSLEVLYRRNDGYHELRSIIQSLSLCDRLSFSPA
FT                   KTVQISSDSPDWQAEHSLVSKAVALFSEKCGQGRGVNLTIAKRIPLVSGLGGDSSCAAA
FT                   VLKGLNKLWGCGYPRWRLMELGAELGSDVPFFMMGGTAMMEGRGETVTPLPTLNQMWAV
FT                   LLVPEIEMPPDKTAALYRNLHADSFSSGEISDKLLEDICQGKLSYSSCFNVFEKIAFTL
FT                   FPDLAKYRWQFLEAGAYQIFLAGAGPTLFTLLKDKNMAEKIYHNLCQKGHQAYLVSTLG
FT                   PLD"
FT   gene            384656..385153
FT                   /locus_tag="DET0406"
FT   CDS_pept        384656..385153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0406"
FT                   /product="rubrerythrin/rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DET0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40327"
FT                   /db_xref="GOA:Q3Z9E8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E8"
FT                   /protein_id="AAW40327.1"
FT                   /translation="MSSSENLSAAFAGESQANRKYLFFADKAEKEGFAHVARLFRAAAE
FT                   AETVHARNHLNALKGVGDTAANLSAAVEGESYEFTSMYPPFIKEAEAEGNSAALLSFNH
FT                   ANKVEKIHHGLFEKALEEVKSGVKAPDQVYYVCQVCGNTVLGEAPARCPICGAPASSFK
FT                   AV"
FT   gene            complement(385230..385469)
FT                   /locus_tag="DET0407"
FT   CDS_pept        complement(385230..385469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0407"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL03ST4202"
FT                   /db_xref="EnsemblGenomes-Gn:DET0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40326"
FT                   /db_xref="GOA:Q3Z9E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E7"
FT                   /protein_id="AAW40326.1"
FT                   /translation="MQIKKDLALTNKLLSQGLVSSRDPETGFRYILCATCPKDGGDGTV
FT                   ARIDRKDNEVERVLFCCSICGQEFAAKPEDIFLT"
FT   gene            complement(385554..386363)
FT                   /locus_tag="DET0408"
FT   CDS_pept        complement(385554..386363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0408"
FT                   /product="cation channel family protein"
FT                   /note="identified by similarity to OMNI:NTL01XC3234"
FT                   /db_xref="EnsemblGenomes-Gn:DET0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40325"
FT                   /db_xref="GOA:Q3Z9E6"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E6"
FT                   /protein_id="AAW40325.1"
FT                   /translation="MTSHDTMKKVHDLLTFGFESQPRKFISWFIISLICLNVLAVILGS
FT                   VDTIARDYHTLLHSFEIFSVTVFSLEYILRVWSCTVEPKYSHPFTGRIRFALSPLVLMD
FT                   LLAILPFYLPFLIRVDLRFLRTLRLLRLFRLSHLKRFNETSHMILNVLRERREALIISF
FT                   SIILLLVIITSSLMYFVENPAQPEVFKNIPDAMWWSVMTMTTVGYGDIYPITALGKFLG
FT                   SVIAVLGLAVFALPTAILSAGLLEEFRRKKELNEHICPVCGQEIPKH"
FT   gene            complement(386350..387606)
FT                   /locus_tag="DET0409"
FT   CDS_pept        complement(386350..387606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0409"
FT                   /product="polyA polymerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40324"
FT                   /db_xref="GOA:Q3Z9E5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E5"
FT                   /protein_id="AAW40324.1"
FT                   /translation="MNTEKLRSFLKNRLPPEINRLILAAAELAASQEASLYLVGGLVRD
FT                   CLLDKTPKDADLVITANAIRFGQDLLQGTSYKTTLHHRFGNLSADINGFKLDITTARSE
FT                   VYPAPGKLPEVGAGDIKADLFRRDFKINAMAISLSQQNSGCLVDPYDGLTDLKQGKLSV
FT                   LHPKSFQDDPSRIWRALRYSERLGFDISAETLALLKRDMQLIPLIGADRLRYEIECVLE
FT                   EAKPENIFLKAEETGVLRYSLPGVKADGWLVGKFAEARKIYGTCIPRVIYYCLLSARLN
FT                   KLQAENLVTGLNPGKYITGCLGDYRYLAENLPELEKTGLRPSHLYKILVKCRKEARQSF
FT                   YIASDNPLVRQNISLFEEELSNIKPHLKGADLIALGFTPGPAIQTILRELLFLKLDGQL
FT                   TSRADEIDYVKRRQADDQS"
FT   gene            387687..388604
FT                   /gene="nodI"
FT                   /locus_tag="DET0410"
FT   CDS_pept        387687..388604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="DET0410"
FT                   /product="nodulation ATP-binding protein I"
FT                   /note="identified by similarity to SP:P23703"
FT                   /db_xref="EnsemblGenomes-Gn:DET0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40315"
FT                   /db_xref="GOA:Q3Z9E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E4"
FT                   /protein_id="AAW40315.1"
FT                   /translation="MSTPAIKVSNLVKRYKDCTALDGLNLEIEQGECFGLLGPNGAGKT
FT                   TLVRILTSLTPSDSGKVEVMGLDLADHLRQIKAMFGVIPQLDNLDSELSVTENLVTFAR
FT                   FFDIKAADARRRASEILHLFKLEQKANSEVKALSGGMRRRLLLARGLMNNPGIIILDEP
FT                   SVGLDPQSKYLVWQKLKELKAGGITQLLTTQNMDEAAVLCDRIAIMHQGRVLDMDTPKG
FT                   LVDNHVGHCLMEIEVRPGEHEAITAECMRRRLDFEDSGLIIQVFRCGEDSLLDELKALG
FT                   WNVWQRIGTLEDVFLRLTGKGLVE"
FT   gene            388601..389368
FT                   /locus_tag="DET0411"
FT   CDS_pept        388601..389368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0411"
FT                   /product="putative NodJ"
FT                   /note="identified by similarity to SP:P55475"
FT                   /db_xref="EnsemblGenomes-Gn:DET0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40314"
FT                   /db_xref="GOA:Q3Z9E3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E3"
FT                   /protein_id="AAW40314.1"
FT                   /translation="MNWPTYRAFYMWLRNYDVFIRLFWSIAPGFIIEPVVLLVALGFGF
FT                   GSFIGDINGQPYMEFIIPGVIASYAMTSATFECTYNVFFRMDFRKTYDSILATPMNISD
FT                   VVTGEVLWGATRSIITACIILLVAALFGVIHSPLALLAPVFAVLEGIMFASMGVFFASI
FT                   VPSVYSFNYYFTLFIGPMTFFSGAFFPVSSFPETVQVISNIVPLTPAVSLIRGAVSGDF
FT                   AGVNVVISLLAVIGVSAAFYIATLFSMKRRVME"
FT   gene            389417..389968
FT                   /locus_tag="DET0412"
FT   CDS_pept        389417..389968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q58794"
FT                   /db_xref="EnsemblGenomes-Gn:DET0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40313"
FT                   /db_xref="GOA:Q3Z9E2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E2"
FT                   /protein_id="AAW40313.1"
FT                   /translation="MKVIALVGMPGAGKTEASRMFSKNGFIRIRFGDITDEKLRELGLP
FT                   LNEENERKVRESLRKQYGMEAYAVLNLSRIDENLKKDNVVVDGLYSWEEYKFLKSYYKD
FT                   KLIVLAISSSPATRYSRLCERADRPLNYENAVSRDYSEIENINKAGPIVMADITLLNEL
FT                   DLKDMEKQVKKLSLELRADV"
FT   gene            389965..390438
FT                   /locus_tag="DET0413"
FT   CDS_pept        389965..390438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0413"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by similarity to SP:O22000; match to
FT                   protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:DET0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40312"
FT                   /db_xref="GOA:Q3Z9E1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E1"
FT                   /protein_id="AAW40312.1"
FT                   /translation="MSRPNADEYFLKIAAVVAERSTCVRHHVGAVAVKDKHILSTGYNG
FT                   APAGLTDCLELGCLRNQNGIPSGTRHEICRAVHAEQNVIIQAALHGTSLEGATVYATHT
FT                   PCVLCAKMLTNARIKRYVSYGKYADDSFIDMFKQAGIEVVIKDRPPGIVEYLD"
FT   gene            390526..391431
FT                   /locus_tag="DET0414"
FT   CDS_pept        390526..391431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0414"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /note="identified by similarity to OMNI:TM0358; match to
FT                   protein family HMM TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:DET0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40311"
FT                   /db_xref="GOA:Q3Z9E0"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9E0"
FT                   /protein_id="AAW40311.1"
FT                   /translation="MVAKVIVNPVAGAKSTEQKWPHISRLMCDMGFSYDFQYTESQGHA
FT                   IEIARDAALNGYPYLVAVGGDGTINEVVNGILTASHDQKTLMGVVDTGTGNDFVRSLGL
FT                   DGNYLHSCQHLLSPKHTLVDAGLVTFQKDGRQVSRFFVNGAGVGFDAEVAATTEHMPKA
FT                   LGGTIPFVMALAKTLLGYRNKTVDIGLDEDNYTRRVLSVIVANGSYFGGGMKVAPSALI
FT                   TDSRFDVITLGDVNKLEILQTFPKIYKGTHITHPKVKTEHARFVSISSEEGLYLQADGE
FT                   LLGKTPATFEVLPQALTMVF"
FT   gene            complement(391497..392009)
FT                   /gene="dut"
FT                   /locus_tag="DET0415"
FT   CDS_pept        complement(391497..392009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="DET0415"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by similarity to SP:O67539"
FT                   /db_xref="EnsemblGenomes-Gn:DET0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40310"
FT                   /db_xref="GOA:Q3Z9D9"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D9"
FT                   /protein_id="AAW40310.1"
FT                   /translation="MTALAREEILRLIKSAKPLLENYPDLENQLQPNGFDLSLKQVRTL
FT                   EGEGVLPTDNARRKLPSNNPLEFDCNNQIKLMPGIYSVVYNEVVNIPKDVMALATPRSS
FT                   LLRSGCTVNTAVWDAGYSGRSESLLVVYNPAGLILERNTRLIQLVFFKLNAETGGYCGI
FT                   YQNENKS"
FT   gene            392224..392511
FT                   /locus_tag="DET0416"
FT   CDS_pept        392224..392511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01MM2338;
FT                   similarity to OMNI:NTL03CP2599"
FT                   /db_xref="EnsemblGenomes-Gn:DET0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40309"
FT                   /db_xref="GOA:Q3Z9D8"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D8"
FT                   /protein_id="AAW40309.1"
FT                   /translation="MAQDKTLVCRDCGNEFIFTAGEQEFYASRGLKNEPKRCPACRSAR
FT                   RSENRGEGGERRTYEVVCAACGVQTTVPFEPTEGRPVYCKDCYAKTKESE"
FT   gene            complement(392594..393355)
FT                   /locus_tag="DET0417"
FT   CDS_pept        complement(392594..393355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0417"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P48243"
FT                   /db_xref="EnsemblGenomes-Gn:DET0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40301"
FT                   /db_xref="GOA:Q3Z9D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D7"
FT                   /protein_id="AAW40301.1"
FT                   /translation="MNKKQTAAEQPIIKIENVQKHFGRVKALRGVSLDIKRGEVVVIIG
FT                   PSGSGKSTLLRCINRLEEYDSGKITVDGIPLDSTENINHVRREVGMVFQSFNLFSHLKV
FT                   IDNITLAQCQVRKRTKEEAAEIAADLLKKVGIPDKAHAFPVQLSGGQQQRVAIARALAM
FT                   NPQIMLFDEPTSALDPEMIKEVLDVMTTLAKEGMTMVVVSHEMGFARAAADRVIFMDEG
FT                   LIVESAAPDEFFTNPKHERTKLFLSKILHNS"
FT   gene            complement(393355..394176)
FT                   /locus_tag="DET0418"
FT   CDS_pept        complement(393355..394176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0418"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:DET0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40300"
FT                   /db_xref="GOA:Q3Z9D6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D6"
FT                   /protein_id="AAW40300.1"
FT                   /translation="MAEDKLKQSEKMNLIPGAEPSSRMDPWWWLVAGVFVLTGGLMLFQ
FT                   PDPFLDIFKYVWVGIGITVLVAVVSYFLMLILGMFGALGRLSKNTILRGLATFYVEIVR
FT                   GIPLLVQLIWWYFAFPVIIQSIGQGLNFGPMMNYQANPIVMAIWGMTFCYGAYMSEIYR
FT                   AGIQSIPKGQMEAARSLGMSHTQAMRYVILPQALRVVLPPMGNEFIALLKDTSLVSTVA
FT                   VADMVRLGREFTATNFNPIEVWTMIGLLYLILTLLSSRLINYIEKKTAFSR"
FT   gene            complement(394234..395016)
FT                   /locus_tag="DET0419"
FT   CDS_pept        complement(394234..395016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0419"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by similarity to SP:P30860; similarity to
FT                   SP:P39174"
FT                   /db_xref="EnsemblGenomes-Gn:DET0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40299"
FT                   /db_xref="GOA:Q3Z9D5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D5"
FT                   /protein_id="AAW40299.1"
FT                   /translation="MKRLSTILMSLILSGALLFSGCQSSTDDTDDNDDSTAKIQVTVVT
FT                   DATWPPFEYVNEQTHAIEGFDIDLMKAIAEKGNLEVTFQNVAWDALLAGLATGQYKVAI
FT                   SSITINAERAEKWLFSDPYFNAGQMVCVQKNNTTILSHNDLTGKKVAAQTGTTGFIEAQ
FT                   KIEGATVKSYDEIGLAFQDLMNGQIDAVICDTPVAIDYVNANPDKIKKVGTAFTDEFYG
FT                   ISVAKGQTEILARINQGLAAVIADGTFDQLVAKWNLNP"
FT   gene            complement(395060..395170)
FT                   /locus_tag="DET0420"
FT   CDS_pept        complement(395060..395170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40298"
FT                   /db_xref="GOA:Q3Z9D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D4"
FT                   /protein_id="AAW40298.1"
FT                   /translation="MQITPGRALFFQIKLQKHGHTDINIVDFVRNLFNLR"
FT   gene            complement(395219..396058)
FT                   /locus_tag="DET0421"
FT   CDS_pept        complement(395219..396058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0421"
FT                   /product="degV family protein"
FT                   /note="identified by similarity to GP:28202560; match to
FT                   protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:DET0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40297"
FT                   /db_xref="GOA:Q3Z9D3"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D3"
FT                   /protein_id="AAW40297.1"
FT                   /translation="MAIKIVTDSTADIPPQLAESLGITIVPLYVRFGEKALKDGVEITQ
FT                   DQFFEKLQTSTVHPNTSQPSPQDFIDVYQKLAQDCDGIVSVHISSKLSGTYDSAVQAKK
FT                   LLGNDAPPIEVIDSRSVSMGLGLLGLLAAEEASSGKSLNEVADTVRSAVDKVQMMGFFD
FT                   TLKYLALGGRIGKSKALLGALLSVKPVLVVGEGELLPAGQVRSRSKGMDKLAEFTAGVK
FT                   NLAALSVVYTTTPDEAVALADRLAEFFPRKQIIISRLGAALGVHAGPGTLFVATRSK"
FT   gene            complement(396447..396522)
FT                   /locus_tag="DET_tRNA-Met-1"
FT   tRNA            complement(396447..396522)
FT                   /locus_tag="DET_tRNA-Met-1"
FT                   /product="tRNA-Met"
FT   gene            complement(396513..396632)
FT                   /locus_tag="DET0423"
FT   CDS_pept        complement(396513..396632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40296"
FT                   /db_xref="GOA:Q3Z9D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D2"
FT                   /protein_id="AAW40296.1"
FT                   /translation="MTANTLKHLCPLFSPALCFTLGYLTNTPCRFYNTFLVAA"
FT   gene            396762..397712
FT                   /locus_tag="DET0424"
FT   CDS_pept        396762..397712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0424"
FT                   /product="magnesium and cobalt transport protein, putative"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:DET0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40295"
FT                   /db_xref="GOA:Q3Z9D1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D1"
FT                   /protein_id="AAW40295.1"
FT                   /translation="MALTQVKNNTSNIESITYGKLTWINIENPQEPDTEYLAANYPFHP
FT                   LDLDDVLSRRQRPKIDEYKEYLFFVLHFPFYNKELRTTVPAQLSVFIGENYIITLHSGN
FT                   LKPLVKLYREMELDEDARPEYFSHGSGFLMYRIVDRLVDYCLPITVKLLDNLEEVEDTI
FT                   FTGSGSDLNIVKDIALLRRDIIANRRIIWPMRAVIGCLENKLRKFINQDMSVYFGDMTD
FT                   HMDKVWDTLDETKEVIEGLSSTFDSMSSHRTNRAMRILTIVATILLPFTMVASIFGMNI
FT                   PLPFQNSENAIYFVAVITAIIVGFMLYMFRRIRLI"
FT   gene            397734..398393
FT                   /locus_tag="DET0425"
FT   CDS_pept        397734..398393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0425"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:DET0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40287"
FT                   /db_xref="GOA:Q3Z9D0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9D0"
FT                   /protein_id="AAW40287.1"
FT                   /translation="MNVSSRLLVVSGLYITCLITANLIAVKIIALGDIFLPAAVIVFPF
FT                   SYIFGDVLTEVYGFHWARRIIWLGFICNLIFVVFVALGQVLPGAPFWEGQGAYETILGY
FT                   TPRILLASFLGYLVGEFVNSFIMAKLKLRTQGRYLWVRTIGSTLAGQGLDTSIFILVAF
FT                   LGTPAFVPMMILYHWGSKVIIEAAATPLTYKLVNYLKKAEKSDYFDTSTNFSPFRL"
FT   gene            398414..399190
FT                   /locus_tag="DET0426"
FT   CDS_pept        398414..399190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0426"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40286"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C9"
FT                   /protein_id="AAW40286.1"
FT                   /translation="MEIVFLGAHNCETKTTRPSCLMLSGGVVLDAGAITSSLTLDELYE
FT                   LRAVILSHAHYDHIKDVPLLAMNLAYGLKSVDIYGSQAVQEVVTQPPFSGGFYPDFFTR
FT                   PPSAPALRFHEITPGLEFSCENYQILPLSVPHSRDTTGFLVKDAGGHSFFYTSDTGSGL
FT                   GDVWQQINPELLIIELTMPNRLTELALSSKHLSSELLEAELRLFRELKGYLPRIVTLHT
FT                   TPLFEAEIKTEIQAVAERLHTDILMASEGLKLRLGE"
FT   gene            399337..400875
FT                   /locus_tag="DET0427"
FT   CDS_pept        399337..400875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0427"
FT                   /product="carbohydrate kinase family protein"
FT                   /note="identified by match to protein family HMM TIGR00196;
FT                   match to protein family HMM TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:DET0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40285"
FT                   /db_xref="GOA:Q3Z9C8"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C8"
FT                   /protein_id="AAW40285.1"
FT                   /translation="MYIVSTTQMRQIEEACVKQGITTETLMDNAGRAVAVLARHLLEKQ
FT                   NGCRVVILAGAGNNGGDGLVAGRYLAAWDKKVSIFEPFAGASKNKTASGGLKTPENIFT
FT                   DLTGLKDHLREADLVIDALLGTGVNRPLEGVYRQALQMTADVKNTRPEMQILALDLSSG
FT                   LNADTGQADEACLKADFTLSLGIAKQGLFTHLGLELSGAVSVADIGIPLGLTADIHTRL
FT                   IEKDWAKGVLPVRSPHANKGSFGRVMIVAGSDPYIGAAMLAGSAAMRIGAGLVTLALPQ
FT                   SLTGAVAAKIPEATYLPLPEVSCGTADSFASRLILSELVKYDVLLIGPGLGQSPYAARL
FT                   VTEVLSNLPEELKVVIDADALNILAAIPRWWLEYSFDAILTPHPGEMARLAKTTAEAVQ
FT                   SDRFGICRESARKWGKTIILKGAGTIVSSPEGETLCNPAANPVLASAGTGDVLAGIISG
FT                   LLGQGLNLFEAAGLGVYLHSLAGATLRSEMGDAGVLASDLLLKLPAVIKELKQS"
FT   gene            400891..401667
FT                   /locus_tag="DET0428"
FT   CDS_pept        400891..401667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0428"
FT                   /product="transcriptional activator, putative"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:DET0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40284"
FT                   /db_xref="GOA:Q3Z9C7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9C7"
FT                   /protein_id="AAW40284.1"
FT                   /translation="MSEKLVAVDIGNTSVNIGIFEGEKLLANWHLGSVAQRMADEYASL
FT                   LLGLLQHAGIHPEELNRVIMCSVVPPLTTTFEEVFKSYFKAAPLVVGAGIKSGVKVRMD
FT                   NPREVGADRIVNAAAARVLYPGACIIVDMGTATTFDTLSEGGAYIGGAIAPGIATSAQA
FT                   IAEKTSKLPKIEIIRPAKVIGSNTVSAMQSGIYFGYIGLVEELVRRIQTELGQKTRVVA
FT                   TGGYAALIAEGSRIFDIVRPDLTLQGLRIIYQMNQA"
FT   gene            401769..402950
FT                   /gene="coaBC"
FT                   /locus_tag="DET0429"
FT   CDS_pept        401769..402950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="DET0429"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04127;
FT                   match to protein family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:DET0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40283"
FT                   /db_xref="GOA:Q3Z9C6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C6"
FT                   /protein_id="AAW40283.1"
FT                   /translation="MDKKKTVVLGITGSISAYKAADIASKLVAAGYTVKAVMTENACRF
FT                   ISPLTIRTLSRQQVVTGMWDMNSEYSVEHVSLAEEAAVILVAPATANIIAELACGLAGD
FT                   MISSTILASKAPVIIAPAMNDNMYSNPATQQNIAKLKERGFVFVEPESGRLASGKTGQG
FT                   RLASVDTILGSVTQVLGKNGPLAGKKLVISAGGTREPVDPVRYLGNRSSGKMGYALAEE
FT                   AVRRGASVRLVSGAVDKPAPFGVDIKYTETAMEMFISLREAVKGADALIMTAAVADYRP
FT                   EKPAADKIKKGDGELDLHLVANPDILASLQGDFVKVGFAAESRDLMINAVKKMADKNLD
FT                   IIAANDISQPDSTFGSDTTRLTLFFKNGRIEEMPLMSKQEAAVRLLDELSALL"
FT   gene            403040..405682
FT                   /gene="valS"
FT                   /locus_tag="DET0430"
FT   CDS_pept        403040..405682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="DET0430"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:DET0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40282"
FT                   /db_xref="GOA:Q3Z9C5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9C5"
FT                   /protein_id="AAW40282.1"
FT                   /translation="MAQCSGLPEMAKAYEAAEVEKKWYQYWMEKGYFKPNPDSDKKPFV
FT                   IIMPPPNVTGELHLGHALTATLEDIMIRWHRMLGEPALWLPGADHAGIAAQVVVERMLA
FT                   KQGKTRQELGRELFLEKMWEWVNPCRERIRHQHMRLGASCDWDRETFTLDPGPVKAVRE
FT                   IFTNLYQKGLIYRGERIINWCPRCATAVSDLEVDHKDLAGHIWHLRYPLEDGSGFVTVA
FT                   TTRPETMLGDTAVAVHPDDARYTGMVGKNVLLPIMNRRIPVIADEAVDMAFGTGAVKVT
FT                   PAHDPNDFEMGLRHSLPMITIQNRDTTMNENAGPCSGMTAKACREYVVSELKSLGLLLK
FT                   IEDYTHSVGHCQRCSAVIEPMVSKQWFVKMEPLAKPALEAVNSGRIQILPERFTKVYQN
FT                   WMENIRDWCISRQLWWGHRIPVWYCPCGEMIVSKEDPTACPKCGSTKLEQDPDVLDTWF
FT                   SSGLWPHSTLGWPDQTEDLKRFYPGSVLETAYDIIFFWVARMIVMGIEDMKEVPFRTVY
FT                   LHGLIRDDKGEKMSKTKGNVIDPLKVIDQYGTDALRFAVTFGTSPGNDSKLGQTKLEAA
FT                   RNFVNKLWNASRFVIMNLGEEKELLPEAGLPLEDRWILSRMNRVTADVIRLMEEFQFGE
FT                   AQRVLQDFVWGEFCDWYIELAKVRLRDEASVSPRPVLVKVLSTILRLLHPYMPFITEEL
FT                   WSYLRPYLPKSLGETDIIVAPFPQADETCFDEQAESIMGSLVEVVRSLRNLRAEHNVEI
FT                   SRYIQANIYAGDMAEVLSNYLGAVETLSRSRPVNILPGHYSGASTATEVVLVLNGIEVV
FT                   VPMSTMVDLEAEAKRVEAEIAELETQIERLSARLSDTQFLAKAPQAVVDKERTKLEGYI
FT                   EKVSRLKAV"
FT   gene            complement(405679..406752)
FT                   /locus_tag="DET0431"
FT   CDS_pept        complement(405679..406752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0431"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40281"
FT                   /db_xref="GOA:Q3Z9C4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C4"
FT                   /protein_id="AAW40281.1"
FT                   /translation="MTETRFKPPALCHRCLFENASDAIWFYDRNGHIVYANRASAELTG
FT                   YTRTELKQKNLKDLLTTASEYDQIMDINSRIASGEEVKMPYEQKIRRHDGSIAVLRMAT
FT                   TLVKSADEVLGFQNIARDITEEIRRQQNMKSFVQDVIRAQEAERKRISRELHDEVAPLL
FT                   LLLMQKIDNLSKQSERDIADCKPQLDALRSQSEEALESLRRIAQDLRPRILDDLGLIPA
FT                   LEWLTEKLAQDGQIHAESSIKGREVELTAEIQLLVFRIAQEAFNNIRKHSLATWVRLEL
FT                   EFKPKTILLTIQDNGKGFNLSEQTDNLAQNGKLGLAGMHERAQLIGGHIHILTHPGQGT
FT                   TVIAEVPTVSTDIKQAS"
FT   gene            complement(406733..407431)
FT                   /locus_tag="DET0432"
FT   CDS_pept        complement(406733..407431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0432"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by similarity to SP:P54662"
FT                   /db_xref="EnsemblGenomes-Gn:DET0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40271"
FT                   /db_xref="GOA:Q3Z9C3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C3"
FT                   /protein_id="AAW40271.1"
FT                   /translation="MAKTKVLIADDHAVLREGMSRLLSQEKDIEVVGEAGDGQEAVDMV
FT                   GQFKPDVVLMDIVMPRLTGVEATKLIKKNNPSTCILILTAYSDIRYILGLLEAGASGYL
FT                   LKSAKSDEIVGAIRAIKAGESVLDSIATRKLLERVVNVSKETDEDKVRGQLSPREIEIL
FT                   QLASKGLSNREIADKLELSMRTVKAHLSNIFNKMRCSCRTEAIVKGFREGYVMLEDVPQ
FT                   GIDGYDRNTL"
FT   gene            complement(407534..408217)
FT                   /locus_tag="DET0433"
FT   CDS_pept        complement(407534..408217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40270"
FT                   /db_xref="GOA:Q3Z9C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C2"
FT                   /protein_id="AAW40270.1"
FT                   /translation="MTEVLSGQTPELVIARLRAAIENGQAWYPAMLEAAAAWPLESEEY
FT                   AGRHYQYLIGSEALDLILLFERFSRELEDLIPAQERDNLLFRGIAPQELTSDELLAFLG
FT                   EVRYRQYLNYFYGITVEEALLVVTQSEVRKEHRSLGVRREGTVIDEAFVQLYERTHDEM
FT                   LDQFRREKRYSKTSTIKIHQLKEFTYWLFKYRLLHSEKARVASDTNKSLNYLKKYARRL
FT                   QQKSG"
FT   gene            complement(408241..411099)
FT                   /gene="secA"
FT                   /locus_tag="DET0434"
FT   CDS_pept        complement(408241..411099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="DET0434"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by similarity to SP:P10408; match to
FT                   protein family HMM PF07516; match to protein family HMM
FT                   PF07517; match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:DET0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40269"
FT                   /db_xref="GOA:Q3Z9C1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9C1"
FT                   /protein_id="AAW40269.1"
FT                   /translation="MFKFFSGFGDSNEKEIRALEPLVDKINQLESSFSALSDEALKAKT
FT                   AEFKERLKETFETTASAILKDIAGTTAELEEAQKTADNSKQSRLKAKLESLNKDLSVKE
FT                   NAALNAILPEAFAAVREASRRTIGLRHYDVQLIGGMVLHHGKIAEMRTGEGKTLVATLP
FT                   LYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMQTPTEELPSRLFDP
FT                   TYTSETPNDPWMHFRPISRQEAYKADITYGTSTEFGFDYLRDNLRPDLAQCVQREMNYA
FT                   IVDEIDNLLIDEARTPLIISAPDTEAGKLYEVFARLAPRLAAGKDYEINEKDRNAELTE
FT                   DGWANVEKLLSREGVMKGSSLYDPQNAPLIRHLRNALSAKEFYKKDHQYVVKENEVIII
FT                   DEFTGRMMLGRRYSEGLHQAIEAKEHVKIQQESKTYATVTIQNLFRMYRKLCGMTGTAA
FT                   TEAEEFSKIYKLEVVIIPTNKPAIREDYGDQIYKDQSAKFKAVVNEINEMRNLGRPVLV
FT                   GTVSIENSEMLSNMLKRQGIEHKVLNAKQHEKEAQVVAEAGKPGAVTVATNMAGRGVDI
FT                   LLGGKEPPKDDDKAYSQWQVHHQQVLEAGGLHVIGTERHESRRIDNQLRGRSGRQGDPG
FT                   SSRFYVALDDDIMRRFGSERIQGIMEWAGMDENTPIENGLVSRTLENAQKRVEGYHFDV
FT                   RKHLVEYDDVVNKHREVIYAERRKILLGADLKSNILDMIREEIMTQTAEHTQGYDSSEW
FT                   NLEGLVTHIGGIFALPAEINAEALAKLSQEEITELLTRTAEELYQKKEAEIGAGSMRLL
FT                   ERIIMLHTLDSLWVEHLTIMENLRREIGLQAFAQRDPLIAYKNEGHVRFQELLETIKHD
FT                   VVHNIYRVNIQIQHQTESATAKAASRPVQQQKPLPAAPAAAIPGVSAKAATQPAAPAAK
FT                   EVGRNDPCPCGSGKKYKKCCGK"
FT   gene            complement(411103..412077)
FT                   /gene="prs"
FT                   /locus_tag="DET0435"
FT   CDS_pept        complement(411103..412077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="DET0435"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by similarity to GB:CAA58682.1; match to
FT                   protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:DET0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40268"
FT                   /db_xref="GOA:Q3Z9C0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9C0"
FT                   /protein_id="AAW40268.1"
FT                   /translation="MLANGNLTDELKIFTGNANPDLAKAVADYLKVQMGKCEVFQFSNE
FT                   NIFVRIQESVRKKDVYVIQPTCSPVNQSIMELLIMMDALKRASSERITAVLPYYGYGRT
FT                   DKKDQPRVPITARLIADLLTAAGASRILTLDLHAPQIQGFFDMPVDELTAENLLANYFK
FT                   KKKLEDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDVEGKNA
FT                   LTFDDEIDTAGSLVGNVNILINKGVKEVYSCATHPVLSGPAIQRIAASPIKELVVTDSI
FT                   PLTPPKKIDKITVLSIAPLIGEAIYRIHTGNSIGEMYDQMQME"
FT   gene            complement(412092..413339)
FT                   /gene="glyA"
FT                   /locus_tag="DET0436"
FT   CDS_pept        complement(412092..413339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="DET0436"
FT                   /product="Serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by similarity to GP:22219039"
FT                   /db_xref="EnsemblGenomes-Gn:DET0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40267"
FT                   /db_xref="GOA:Q3Z9B9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B9"
FT                   /protein_id="AAW40267.1"
FT                   /translation="MSFLKTSDPAVYNAIMQETTRLKETIDLIASENYTSKAVLEAQGS
FT                   VFTNKYAEGYPGKRYYAGCEYADAIEELAIDRAKTLFHAEHANVQPHSGAQANMAAYFA
FT                   MVKPGDTIMGLTLSHGGHLTHGSKANFTGKLYHVIEYGLNAETERIDYDNLEKLALEHR
FT                   PRLIVTGASAYPRILDFERFRAICDKVDAKLMVDIAHIAGLVAAGLHPSPVPYADVVTS
FT                   TSHKTLRGPRGGFILCKEQYAKAIDQAVFPVIQGGPLMQVVAAKAVAFQEAMQPGFVTY
FT                   QKKILENTQVMAEELRKLGLRLVSGGTDNHLVLVDLSPIGVNGYDAQLALRRAGIVINR
FT                   NTVPFAENQTANVPAGIRLGCPAATSRGFGPAEIRQTVSWIGKILKNIGNEDIEKQVLA
FT                   EVIHLCRKFPVPGIDA"
FT   gene            413523..414092
FT                   /locus_tag="DET0437"
FT   CDS_pept        413523..414092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0437"
FT                   /product="uracil-DNA glycosylase, putative"
FT                   /note="identified by similarity to GP:21464612; match to
FT                   protein family HMM TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:DET0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40266"
FT                   /db_xref="GOA:Q3Z9B8"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9B8"
FT                   /protein_id="AAW40266.1"
FT                   /translation="MCTFNLHTTRTHAVPGEGNADAKIMFIGEAPGFNEDQQGRPFVGA
FT                   AGKFLTELIHSIGLRREDVYITNVVKDRPPGNRDPLPDEISACRNFLDRQIEIIKPKII
FT                   VTLGRYSMARYFTGSTISRIHGKPMRRDGVIYYPMYHPAAALHQGGLRKEIEQDMLRIP
FT                   GLLEELNRAEAPLVPKEPPARQLGLF"
FT   gene            414099..415754
FT                   /locus_tag="DET0438"
FT   CDS_pept        414099..415754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0438"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by similarity to GP:28203198; match to
FT                   protein family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:DET0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40265"
FT                   /db_xref="GOA:Q3Z9B7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9B7"
FT                   /protein_id="AAW40265.1"
FT                   /translation="MAKPKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEML
FT                   GIDLVIPDISYVLENREKVRGIVITHGHEDHIGALPYILPQINVPIYCTKLTQGLISVK
FT                   LKEAKLLHQTKINVIPSDGTFKLGKLKVDFYPVCHSLPDSVGLVIQTPIGAVVHSGDFK
FT                   LDYTPVDGKPTNLSRLAMLGSRGVLLLMSDSTHVELPGYTPSETVVGENIDRIIGAATG
FT                   RVLVTTFASLISRQQQVIDAAAKYGRKLFFAGRSMTEIHKMAADLGYLKVPEGLVCNID
FT                   QLQRVPPEKVVLMTTGSQGEPTSALVRIANRDFRHVHIMKGDTVIISASPIPGNESLVS
FT                   RTIDSLFRQGAKVFYDRIAKVHVHGHASQEELKLVLNLVKPKYFVPVHGEYRHLTMHAE
FT                   LARTMGVAPENTFIMEDGDILELNTKSGRITGKVPSGNVYVDGLSVGDVGGVVLRNRRM
FT                   LSQDGIVVAIVAINKQTGMLVGRPDIVSRGFVDPDESKAMLDASRDLIIKLLDHDGKDI
FT                   PEGAMYNDVKETLNKFYYEQTKRRPMVIPVMVKV"
FT   gene            415774..418218
FT                   /locus_tag="DET0439"
FT   CDS_pept        415774..418218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0439"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40264"
FT                   /db_xref="GOA:Q3Z9B6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9B6"
FT                   /protein_id="AAW40264.1"
FT                   /translation="MPKKEDPRDTLRNARPRAKSAVKVTARPFKKTAPVRSKAKKTAAK
FT                   KAFSNTPVRGGASWLWVMLIASAMAFVVWQWEGVMDFFANFGSGTAGLFGWGLLLILLG
FT                   IIIAIVALRFDQMSEWAHRYRLNLWNKWLGGVVLILAAWGMLGMMDAGGDIGLSILGGN
FT                   ADINGFMRVLALIVLGVILIAPGAVWRSLSGLFRGIFSPSRRSNMPEVARLDRTVVSRP
FT                   VFGGDEDRIDMGEEARRPLPEKAAPKIELPSIKLPSFGKAESRVVEVKNPLAAKSTPQT
FT                   ELPNMPPETAAKEPKSVDERTDADRKQIASEVWKKYGEAEGIAEVDGWKLPPIEMLDKT
FT                   TEIGFSEADNLQRARAIEEALASYGVEGKVIQINAGPTVTQFGVEPGWDRKFKEVKERD
FT                   KDGETVSRQVEVSKTRVKVDRIASLANDLALALAAPSLRIEAPVPGKSIVGIEVPNTSF
FT                   GVVSMRSVMETNTFQKILARSPLALALGKGAGGEAVSGDLTKMPHLLIAGATGSGKTVC
FT                   LNSIICCMLLNNTPSSVKFIMIDPKRVELTPFNGLPHLATPVIVDVEKALSALRWLAAE
FT                   MDRRYQTLAAAGSRNIEGYNKTRMGSDRMAFIVLIIDELADLMMAGFDEVEHILCRLAQ
FT                   MARAVGIHLVVATQRPSVDVITGLIKANFPTRISFAVTSQVDSRTILDMVGAEKLLGRG
FT                   DMLYMPTEAAKPKRLQGCYVSDAESERLIYFWTNQKDISPSEALKVEEITAPPPAPKSK
FT                   SKDPLFDEAMALISEHNNIISASFLQRKMHIGYPRAARLADELREAIEGDDGKAEVPKD
FT                   EY"
FT   gene            complement(418268..418408)
FT                   /locus_tag="DET0440"
FT   CDS_pept        complement(418268..418408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40255"
FT                   /db_xref="GOA:Q3Z9B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9B5"
FT                   /protein_id="AAW40255.1"
FT                   /translation="MKEPSKNPLTRQERREEKLESRRRKMTQHGKGLARVYKDAVEKKT
FT                   K"
FT   gene            complement(418392..420398)
FT                   /gene="uvrB"
FT                   /locus_tag="DET0441"
FT   CDS_pept        complement(418392..420398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="DET0441"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by similarity to SP:P37954; match to
FT                   protein family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:DET0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40254"
FT                   /db_xref="GOA:Q3Z9B4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B4"
FT                   /protein_id="AAW40254.1"
FT                   /translation="MPDFKIVSDFALTGDQPQAVEKLSEGLAHGLTDQTLLGVTGSGKT
FT                   FTMANVIARVNRPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYYDYYQPEAYVPQK
FT                   DMYIEKDADINEEIDKLRHAATRALFERRDVVIVASVSCIYGLGEPEEYRSFVLPLKKG
FT                   QSLRRDLILRRLVDMQYERNDIDFSRGKFRLRGDTLEIQPAYEELALRVEFFGDEIERI
FT                   VSLDPVSGELLADIDEINIYPAKHFVTSAEKMAEAIKGIQAELEDRLKELEAEGKMLEA
FT                   ARLKQRTNYDLEMMQQAGYCSGVENYSRHLAGRKAGSAPWTLLDYFPEDFLLIVDESHM
FT                   SLPQIRGMYAGDAARKKTLVDYGFRLPSAMDNRPLSFDEFKARVKQAIYVSATPGPYEK
FT                   EHSQQVVEQLVRPTGLLEPVITVKPTGGQIDDLLEEVKKRVDKKERVLITTLTKKMSEK
FT                   LADYLVEMGIKTHYLHSEVDTLERVEILRDLRLGVYDVIVGINLLREGLDLPEVSLVAI
FT                   LDADKEGYLRSEQALIQTMGRAARHVDGQVIMYADKITGSMQRAMDEISRRRKIQEDYN
FT                   RLHNITPQGIRKAIKDINERIRSVTAEVSGPEFRPAPTLREDIVRLIKELESQMKKAAK
FT                   NLEFERAALIRDRVVELRAALETDPVNKNERTK"
FT   gene            complement(420444..421028)
FT                   /gene="ruvA"
FT                   /locus_tag="DET0442"
FT   CDS_pept        complement(420444..421028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="DET0442"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="identified by match to protein family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:DET0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40253"
FT                   /db_xref="GOA:Q3Z9B3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B3"
FT                   /protein_id="AAW40253.1"
FT                   /translation="MISSLSGILEASGKDWAVINVSGVGFRTYMPASSPALIGELGQRV
FT                   RVFTHLHVREDALNLFGFGTAEELSLFETLIDVSGIGPKLGLAMLSAMNAEALASAIIS
FT                   GNTELLSTIPGVGKKTASRIVLELKDKITKSWEAGVLIQVTEANSDILATLTALGYSAG
FT                   EAAKAIASLEDITGMPLEERIKLALNYFNNK"
FT   gene            complement(421030..421527)
FT                   /gene="ruvC"
FT                   /locus_tag="DET0443"
FT   CDS_pept        complement(421030..421527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="DET0443"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="identified by similarity to SP:P24239; match to
FT                   protein family HMM TIGR00228"
FT                   /db_xref="EnsemblGenomes-Gn:DET0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40252"
FT                   /db_xref="GOA:Q3Z9B2"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B2"
FT                   /protein_id="AAW40252.1"
FT                   /translation="MRILGIDPGTMVVGYGVIEAADDELSLIGFSSLTPPASAPIPQRL
FT                   AYIYKGLVEVIELYQPDEVAVESPFADKNIKSALAIGKAQAVALLAAANHSLSVTEYSP
FT                   ACIKSRVSGSGTASKEQIQEMVRLLLNLAEIPQPNDAADALAVAICHHSHRAFANITSQ
FT                   GD"
FT   gene            complement(421531..422286)
FT                   /locus_tag="DET0444"
FT   CDS_pept        complement(421531..422286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0444"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by similarity to OMNI:CT1665; match to
FT                   protein family HMM PF01709; match to protein family HMM
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:DET0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40251"
FT                   /db_xref="GOA:Q3Z9B1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B1"
FT                   /protein_id="AAW40251.1"
FT                   /translation="MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEG
FT                   NARLRLAIQKAKDNRMPSDNIERAIKKGSGELEGATVIEIILEGYGPGGVAVLVNGMSD
FT                   NRNRTVSDVRHMFSKSGGSLAESGAVSWIFETKGVIGVETVGLDTDELSLKAIDMGAED
FT                   VNIEEDYMEIYTAMPDMEKVRQQLEAQGVTVDSAEINMIPKNTVKLDEETSLQVLKLLD
FT                   KLEELDDVQTVSSNADFDPEVVEKYHSQA"
FT   gene            complement(422402..422761)
FT                   /gene="acpS"
FT                   /locus_tag="DET0445"
FT   CDS_pept        complement(422402..422761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="DET0445"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:DET0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40250"
FT                   /db_xref="GOA:Q3Z9B0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9B0"
FT                   /protein_id="AAW40250.1"
FT                   /translation="MLYTGTDIIEIRRIKAAQARWGKRFLNRIFTPAELSLCKDRLPSL
FT                   AARFAAKEAVIKALSLPKNQSYSEIETLNLPDGQPSVNLYGQALAKAITLGIKQISVSL
FT                   SHCREYAIAMVVAQD"
FT   gene            complement(422803..423267)
FT                   /locus_tag="DET0446"
FT   CDS_pept        complement(422803..423267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0446"
FT                   /product="[Fe] hydrogenase, HymA subunit, putative"
FT                   /note="identified by similarity to GP:2865515"
FT                   /db_xref="EnsemblGenomes-Gn:DET0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40249"
FT                   /db_xref="GOA:Q3Z9A9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A9"
FT                   /protein_id="AAW40249.1"
FT                   /translation="MDKPVNQAYTPVLSLYEAKKENLIPILLAFQRKFSYLSRDMMQSV
FT                   SVYVGVPESSVYNIATFYSQFRLEPPGIHKVHVCRGTACHVMGAERLLRNIEKRLGIKA
FT                   GETTPDNEISLDTINCAGICGLAPTLEVDGKLYTRLDGSSLNRILGKKKK"
FT   gene            423507..425057
FT                   /locus_tag="DET0447"
FT   CDS_pept        423507..425057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0447"
FT                   /product="acyl CoA biotin-dependant carboxyltransferase"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:DET0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40239"
FT                   /db_xref="GOA:Q3Z9A8"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A8"
FT                   /protein_id="AAW40239.1"
FT                   /translation="MAVQEQLDNLNRLKKQAEMGGGEAKIDAQHKRGKLTARERIDLLF
FT                   DKGTFNELGAFAAHRCRDFGLEKQRNAGDAVVTGSGLVNGRLVFAYSQDFTVLGGSISE
FT                   VVGQKVAQVIDMAIRAGAPLIAINDSGGARIQEGVASLSGVGDILLRNTIASGVIPQIS
FT                   VVVGPSAGGAVYAPALTDFIFAVKGISQMYITGPDVIKAVTGEDISHEALGGAEIHAKK
FT                   SGVAHFLCENEKECFEQIRELMGFLPQSNRHKPPRGKNKDNEERKTRDLRDIIPDNPKR
FT                   AYDMKKVITEVADEKEFFEVHKHFAQNIIVGFVRMGGQPAGIVAQQPSHMAGVIDINAS
FT                   LKAARFIRFCDAFEIPLVSFVDVPGFMPGTDQEHSGIIKHGAKLIYAYAEATVPKITVI
FT                   TRKAYGGAYIVMSSKHLRGDINYAWPASEVAVMGAEGAVNIISRKAIAEAANPEETRQK
FT                   LLDEYREHFANPYQAAQLGYIDDVIDPADTRSKIIKALRSLENKVLANPPKKHGNIPL"
FT   gene            425080..426333
FT                   /locus_tag="DET0448"
FT   CDS_pept        425080..426333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0448"
FT                   /product="homoaconitate hydratase family protein"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR01343; match to protein
FT                   family HMM TIGR02086"
FT                   /db_xref="EnsemblGenomes-Gn:DET0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40238"
FT                   /db_xref="GOA:Q3Z9A7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A7"
FT                   /protein_id="AAW40238.1"
FT                   /translation="MGKTLAEKILSLKSGSDASAGDIVVSKVDLAFVQDTTGPLTVREF
FT                   WDNGFTKLANPSRTALFLDHAAPSPQRQLSTDHILLRKFARDTGALIFDVGEGVCHQLV
FT                   AEKLARPGDVIVGADSHTVTAGGLGAFSTGMGSSDIAVAFALGKTWFRVPETIKVVVSG
FT                   RFKHGIYAKDLILYLIGLIGADGATYKALEFSGNVVNNMTIAERLTIANMAVEAGAKVG
FT                   LFPSDRQTLEYLRSVGREADYQPLAADEDAVYERVIEIDATALEPMVAKPHTVDNTATA
FT                   RELKGTKLDQVFIGTCTGGRLDDLAVAAAIFKNRRHHPQTRLIVTPASQKVYLEAIRLG
FT                   YIEILVQAGANVMPPGCGACLGVHQGVLGDGEVCLSTANRNFKGRMGNPEGFIYLASAA
FT                   TAAASAIKGEISDPREVM"
FT   gene            426333..426836
FT                   /locus_tag="DET0449"
FT   CDS_pept        426333..426836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0449"
FT                   /product="aconitase C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR02087"
FT                   /db_xref="EnsemblGenomes-Gn:DET0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40237"
FT                   /db_xref="GOA:Q3Z9A6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A6"
FT                   /protein_id="AAW40237.1"
FT                   /translation="MLKGKAFKFGDSISTDHIAPGRLVHLRSNLPELAKHVLEDADPTF
FT                   AQRVKPGDFVVAGNNFGLGSSREHAPLIIKMSGVSAVLAKSVARIFFRNAINLGLPVLI
FT                   CDTDKIAEGDELEVDLTGGKIYDRTNGAELTFGKIPPAMLKILDEGGVMPYIKKYGDFK
FT                   LNEV"
FT   gene            426851..427930
FT                   /locus_tag="DET0450"
FT   CDS_pept        426851..427930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0450"
FT                   /product="isocitrate dehydrogenase, putative"
FT                   /note="identified by similarity to SP:P33197; match to
FT                   protein family HMM PF00180"
FT                   /db_xref="EnsemblGenomes-Gn:DET0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40236"
FT                   /db_xref="GOA:Q3Z9A5"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A5"
FT                   /protein_id="AAW40236.1"
FT                   /translation="MSHNVTLIPGDGIGPEISEATRRVLEATGVKFNWEIVNAGADVVA
FT                   EYGTPLPDMVLESIRKNKVAIKGPVTTPVGSGFRSVNVGMRKALNLYTCLRPCKTYPGV
FT                   PSRYDNVDIVIVRENMEDLYAGIEFEKGSPEALRLIEFIKENKKVEIRADSGISIKPIS
FT                   VFGTERIFRWAFKYARDNKRKRVTAVHKANIMKYSDGLFLAIGRKVAEEYPEIEFEDRI
FT                   VDNMTMQLVKNPSQFDILVCPNLYGDILSDLCAGLVGGLGVAPGANIGDEYALFEPTHG
FT                   SAPKYKGMNKVNPMAMMLSGVLMLRYLKEEKAADKLENAIAAVIAEGKSVTYDMLSPDK
FT                   QAAAVGTSQVADAIIAKMK"
FT   gene            428007..428930
FT                   /gene="mdh"
FT                   /locus_tag="DET0451"
FT   CDS_pept        428007..428930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="DET0451"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by similarity to SP:P80039; match to
FT                   protein family HMM PF02866; match to protein family HMM
FT                   TIGR01763"
FT                   /db_xref="EnsemblGenomes-Gn:DET0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40235"
FT                   /db_xref="GOA:Q3Z9A4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z9A4"
FT                   /protein_id="AAW40235.1"
FT                   /translation="MPKISVIGAGNVGATLAQRLIEKDFADVVMLDVVEGIPQGKALDI
FT                   SQSANVLGFSHTITGSNDYAETAGSEIVVITAGIARKPGMTREELLAINQKIMTDVVSN
FT                   CLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRLATFVARELGVKP
FT                   SAVTPCVMGEHGGSMVVMPRFTLVSGKPLSELVSAEKADELAKRAVNGGAEIVAFLKTG
FT                   SAFYAPSASIAAMAEAIFTGSGKVMNCAAVLDGEYGLKNIVLGVPVKLGKGGLQEIITL
FT                   PLDGTENARLLASAEVVKGQIAALSL"
FT   gene            428953..429324
FT                   /locus_tag="DET0452"
FT   CDS_pept        428953..429324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40234"
FT                   /db_xref="GOA:Q3Z9A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A3"
FT                   /protein_id="AAW40234.1"
FT                   /translation="MSNDKEFLDAFLKLKTELDDTVYKLEDVVINGNLEEKVAALKEAE
FT                   ETLLPSLERFDTLPEPEAESVKNARDSYKKAMQLYQQACGHYVKLLTEQNREEGKDGAY
FT                   KMKQAGDLFVKASEYLEGK"
FT   gene            429325..430167
FT                   /locus_tag="DET0453"
FT   CDS_pept        429325..430167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0453"
FT                   /product="fumarate hydratase, alpha subunit, putative"
FT                   /note="identified by similarity to SP:Q58690; match to
FT                   protein family HMM PF05681; match to protein family HMM
FT                   TIGR00722"
FT                   /db_xref="EnsemblGenomes-Gn:DET0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40233"
FT                   /db_xref="GOA:Q3Z9A2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A2"
FT                   /protein_id="AAW40233.1"
FT                   /translation="MREIDSSQISAALSELIVKTSTSLGDDILTALHKAYEAEVSPAGR
FT                   DILLSLLENACIAGEKKIPLCQDTGTAIVFAEAGQDVHINGNLVDAINLGVRQGYEQAY
FT                   LRKSIVSQPFSERVNTQDNTPAVIHTEIVPGDRLKLSFMAKGSGAENMSRLFMLKPGVG
FT                   HEGVIEAVLETVENAGGSPCPPIIIGLGVGATAEKAMFMAKKALLRPLGVSSPEAEVAA
FT                   LEAEVLKRVNGLGIGPLGLGGRVTALGVMAEAAPTHIASLPVAVNLQCHSARHGEVVL"
FT   gene            430164..430730
FT                   /locus_tag="DET0454"
FT   CDS_pept        430164..430730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0454"
FT                   /product="fumarate hydratase, beta subunit, putative"
FT                   /note="identified by similarity to SP:P14407; match to
FT                   protein family HMM PF05683; match to protein family HMM
FT                   TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:DET0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40232"
FT                   /db_xref="GOA:Q3Z9A1"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A1"
FT                   /protein_id="AAW40232.1"
FT                   /translation="MISGIKLNSPFNPAELEKLQAGDRVLISGVIYAARDAAHKRLVEA
FT                   LNQGKPLPFDLKGQTVYYMGPSPAKPGEVIGSAGPTTSSRMDRYTPELLDAGLLAIIGK
FT                   GNRSAEVSRAIVGKKAVYFISIGGAGALLSQRIKESRMVAYPELGAEAILALKVEDFPA
FT                   IVAIDSQGNNAFTLGQSIYRTAKEA"
FT   gene            430732..431073
FT                   /locus_tag="DET0455"
FT   CDS_pept        430732..431073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0455"
FT                   /product="HIT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40224"
FT                   /db_xref="GOA:Q3Z9A0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z9A0"
FT                   /protein_id="AAW40224.1"
FT                   /translation="MSCIFCQIVKGEIPAQIVYKDEDLVAFKDINPQSPVHILIIPRRH
FT                   ITNLTELDEADTELAGKMILLAGKLAREMDIAESGYRLVINSGREGGQVVNHLHLHLLG
FT                   GRQLGGQLG"
FT   gene            complement(431070..431600)
FT                   /locus_tag="DET0456"
FT   CDS_pept        complement(431070..431600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0456"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40223"
FT                   /db_xref="GOA:Q3Z999"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z999"
FT                   /protein_id="AAW40223.1"
FT                   /translation="MVEKILSSQYIYCGNLIKVRKAAVELPSGKVAPRELVEHNPCVVV
FT                   IAEDADGKLLMVKQYRLAASQDMLELVAGSMDAGETPEESASRELREEAGYKPHKLKRL
FT                   GGFYSSPGFLTEYLHVLVASDLEYAPLTAEDTEDIEVFRYTPAEVKAMIAGGQITDSKT
FT                   LAGLMLYFSRTSV"
FT   gene            complement(431619..432095)
FT                   /locus_tag="DET0457"
FT   CDS_pept        complement(431619..432095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0457"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:CT2212"
FT                   /db_xref="EnsemblGenomes-Gn:DET0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40222"
FT                   /db_xref="GOA:Q3Z998"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z998"
FT                   /protein_id="AAW40222.1"
FT                   /translation="MYTIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFYV
FT                   IRGDNGEVIACAALHISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKSLQIPTVF
FT                   CLTYKPAFFAKCGFHQVEKNALPHKIWGECYRCPKFPNCDETAMMLSLTEANIA"
FT   gene            complement(432079..432933)
FT                   /locus_tag="DET0458"
FT   CDS_pept        complement(432079..432933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0458"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase, putative"
FT                   /note="identified by similarity to GP:27262282"
FT                   /db_xref="EnsemblGenomes-Gn:DET0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40221"
FT                   /db_xref="GOA:Q3Z997"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z997"
FT                   /protein_id="AAW40221.1"
FT                   /translation="MYKKIGIIYHPLNPAACELAVRLAAKLDSLGIENWSDSAWQADKL
FT                   ASKIQNTQLIVTTGGDGTILRTAHAILPHEIPILSINLGKVGFMTELSPEDAILGLEKV
FT                   LAGNGWIDERNLLEAEYLPHNSAPARQFFIMNDAVVARGQIARVICVSVDINSHPFTTY
FT                   KADGAIVSTATGSTGYSYAAGGPVLQPNSADIILTPILPHLGRGYSLVLPADSTIDLKV
FT                   NTWHEATLSIDGFINMPVSSGDILRLRRSAKKINFIRLRPDNYFYKELDTKLKGNNESV
FT                   YDR"
FT   gene            complement(433005..433328)
FT                   /locus_tag="DET0459"
FT   CDS_pept        complement(433005..433328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40220"
FT                   /db_xref="GOA:Q3Z996"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z996"
FT                   /protein_id="AAW40220.1"
FT                   /translation="MKVGPIEILLIGGLIAIVWAVSKFGKLGKKSDTTEDDKPKPVRTA
FT                   PKAPPRSHVSYRLQYLGIIVLFIGLLLGAITFLLVKQLAYGIVWGAAIACVGLLLLFFS
FT                   RRR"
FT   gene            complement(433421..434284)
FT                   /locus_tag="DET0460"
FT   CDS_pept        complement(433421..434284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0460"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:DET0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40219"
FT                   /db_xref="GOA:Q3Z995"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z995"
FT                   /protein_id="AAW40219.1"
FT                   /translation="MKIGILGGSGKMGQWFSRFLTENGHQVWLWGRNPSKLAPVASRLG
FT                   SQVITQPDQLTEMDCLVISVPIDAFEDTLKEIAPFTKPEQMVFDLCSVKERPVELMHQY
FT                   LPHCRTLGTHPVFGPGAKSLKGYNFILTPTTGAETELAEKVKIWLEKHGSTVSLISPEE
FT                   HDRLMSVVLGLAHFIAIVSADTLLGQNLPGIAGAGGTTFRLLDTLTKSVLTEDPNLYAS
FT                   LQVNMPKLPGLEADFIKRATDWAELVKNGDKTGFAHRMQAIKDKLAQTEPGFEKAYQDM
FT                   YHLKQP"
FT   gene            complement(434281..435357)
FT                   /gene="tyrA"
FT                   /locus_tag="DET0461"
FT   CDS_pept        complement(434281..435357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="DET0461"
FT                   /product="chorismate mutase/prephenate dehydratase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:DET0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40218"
FT                   /db_xref="GOA:Q3Z994"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z994"
FT                   /protein_id="AAW40218.1"
FT                   /translation="MNLSDLRKQIDELDAELVKLMAKRLEVSDQIGKVKEETNSPVQDL
FT                   SRESEVLNRVQSLARSLGLDPQDIESLYQEILFISKKQQRFTVAFQGAAGAYSEETALK
FT                   IFGPNTLALPYEQLDGAFEAVEKGMARFAVVPVENSLEGSISRTYDLLFDSNLMVAAEH
FT                   ELRVSHCLIANPETTLEGVKTIYSHPQALGQCQSFLKHLRAELIPAYDTAGSVKMIKEK
FT                   HLLDGAAIASERAAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPSGNDKTSVVFAVK
FT                   HEAGALYDFIKELASRKINMTKLESRPTRLKPWEYNFYLDIEGHRQDENIKQALAKAED
FT                   HVIFMKVLGSYPKMKKRI"
FT   gene            complement(435354..436448)
FT                   /gene="aroC"
FT                   /locus_tag="DET0462"
FT   CDS_pept        complement(435354..436448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="DET0462"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by similarity to SP:P23353; match to
FT                   protein family HMM PF01264; match to protein family HMM
FT                   TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:DET0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40217"
FT                   /db_xref="GOA:Q3Z993"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z993"
FT                   /protein_id="AAW40217.1"
FT                   /translation="MSNSLGKLFQITSFGESHGDCVGVVIDGVPAGLAINVDEIQVEVD
FT                   KRKSRAKAHATPRCEDDRIEIFSGILNNFTTGAPICLVIWNKNIDSSEYERTRSKIRPG
FT                   HADFTGFVKYGGFNDFRGGGRFSGRITAGHVMAGAIARKLISTIGIEVIGYTAELGGIV
FT                   AKLPKTKDIRQNISQSDVNCPDLTATKKMLALIQQAAEEGDSLGGVVECLGLNLPVGLG
FT                   EPVFDTLEGELAKAMFAIPAVKGVEFGAGFEASRLRGSKNNDPFSIQANHIRTTSNKCG
FT                   GVLGGISDGMPLQFRVAVKPTPSISLSQPTVNIDTMTNTSLEIRGRHDTCIVPRAVSVV
FT                   EAMTCIVLADLALRAGMIPRVIKQ"
FT   gene            complement(436441..437703)
FT                   /gene="aroA"
FT                   /locus_tag="DET0463"
FT   CDS_pept        complement(436441..437703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="DET0463"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:DET0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40208"
FT                   /db_xref="GOA:Q3Z992"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z992"
FT                   /protein_id="AAW40208.1"
FT                   /translation="MKIRLDKSLPGGEIAVPSSKSYTIRGLIAAAQANGQSRIISPLAA
FT                   DDTLASRQVLSGLGIDINTDAEAESWQLTGNTFKKPAGNLFCRESAATLRFMSAVCARL
FT                   PFECRLLAGHSLMRRPMLPLIQALHQLGIEIETRGNTTVIKGGEITRSKVSLPGNISSQ
FT                   YVSALMLMAPACKSGLEIHLATPPASLPYLKMTKQTLESFGIKAYTSIDWQEISIPPQP
FT                   YLPARYRVEGDWSSASSFLALGAIAAPLFISNLDTESFQADRIMIKFLSEMGAEVESGQ
FT                   NWVKVSPKPLTAIQADLTHSIDLLPALAITAACAKGQSILSGVRQARIKESNRIRAVSQ
FT                   GLSAMGINVTEEDDRLIIEGGMPRGAEIDSLGDHRIAMAFGALGAVTGETCISEAECVS
FT                   KTYPDFWQKLESLGGKVIKDV"
FT   gene            complement(437684..438214)
FT                   /gene="aroK"
FT                   /locus_tag="DET0464"
FT   CDS_pept        complement(437684..438214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="DET0464"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by similarity to SP:P24167"
FT                   /db_xref="EnsemblGenomes-Gn:DET0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40207"
FT                   /db_xref="GOA:Q3Z991"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z991"
FT                   /protein_id="AAW40207.1"
FT                   /translation="MKIKNNIALIGFMGAGKSSVSKLLSERLGKTLVSTDACIETREGL
FT                   SIISIFKEKGEDYFRQMESRVLEDLCRQSGQIIDCGGGIVMRPPNLSLMRLNCLVIYLE
FT                   SRPEDLEARLKNHTNRPLYNAERLDKMLKLLESRLPLYRAAANITISTHNKSCHEVCEE
FT                   IEDKLREYENTSG"
FT   gene            complement(438198..439058)
FT                   /gene="aroE"
FT                   /locus_tag="DET0465"
FT   CDS_pept        complement(438198..439058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="DET0465"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by similarity to SP:Q58484; match to
FT                   protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:DET0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40206"
FT                   /db_xref="GOA:Q3Z990"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z990"
FT                   /protein_id="AAW40206.1"
FT                   /translation="MKTIPDALFGLIGFPVSHSVSPAMQNAAFKHCKLDYLYLTIAAKP
FT                   EELQNVIASMGPLNIRGLNVTIPHKIEVIKYIDSLDPAAEKIGAVNTIVNENGRLKGYN
FT                   TDFGGFVRLLEHNRIAPAKQRFTLLGAGGSAHAIALAVCNLGGHLTVLARQEEKAKDLA
FT                   GKMCLRLSGKTQGLELNDTNLEEALADTDVIVNCTPVGMGNLAGQSLVPPRLLRPDLTV
FT                   IDAIYNPCKTRLLEDAEKRGARIINGLEMLVWQGAMSFEIWTNQKAPFRLMMKEAELAL
FT                   DENKK"
FT   gene            complement(439042..439710)
FT                   /gene="aroD"
FT                   /locus_tag="DET0466"
FT   CDS_pept        complement(439042..439710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="DET0466"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by similarity to SP:P05194; match to
FT                   protein family HMM PF01487; match to protein family HMM
FT                   TIGR01093"
FT                   /db_xref="EnsemblGenomes-Gn:DET0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40205"
FT                   /db_xref="GOA:Q3Z989"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z989"
FT                   /protein_id="AAW40205.1"
FT                   /translation="MKNPPVCCVITRLPEAESLKKSEGAAFYELRLDLLGESWREAAAM
FT                   LDKPFMATCRRSAEGGSFSGSEEERIGLLEKAAAAGAFMLDIEYSTPHLGEVLKRLRTQ
FT                   SKCLVSHHNFADTPSAGDLKTLVKDMLNYPADIYKVITTATSINDNIKLLNLIKEIPDK
FT                   KIVAFAMGNLGILSRILCPLAGSPFTYASLNDSNQSASGQMTLAQMIEIYRSVNYENHT
FT                   "
FT   gene            complement(439707..440786)
FT                   /gene="aroB"
FT                   /locus_tag="DET0467"
FT   CDS_pept        complement(439707..440786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="DET0467"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by similarity to SP:P07639; match to
FT                   protein family HMM PF01761; match to protein family HMM
FT                   TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:DET0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40204"
FT                   /db_xref="GOA:Q3Z988"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z988"
FT                   /protein_id="AAW40204.1"
FT                   /translation="MKSIGLNLSGREYKILIGSDLLAETADLLKQAIPCDRVVVITNID
FT                   INRLYGKKLKKHLESKGIGSLFLELPEGEIHKSLDMASHIYPQLINHFAERNTPILALG
FT                   GGVIGDLSGFVAATYQRGVPLVHLPTSLLSQVDSSIGGKVAVNHGGIKNIVGSFYQPRL
FT                   VISDISCLKTLPEKEFACGMAEIIKSAAIGSSELFKQLETNTPAIKDRSPEIMEDIISQ
FT                   TAAIKAGIVCQDETDRGIRNILNFGHTLGHALESTSSFSQSHGAAVAIGMCFASRLSVK
FT                   LGLCENETVLRLEKLIADFGLPTRPQDIDPEKIIDAMHHDKKVSDGRIRFILLKRPGEP
FT                   LIAENILRADVISILEEMK"
FT   gene            complement(440806..441861)
FT                   /locus_tag="DET0468"
FT   CDS_pept        complement(440806..441861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0468"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by similarity to SP:P39912; match to
FT                   protein family HMM TIGR01361"
FT                   /db_xref="EnsemblGenomes-Gn:DET0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40203"
FT                   /db_xref="GOA:Q3Z987"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z987"
FT                   /protein_id="AAW40203.1"
FT                   /translation="MIIMKKDATPEELENVIAEVRRCGLKTDISKGEFRTIIGLIGDEK
FT                   SIPFAYFSSLPGVKEARMVETPYKLISREYSNLWQAEGLTREIKVKDITIGGDEPVFIA
FT                   GPCAVESKEALMKIAEGAKMAGAQILRGGVYKPRSSVHSFQGLGSAGKDEATEALSWLK
FT                   EAGERFEMAVMTEIRGESQADLVAEYVDILQVGSRNMYDQDLLATVARKGKPVMYKRHF
FT                   GASMEEFLSFAEYIAAEGNKDIILCERGIVPVGKGKNFTRYNLDLAAVPVALKETYLPI
FT                   MVDPSHATGRRDLIYSMSCAAMAAGANGLMIEVHTNPAEALVDASQMITPPELKELINT
FT                   CRQINKLVKKH"
FT   gene            442098..442214
FT                   /locus_tag="DET0469"
FT   CDS_pept        442098..442214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40202"
FT                   /db_xref="GOA:Q3Z986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z986"
FT                   /protein_id="AAW40202.1"
FT                   /translation="MGSFFLVVVIGRAADKCPEADGGYPPALNQRVFSDGWS"
FT   gene            442383..442817
FT                   /gene="rpsL"
FT                   /locus_tag="DET0470"
FT   CDS_pept        442383..442817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="DET0470"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:DET0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40201"
FT                   /db_xref="GOA:Q3Z985"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z985"
FT                   /protein_id="AAW40201.1"
FT                   /translation="MPTVNQLVRKGRSSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKR
FT                   GVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDL
FT                   PGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK"
FT   gene            442831..443301
FT                   /gene="rpsG"
FT                   /locus_tag="DET0471"
FT   CDS_pept        442831..443301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="DET0471"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by similarity to SP:P13577; match to
FT                   protein family HMM PF00177; match to protein family HMM
FT                   TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:DET0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40194"
FT                   /db_xref="GOA:Q3Z984"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z984"
FT                   /protein_id="AAW40194.1"
FT                   /translation="MPRRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVYD
FT                   AIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMRWI
FT                   IKAARKRTGKSMAERLAAEMLEASREQGAAVKKREETHKMAEANRAFVHYRW"
FT   gene            443357..445438
FT                   /gene="fusA-1"
FT                   /locus_tag="DET0472"
FT   CDS_pept        443357..445438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA-1"
FT                   /locus_tag="DET0472"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:DET0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40193"
FT                   /db_xref="GOA:Q3Z983"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z983"
FT                   /protein_id="AAW40193.1"
FT                   /translation="MSDRKYPLERVRNIGIIAHIDAGKTTTTERILYLTKRTHKIGNID
FT                   DGTTVMDWMEQEKARGITITSVATSAYWNGHHLNVIDTPGHVDFTVEVERSLRVLDGGV
FT                   VVFDGVAGVEAQSETVWRQASRYGVPRICFINKMDRTGANYERTLGMITQRLKAKCLPL
FT                   QIPIGCAETFRGSCDLLDFQCYGMDNSPEEPAETFDLPDADKERAVKFRNTMIERLAEE
FT                   DDEVMEAYLAGEELPVEKLKAAIRRVCLANKAIPIFCGTSLRNKGVKRLLDAVCDYLPS
FT                   PVDIPAIKGTAPKTGEPMERHASDTEPFSALAFKIVSDPFVGRLVYFRIYSGNVSAGSG
FT                   VYNSTRGERERIGRLIRMHANDREEIEYADAGEIVASLGLRNTFTGDTLCDQSAPILLE
FT                   SIKFPEPVINLAIEPKTRSDQDKMTEGLQKLAEEDPTFKVKFDDETGQTVIYGMGELHL
FT                   DVLVSRLLSEFKVNASVGKPRVAYREAITAHAKAQGKFVRQSGGRGQYGDVTIEVEPRE
FT                   RGAGYEFVDNVKGGAVPRNFLMAAEAGIRETLETGVYAGYPMVDVKVTAVDGSYHDVDS
FT                   NENAFKMAGSMAIKAAVAKAKPILLEPIMKLEAVTPEEYMGDVIGDFNSRRGQIISVEP
FT                   NPETTVITGNVPLAESFGYTTDLRSVTKGRATFSMEFESYREMPGELANQVVEAAGKK"
FT   gene            445463..445771
FT                   /gene="rpsJ"
FT                   /locus_tag="DET0473"
FT   CDS_pept        445463..445771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="DET0473"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:DET0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40192"
FT                   /db_xref="GOA:Q3Z982"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z982"
FT                   /protein_id="AAW40192.1"
FT                   /translation="MTKQKIRIKLKGFDHKILDQSALQIVEALERTGATISGPVPLPTR
FT                   IQRYSVIRSSFIDKDSQEQFEIRTHKRLIDIVETTSKTIDALTNLNLPAGVSIDIKL"
FT   gene            445780..446397
FT                   /gene="rplC"
FT                   /locus_tag="DET0474"
FT   CDS_pept        445780..446397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="DET0474"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by similarity to SP:P02386"
FT                   /db_xref="EnsemblGenomes-Gn:DET0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40191"
FT                   /db_xref="GOA:Q3Z981"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z981"
FT                   /protein_id="AAW40191.1"
FT                   /translation="MIQGIIGKKIGMTQIFQEDGKAQPVTLVEAGPCVVVQVKTEKQDG
FT                   YEAVQLGYGKAKHITSAVKGQCRGFGEFKVLREVDVDDIAAVNVGDQITVSDFKDGEKI
FT                   DASGVSRGRGFAGVVKRWHFAGGPKTHGQSDRHRAPGSISSTTTPGRIYKGKRMAGHMG
FT                   NDAVTIRNLVVLKTDAEKNLLMVKGAIPGGKNTIILIKKTGK"
FT   gene            446400..447032
FT                   /gene="rplD"
FT                   /locus_tag="DET0475"
FT   CDS_pept        446400..447032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="DET0475"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by similarity to SP:P28601; match to
FT                   protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:DET0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40190"
FT                   /db_xref="GOA:Q3Z980"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z980"
FT                   /protein_id="AAW40190.1"
FT                   /translation="MEIPVYNASGEIIKNISISEDVFGVPFNEALVHQAFVAQQANARQ
FT                   GTQSTKTRGEVQGSSRKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKM
FT                   RRQAIRCVLSFKLESGELKVVDQLSFDEPKTRDMAKILAALQVMSPTLIAVDNPDTNFI
FT                   KSARNIPAVKTTPANLLNISDMLRNKQLVMTEEAVRQVEELWGQRSR"
FT   gene            447045..447329
FT                   /gene="rplW"
FT                   /locus_tag="DET0476"
FT   CDS_pept        447045..447329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="DET0476"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:DET0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40189"
FT                   /db_xref="GOA:Q3Z979"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z979"
FT                   /protein_id="AAW40189.1"
FT                   /translation="MNLYEVLRRPLISEKNSVQAVQNKYVFEIAKGANKRMVKLAVEQA
FT                   FNVTVEDVNMLHIPGKQKRMGRNLVQTAGLRKAIITLKEGDKITLFEGV"
FT   gene            447355..448179
FT                   /gene="rplB"
FT                   /locus_tag="DET0477"
FT   CDS_pept        447355..448179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="DET0477"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:DET0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40188"
FT                   /db_xref="GOA:Q3Z978"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z978"
FT                   /protein_id="AAW40188.1"
FT                   /translation="MAIKIYRPTSPGRRHHSVSSFEEITKSRPEKALLVSVKNDSGRNN
FT                   QGRVTVRHRGGGSKTQIRVIDFKRNKLDVPGRIAAIEYDPNRTARIALVFYTDGEKRYI
FT                   LAPSDLKIGDVIMAGENAEPKSGNALPLSAIPTGTFIHNIELIKGRGGIMVRSAGAAAQ
FT                   LMAKEGDYALVRLPSGEMRKVRSDCSATVGQIGNIEHGTLEIGKAGRNRHLGWRPTVRG
FT                   SAMSPNNHPHGGGECRSPIGMTGPKTPWGKPALGYRTRKAKYSDKLIVKRRG"
FT   gene            448186..448467
FT                   /gene="rpsS"
FT                   /locus_tag="DET0478"
FT   CDS_pept        448186..448467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="DET0478"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to SP:P12731; match to
FT                   protein family HMM PF00203; match to protein family HMM
FT                   TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:DET0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40187"
FT                   /db_xref="GOA:Q3Z977"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z977"
FT                   /protein_id="AAW40187.1"
FT                   /translation="MSRSVKKGPALCPKLMKKVEVASATNQKSIIKTWARWSTITPLMV
FT                   GLNVGVHDGRRHVPIYITENMVGHRLGEFTTTRNFRGHAKAEKVSQVK"
FT   gene            448498..448827
FT                   /gene="rplV"
FT                   /locus_tag="DET0479"
FT   CDS_pept        448498..448827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="DET0479"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:DET0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40186"
FT                   /db_xref="GOA:Q3Z976"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z976"
FT                   /protein_id="AAW40186.1"
FT                   /translation="MEVKAIVKDTGYSALKVRLCVDMVRGKKVSEAITMLRFMTSPTAK
FT                   VVSKVIKSAAANAENNFQMNPADLKISQIYADEARMLKRMRPQARGRVSPILKRSSHIT
FT                   VVVAD"
FT   gene            448836..449672
FT                   /gene="rpsC"
FT                   /locus_tag="DET0480"
FT   CDS_pept        448836..449672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="DET0480"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:DET0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40177"
FT                   /db_xref="GOA:Q3Z975"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z975"
FT                   /protein_id="AAW40177.1"
FT                   /translation="MGRKVHPIGFRLGIIKDWSAKWHASDKGFAECLTEDLKLRKAIAK
FT                   KYVDAAISQVDIERQSNKVTVSVRTARPGIVIGRGGQRVDEMRHFLEELIGKKVQLNIV
FT                   EISQAELDAFLVARSVAEQIERRVAYRRAMKQAIFRSMQAGAKGIKVCASGRLGGVEIA
FT                   RREVMHEGRVPLHTLRADIDYGCTRAHTALGDIGIKVWVYRGDILPEAKEQSEPEVTEM
FT                   AAVMADAPAAAVAEAKVADTVAKPKRVTKKAEAEASAEEKPKRAAKKAENITKEEE"
FT   gene            449674..450123
FT                   /gene="rplP"
FT                   /locus_tag="DET0481"
FT   CDS_pept        449674..450123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="DET0481"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:DET0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40176"
FT                   /db_xref="GOA:Q3Z974"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z974"
FT                   /protein_id="AAW40176.1"
FT                   /translation="MLQPKRVKFRKVQRGRRDGAAHKGNTVAFGEFALQSLEAGWITAR
FT                   QIEATRRAITRYIRRGGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRIMF
FT                   EIGGVTPEAAKEAMRLASYKMPVKTRFVARDVPAAAEETEVAEAE"
FT   gene            450125..450322
FT                   /gene="rpmC"
FT                   /locus_tag="DET0482"
FT   CDS_pept        450125..450322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="DET0482"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:DET0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40175"
FT                   /db_xref="GOA:Q3Z973"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z973"
FT                   /protein_id="AAW40175.1"
FT                   /translation="MNINDIRGLSDTEIKKKLEDAHKELFELRLKLSTRQLVNHRELPR
FT                   VKNDIARILTVMRERELQIR"
FT   gene            450330..450590
FT                   /gene="rpsQ"
FT                   /locus_tag="DET0483"
FT   CDS_pept        450330..450590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="DET0483"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:DET0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40174"
FT                   /db_xref="GOA:Q3Z972"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z972"
FT                   /protein_id="AAW40174.1"
FT                   /translation="MEKNKTRIGHVISDRMEKTIVVGIDVAKRHPLYKKTYRRTMKYLV
FT                   HDEKNEAKIGDMIEIVKCRPISKGKYWRLNRIITKGHIVAA"
FT   gene            450615..450983
FT                   /gene="rplN"
FT                   /locus_tag="DET0484"
FT   CDS_pept        450615..450983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="DET0484"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:DET0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40173"
FT                   /db_xref="GOA:Q3Z971"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z971"
FT                   /protein_id="AAW40173.1"
FT                   /translation="MVQQYTRLNVADNTGAKKIMCINVLGGSRKLQAKVGDVIVAAVKK
FT                   SSPDAQAKSGTVVKAVVVRITKPYARPDGSYIKFDDNAAVILNDKMEPKGTRIFGPVAR
FT                   ELRDKKFTKILSLAPEVL"
FT   gene            450994..451305
FT                   /gene="rplX"
FT                   /locus_tag="DET0485"
FT   CDS_pept        450994..451305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="DET0485"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:DET0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40280"
FT                   /db_xref="GOA:Q3Z970"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z970"
FT                   /protein_id="AAW40280.1"
FT                   /translation="MRLKKNDNVLVIAGKDKGKTGKVRYAFPRTDRVLVEGVNMIKRHS
FT                   RARGQAKQAGIIEREAPLHVSNLMLLCSKCNKPARIGSRELADGKSVRYCKSCNEVID"
FT   gene            451305..451844
FT                   /gene="rplE"
FT                   /locus_tag="DET0486"
FT   CDS_pept        451305..451844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="DET0486"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P08895; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:DET0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40279"
FT                   /db_xref="GOA:Q3Z969"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z969"
FT                   /protein_id="AAW40279.1"
FT                   /translation="MLKVEERYTNAVPELQKAFKYENIMQVPKLVKVVINTGVGEAVSN
FT                   SKALETAEADIVAIAGQHPVITRAKRSVANFKLRAGMPIGLKVTLRGQRMYDFLNKLFF
FT                   ITLPRVRDFQGVSNTAFDEHGNYTLGFKDHSVFPEIDFNKIEKPRGLEVCIVTTANTPE
FT                   EGKKLLELLGMPFSKD"
FT   gene            451853..452038
FT                   /gene="rpsN"
FT                   /locus_tag="DET0487"
FT   CDS_pept        451853..452038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="DET0487"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to SP:P12878"
FT                   /db_xref="EnsemblGenomes-Gn:DET0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40615"
FT                   /db_xref="GOA:Q3Z968"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z968"
FT                   /protein_id="AAW40615.1"
FT                   /translation="MAKTSKIVQSQRASKFKVQHHNRCSRCGRPRGYINRFGLCRICFR
FT                   ELALQGQIPGVRKSSW"
FT   gene            452072..452467
FT                   /gene="rpsH"
FT                   /locus_tag="DET0488"
FT   CDS_pept        452072..452467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="DET0488"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:DET0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40278"
FT                   /db_xref="GOA:Q3Z967"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z967"
FT                   /protein_id="AAW40278.1"
FT                   /translation="MISDPIADMLTRIRNGVMAKHEVVIMPASRMKQYLAKVMKQEGFI
FT                   AGYEVIGAKPKRQLKIVLRYDEGGASFVSGLERISKPGLRVYVQRGEIPRVYGGLGIAI
FT                   VSTSKGVMTGSQAWRQGLGGELLCKVW"
FT   gene            452483..453031
FT                   /gene="rplF"
FT                   /locus_tag="DET0489"
FT   CDS_pept        452483..453031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="DET0489"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:DET0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40277"
FT                   /db_xref="GOA:Q3Z966"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z966"
FT                   /protein_id="AAW40277.1"
FT                   /translation="MSRIGKMPIKVPPGVTVDIKGNDVTVKGPKGTLNRTFRPEVTITR
FT                   DGDYLVVAPVGTDKAARSFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGNNII
FT                   FKVGYSHTVTVAPPAGITLSVDGTTKVKVSGINKEEVSQMAAEIRSIRKPDHYMGKGIR
FT                   YAGEYVRIKPGKAIGKGAK"
FT   gene            453031..453396
FT                   /gene="rplR"
FT                   /locus_tag="DET0490"
FT   CDS_pept        453031..453396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="DET0490"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:DET0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40276"
FT                   /db_xref="GOA:Q3Z965"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z965"
FT                   /protein_id="AAW40276.1"
FT                   /translation="MAKVNAREARIVRHERLRKKVSGTEARPRLCVFRSIENIYTQVIN
FT                   DNCGSTLVQASTKDAELKAELDGKTKTEQAVVIGNLIAKRSLEAGISEVVFDRGGYKYH
FT                   GRVKALAEAARSGGLKF"
FT   gene            453413..453931
FT                   /gene="rpsE"
FT                   /locus_tag="DET0491"
FT   CDS_pept        453413..453931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="DET0491"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P21467; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:DET0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40275"
FT                   /db_xref="GOA:Q3Z964"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z964"
FT                   /protein_id="AAW40275.1"
FT                   /translation="MLAKVERIDPSELELNDKLIFINRVTKVVKGGKRMGFAALVVTGD
FT                   GKNHVGIGVGKAKEVPSAISKASANAKRNLSRILLNGTTVPHEIVFKYGAAQVLLKPAA
FT                   PGTGIIAGGSVRAVLESTGIKDILTKSMGCSNKANVAKATLGGLTAMRDPKTTVTKRRS
FT                   SLKEEAAGG"
FT   gene            453924..454106
FT                   /gene="rpmD"
FT                   /locus_tag="DET0492"
FT   CDS_pept        453924..454106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="DET0492"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:DET0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40274"
FT                   /db_xref="GOA:Q3Z963"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z963"
FT                   /protein_id="AAW40274.1"
FT                   /translation="MAKIKITWVKSAIGYKFDQAATIKALGFKKLNQSVIQDDSAAIRG
FT                   MILKVRHLVVLEEVT"
FT   gene            454107..454568
FT                   /gene="rplO"
FT                   /locus_tag="DET0493"
FT   CDS_pept        454107..454568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="DET0493"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:DET0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40273"
FT                   /db_xref="GOA:Q3Z962"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z962"
FT                   /protein_id="AAW40273.1"
FT                   /translation="MRLNELSPAPGSKKDRKRVGRGDAGRGNYSGRGMKGQKARSGGAT
FT                   RPGFEGGQLPIYLRLPRKRGFFNPFRIEYTVVNIEQLNIFEAGTEVTPETMLAAGLIRN
FT                   FVKPVKILAAGHIDRALEVSAHKFSQAAKAQIEAAGGKVQEIDYAAEIE"
FT   gene            454549..455865
FT                   /gene="secY"
FT                   /locus_tag="DET0494"
FT   CDS_pept        454549..455865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="DET0494"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:Q59916; match to
FT                   protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:DET0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40272"
FT                   /db_xref="GOA:Q3Z961"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z961"
FT                   /protein_id="AAW40272.1"
FT                   /translation="MRQKSSRPRLLQAMIDAFSLPDLRRRLLITLGILVAARFIAHVPL
FT                   PGVDSAALQDLFDQNGALGMLDLFSGGAMRYFSVAALGVYPYITASIIMTLLTPVIPKL
FT                   TALSKEGEAGRNKINTITHWLAVPTAALAGYSQLLLLQREGAVAQTEPLAAVAIVLSIV
FT                   AGTMFMVWLGEQITNYGIGNGISLIIFAGIVAGLPDTIGRGLMASDQFAGLAVYAIMAL
FT                   LTTVLIVIFTEAHRRIPVQYAQTVIRSGKMYRRGGESHIPLRVNSAGMIPLIFASALVM
FT                   LPGLVASYFMAGSTEDPNFWNTIYNIFSSSASMPGGLVYWGLYFFMTIIFAFFYTMVTF
FT                   EQQDIPGTLQRQGGFVPGIRPGKMTDQYLSGVIGRITWAGALFLGFVAIMPFIAREVTG
FT                   IQVIQLSSFGMLIVVGVALDTMKQLEAQLVMRRYEGFIK"
FT   gene            455875..456525
FT                   /gene="adk"
FT                   /locus_tag="DET0495"
FT   CDS_pept        455875..456525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="DET0495"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to SP:P27142; match to
FT                   protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:DET0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40263"
FT                   /db_xref="GOA:Q3Z960"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z960"
FT                   /protein_id="AAW40263.1"
FT                   /translation="MYNVIFLGAPGSGKGTQGEVVAKELRLAHMATGDLFRKAIERGDE
FT                   LGDTVKSYMERGELVPDEITISVVLKHLAGLKDVSGIILDGFPRSLRQAEALDEALVKQ
FT                   GEGIGRVIYINVPEDELVRRLSGRWVCRSCQSPYQCGCAEVAEGKCSRCQGELYQRPDD
FT                   TPETVKERLKVYFSKTAPLIEYYRSKGKLSEIDGMAEITEVTKRIVSAIKCGK"
FT   gene            456533..457288
FT                   /gene="map"
FT                   /locus_tag="DET0496"
FT   CDS_pept        456533..457288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="DET0496"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by similarity to SP:P19994; match to
FT                   protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:DET0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40262"
FT                   /db_xref="GOA:Q3Z959"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z959"
FT                   /protein_id="AAW40262.1"
FT                   /translation="MTIILKTEKEIAIMRRAGHILAAALEEVKKNVRPGVTTRELDEIA
FT                   ERELRRRGTTPSFKGYQGFPASLCASVNEEIVHGIPGGRVLKEGDIISLDIGNILEGFQ
FT                   ADMAVTVGVGEISPAATRLLSATQASLVAGIAQARAGGHLGDIGAVVEEYAQSRGYGVV
FT                   RDYTGHGIGRDMHEDPQIPNFGRRGKGPELKKGMTLAIEPMLNLGTEKTRVAPDCWTVY
FT                   TADGSLSAHFEHTVAITDGEPEILTVIEG"
FT   gene            457298..457519
FT                   /gene="infA"
FT                   /locus_tag="DET0497"
FT   CDS_pept        457298..457519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="DET0497"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:DET0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40261"
FT                   /db_xref="GOA:Q3Z958"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z958"
FT                   /protein_id="AAW40261.1"
FT                   /translation="MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYI
FT                   RILPGDRVLVELSPYDLTRGRVTYRFKS"
FT   gene            457548..457661
FT                   /gene="rpmJ"
FT                   /locus_tag="DET0498"
FT   CDS_pept        457548..457661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="DET0498"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:DET0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40260"
FT                   /db_xref="GOA:Q3Z957"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z957"
FT                   /protein_id="AAW40260.1"
FT                   /translation="MKVRASVKTMCEKCKIVKRNGVVRNICTNPKHKQRQG"
FT   gene            457671..458060
FT                   /gene="rpsM"
FT                   /locus_tag="DET0499"
FT   CDS_pept        457671..458060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="DET0499"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P80377"
FT                   /db_xref="EnsemblGenomes-Gn:DET0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40259"
FT                   /db_xref="GOA:Q3Z956"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z956"
FT                   /protein_id="AAW40259.1"
FT                   /translation="MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKAIRV
FT                   NKLTDEEINRLREIIDKEYRVEGDLRKEIALNIKRLIDIGCYRGNRHKHNLPVRGQRTK
FT                   TNARTRRGPRKTVAGRGQKRGATKK"
FT   gene            458086..458478
FT                   /gene="rpsK"
FT                   /locus_tag="DET0500"
FT   CDS_pept        458086..458478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="DET0500"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:DET0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40258"
FT                   /db_xref="GOA:Q3Z955"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z955"
FT                   /protein_id="AAW40258.1"
FT                   /translation="MAVKKRAGAKKKEKKVIPVGKAFVQATFNNTIVTLTDLQGNVIAW
FT                   ASCGTAGFKGSRKGTPYAAQMAAQAAARKAAESGLRQVEVLVKGPGSGREAAIRSLQAS
FT                   GINVTAIRDVTPIPHNGCRPPKRRRV"
FT   gene            458488..459111
FT                   /gene="rpsD"
FT                   /locus_tag="DET0501"
FT   CDS_pept        458488..459111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="DET0501"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:DET0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40257"
FT                   /db_xref="GOA:Q3Z954"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z954"
FT                   /protein_id="AAW40257.1"
FT                   /translation="MSRETGAVCRMCRRSGDKLFLKGDKCVTKCVFEKRPKAPGPQLGR
FT                   PRRLSDRGQQLRHKQSIRWSYGMTERQFRRFFGLATAQPGVTGDNMMILLERRLDNVLF
FT                   RLGFGTSRAQARQIVMHGHILVNGQKTDIPSYLVKEGQEITVRETSKATAYFKTLAENI
FT                   EAKAIPGWLSLDRKTLSGKVISLPAAGDIDARFDAQTVVEYYSR"
FT   gene            459132..460124
FT                   /gene="rpoA"
FT                   /locus_tag="DET0502"
FT   CDS_pept        459132..460124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="DET0502"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P20429; match to
FT                   protein family HMM PF01193"
FT                   /db_xref="EnsemblGenomes-Gn:DET0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40256"
FT                   /db_xref="GOA:Q3Z953"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z953"
FT                   /protein_id="AAW40256.1"
FT                   /translation="MSDLAIPTISCTESDGKYGRFVVEPLEKGFGTTMGNSLRRILLSY
FT                   LDGVAITRVRIDGIQHEFSALPKAKEDTLDFLLNLKNIRVESLSGLEGILYLKASGAKV
FT                   VTAADIEPSNDFEVVNPELYLLTLDSDDAVLNVELEVELGRGYRAPESTENTPIGTIPV
FT                   DAIFTPIRKVNFTTEPMHVGRETSLERLVLEVWTDGTIEPATAVSRSADILVKQFAALV
FT                   SHNKVVAEVEASEPVKYAIPEEKYNMPIEQLDLSVRAVNCLRHAGITTVGEVINRGTKE
FT                   LLTLRNFGLKSLTELEDRLKTIGLSLNPEEELFEDAENSKKKNKGMDEA"
FT   gene            460155..460508
FT                   /gene="rplQ"
FT                   /locus_tag="DET0503"
FT   CDS_pept        460155..460508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="DET0503"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:DET0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40248"
FT                   /db_xref="GOA:Q3Z952"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z952"
FT                   /protein_id="AAW40248.1"
FT                   /translation="MRHNVSGRKFDRPTGQRMSLYRNLVTDLLNYEEITISEPRAKEIR
FT                   SMAEKMITLGKKGTLASRRRALAFVYIPGIVDKVFEDLSKRYAERPGGYTRMTKLGPRQ
FT                   GDGAEMVKLELVK"
FT   gene            460538..461284
FT                   /gene="truA"
FT                   /locus_tag="DET0504"
FT   CDS_pept        460538..461284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="DET0504"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:DET0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40247"
FT                   /db_xref="GOA:Q3Z951"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z951"
FT                   /protein_id="AAW40247.1"
FT                   /translation="MLLVIEYEGTRYSGFQVQDKGATIQGELETAIRKLTSEQTRVSGS
FT                   GRTDAGVHAAYQVVSYLSESSLGLDKIKGGLNFYLPPDIAVKEVHFVAESFDVRRRAIS
FT                   REYSYQILNSKTRSPLARLQAWQVPYKLDIKLMEQAFKMLEGEHDFIAFASSLGPEIKK
FT                   TVRRVNWTRLGIREDRLIFNIEANSFLTHQVRNTIGTLVELGRGTMSMSEFEALFEAKT
FT                   PGLAGPAAPACGLSLVRVNYREPFGS"
FT   gene            461286..461717
FT                   /gene="rplM"
FT                   /locus_tag="DET0505"
FT   CDS_pept        461286..461717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="DET0505"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:DET0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40246"
FT                   /db_xref="GOA:Q3Z950"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z950"
FT                   /protein_id="AAW40246.1"
FT                   /translation="MNTYTVKASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFC
FT                   RNLDCGDYVVIINAKKVTVTGNKLDQKIYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHA
FT                   VKGMIPRNTLGAQILAKLKVYEGEEHPHASQTGEVSKES"
FT   gene            461730..462128
FT                   /gene="rpsI"
FT                   /locus_tag="DET0506"
FT   CDS_pept        461730..462128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="DET0506"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:DET0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40245"
FT                   /db_xref="GOA:Q3Z949"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z949"
FT                   /protein_id="AAW40245.1"
FT                   /translation="MVEKNTYFIGVGRRKTAVATVKLTSGNGVIVIDGKPIEERFTRVQ
FT                   ERNVILNPMMVTDTMGKYNAVIKVLGGGVAGQSGAIAHGIARALEKSDDKLRATLKSNG
FT                   LLTRDDRTKERKKPGLKRARKAPQYTKR"
FT   gene            complement(462206..462400)
FT                   /locus_tag="DET0507"
FT   CDS_pept        complement(462206..462400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40244"
FT                   /db_xref="GOA:Q3Z948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z948"
FT                   /protein_id="AAW40244.1"
FT                   /translation="MKTSLFYLGLGVVMIGIGIFTYLQPASIDSLAFSQTVLGILSMAI
FT                   GLLTIIIGAVRYFRDERGH"
FT   gene            complement(462547..462642)
FT                   /locus_tag="DET0508"
FT   CDS_pept        complement(462547..462642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40243"
FT                   /db_xref="GOA:Q3Z947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z947"
FT                   /protein_id="AAW40243.1"
FT                   /translation="MQMFCCHRSTISLYYRPVRRVMCLKVFTKPD"
FT   gene            complement(462708..463775)
FT                   /locus_tag="DET0509"
FT   CDS_pept        complement(462708..463775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0509"
FT                   /product="SIS domain protein"
FT                   /note="identified by similarity to GP:1208896; match to
FT                   protein family HMM TIGR02128"
FT                   /db_xref="EnsemblGenomes-Gn:DET0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40242"
FT                   /db_xref="GOA:Q3Z946"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z946"
FT                   /protein_id="AAW40242.1"
FT                   /translation="MDIRNLDDLNIYTKLDPNHMLDELRRMPSLCKQAWETAEALNLPE
FT                   DYRAVKQVVILGMGTSGVAAQLAERIVRDECKIPIYLHQDYLLPAYVSADTLVIASSSS
FT                   GSTEEVVSCFNQAASRQAKLLVLTTGGELKEMAAGHNIPGLVYDYTYRPSTAIAYGVLP
FT                   VLSILHKLGFIPNKSAEVSESLIVLSQIAERLSEKYQTSNNPAKQLADKLEGRAVMAFG
FT                   SGVTFPAARRFKTQLNENAKCFAFAEEIPEMNHNSVVGYQLPQNSGRYWAAVMFKTTFL
FT                   SKRIHQRMKITTDILHQAKIPVFSIDGYGFSPLCQALSLILQGDFVSLYLAFLNGVDPY
FT                   PIDAVDYFKQELAES"
FT   gene            complement(463800..465227)
FT                   /locus_tag="DET0510"
FT   CDS_pept        complement(463800..465227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0510"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by similarity to OMNI:CT0279"
FT                   /db_xref="EnsemblGenomes-Gn:DET0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40241"
FT                   /db_xref="GOA:Q3Z945"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z945"
FT                   /protein_id="AAW40241.1"
FT                   /translation="MTSQIKFGTDGWRGIIAKDFTFDNVSVCAQATAAYLKNTSPRNLS
FT                   LVIGYDTRFASADFARSAAEVMAANGIKVYFCSCPTPTPVISHGVVNLKAAGAVIITAS
FT                   HNPARWNGFKVKSADGASAPTQMITGIEAEIAKLGDKPPVLNLDFDTAVSRGLIEHVDL
FT                   APAYFEKIGGLVDIEKLRDAGFNIAIDSMHGAGIGYFKQLLDGGCNRLNEINAEPNPNF
FT                   PGMLQPEPITPNLAKLMRLVKDIRSDIGLATDGDSDRLGVVDEMGNFLNQLQVFSLLAL
FT                   YMLEVKGLRGPLVKTITNSSMIDKLGELYNVPVFETKVGFKYVSPVMLEQNALIGGEES
FT                   GGYAFTGHVPERDAILAGAYFLDFMITTGKSPAEMLEYLYSKVGPHYYNRVDYTFAEAR
FT                   REEIIKHLTDQKPASLGETKVVSTDKLDGFRYKLEDGSWLLIRFSGTEPLLRVYAESPS
FT                   QAKTAALLEDGRQLSGI"
FT   gene            complement(465211..465414)
FT                   /locus_tag="DET0511"
FT   CDS_pept        complement(465211..465414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0511"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01PH00939"
FT                   /db_xref="EnsemblGenomes-Gn:DET0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40240"
FT                   /db_xref="GOA:Q3Z944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z944"
FT                   /protein_id="AAW40240.1"
FT                   /translation="MIKTVLLAFFGAIIVELAVIVLATVMGLAGLTFVIMVLFLPVVLI
FT                   LGSVIFILSKIFKGDSQNNKPN"
FT   gene            complement(465447..466667)
FT                   /gene="metK-2"
FT                   /locus_tag="DET0512"
FT   CDS_pept        complement(465447..466667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK-2"
FT                   /locus_tag="DET0512"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P54419; match to
FT                   protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:DET0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40231"
FT                   /db_xref="GOA:Q3Z943"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z943"
FT                   /protein_id="AAW40231.1"
FT                   /translation="MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPNA
FT                   HVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSIN
FT                   RQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSK
FT                   RLSEVRKNGTLAYLRPDGKSQVTVEYHNGEAKRISSVVIGAQHDPDVTTEKIQADIIRE
FT                   VIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSG
FT                   KDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMSHE
FT                   DILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATM
FT                   ESLSVSK"
FT   gene            complement(466677..467933)
FT                   /gene="ahcY"
FT                   /locus_tag="DET0513"
FT   CDS_pept        complement(466677..467933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="DET0513"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by similarity to SP:O67240; match to
FT                   protein family HMM PF05221; match to protein family HMM
FT                   TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:DET0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40230"
FT                   /db_xref="GOA:Q3Z942"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z942"
FT                   /protein_id="AAW40230.1"
FT                   /translation="MPNFDVKDMSLAALGKKRIDWAGREMKTLSLIKERFEQEKPFKGI
FT                   RIAACLHITTETANLGLVLKAGGADLTLCASNPLSTQDETAAALVEHGINTFAIHGEDN
FT                   ESYYRHIAAALDAKPQLTVDDGADLVATLHSQRTELLSGILGGTEETTTGVIRLRALAE
FT                   SGKLCYPIIAVNDAKTKYMFDNRYGTGQSTLDGITRATNFLWASKTVVVVGYGWCGHGV
FT                   AMRAKGLGAHIIVTEVDPVKALEAVMDGFSVMPMAEAAKAGDIFITVTGDKHVIDANHF
FT                   KLMKDGATLANSGHFNSEINIPALETLACGKETIRPSVEEYKMKDGRRIYLLGEGRLIN
FT                   LAAAEGHPAAVMDMSFANQALSLEYLVKNHTKLEKKVYAVPEEIDRAVAATKLSSLNVS
FT                   IDTLTEEQIKYLSSWQEGT"
FT   gene            complement(467941..469503)
FT                   /locus_tag="DET0514"
FT   CDS_pept        complement(467941..469503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NS4782"
FT                   /db_xref="EnsemblGenomes-Gn:DET0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40229"
FT                   /db_xref="GOA:Q3Z941"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z941"
FT                   /protein_id="AAW40229.1"
FT                   /translation="MSDLPLYAQAMLRPDFYPEPTSKVELVQTQMSFVFLTDHFAYKTK
FT                   KAVNLGYLDYSELSERKALSEKELVLNRRLCDYAYLEVLPVTENEGGYSLGGCGEVVEY
FT                   TLKMRRLPEDRMLINLLSTGGVSSGMLEKLAEKLAVFHQTARTDAEVQKYGNLEAIKYN
FT                   TEENFEQTGSKVGLTVSPGEYARISSFTRSFISDNQALFNARVNGGKIRDCHGDLHAAH
FT                   ICFMDNICIYDCIEFNDRFRYGDVASEVAFLAMDLDHYGRADLSRRFVNSYIQKSKDTD
FT                   LYKLLRFYKCYRAYIRGKVEGFKLDDPYISEAEKAKYVQKSKNYYHLADFYASPKPTLF
FT                   ITTGFCGCGKSTLAQSLAEVSGSVVISSDIVRKGLSNIDCHQHCFEDADQGIYSPEMTK
FT                   KTYQAMFDQAGDALKEGYSVILDATFLKEDQRKQAEECAGQNNAKFVVLEVKLSPELAK
FT                   KRLEERLDKQSVSDGRWEVYLKQIKSFEPLAVQPNRVIIDSSKPTDKQLSDILEFFKSN
FT                   QGE"
FT   gene            complement(469503..469703)
FT                   /locus_tag="DET0515"
FT   CDS_pept        complement(469503..469703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:TM0518"
FT                   /db_xref="EnsemblGenomes-Gn:DET0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40228"
FT                   /db_xref="GOA:Q3Z940"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z940"
FT                   /protein_id="AAW40228.1"
FT                   /translation="MNCATELNKVNCNCTYEPCERKGKCCRCISYHLSMDELPACAFPD
FT                   NIEKTHDRSFKCFARMVSKES"
FT   gene            complement(469700..470728)
FT                   /locus_tag="DET0516"
FT   CDS_pept        complement(469700..470728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02SC5267"
FT                   /db_xref="EnsemblGenomes-Gn:DET0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40227"
FT                   /db_xref="GOA:Q3Z939"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z939"
FT                   /protein_id="AAW40227.1"
FT                   /translation="MTKTDFHFLPTMIGSMPHTDPKAAVDIITHYLQDIPVWPQLPRRS
FT                   CLEGMSAQFSQGLPGVKINQDKVWIEPNPSFESELESLYQAYLDNDFNKFPIGAEYAAG
FT                   LYELASRNLSPLLVKGHITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKATWQEH
FT                   FLSNICRNTIIFVDEPAMSAYGSAYLPLSREQVTGMFDEVFSGISGLKGVHCCGNTDWS
FT                   ILMDTRVDIINFDTYAYANSLSIYTDELKAFIKRGGAVAWGIVPTDEKALKEETAASLK
FT                   DRLEAAMSHFDSRGLPFAELARHSLITPACGLGLKSPEAAERAPQLLAELSALLRRKHG
FT                   TV"
FT   gene            complement(470721..471605)
FT                   /gene="mtaP"
FT                   /locus_tag="DET0517"
FT   CDS_pept        complement(470721..471605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaP"
FT                   /locus_tag="DET0517"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="identified by similarity to GP:5542154; match to
FT                   protein family HMM TIGR01694"
FT                   /db_xref="EnsemblGenomes-Gn:DET0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40226"
FT                   /db_xref="GOA:Q3Z938"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z938"
FT                   /protein_id="AAW40226.1"
FT                   /translation="MVNYAKIGVIGGTGLYDIEGLTDIREHSPDTPFGKPSDTIVTGNL
FT                   NGVGVAFLPRHGRGHRILPSEIPSRANIYALKSLGVEHIIAINSVGSFKKEVKPGHLLI
FT                   PDQLIDRTSQRTNTFFGKGIVAHIAFSQPFCPDLRKLLYECAKEAGADVHNGGTYVVME
FT                   GPAFSTQAESRLHKSWGADVIGMTALPEAKLAREAEICYAIIACATDYDAWHEEEEAVT
FT                   VDKVIATLRGNINLSKNIIKLAVGRIGEARNCECSTALSNAIMTSPEAVPNTRKRELAL
FT                   IIDKYMPAASEND"
FT   gene            complement(471674..472678)
FT                   /locus_tag="DET0518"
FT   CDS_pept        complement(471674..472678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0518"
FT                   /product="translation initiation factor, putative, aIF-2BI
FT                   family"
FT                   /note="identified by match to protein family HMM PF01008;
FT                   match to protein family HMM TIGR00512; match to protein
FT                   family HMM TIGR00524"
FT                   /db_xref="EnsemblGenomes-Gn:DET0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40225"
FT                   /db_xref="GOA:Q3Z937"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z937"
FT                   /protein_id="AAW40225.1"
FT                   /translation="MKAIEWRDNRLIILDQTLLPLEEKYLELNDYHAVAEAIKTLRVRG
FT                   APSIGVAAAYGIALGALGIETQYCSEFLPLYQQVSAEIASTRPTAKNLFMAAERMDHVV
FT                   ASGTDVSQVKISLVEEAVKIHHEEEEASRKISAFGAELIQPGWTVLTHCNAGPLATAGY
FT                   GTALGVIIAAHQQGKNISAFATETRPLLQGARLTALELKEAGIPFKLITDSMAGHFMQK
FT                   GVINAVVVGADRIAKNGDTANKIGTYSLAVLALAHGIPFYVAAPSSTFDKSIESGRDIV
FT                   IEERKPEEITQIRGQRIAPENIAVANPAFDVTPANLITAFITENGIIRREAKN"
FT   gene            complement(472680..473777)
FT                   /locus_tag="DET0519"
FT   CDS_pept        complement(472680..473777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0519"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="identified by similarity to OMNI:NTL01BMA0802"
FT                   /db_xref="EnsemblGenomes-Gn:DET0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40216"
FT                   /db_xref="GOA:Q3Z936"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z936"
FT                   /protein_id="AAW40216.1"
FT                   /translation="MRFWQLGIRALKETYRDPMALGFLLGFPLMFMLLFGFAFSGEGSA
FT                   SYQIGVIDEDQTPVSIAFADEALPNVPAYEISYINTPDEALTKLKQSDIRAYIIIPAGF
FT                   GEEVNKLWAGENGNIYLDVTYDESDIQAAGEILSQLNAVCRAFAKIEIPLSINAQPVNI
FT                   ENKITNIDFISPGIIVFGLLILIPTSARIMVRDKEKGFMSRMLTTPSRPVDFILGYSLS
FT                   MTFICIIQIIFFMLLGYLFGMDITGNIALAFLIFFLTGLSSIGIGMVIAGFSKSENQSE
FT                   SISWFFSMPLAMVSGTWFSIQFMPDILKGLGYAFPYSHAIEASRLVILRGADFSAVSSE
FT                   IGILAVWTVAIFALGTIIFGRTMRS"
FT   gene            complement(473774..474724)
FT                   /locus_tag="DET0520"
FT   CDS_pept        complement(473774..474724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0520"
FT                   /product="daunorubicin resistance ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /note="identified by similarity to OMNI:TM1403; match to
FT                   protein family HMM TIGR01188"
FT                   /db_xref="EnsemblGenomes-Gn:DET0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40215"
FT                   /db_xref="GOA:Q3Z935"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z935"
FT                   /protein_id="AAW40215.1"
FT                   /translation="MAATSKAPPEIPAIETADLSRSYGQLLAVEKLNLNIRRGELFALL
FT                   GPNGAGKSTTINMLCCLLKPTAGTARIMGFDINTQSYQVKSTIGSSPQETAISDHLTPV
FT                   ENLELFGRLNGVAPEKLKEWIPRFLEIMGLEDRAKSQVRTFSGGMKRRLSIMMALIHNP
FT                   DVVFLDEPTLGLDPQVRHAMWEYIKSLKGQKTILLTTHYMEEADQLADRIGIMDQGKIV
FT                   ALGTPVELKQSLIKEPTMKIQAFNISQKIIADLKTFYPKVEFSGGTLSVSAEHLEFNEI
FT                   VNRLQNAGAVIRSAQIKDPSLEDVYLKLTGKELRP"
FT   gene            474796..475239
FT                   /locus_tag="DET0521"
FT   CDS_pept        474796..475239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01OI0672"
FT                   /db_xref="EnsemblGenomes-Gn:DET0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40214"
FT                   /db_xref="GOA:Q3Z934"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z934"
FT                   /protein_id="AAW40214.1"
FT                   /translation="MYYKLGRMQDIKYTLEDLRANPGLRLPPLKLVIERGMVERFCRAV
FT                   GDDMNNWQTEAPPSLALTLGFGQMLEAISADNITVLHGSSELESLKPLEIGQEVVVETS
FT                   LLSLRERPGKMGLSSFLNFEMQVSNNKGELLARVCQLAIIYSA"
FT   gene            475236..475649
FT                   /locus_tag="DET0522"
FT   CDS_pept        475236..475649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01ML1916"
FT                   /db_xref="EnsemblGenomes-Gn:DET0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40213"
FT                   /db_xref="GOA:Q3Z933"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z933"
FT                   /protein_id="AAW40213.1"
FT                   /translation="MTSVFENITEGQEIACQMLAFSSRDLVIWAGASGDYNPIHYDKDI
FT                   ALKKGLGGVVVPGQLVGAMLGSLASRFACPSGRLAKLSVSYKKMMPLGENLVLKGIVSS
FT                   KADTPESKSLSLKLWAEDTAGDKTVTAAAVILY"
FT   gene            complement(475636..476196)
FT                   /locus_tag="DET0523"
FT   CDS_pept        complement(475636..476196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0523"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to GP:23978678"
FT                   /db_xref="EnsemblGenomes-Gn:DET0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40212"
FT                   /db_xref="GOA:Q3Z932"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z932"
FT                   /protein_id="AAW40212.1"
FT                   /translation="MIYTQGKLTRLRDKRLEDASLDYVWQTDPELSRLDAAEPLTIPFR
FT                   TFLGEYLFVLENSLALRVQFGIETLKGEYIGYCACYNLDSAAAEAEVGIMIGQKEYWGK
FT                   GYGSDALRQMIDYAFKGLKLKRLHLKTLHDNSRAQLCFKKCGFKPFAEKESGQYRFLLM
FT                   ELLKADWLKNKDMLAEDCQPNKV"
FT   gene            complement(476201..477151)
FT                   /locus_tag="DET0524"
FT   CDS_pept        complement(476201..477151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0524"
FT                   /product="PBS lyase HEAT-like repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40211"
FT                   /db_xref="GOA:Q3Z931"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z931"
FT                   /protein_id="AAW40211.1"
FT                   /translation="MSQENTEITEIFDRLADESTGLKHTDLALLSDLNSQEIAAFKDFW
FT                   IRLSPERRLDIVSRLGELAEDDVSLDFESIFLRTMHDPNPEVRAKSIDGLWECNRPSLI
FT                   DQLLSLANEDPSIEVRIAATATLGRYSLMGEFGQLPEKTSQLLQTSLLAIFQNTELPLE
FT                   LRRRALESVSPFGQPQVTMAISQAYNCPEHLLRIGAVYSMGQNAGSQWESVITSELNSD
FT                   NNDLRYEAAVAAGELGMESFVPKLISLIEDSDMEVQLASIQALAKIGGKNAKKGLTESL
FT                   EHTTSQAVREMITTALADIEAEESASGLPAIKPEE"
FT   gene            complement(477151..477981)
FT                   /locus_tag="DET0525"
FT   CDS_pept        complement(477151..477981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:AF0525"
FT                   /db_xref="EnsemblGenomes-Gn:DET0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40210"
FT                   /db_xref="GOA:Q3Z930"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z930"
FT                   /protein_id="AAW40210.1"
FT                   /translation="MDKKYKLNSRPKLKSPCLLAAWPGISNVALIVATYLARKLEFKEL
FT                   AEIDSPSFFDPIGVLVKDGVVEEPQFPQNRFYYLKNKQDNDIILFIGEDQPSAKSYELA
FT                   NLILDVGQRFGVKKIYTFAAALTRIHHSEQPRAWAVGTNPQVANELVERGLSGSGNLQI
FT                   SGLNGLLLGVAKERNIDGVCLLGEVPSYASRLQNPMAALVIVQILSKLLQLEVDISELE
FT                   QIASEAKQHVSQIAAEAMEDYIDYFTEPIWESGEDDDDDLDNDDDDDNEEASNN"
FT   gene            complement(477995..479296)
FT                   /locus_tag="DET0526"
FT   CDS_pept        complement(477995..479296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0526"
FT                   /product="pmbA/tldD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40209"
FT                   /db_xref="GOA:Q3Z929"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z929"
FT                   /protein_id="AAW40209.1"
FT                   /translation="MLEKIIEQAKKVAEQAECFMVESESAPIHFEANHLKNIESKQSLS
FT                   LALRIIKDGKIGYAASSNPANWPKLADMALETAAYGQTARFQFPATQTCPEVKIFDPEV
FT                   ETVSLEEMVKLGKDMITGLLEINPELVCSASLAKSTFRIRLLNTSGADISYKKSHFSMG
FT                   LEGTLVRGTDMLFVGDGLSSCRPIRSGSEVVNLVGKQLERASRNVNLQSGEMPVIFTPH
FT                   GVGSTIIPALSAALNGKLVQEKASPLAGKLGEQMFDPAFSLVDDPTQSFSPNSRPFDDE
FT                   GTASQITPMVESGVIKNFIYDLRTAALAKAKSTGNAERHGGQPAPGFSALMIKPGTVSF
FT                   EEMVSGIKEGLIVEFMMGAEQGNVLGGDFSGNVLLGYKIENGQIAGRVKDTMLSGNIYN
FT                   ALKTINAIGSDGRWLDGELFSPSIYFPKLSVAAK"
FT   gene            complement(479298..480674)
FT                   /locus_tag="DET0527"
FT   CDS_pept        complement(479298..480674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0527"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by similarity to SP:P46473"
FT                   /db_xref="EnsemblGenomes-Gn:DET0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40200"
FT                   /db_xref="GOA:Q3Z928"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z928"
FT                   /protein_id="AAW40200.1"
FT                   /translation="MTELRNIAHELSQQLYHYRADYLEIHLEESSGSYISYRGQNLDTA
FT                   GRSSDLGGNIRALVNGGWGFVSFNSLDDIQKRIDQAIHQAALAGSAQSQFASAPSVTYA
FT                   QPDELSQSSVERPLEDKKRVLDEYKDLIWQTKGIKTSFIRFSDGYRRRFYVNSRGSVIE
FT                   QSRADINFNATAIASADGELQQSNISVGSRGDYNAITRLHSQIKDMTEHAVKLLTAPKV
FT                   KGGEYTVILDPILAGVFVHEAFGHLSEADHIYENPQMREVMVLGKKFGPKILNIVDNPT
FT                   MPDLRGSYKYDDEGVAATKNYLIREGKLSGRLHSRETAAKMNEPLSGNARAISYRYAPI
FT                   VRMSNTYIEPGTSTLEEMLDGVKEGIYVKNWYGGTTSMEMFTFSSGEAYMIRDGKIAEA
FT                   LRLVVLSGNVFDTLHNIDMIGNDLDMNQGGGCGKGGQSPLPVSNGSPHIRIQKCLVGGA
FT                   "
FT   gene            480812..482104
FT                   /locus_tag="DET0528"
FT   CDS_pept        480812..482104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0528"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:DET0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40199"
FT                   /db_xref="GOA:Q3Z927"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z927"
FT                   /protein_id="AAW40199.1"
FT                   /translation="MGLFGTSGIRRLVDERLMEIALKVGFSVGKRYRRVVLAGDSRTST
FT                   PAIKRILSGALVSAGADVVDIGLVPTPTLAFMVRDFDAGLMVTASHNTAEYNGIKFLNP
FT                   DGSAFSYLQQQEITKDVESSRAHPMKWDSFGQINAFPSTVEKHMEHILGYLPDKCRLKV
FT                   VVDCGGGAASVITPWLLQRMGSRVISLNDTTHGFFPHPPEPLAENLSGLIQTVKESDAD
FT                   LGIAHDGDADRMVAVDKHGNFISGDKMLVLFARAARADKVVTTLDASMAVDEMGFKVIR
FT                   TAVGDNYVSEELKRQGNFGGEPCGAWVFPESSLCPDGIYAAARLLNLVSHQPLSELISD
FT                   IPEYSMKRGSVEGSGLNLALVEESLQCLNPLSSSLLDGIKLNLKDGWLLIRPSGTEPKI
FT                   RLTAEARTPEYCETIYQTGLKCLKSCLSREK"
FT   gene            482106..483308
FT                   /locus_tag="DET0529"
FT   CDS_pept        482106..483308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0529"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by similarity to GP:1814004"
FT                   /db_xref="EnsemblGenomes-Gn:DET0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40198"
FT                   /db_xref="GOA:Q3Z926"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z926"
FT                   /protein_id="AAW40198.1"
FT                   /translation="MKAVILAAGEGSRMRPLTFTRPKVMLPIAGKPILEHLLLEVSAAG
FT                   ITEFILVVGYRDEQVRSYFADGARWGLKISYCQQTRQLGTAHALKQLEKQLQADFLVMN
FT                   GDILAKSADIAALAASSETTLGVFEASDPRRLGVLETDGSRVKRIHEKSANPPTNLANA
FT                   GLYFFTPRIFAAINNTPLSLRGEYEITASIQMLIDSGLAVGYRPLTYWQDVSYPWDLLD
FT                   LNASMLKSLSQRICGQVEENAVIRGAVEIGEGSRVRSGAYLEGPVIIGKNCDIGPNCYI
FT                   RPATSIGDNCRVGASVEIKNSIIMDNTKIPHLNYVGDSVIGQNCNLGAGTKLANLRFDG
FT                   ADITAGGVNTRRRKLGAVLGDGVETGINVSLNPGVLIGAGSRIGPGAVVSGVIEPNSYI
FT                   G"
FT   gene            483324..484505
FT                   /locus_tag="DET0530"
FT   CDS_pept        483324..484505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0530"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by similarity to SP:P08075"
FT                   /db_xref="EnsemblGenomes-Gn:DET0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40197"
FT                   /db_xref="GOA:Q3Z925"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z925"
FT                   /protein_id="AAW40197.1"
FT                   /translation="MKQAVILAAGEGQRLRPFTSSKSKVMLSIAGKPLLEYVIESLARN
FT                   GIRDIILVVGYKRERIFDYFGDGGHLGVEITYVSQPNQLGTAHALKQTRDKIRGDFLVL
FT                   NGDQLISPATIGDFVKEPPQAVMVKAINGEDPRRYGVVSSSGRRLTSIEEKPSIAKSNL
FT                   INTGIYSFSTRVFDYIAEHLDIPMVLQSMIKDGLDIRVAESRGVWLDIVYPWDMLSLNA
FT                   VVSDTLKPGVAGTIESGVVMKGPVLIGKNTVIRSNSYITGPVIIGEGCDIGPSVCIYPS
FT                   TSIADNVTVAPFCQIKNSLIYSGNSIGVASVIEDSVIDRGCVIRGQFSAPSAEVETRIN
FT                   DELHKIKVGTMMGEDCMVGNGAVLQGGTVVGNSSRIAPLKTLSGSIPDGSLVV"
FT   gene            484507..486288
FT                   /gene="glmS"
FT                   /locus_tag="DET0531"
FT   CDS_pept        484507..486288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="DET0531"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by similarity to SP:Q56213; match to
FT                   protein family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:DET0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40196"
FT                   /db_xref="GOA:Q3Z924"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z924"
FT                   /protein_id="AAW40196.1"
FT                   /translation="MCGIVGYTGKRQAQAVLYDCLCRLEYRGYDSCGIAVNTPEVQVFK
FT                   DAGKVRNILQNAPRFEGTAGLGHTRWATCGEPTRINAHPHIDCTGKISLVHNGVINNYA
FT                   QLRKRLEANGHKVVSDTDTELIAHLIEEYDKGNLEEAVRQAVKEIDGSYALVVMRSGDN
FT                   TLVAVRKDSPLVIGVGDSEYLVASDVPAILGYTNRVIYPEEGDIAVISPDSLKINRNGE
FT                   YIIPRVEKINWTPDEAQKGGYSHYMLKEIHEQPQVIQNTLINMPLTESFYKSPLLEQGR
FT                   KTGILFLACGSSYHAALTGRYLVEEHLNIPVRLEVASEFNYMQHLPPCKLAVVLSQSGE
FT                   TADILRAMRRLKQAGCMIVAITNVAGSTAARLADHVIYTQAGPEIGVAATKSFIAQLVV
FT                   LYALCFACASAASPRYQDYLSTMRLLPGAVQKILGSHQNIKDAAIEVAKAKSAFFIGRG
FT                   INYPIALEGALKLKEISYIHAEGYAAGELKHGPFALLSPETPVLALVSRDQTYEAMLTG
FT                   LREIKVRRAPLIVIGEDGDDQLEQLADRVIKIPPFNRLFSPILFSVVLQLLAFYAAYEL
FT                   GRDIDTPRNLAKSVTVE"
FT   gene            complement(486296..486748)
FT                   /locus_tag="DET0532"
FT   CDS_pept        complement(486296..486748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0532"
FT                   /product="phosphatidylethanolamine-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01161;
FT                   match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:DET0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40195"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z923"
FT                   /protein_id="AAW40195.1"
FT                   /translation="MLLGSSAFACGEYIPRRYSGLGGNISPPLEWMKLPEGTKSLTLIL
FT                   EDPDASKTFTHWLIYNIPSDREGLPEAVPAEPNLPDGIRQGLNSAGETGYTGPYPPPNR
FT                   VHHYHFRLFALDTVLRLKAGSHQADLIKAMEGHIIDQTDLTGLFVA"
FT   gene            complement(486760..487464)
FT                   /locus_tag="DET0533"
FT   CDS_pept        complement(486760..487464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0533"
FT                   /product="HAD-superfamily hydrolase, subfamily IA"
FT                   /note="identified by match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:DET0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40185"
FT                   /db_xref="GOA:Q3Z922"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z922"
FT                   /protein_id="AAW40185.1"
FT                   /translation="MIKGVFFDLYNTLIGYQPSREEMTVKLLAELGYTINEDDLYLPVN
FT                   KADEYFYQQNAQKPISLRERAEQMAVWSHYYRIILEEIGIEPKPELINNLISRWKNLKW
FT                   EMTLYQDVIPCLENLKKRNLKIGLISNAEKDMSELFNKTGLNKYLETVVISQEVGVTKP
FT                   NPLIFQAALKKSGLTAKEVLYIGDQYQVDYMGAMNVGLNPVLLDRRNCYLDLKDCRRIT
FT                   GLAELEYCIDNT"
FT   gene            487604..488908
FT                   /gene="lysA"
FT                   /locus_tag="DET0534"
FT   CDS_pept        487604..488908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="DET0534"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:DET0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40184"
FT                   /db_xref="GOA:Q3Z921"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z921"
FT                   /protein_id="AAW40184.1"
FT                   /translation="MEPRIQVFPKNTEVKNNRLVIGGADVAGLCAKYGTPLYVFDEATI
FT                   RQNCRDFKREFSRRYADSSVSYASKAFLHPALLKILAEEGMSLDVVSGGELSIASSAGF
FT                   PMDMVYFHGNNKSADELRLALRLHVGRIVVDSFDEIKLLSKLADESGHIPDILLRLTPG
FT                   VDAHTHHHITTGKLDSKFGFPLFQAAEAVGLAMAQASLNLVGFHFHIGSQIFETQPFLD
FT                   AIDLVLEFAAQVQERYGFDIEELDIGGGYGVQYEVDKPAPQVSVYAEAIGAKIVSKCHS
FT                   LKLTPPSLNIEPGRAVIAQAGVALYTVGVIKDIPGIRVYASVDGGMGDNIRPALYEAKY
FT                   EAVVANNVQSSEKQKVTVAGKFCESGDILITDIELPVLKTGDILAVPCCGAYCLPMSSN
FT                   YNGYQRPAVVMLKNGEDRLIRRRETVEDLSRLDSV"
FT   gene            488923..489942
FT                   /gene="holB"
FT                   /locus_tag="DET0535"
FT   CDS_pept        488923..489942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="DET0535"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P37540"
FT                   /db_xref="EnsemblGenomes-Gn:DET0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40183"
FT                   /db_xref="GOA:Q3Z920"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z920"
FT                   /protein_id="AAW40183.1"
FT                   /translation="MWQIIGQDKAVSFLCNSLNQDKLCHAYVFYGQSGVGKKRMALSFA
FT                   QALNCQAASPPCQECPVCERIMAGNFPDVIHIELLSAEDSSDGKAKAEIGVKQVEDIQH
FT                   AASLPPFEGKYKVFIIHQAEKLSVESSNRLLKTLEEPGSQNIFILLTADKSLLLPTVLS
FT                   RCQILELKYAETGLIHEAFIKQGLDEEKAELLSHLSYGRVGWAMEAASNPEILEERKAK
FT                   IDKIMRVLGQDEEDRFNYAADVSNLFGKNRAEAEEVLDMWLGLFRDMLLLKADAGQNMT
FT                   NIDYKDILYQACGGLGLVDIRAGIDNILKAQSQLRANANPRLCLEVLMLSLPLVKEGL"
FT   gene            489945..490778
FT                   /locus_tag="DET0536"
FT   CDS_pept        489945..490778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:DET0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40182"
FT                   /db_xref="GOA:Q3Z919"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z919"
FT                   /protein_id="AAW40182.1"
FT                   /translation="MVDIVKIRYKQAGKIYYFDPAGFELYPYDCVVVETSRGEELGWVV
FT                   ASPSQVEESSLEQPLKPVIRLATAEDMARERQLEEKNQSAVSECIELVDKLNLPMKLIR
FT                   AEYSLDENHVTIYFSAEDRVDFRELVREISRKLRVRVELRQIGPRDEAKMVGGYGRCGR
FT                   ELCCCSFLSEFDPVSIKMAKEQNLPLNPQKISGVCGRLLCCLDYEYETYKAAKAKMPKD
FT                   GLKVITPVGKGEVVGGNPLEEMVFVLLESGANAEVPLKDIRPDKEGRRPDASLHR"
FT   gene            complement(490764..491297)
FT                   /locus_tag="DET0537"
FT   CDS_pept        complement(490764..491297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0537"
FT                   /product="HNH endonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40181"
FT                   /db_xref="GOA:Q3Z918"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z918"
FT                   /protein_id="AAW40181.1"
FT                   /translation="MDNHQVLVLNQDYQPLNVCHVRRAVLLVYQSKAEMLENGSGFWHS
FT                   EKDLFALPSVIRLSCLIKHPPLRPKLNRAEIFSRDKHTCQYCGRKDLELTIDHVNPKHQ
FT                   GGPHVWENVVTACLHCNRLKAGRTPEQAHMKLLSTPGVPQYRYGYSLPRSNGSIRHEWR
FT                   PYLGLENEPKLAVE"
FT   gene            complement(491369..492649)
FT                   /locus_tag="DET0538"
FT   CDS_pept        complement(491369..492649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0538"
FT                   /product="ATP-binding protein, DnaC family"
FT                   /note="identified by similarity to SP:P07905"
FT                   /db_xref="EnsemblGenomes-Gn:DET0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40180"
FT                   /db_xref="GOA:Q3Z917"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z917"
FT                   /protein_id="AAW40180.1"
FT                   /translation="MYPVSAEGVTDFSRVIPCQCTQTESGADREKRLLTYSCLGGLQKY
FT                   TFEKLNSLGKSEEPHNQNMFSQAYNAALNFASNPAGWLVFSGPSGAGKTHLAAAIANKR
FT                   LAMGQPVLYKRASELIDDLKKSFEPDSEAAYSQSFDILKNAPLLIIDDLTVQSGSDWSK
FT                   EKLDQLLTYRFSQELPTIITLSTPINELDSRIQSRLLDKSVSRIYPVASNPEDTLEYRW
FT                   DNALALQKKMTFENYDHKRSNLPPEQRQNIEAAYNLALEFSRNPESWLVFQGETGCGKT
FT                   HLASAIVNERYRQGKPAMFVVVPEFLDHLRSTFSPESKTSYDQMFDAVKNAKLLVLDDF
FT                   GEQSSTPWAQEKLYQVINYRYNRRLPTVITTRCPLSEIEVAISSRFVDPQISMVFNITA
FT                   PNFRCDSTGQQKQRPVSRINRTTRPQR"
FT   gene            complement(492705..493415)
FT                   /locus_tag="DET0539"
FT   CDS_pept        complement(492705..493415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0539"
FT                   /product="dnaD/phage-associated domain protein"
FT                   /note="identified by match to protein family HMM TIGR01446"
FT                   /db_xref="EnsemblGenomes-Gn:DET0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40179"
FT                   /db_xref="GOA:Q3Z916"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z916"
FT                   /protein_id="AAW40179.1"
FT                   /translation="MSNAPLFPARQEFTPVSRFFIHRVAPLIEDMTELKVSLAVFSLIQ
FT                   AKKGYPRYTTLAELAAEETLVKALGKTRDESLQSLDKALQMAVKRGTLLGLEIKSGKHT
FT                   HQLYFVNTESEAAVVEKIKTGNLVLPGLKEASTEVISGQAEQPNIFKLYEQNIGMLTPM
FT                   LADNLKEAEKLYPEEWIAEAIKEAVNLNKRNWRYIERILENWSSQGKNSGTHKGHTGET
FT                   DKYKGQLFDHLVQR"
FT   gene            complement(493412..494788)
FT                   /gene="dnaB"
FT                   /locus_tag="DET0540"
FT   CDS_pept        complement(493412..494788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="DET0540"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:DET0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40178"
FT                   /db_xref="GOA:Q3Z915"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z915"
FT                   /protein_id="AAW40178.1"
FT                   /translation="MLDAKMPPYDVDAEESVSGSLLIDGQAIFDIIPILKPQDFFTESN
FT                   RLIFEACMSLYGRSEAINQVTVAQELERLGKLERCGGSAYLSHVVTVVPTSLDIEHYAR
FT                   IVYRLSVMRQLIEAGQKISELGFKADPDVSDSLGKAEDLLFRLRHERSSLGFTHIKNIL
FT                   DKYFEPVPIPGSEGYQAIPHVLTGLTGMDTFLGGLQRSDLIIMAGRPSMGKTSLALNIA
FT                   RNAAVEQRACTAIFSLEMSRESLVQRLLSNEAAVNSRSIRLNESSPDEERKIMDAIGVL
FT                   SEAPIFIDDSPQIRVAEIRSKALRLRYEQNIDLIIVDYLQLIQGEGSGKENRVQEISYI
FT                   SRSLKGIARELNVPVIAISQLSRAPEFRSSHQPQLSDLRESGSIEQDADIVVFIYRDEF
FT                   YYKEDEWANLHPDQEYPREIADIIIAKHRNGPIGTVKCRFRHDLTRFENLGSSTEPSFL
FT                   "
FT   gene            complement(494789..495244)
FT                   /gene="rplI"
FT                   /locus_tag="DET0541"
FT   CDS_pept        complement(494789..495244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="DET0541"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by similarity to SP:P02417; match to
FT                   protein family HMM PF01281; match to protein family HMM
FT                   PF03948"
FT                   /db_xref="EnsemblGenomes-Gn:DET0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40169"
FT                   /db_xref="GOA:Q3Z914"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z914"
FT                   /protein_id="AAW40169.1"
FT                   /translation="MKVAFLKDVPGRGKTGDVKEVNDGYARNYLIPNKLAMPASASVTS
FT                   EIAAKQAAEDRRKAKAEAEMAQLAKELDGTNVSIKAKTGAKDKLYGQVTTTVIAAEIEK
FT                   QTGKAIDKRKLELSEPIRQLGSYEVVIRFNKDLSSKINLIITAEENT"
FT   gene            complement(495314..496234)
FT                   /gene="trxB"
FT                   /locus_tag="DET0542"
FT   CDS_pept        complement(495314..496234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="DET0542"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:DET0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40168"
FT                   /db_xref="GOA:Q3Z913"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z913"
FT                   /protein_id="AAW40168.1"
FT                   /translation="MSPLLYDVIIIGGGPAGLTAALYTGRAKLKTLVIERAFIGGQITR
FT                   SEKVDNYPGFPEGITGFDLTQQMQIQAEKYGAEIISAEVTALNKAKDSFELSTEAGKLS
FT                   GRCIIICGGTERNKLGVPGEEEFSGRGVSYCATCDAPFYNDKVVAAVGGGNMAIYEALH
FT                   LSEFAKKVYLIHRRQGFRADAVLVDKAKSKGNIEMVLDTVITSINGKDSIQSLSLNNLK
FT                   TQKTSDLPVNGLFVAVGLQPNTAYLKGVVDMDKNGSILVNDQMETSVSGILCAGDIRSG
FT                   SIRQVISAAGDGAVAALSAKRYLDR"
FT   gene            complement(496215..497258)
FT                   /gene="plsX"
FT                   /locus_tag="DET0543"
FT   CDS_pept        complement(496215..497258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="DET0543"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by similarity to SP:P71018; match to
FT                   protein family HMM PF02504; match to protein family HMM
FT                   TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:DET0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40167"
FT                   /db_xref="GOA:Q3Z912"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z912"
FT                   /protein_id="AAW40167.1"
FT                   /translation="MIIAVDVDGGDYAPKEIIKGALKAAQEYKIGLILLGKKEVIHVHA
FT                   GHYLKKYPIEIVHCPQTITFNEHAVEAIKGKPKSAIVIGTSLVKQGKADAFISAGNTGA
FT                   VLAAAFFILGKIDGVERPALGAIITTRPHIPSLLIDAGANAECRPNHLDEFAHLGNIYA
FT                   KQVLGLEKPRIGLLNNGEEEAKGTKLTLETHQLLKKSQLNFIGNIEGHDISLNKADVIV
FT                   TDGFTGNVVLKTLEGLGDALLKLRKVGHAIDSAAHLRGRALLADVGLGSMVKGMDFEEC
FT                   GGACLLGVKGTVIVAHGRSHARAIKNAIGLAKRTAEKGVDKLIAEDVRLRTLTATEGEQ
FT                   NHVTTPV"
FT   gene            complement(497298..498149)
FT                   /locus_tag="DET0544"
FT   CDS_pept        complement(497298..498149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0544"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /note="identified by match to protein family HMM TIGR00241"
FT                   /db_xref="EnsemblGenomes-Gn:DET0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40166"
FT                   /db_xref="GOA:Q3Z911"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z911"
FT                   /protein_id="AAW40166.1"
FT                   /translation="MNIFLGIDSGSVSTKIICLSPSAELADWIYLPTAGDPLSTLRTGL
FT                   RQLQHRLPEDTSVLGVAVTGSARELVADAVGADMVKNEISSQAKAAAHLIPEVKTVIEI
FT                   GGQDSKLILLENGFVSDFAMNTVCAAGTGSFLEHQSRRLNLSLEEMGKLAHFSQNPIEL
FT                   KGRCTVFVESDMIHFQQTGSSRPDIVYGLCKALVRNYLNDLGLHKEIRQPVVFQGGVAR
FT                   NPAMKKAFEEELGFSLIVPPRPEITGALGAALLLCQERETDSPAKPTNFRGFETPFLRE
FT                   KV"
FT   gene            complement(498174..499367)
FT                   /locus_tag="DET0545"
FT   CDS_pept        complement(498174..499367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0545"
FT                   /product="amidohydrolase family protein"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:DET0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40165"
FT                   /db_xref="GOA:Q3Z910"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z910"
FT                   /protein_id="AAW40165.1"
FT                   /translation="MSDNNLANIKSAVIKMIDTEKGSLEELSLKLHANPELGYQEYKAV
FT                   EWLCEYLSRHNFSIERNTGGLKTAFKATFGQGKPVIGFLAEYDALPQLGHACGHNLIAT
FT                   AAAGAAVAARLAAKLYGGTVCLIGTPAEELSGGKIQMVEKGVFKELEAALIAHPGNDDI
FT                   ATTQALACVTLNVEYFGKESHAAAHPDKGINALDAIVLAYTSLNSLRQHIEPGARIHGI
FT                   ITDGGKAANIVPGHSAGTFLIRSQTLPYLRELMDRVLDCFKSAAQATGARLEYRFDKSI
FT                   YAPMNNNMALANLYVKNMDMLGHRTLLEDPEMNFGSTDMGNVSQVVPSLHGYYAITGKD
FT                   VSGHTPEFASAACSAKGIKGALDAAKAMAMTAADLFGSSANLEKVKTEFQKSTRPSA"
FT   gene            499589..502429
FT                   /gene="uvrA"
FT                   /locus_tag="DET0546"
FT   CDS_pept        499589..502429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="DET0546"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by similarity to SP:O34863; match to
FT                   protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:DET0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40164"
FT                   /db_xref="GOA:Q3Z909"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z909"
FT                   /protein_id="AAW40164.1"
FT                   /translation="MAQEYIKIKGAREHNLKNIDVQIPRDKLVVVTGLSGSGKSSLAFD
FT                   TVYAEGQRRYMESLSSYARQFLGRMEKPDVDHIEGLSPAIAIDQKGVSHNPRSTVGTVT
FT                   EIYDYLRLLFARTGHPHCPECGKEISAQSVEQITDAVQTLAEGTKILILGPLVRGRKGE
FT                   YAQMFKDLRKSGYARVRVDGQIRDLSEEIELDKNKKHDIEAVVDRLVVGQAGVQGRIAD
FT                   SVETALKLGGGLVIISVVDGQDMLFSEKFSCADCGVSLGEIEPRTFSFNTPHGACPTCM
FT                   GLGAKMELDPDLIIPDKSLSLADGAISPYQTQNWYFGQLEDLARRAGFSVNKPVSTFTP
FT                   AQMQVLLYGEGGDIHKYRNRYGRVREYTSGFEGVIPRLDRLYRDSESQGVRESIEKYML
FT                   ASPCQACGGKRLRKEALSVKIGELNIADVAAMSVDEQLKWANELAGKHTIFNKREQLIA
FT                   AQILKEIRSRLGFLNNVGLEYLTIDRIAGTLSGGEAQRIRLASQIGSGLMGVLYVCDEP
FT                   TIGLHPADDTRLVETLQKLRDLGNTILVVEHDESVMRAADYIIDMGPGAGEHGGRVVAT
FT                   GNITEIMQNPASLTGQYLSGARVIPVPEKRRNGNGQEIIIQGARQNNLKNIDVHIPLGK
FT                   LVCVSGVSGSGKSTLVTDILFKHLAQVFYGAKDRAGGSDAITGTEHIDKIIEINQSPIG
FT                   RTPRSNPATYTGAFTHIRELFASVPEAKVKGYGPGRFSFNIKGGRCETCGGEGSIQIEM
FT                   QFLPDVTVPCEVCHGARYNREVLEIKFKDKTIADVLDMTVDRALEFFENFPKISSKLQT
FT                   LQDVGLGYIRIGQPAPTLSGGEAQRIKLATELSKRATGRTLYILDEPTTGLSFEDVAAL
FT                   LRVLQRLVDSGNTVVVIEHQLDVIKNADWIIDLGPGAGVKGGQIVAEGVPEDVALNKAS
FT                   LTGKYLRRVLPKLKPA"
FT   gene            502495..503046
FT                   /locus_tag="DET0547"
FT   CDS_pept        502495..503046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0547"
FT                   /product="HDIG domain protein"
FT                   /note="identified by match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:DET0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40163"
FT                   /db_xref="GOA:Q3Z908"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z908"
FT                   /protein_id="AAW40163.1"
FT                   /translation="MDRQLALAEVEKRIENKNLVKHMLAVEAVMKSLAAYFGENEDEWA
FT                   LAGLIHDIDLGEVKDDMSLHSKRGAEIAAGLGASEDVCRAILVHNSAHGILPESRMEKA
FT                   LFCSDPITGLITAAALVRPDKKLACVEAKSVSKRFKEKSFAAGANREQIAACSDLGLEL
FT                   DEFIRISLGAMQAVASDLGL"
FT   gene            503156..503359
FT                   /locus_tag="DET0548"
FT   CDS_pept        503156..503359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0548"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40162"
FT                   /db_xref="GOA:Q3Z907"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z907"
FT                   /protein_id="AAW40162.1"
FT                   /translation="MILRTRIKELRARYNLTQAELAETVGVSRQTMLYLEKGTYNPSLI
FT                   LAHKVAKALHADIDDVFILRDV"
FT   gene            complement(503356..505935)
FT                   /locus_tag="DET0549"
FT   CDS_pept        complement(503356..505935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0549"
FT                   /product="exonuclease SbcC, putative"
FT                   /note="identified by similarity to SP:P13458"
FT                   /db_xref="EnsemblGenomes-Gn:DET0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40153"
FT                   /db_xref="GOA:Q3Z906"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z906"
FT                   /protein_id="AAW40153.1"
FT                   /translation="MIPVKLKIKNFMCYRGEIPPFSFNGVHTACICGQNGAGKSALIDA
FT                   ITWALWGKSRAKSDDDVVSLNEQEAEVSLDFEISGELYQVIRQRQRPKKAGANGQSLLS
FT                   LFAIKDGKPLNITGDTLTQTEKKIISILHMDYDTFINSAFLRQGHANQFTQQPPGKRKE
FT                   VLSNILGLEIYDQLEDLARQAVREAEAKKLLIEQSIADGQEGLKSRPELEETLKNTRLD
FT                   LTDGEEKLKTHLAKLEILRHKKHAFDAKQSACLQIEKDLRDISKDQSLWLQNQQEIKER
FT                   ISTFETLIAQEEAILKGYKEYSDCQSLYEKHNRILAKLRQLEKEKKPLEDAVYKEENSL
FT                   KNTLTKYQEHLKMRQETAQTLGTLEQEKTLSDQLHLELENEETALKARQTRLADMQGSL
FT                   AGLETEYAGTAREINSLEEKLKLLTEAGESRCNCPLCETELGHDKLKLVFGKYRTEQDA
FT                   KEKQQSSLKLKLEQLRLDIQTLTAQIETETKRLNQKRRQYEGQLSVLEKGIADAKDAGT
FT                   KAAKGRELISDIEKQLNQRSYAVSEQASLAVIEKEIQELNFDNAEYTQNQQTLAGLTHF
FT                   EEQKRKLDDAQSRLPREKDSLEKTASALAELTARHNTKLSEQQTLQRELAELPALEQEL
FT                   ETAEAGYKSLSQTQDTLRQQLGSLSQKEEQLNELEKKLKKQEQDKEQTAKEIYYFGKLA
FT                   RAFGKKDGIQTMLIEDTLPELESGADLLLSRMTDGRMHLSIETQRSTKKGDQTETLDIN
FT                   ISDELGTRNYETFSGGEAFRIDFAVRIALSRLLANRLGAPLRTLIIDEGFGTQDSTGIE
FT                   RLKEAINSIQDEFDKILVITHIDDLKDSFPTRIEIDKTPSGSAIRLN"
FT   gene            506011..506130
FT                   /locus_tag="DET0550"
FT   CDS_pept        506011..506130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40152"
FT                   /db_xref="GOA:Q3Z905"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z905"
FT                   /protein_id="AAW40152.1"
FT                   /translation="MEYPLILHNPVNTDKKPLPFGARAAFGYEWVWRLFQIIF"
FT   gene            complement(506110..507672)
FT                   /gene="rpoD"
FT                   /locus_tag="DET0551"
FT   CDS_pept        complement(506110..507672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="DET0551"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by similarity to SP:P06224; match to
FT                   protein family HMM PF00140; match to protein family HMM
FT                   PF04539"
FT                   /db_xref="EnsemblGenomes-Gn:DET0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40151"
FT                   /db_xref="GOA:Q3Z904"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z904"
FT                   /protein_id="AAW40151.1"
FT                   /translation="MPAEKDKKEFSPDDTYDDKDIEDGLEDIHEEQDAEAENDKMAEPD
FT                   LKDIADTDIPAELTEEELAAEADMMPDTDEEIGPLNIDLEIPLEQIDTQGIVDDPVRMY
FT                   LHEIGRVPLLSAEDEKTLAKKMEEGKRIREIRQECLEKRGRYPSAAESFLCMLRELSQA
FT                   TEVLFQLGQELGMDTSASLKNVIHDPKLRTAIDHEIDQQLTKNISDNTGKSMAEIEQSF
FT                   INLAINSSLLPKVILDAIPEKMTIPEIATYTNDPAFISHLERHEASLKYYLDNLEIDAK
FT                   RAERHLIQANLRLVVSVAKKHIGRGMPLLDLIQEGNIGLIRAVEKFDFHRGFKFSTYAT
FT                   WWIRQAITRAIADQARTIRIPVHMVETINKLLSISRQLSQKLGREPTPDEIAVEMDLPP
FT                   EKVREIAKVSQLPVSLESPIGEEEDSHLGDFIEDQNALAPPDAASRQLLKEQIDTVLGS
FT                   LTPRERRVLQLRFGLEDGRSRTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKD
FT                   YLE"
FT   gene            complement(507673..509445)
FT                   /gene="dnaG"
FT                   /locus_tag="DET0552"
FT   CDS_pept        complement(507673..509445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="DET0552"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:DET0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40150"
FT                   /db_xref="GOA:Q3Z903"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z903"
FT                   /protein_id="AAW40150.1"
FT                   /translation="MNDAVEEIKQKLDIVSFIGQYTKLTKAGRTMRGICPFHSEKHGSF
FT                   FVYPEAQNWHCFGACNTGGDIFAFVMKKEGLDFKGALELLAEKAGVSLPSQINPQIRDQ
FT                   RERLYEINLAAAQYYHNLLLNSPQAESARSYLKSRGLNEQSLADFQLGYALPEWQGLYD
FT                   YLKERSYTDEDLLKAGVIVRSDEGRIHDRFRNNIIYPIANYKGQIAGFGARVMDNSQPK
FT                   YRNSPQTDLFNKSSLLYGLHLASASIREKNQAIIVEGYMDAIMSHQGGFTNTVACMGTA
FT                   LTDRQIALVKRQTKHLILGLDADSAGEEATLRAIDYENQIESEIRVAVPEGGKDPDEII
FT                   RHAPQTWQEILDNARPLLDYIFEHSQKGLDLSSAAGKAGLTDRLLPIISKMEDGVRQSH
FT                   YLGKLAEMVSTSQNRILERMKKLKNETRITKVLEKEAPSKTVSAAKNPALEEYALSLLF
FT                   KSPELSRFAGKLHPEYLEIPQYRELLAVYSQSAEKDNLRAALDENLREYYDNLMNKNPA
FT                   NDNIEDKFYDLCLRLRERYLRNLAVKLNQALNEISQPETAEYQTLNDQCVKVNEELRSV
FT                   FSLKDRRNQKQRRQ"
FT   gene            complement(509447..510484)
FT                   /locus_tag="DET0553"
FT   CDS_pept        complement(509447..510484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0553"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase,
FT                   putative"
FT                   /note="identified by similarity to OMNI:NTL01TT1634; match
FT                   to protein family HMM TIGR01353"
FT                   /db_xref="EnsemblGenomes-Gn:DET0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40149"
FT                   /db_xref="GOA:Q3Z902"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z902"
FT                   /protein_id="AAW40149.1"
FT                   /translation="MISELRIRERIEAREESLSPYAVKSRLSRGRQKAEDPDPVRTCFQ
FT                   RDRDRIIHSKAFRRLKHKTQVFIAPLGDHFVTRLTHTLEVTQIARTIARALNLNEDLTE
FT                   AICLGHDLGHTPFGHAGEEVLNELYPKGFHHNEQSLRVVDRLEKNGQGLNLSWEVRDGI
FT                   LNHSKSRSNILGEAHNKAATFEGQICRIADAVAYINHDILDSIRAGIIKANDLPLGAVS
FT                   VLGNSHSQRINTMVCDIIKSSWSCTGLIPGAEPEVTMSNKVLSASNTLRDFLFEQVYQS
FT                   KDRKAEHEREIVRLLYKYLVDHQDLLPMEYIALSDKPEQRVVDYIAGMTDLFALRLAKE
FT                   LNLAE"
FT   gene            complement(510481..512757)
FT                   /gene="ppsA"
FT                   /locus_tag="DET0554"
FT   CDS_pept        complement(510481..512757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="DET0554"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM TIGR01418"
FT                   /db_xref="EnsemblGenomes-Gn:DET0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40148"
FT                   /db_xref="GOA:Q3Z901"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z901"
FT                   /protein_id="AAW40148.1"
FT                   /translation="MQKGHEAIVWFNEVTKNDIPLVGGKGANLGEMTGAGIPVPPGYIV
FT                   TANAYFDFINSSNLRPSISKALESLDINDSKQLAVVANSVKEMIMATPLPTELASQIKA
FT                   AYEKMGQGLVAVRSSATAEDLPEASFAGQQSTYLNIEGGDEVVEAVQKCWASLFEARAI
FT                   YYRVQQNFDHLQVGIAVPVQKMVQSQASGVCFTIEPITSDPTKIVIEAIYGLGEGLVSG
FT                   EITPDLYIIDKEGPAVLSRTISHQERRLVRKNGNSASGPEDESGNNYWQPVPSTKQEQQ
FT                   KITEDDIITLAKLAMLIEKHYNGPQDIEWAKEENTIYIVQSRPVTALKDASELEPEIEA
FT                   PIMLQGAAASPGLATGEVKVLQDPSEIDLVLQGDILVAEMTTPDFVPAMKRAAAIVTNR
FT                   GGRTSHAAIVSRELGIPCVVGTGEATRLLKNEQIITVDGTHGKVYNGKVTRNVKTSNIA
FT                   SIVREAIRTKTRVYVNLAQPELADKVAARNVDGVGLLRAEFIFSQIGKHPRYMIEMGQQ
FT                   EEYIQQVYEGVLSFAKAFHPRPVVYRTNDFKTNEYRDLLGGDKYEGQEENPMLGYRGVS
FT                   RYIKDIEVFKMEIEAIKRVRKDYPNVYVMLPFVRTVDELKKVKQILEDEGLKRGPDFKL
FT                   WMMVEVPSNIFLIDKFIDAGIDGISIGSNDLTQLILGVDRDSEMLRETFDERNEAVLVA
FT                   LEKAVTTAARRGITASICGQAPSVYPELTEKLVSWGITSVSVSPDMIGTTREIIAKAEA
FT                   KLKIK"
FT   gene            513056..513484
FT                   /pseudo
FT                   /locus_tag="DET0555"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   OMNI:NTL02SC1304; match to protein family HMM PF02577"
FT   gene            complement(513481..513648)
FT                   /locus_tag="DET0556"
FT   CDS_pept        complement(513481..513648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0556"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40147"
FT                   /db_xref="GOA:Q3Z900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z900"
FT                   /protein_id="AAW40147.1"
FT                   /translation="MPGCTNTFQDLRLSKSSRSRLSTKSRKADSLLISSSLALRVFSPL
FT                   PPAGGSGKSI"
FT   gene            513683..513916
FT                   /locus_tag="DET0557"
FT   CDS_pept        513683..513916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40138"
FT                   /db_xref="GOA:Q3Z8Z9"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Z9"
FT                   /protein_id="AAW40138.1"
FT                   /translation="MRFEAVMNKWGTGLQYLGLGWYIALVILLGTLGGRWLDQALGLSP
FT                   LFLLIGLLSGVFLAFYGVYRLLPKITNNGKGN"
FT   gene            513919..514863
FT                   /gene="atpB"
FT                   /locus_tag="DET0558"
FT   CDS_pept        513919..514863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="DET0558"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:DET0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40137"
FT                   /db_xref="GOA:Q3Z8Z8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Z8"
FT                   /protein_id="AAW40137.1"
FT                   /translation="MPKKKILGMPKAVFWPVMIVILAMLVVGFLSGPIGVALFGDLGFP
FT                   DWMKITTPKPELPSAEIFSIGPVAITNTILTAWVTILVLVGLSIAATRKMKLIPGRLQG
FT                   ALEMVLSWIYNMCVDAAGEKFGRKFFPLVATIFLFIIVNAWMNLLPGYNTIFIELGNGH
FT                   EAHLLRGANTDINLPLALAAITFVMVEYWGIKTLGGFHYLSKFFNFKPLINAFRHKEGV
FT                   IGIFNGFITIFVGLLEFFLEFVRIISLTFRLFGNMIGGEILILMITFLAPFIIGIPFYG
FT                   LEMLVGFVQALVFCNLALVFSLIAVTPHGEENH"
FT   gene            514904..515134
FT                   /gene="atpE"
FT                   /locus_tag="DET0559"
FT   CDS_pept        514904..515134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="DET0559"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:DET0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40136"
FT                   /db_xref="GOA:Q3Z8Z7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z7"
FT                   /protein_id="AAW40136.1"
FT                   /translation="MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKG
FT                   SIFTNMILLVAFAESIAIFALVISIVLIFVA"
FT   gene            515159..515668
FT                   /gene="atpF"
FT                   /locus_tag="DET0560"
FT   CDS_pept        515159..515668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="DET0560"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:DET0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40135"
FT                   /db_xref="GOA:Q3Z8Z6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z6"
FT                   /protein_id="AAW40135.1"
FT                   /translation="MEKLAELGINIPSFIAQVVNFGLLLGLLYLFAYKPILAKLDERSA
FT                   RIKESMERTDQVKEQAQRAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEARAE
FT                   AEAMLSRARTEIRQERDEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENS
FT                   TNLRKN"
FT   gene            515689..516231
FT                   /gene="atpH"
FT                   /locus_tag="DET0561"
FT   CDS_pept        515689..516231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="DET0561"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:DET0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40134"
FT                   /db_xref="GOA:Q3Z8Z5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z5"
FT                   /protein_id="AAW40134.1"
FT                   /translation="MAKRVYAIAMRYAQALYELAKEQKSLDKWQEDLQDLSSLTEDASV
FT                   AEFLSNPKIASARKHKVLAKLSNIDPLMLNLVDMLVATRRLGIMRAVSGEYNRLLNEAR
FT                   GVEDAIVTTAKPSSEADIEIIRQQLSKITGKKINVVTATDPGLIAGLKARIGDKLIDGS
FT                   VSRRLVLLQNEISQGRI"
FT   gene            516254..517765
FT                   /gene="atpA"
FT                   /locus_tag="DET0562"
FT   CDS_pept        516254..517765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="DET0562"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02874;
FT                   match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:DET0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40133"
FT                   /db_xref="GOA:Q3Z8Z4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z4"
FT                   /protein_id="AAW40133.1"
FT                   /translation="MSARGQDIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLS
FT                   NAKYNELLEFPGGVMGIALNLEEDSVAAVILGDDANIKEGDEVKATGRISEITVGKGMI
FT                   GRVVDPLGRPLDGKGPIKAETVRPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQ
FT                   RELIIGDRSTGKTAIALDTIINQKGGDLVCIYVAIGQKASKVARTVALLEQYGAMEHTI
FT                   VVAANSSDAVALQYLAPYAGCAIGEEFMEQGQDALVVYDDLTKHAWAYRQLSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNDKLGGGSLTALPIIETQAGDVSAYVPTNVISITDG
FT                   QIYLEPDMFNSGIRPAVNVGISVSRVGSSAQTKAMKKVASKLKMDMGQYRELAAFAQFG
FT                   TSELDKATRMQLERGQRITEVLKQGQYQPVPMANQVAILYAALNGYLDSVEVAKVRDFE
FT                   SGLYRFLEANFASVLNNITKENAISAETETALKTALDDYKKGLVV"
FT   gene            517790..518647
FT                   /gene="atpG"
FT                   /locus_tag="DET0563"
FT   CDS_pept        517790..518647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="DET0563"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:DET0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40132"
FT                   /db_xref="GOA:Q3Z8Z3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z3"
FT                   /protein_id="AAW40132.1"
FT                   /translation="MANIRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRPY
FT                   SEKITEVIAALAALPQSGEILHPLLERRPVKKIAVLHITPDRGQCGGLVANINRKTGTF
FT                   MLEQKIPVSAVVVGRKGVDFIRRIKQQMRAEFINLGDRPGYLDTLPISRVIMDDFMSGE
FT                   IDQVFIAYTQFVTTAVQKPVLEQLLPVVPLELPPGQNLEYIYEPESATVLNSLLPRFVE
FT                   MSVYHAILESIASEQSARMVAMRNATDNAKELIGELTLVYNKARQESITNELLDIVGGA
FT                   AALA"
FT   gene            518663..520057
FT                   /gene="atpD"
FT                   /locus_tag="DET0564"
FT   CDS_pept        518663..520057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="DET0564"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:DET0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40172"
FT                   /db_xref="GOA:Q3Z8Z2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z2"
FT                   /protein_id="AAW40172.1"
FT                   /translation="MANGKVIQVIGSVVDVEFSADSMPALFNALEIPRDNGKMVLEVQS
FT                   HVGNNRVKCLSFTPTDGLERGAEVIDTKRPLSVPVGRNTLGRIFNVLGEPLDNRGDVKA
FT                   EKTMPIHRSAPAMDELESSAQVLETGLKVIDLIAPFARGGKIGALGGAGVGKTVLIQEL
FT                   IRNIATEHEGFSVFAGVGERSREGNDLWHEMEDSGVLPKTTMVFGQMNELPAVRLRIAL
FT                   TGLTMAEYFRDEERQDVLLFIDNIYRYTLAGMEVSALLGRMPSAVGYQPTLATEMGALQ
FT                   ERIASTKQGSITSFQAVYVPADDYTDPGVVATFGHLDAMIALERSLAEQALYPAVDPLA
FT                   SNSRILDPQVVGEEHYQVARDVQKVLQRYKDLQDVIAILGMEELSEEDKLTVARARRIQ
FT                   RFLTQPMFVSEVFTGRPGQYVSLAETIRGFKEILEGKHDSLPEQAFYMVGTIDDAVAEA
FT                   KKLSAA"
FT   gene            520082..520504
FT                   /gene="atpC"
FT                   /locus_tag="DET0565"
FT   CDS_pept        520082..520504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="DET0565"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00401;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:DET0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40171"
FT                   /db_xref="GOA:Q3Z8Z1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z1"
FT                   /protein_id="AAW40171.1"
FT                   /translation="MAKLKLDIVTAERSVFSEEVDLVVAPGIEGEMAILPHHAPLMTAL
FT                   QAGELKAKIGSEEYSMVVSGGFLEVRPDRVIVLADSAERAEEIDIARATEAKKRAEARM
FT                   ADKYEPGMLAAETEASLRRAMIRLKVAEKRRKRPSV"
FT   gene            complement(520575..521078)
FT                   /gene="rimM"
FT                   /locus_tag="DET0566"
FT   CDS_pept        complement(520575..521078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="DET0566"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by similarity to SP:P21504"
FT                   /db_xref="EnsemblGenomes-Gn:DET0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40170"
FT                   /db_xref="GOA:Q3Z8Z0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Z0"
FT                   /protein_id="AAW40170.1"
FT                   /translation="MTQEEEYILIGKVLGVWGINGGLKIEVLTDFPERFDAGNELLIGR
FT                   APYTISQTSWQKAQVIVHLSEITGIDAAEELSGAQVEIPAAALKKLPKGVYYDFQLIGL
FT                   EVTDLSGNRIGQIKEILHMPSNDIYVSSYGAKEALIPAVKDVVKEINLQKGQVIIDPIP
FT                   GLLD"
FT   gene            complement(521166..521393)
FT                   /locus_tag="DET0567"
FT   CDS_pept        complement(521166..521393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8XJP5"
FT                   /db_xref="EnsemblGenomes-Gn:DET0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40161"
FT                   /db_xref="GOA:Q3Z8Y9"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y9"
FT                   /protein_id="AAW40161.1"
FT                   /translation="MKELVEYIAKSLADEPNDVVVTEEPEEEGIKLTLKVADVDKGRII
FT                   GKQGRIAQAMRTLIRVKAAKAGKRARLEIL"
FT   gene            complement(521409..521657)
FT                   /gene="rpsP"
FT                   /locus_tag="DET0568"
FT   CDS_pept        complement(521409..521657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="DET0568"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:DET0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40160"
FT                   /db_xref="GOA:Q3Z8Y8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Y8"
FT                   /protein_id="AAW40160.1"
FT                   /translation="MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNP
FT                   ETVVINAEKALYWIGKGAQPTDTVARLLKKAGVVNSN"
FT   gene            521809..522474
FT                   /gene="nfi"
FT                   /locus_tag="DET0569"
FT   CDS_pept        521809..522474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="DET0569"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="identified by match to protein family HMM PF04493"
FT                   /db_xref="EnsemblGenomes-Gn:DET0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40159"
FT                   /db_xref="GOA:Q3Z8Y7"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y7"
FT                   /protein_id="AAW40159.1"
FT                   /translation="MKIKKLHDWDMTPSQAIALQRELAQKVSVCGTLPDIHLVAGADVW
FT                   HSRTSGMGRAAVVVLSYPDMQLVEVSRSEGHCHFPYIPGLLSFREMPLLLSAFEGLENI
FT                   PDLILMDGQGLAHPRRLGIASHLGLFLNKPVIGCAKSRLIGEYTALDESAGSFSDLYHN
FT                   TELIGRVMRTRQGVNPLFISVGHKICLEEACSMVAECCRGYRLPEPTRQAHLAAAELI"
FT   gene            522589..523678
FT                   /gene="prfB"
FT                   /locus_tag="DET0570"
FT   CDS_pept        join(522589..522645,522647..523678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="prfB"
FT                   /locus_tag="DET0570"
FT                   /product="peptide chain release factor 2, programmed
FT                   frameshift"
FT                   /note="identified by similarity to GB:CAB15546.1; match to
FT                   protein family HMM PF03462; match to protein family HMM
FT                   TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:DET0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40158"
FT                   /db_xref="GOA:Q3Z8Y6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y6"
FT                   /protein_id="AAW40158.1"
FT                   /translation="MQDILSELKSRILSDMVRLDIAAKELEITELESASASPDFWQDQQ
FT                   NAQKAMKKLAANKRVSEVWRGLEQRVNDLLELFALTHEDPSLGNEIEREVNTLTAEIDT
FT                   LEVGLAFSGQYDSRNALLTVHAGAGGVESQDWAGMLLRMFMRWAEKKGFGMEVLDQSPG
FT                   EEAGIKSATLQIEGEYAYGFLKSEHGVHRLIRLSPFDADHARHTSFALVEVMPEAEDSV
FT                   DIDIKPEDIKIDMFRSSGPGGQNVQKVSTAVRVTHIPSGIVVASQTERSQHQNREIAMR
FT                   ILASKLLAVEIAKRAEERAKIKGERISAEWGNQIRSYVLHPYKMVKDHRTDYEVGNAEA
FT                   VLEGELDGFINAYLRQNIGREE"
FT   gene            523675..524901
FT                   /locus_tag="DET0571"
FT   CDS_pept        523675..524901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40157"
FT                   /db_xref="GOA:Q3Z8Y5"
FT                   /db_xref="InterPro:IPR039568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y5"
FT                   /protein_id="AAW40157.1"
FT                   /translation="MKRHLLALGLMLGMLLGGLFPVSLSAQSSISIDRNNTSITFPSSI
FT                   GFSITASSTSNITDIRLYYTVERKSFAQIYSEFVLEVTPALSVSASYSWDMRYTGGMPP
FT                   GARVNYWYRITNEDGDILISPIQTLVYNDTRFDWQSISEGMLEIYWYEGDQAFAEELME
FT                   SAQAALVRLAADTGAELKDKVTLYIYANSSDLQSAMVFPAEWTGGVAYTDFNVIAIGIA
FT                   SYDIDWGKRAITHELAHKVTGQITSNPYGDLPVWLNEGISMYAEGNLEAVYVNYLIWAI
FT                   NQDKLISVQSLCSPFSANSADAYLSYAESFTLVNYLITNYGSEKFSDLLETFSHGAGYD
FT                   EALLAVYGFDIQGLNTKWQAALKDGTIEIQPVRAIMLTPGLVVLFTIVGGGSIITAFWL
FT                   WSSRVASRT"
FT   gene            524903..525571
FT                   /locus_tag="DET0572"
FT   CDS_pept        524903..525571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0572"
FT                   /product="DNA repair protein, RadC family"
FT                   /note="identified by match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:DET0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40156"
FT                   /db_xref="GOA:Q3Z8Y4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y4"
FT                   /protein_id="AAW40156.1"
FT                   /translation="MRDLPLAERPRERLQSLGAGVLSSAELLAVILGRGVAGEPVLQSA
FT                   QRLLTHFGGPSGIASASVEELLKLKGIGLAKACQLKAAFELAKRAGGIKAEYQPCIKTP
FT                   EDVFQIIYPLVCDEKKEHFFCLMLDVKSKLIRVGHISAGSLDESVVHPREVFKEALSAS
FT                   AATVILAHNHPSGESEPSPDDIGLSARLREAGGIMGIEVLDHVIIGGQTFTSLKRQGLL
FT                   "
FT   gene            525574..527166
FT                   /locus_tag="DET0573"
FT   CDS_pept        525574..527166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0573"
FT                   /product="oligopeptide-binding protein, putative"
FT                   /note="identified by similarity to SP:P23843"
FT                   /db_xref="EnsemblGenomes-Gn:DET0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40155"
FT                   /db_xref="GOA:Q3Z8Y3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y3"
FT                   /protein_id="AAW40155.1"
FT                   /translation="MKKILFAIFSVCLSFSLVLSGCGYAPDDSTMPAGDNVLTLIGEEP
FT                   YTLDPAKVSDTTSVAYIYQIFSGLIKMGDDLTPVADIAESWEVSPDGLTYTFHLKPNVK
FT                   FHNGRVVTAADFKYSWERAASPETGSSTALTFLGDIEGVKEMTEGQASSISGVTVVDEL
FT                   TLRVKLVSACSFFLSKLSYVTSFVVDKNNVSSGSDWWKKPVGTGPFMLTELTQGNYIIL
FT                   DRNPDYYDTPAKISSVIFRLQSGQPMDLYEVGGVDVAGVGADYLAKATDPDGIFASDLQ
FT                   VIPQLGFYYFAFVTSKAPFDDPKIRQAFSMAVDKSRIIELVYKGSVSAAEGILPPGIPG
FT                   YNPDITGLEYDPARALELIAESSYGSVENLPVITLTTSGWGGLITAELEAVIDQWRQNL
FT                   GVEVVVRQIDNEMFFYDLQAEKDNIYYSGWVADYPHPQDFLAVLFGTGSAYNNGDYSNP
FT                   EVDALLAEAAATLDTEESMRLYAQAEQILINDAACLSFCFGESYILVKPYVKGYKLNAM
FT                   GVPVLTGVTIEDH"
FT   gene            complement(527290..527379)
FT                   /locus_tag="DET_tRNA-Ser-1"
FT   tRNA            complement(527290..527379)
FT                   /locus_tag="DET_tRNA-Ser-1"
FT                   /product="tRNA-Ser"
FT   gene            complement(527537..527821)
FT                   /locus_tag="DET0575"
FT   CDS_pept        complement(527537..527821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40154"
FT                   /db_xref="GOA:Q3Z8Y2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y2"
FT                   /protein_id="AAW40154.1"
FT                   /translation="MRSRYPVLQFIIIVLKILAVLIALAGLVMSIYVMTGQSVTFFEIA
FT                   SSFSVFAGIMGILGSLITGVLIFASAELMQCLIDIERNTRKTARLLNTN"
FT   gene            complement(528044..529195)
FT                   /locus_tag="DET0576"
FT   CDS_pept        complement(528044..529195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0576"
FT                   /product="aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:DET0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40146"
FT                   /db_xref="GOA:Q3Z8Y1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8Y1"
FT                   /protein_id="AAW40146.1"
FT                   /translation="MLSAKKRTVLLEIKPFELERYFARHEFSARYLMSSSDCEPLALSA
FT                   LLALADTECRSLWQNLKLGYTYSDGHPLLRNEIAKLYQITAPADILTAVPEEGIFIALN
FT                   CLLKKGDHVICTFPGYQSLYQLAETLGCEVSYWIPEEENRWRFNPDFLAQNIRPNTSLV
FT                   ITNFPHNPTGAMPDREDYARILEIINQHNLWHFSDEMYRLMEYAPDTRLPAACDQSSKA
FT                   VSLGGLSKSFGLPGLRSGWLACRDEDMLSKMAGFKDYTTICGSATDEILSVIALRNKQT
FT                   IISSQLNRLNQNLTLLEDFMGRHKTDFIWVKPKAGSVCFPRLNKNSLCMDFCRQVLAKA
FT                   GIMLLPSEVYGYGQNHFRIGFGRADFPEVLQVFEDYITANSTL"
FT   gene            complement(529182..530423)
FT                   /gene="serS"
FT                   /locus_tag="DET0577"
FT   CDS_pept        complement(529182..530423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="DET0577"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:DET0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40145"
FT                   /db_xref="GOA:Q3Z8Y0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8Y0"
FT                   /protein_id="AAW40145.1"
FT                   /translation="MLDLKFIRENTELVRKAVAARNTDAPIDEILELDSCRRTLSQELD
FT                   TLRAKRKIIAKQRDEAAIEEGRVLRGRISELETGLSEVEEKLTDRLLRVPNIPDASVPV
FT                   GKDESENVVLYYRGEKRNFSFTPKPHWELGEALDIIDFDRGIKLSGSRFYILKGEGARL
FT                   QRALIAFMLDLHTRKHGYTEIYPPYMIKRECLVASGNLPKFADNLYHDAEEDYWWVPTA
FT                   EAPLTNLHRDEILSVEQLPIHYVAYTACFRREKMSAGKDVRGIKRLHQFDKVELYKYCK
FT                   PEDSFDELEKMVADAEEIADALKIPYRLKQLVTADISFGSAKSYDIEMYSPGVDEWLEV
FT                   SSCSNCTDFQGRRANVRFRRTPEAKPEFVHTLNGSGLALPRVMISVIENYQLPDGSIVV
FT                   PEVLRPFMGVDAIC"
FT   gene            complement(530455..531951)
FT                   /gene="lysS"
FT                   /locus_tag="DET0578"
FT   CDS_pept        complement(530455..531951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="DET0578"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:DET0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40144"
FT                   /db_xref="GOA:Q3Z8X9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8X9"
FT                   /protein_id="AAW40144.1"
FT                   /translation="MPEEYLNAQKMEKLERIKSRGINPYPATFHPSHTSVQAVALLAEL
FT                   EKQENPPKEILRIAGRIMTLRDMGKISFMDIRDGSGKIQVFCRQNDLDEASIELLKDLD
FT                   LGDFIGAEGSLMRTRTGEPSLAATKISLLSKSLLPLPEKWHGLQDVEKRYRQRYLDLIS
FT                   NADARQTFLTRSQVISAIRSFMSSKGFLEVETPVLQPEAGGALARPFITHHQALDCDFY
FT                   MRIALELHLKRLIVGGFDRVYEIGRIFRNEGVSTRHNPEFTMMESYQAYADYKDVMDFL
FT                   EEMVSSVVKEISGGYTVPFGDTTLDFTPPWPRLSMRDAVKQYAGIDFFDFPTKEALAAE
FT                   MIRRKLKVDPAKDWGKLVDELVGEFVEPRLIQPTFLTDHPVAMSPLAKQKPEDPRLTER
FT                   FEAICANMEIANAFSELNDPVEQRARFKEQLEKRNQLRTEESESIDEDFLAALAYGMPP
FT                   TGGLGVGIDRLVMLLTNHDSIREVILFPALKDREDKGEQE"
FT   gene            532182..532352
FT                   /locus_tag="DET0579"
FT   CDS_pept        532182..532352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40143"
FT                   /db_xref="GOA:Q3Z8X8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X8"
FT                   /protein_id="AAW40143.1"
FT                   /translation="MDVSESIIPIIVGIVQVVFIVVLLALGIYSFRNHYSKKHLDTKDI
FT                   PAEESREDLFF"
FT   gene            complement(532376..533137)
FT                   /gene="recO"
FT                   /locus_tag="DET0580"
FT   CDS_pept        complement(532376..533137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="DET0580"
FT                   /product="recombination protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:DET0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40142"
FT                   /db_xref="GOA:Q3Z8X7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8X7"
FT                   /protein_id="AAW40142.1"
FT                   /translation="MTKPHDFKTRAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVRK
FT                   TKSKLSGHLELFCYSEVSLARGKAIDTVTGSQTIQSFLNIRSSLQLSAMAFYVCELAFH
FT                   FSPEESANPAIFQLLLSTLEELDNTTQAELCTKYFEIHLLEMSGYKPELRECANCHQKL
FT                   LATTNYFSPESGGIICPDCRNTQTGIPISVNAVKVLRYIQENDIPNIYRLKINREILSE
FT                   LELAIRANIRFVLEKEPKALLWLDSLSRANL"
FT   gene            complement(533267..533989)
FT                   /locus_tag="DET0581"
FT   CDS_pept        complement(533267..533989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40141"
FT                   /db_xref="GOA:Q3Z8X6"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X6"
FT                   /protein_id="AAW40141.1"
FT                   /translation="MSDTNIRIEYNTLINRLKSLANADNVAGMARFGISSANTLGVSVK
FT                   DIRPLAKSAGHNHALALLLWDSGIHEARIMASLIAESKKVSQEEMESWVKDLDSWDICD
FT                   LCCNNLWSKTPFAYEQALAWTYRREEYVKRAGFVLLTALAVHDKKAADEKFISFFPRLL
FT                   AEASDERNYVKKAVNWALRQIGKRNLSLNQAAITLGQEILDLNTRSARFIATDALRELK
FT                   SPQVQKRLAIKQGKQPHR"
FT   gene            complement(533991..535055)
FT                   /gene="corA"
FT                   /locus_tag="DET0582"
FT   CDS_pept        complement(533991..535055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="DET0582"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="identified by similarity to OMNI:NTL02MA1674; match
FT                   to protein family HMM TIGR00383"
FT                   /db_xref="EnsemblGenomes-Gn:DET0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40140"
FT                   /db_xref="GOA:Q3Z8X5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X5"
FT                   /protein_id="AAW40140.1"
FT                   /translation="MTRQSKKYSQKAGMLPGSVVFIGEGKTEPASLSLSSYTPDAYQPL
FT                   PLKTLADCSTQVKQSGGIVWVKVSGLQDTAMVEELGKCFNLHPLTLEDVVNTEQRPKLE
FT                   DYGNYLFAVIKALHWDSELKKTRSEHISLILGKNFLISFQEHQSDIFNPIHQRLQSDNG
FT                   RIRKLGADYLLYSILDIIVDGYFSLIEGFGDYLDEIEEQLLSSPSSQTLKQISEAKKEM
FT                   LFIRKSIWPARETVAAIERSETPLIDKSSHIYFRDIYDHLIQQIDTGETYRDMLSNMID
FT                   IYLSSLSNRMSEVMKVLTIFASIFIPLTFIVGIYGMNFDIPELRFSWGYPGILLFMLAI
FT                   ALILVLFFKRKKWL"
FT   gene            complement(535094..535708)
FT                   /gene="recR"
FT                   /locus_tag="DET0583"
FT   CDS_pept        complement(535094..535708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="DET0583"
FT                   /product="recombination protein RecR"
FT                   /note="identified by similarity to SP:P24277; match to
FT                   protein family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:DET0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40139"
FT                   /db_xref="GOA:Q3Z8X4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8X4"
FT                   /protein_id="AAW40139.1"
FT                   /translation="MKDTSLPSTAGAVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEEQ
FT                   VLTLSDTIRSIKNQISQCRICFNVADSELCPICQNTKREANKICVVEQPQDILALEHVG
FT                   VYRGYYHVLHGAISPTEGITSQNIRINELMSRLNDGQVDEVILATNPTTEGEATAMYLS
FT                   RLITPLGIKVTRLARGLPFGTELEYADDVTLSRAMEGRQNF"
FT   gene            complement(535729..536028)
FT                   /locus_tag="DET0584"
FT   CDS_pept        complement(535729..536028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8RDI5"
FT                   /db_xref="EnsemblGenomes-Gn:DET0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40131"
FT                   /db_xref="GOA:Q3Z8X3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X3"
FT                   /protein_id="AAW40131.1"
FT                   /translation="MNMIKQAMELKSKLDKAQKELAKVIVETESAKGAIKIKMNGQQKI
FT                   LSLSISPDIINPSKPKDLENALTKAFNDAYEETKKEGSKQMQGLMGDVKIPGLM"
FT   gene            complement(536038..537717)
FT                   /locus_tag="DET0585"
FT   CDS_pept        complement(536038..537717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0585"
FT                   /product="DNA polymerase III, gamma and tau subunits,
FT                   putative"
FT                   /note="identified by similarity to SP:P09122"
FT                   /db_xref="EnsemblGenomes-Gn:DET0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40130"
FT                   /db_xref="GOA:Q3Z8X2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X2"
FT                   /protein_id="AAW40130.1"
FT                   /translation="MTCQVFYRKWRPQTLADLVGQEHVAHTLKNALSSGRIAQAYLFCG
FT                   PRGTGKTSTGRILAKAVNCTTNQGKGEPCNTCPMCLSITEGSSMDVIEIDAASNTGVDD
FT                   IRELKEKVQYAPALANYKVYIIDEVHMLSNSASNALLKTLEEPPPRVIFILATTEIHKV
FT                   LPTIMSRCQRFDFHRVSLSDMSRKLEKISQAEGINIEPEALKLIARSAGGSFRDGENLL
FT                   QQIATTYGTEISLPQVQAALGISGDERIKTLAENILKKDIKNGLQTLNAVVADGIDLKQ
FT                   FRRELLDYLRQIMLLNSGAEGSLELTADEKKALQKVSAITNLEGITKAIKAFSQLDFSS
FT                   DTASSLSFELALVDASLNPDTAPATIPPQAKLPAPKTEKPAVSNEPPQKEAKAEIQDKT
FT                   KNASEPAAASRTGAKESAPKLTRTAIPVEEKPKYTAPAPPKEEEKVLIGAGDVIEQLKV
FT                   SWKNILDQAPDNLKRSAAVAILRSAGVRPVSIEKNVVTLSFKYKYHKDKIEELENRKVT
FT                   AEIISNFVGRTCTLVCISEAETNHLVKEAQKLGAQIISVEEK"
FT   gene            complement(537774..537929)
FT                   /locus_tag="DET0586"
FT   CDS_pept        complement(537774..537929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0586"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40129"
FT                   /db_xref="GOA:Q3Z8X1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X1"
FT                   /protein_id="AAW40129.1"
FT                   /translation="MPEITYRVNKKRLKNTGCNRKTSRRLHPARILHPEYLPRLANQRG
FT                   FFIPCS"
FT   gene            complement(537963..538385)
FT                   /locus_tag="DET0587"
FT   CDS_pept        complement(537963..538385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01CA2954"
FT                   /db_xref="EnsemblGenomes-Gn:DET0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40128"
FT                   /db_xref="GOA:Q3Z8X0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8X0"
FT                   /protein_id="AAW40128.1"
FT                   /translation="MSENAKKILQMLSEGKITVDQANKLLEALGNEDSKPAPAAAITAK
FT                   GVPKYLRVIINGTDEDSNAKVNVRVPMALLRAGIKLASILPADATNEIDHNLKEKGVNF
FT                   DFKNLREEDIEPLIEAMTEMEVDVDSEGSKVKVFTE"
FT   gene            complement(538685..539059)
FT                   /locus_tag="DET0588"
FT   CDS_pept        complement(538685..539059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01TT1546"
FT                   /db_xref="EnsemblGenomes-Gn:DET0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40127"
FT                   /db_xref="GOA:Q3Z8W9"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W9"
FT                   /protein_id="AAW40127.1"
FT                   /translation="MAKDWQELTRLTQGATITVERVKLASSGIAIEGSFELPALARLSA
FT                   EDQVFVMAFVKCHGSIKDMEKFFGISYPTVKNRLQRIGANFSFVENFPTPPATNEDDNV
FT                   LAELEKGGISVDEALRRLQR"
FT   gene            complement(539264..540442)
FT                   /locus_tag="DET0589"
FT   CDS_pept        complement(539264..540442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0589"
FT                   /product="GTPase domain, tubulin/FtsZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40126"
FT                   /db_xref="GOA:Q3Z8W8"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W8"
FT                   /protein_id="AAW40126.1"
FT                   /translation="MKLIVIGLGQCGSRIADEFARMDKRARSQRNVSICPGVFAVNTDQ
FT                   ADLSGLVTIKPDHQHRILIGGRKTGGHGVGKINELGAEIARADADKVIDALRTTKRFYD
FT                   ADGFLVIAGAAGGTGSGSVSIIAQHIKERYMDKPVYALIALPFEHEEKTEERTVYNTAV
FT                   CLKSISSVADAVILVENQRYVRKDFSLRYNLSKINSLIVEPFWDLLCAGEEKNSKYIGA
FT                   KTMDAGDIIQTISGWTVIGHGKARVRTLTLPFDKTDHFRMKSVSNYKGIRAMDEAVSEL
FT                   SLKIDPRDAGRALFLISAPAKEINMDIIKEQGDWLREMAPNAIIRNGDYPREKDTMTVT
FT                   VIFSELSDLERVRYYYNRSTSMMPVIKQRQADLADRRRDIDELSRDIPSLLE"
FT   gene            complement(540536..541540)
FT                   /gene="gap"
FT                   /locus_tag="DET0590"
FT   CDS_pept        complement(540536..541540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="DET0590"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00044;
FT                   match to protein family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:DET0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40125"
FT                   /db_xref="GOA:Q3Z8W7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W7"
FT                   /protein_id="AAW40125.1"
FT                   /translation="MVTRIGINGFGRIGRITLRTINQYHRGELEVVAVNDLADNKSNAH
FT                   LLKWDSTYGKYPGTVESDDCSIIVDGKPIKVFSERDPMQIPWETAGVDLVIESTGLFTD
FT                   AAKASSHLRGSVKTVVISAPAKGEDITVVMGVNEEKYNCNTHRVISNASCTTNCVAPLI
FT                   KVLHDKFGVKKGFMTTCHAYTNDQKIQDMFHKDIRRARAAAVNVIPTTTGAAKAVALVL
FT                   PELKGKLDGISFRIPSASVSLVDFVGELARNVTVEEVNAAFKEAAQGKLAGILEYCEEE
FT                   LVSSDFKGNPASSIIDAPSTMVLDGNMVKVLSWYDNEWGYSTRLGDLIAYISK"
FT   gene            complement(541562..542581)
FT                   /locus_tag="DET0591"
FT   CDS_pept        complement(541562..542581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01CA3558"
FT                   /db_xref="EnsemblGenomes-Gn:DET0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40116"
FT                   /db_xref="GOA:Q3Z8W6"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W6"
FT                   /protein_id="AAW40116.1"
FT                   /translation="MKNNEHPKYIGITTTVPIEILLSAGYSPLDLNNIFVSDTNPDRLI
FT                   RLAEKDGFPLNCCAWIKGIYGVCLDKGISEVICVTSGDCSNTQMLREVLNLKGICTIPF
FT                   DFPTEPNPAEVKASLSKLALRLGTTLEAAEEWRKTLSPARELAHRLDYLCYAENKVSGF
FT                   EDHYWLVSSSDFNSDYVKYQADLQKLLNTAENRTPYPPTELRLAYLGVPSVFGQELYPY
FT                   LEQNGARVVFNEIQRQFSLPKGGADISRSYTAYTYPYPMEYRLRDIRTQLTKRRIDGII
FT                   HYVQAFCHRAIGDIILRQKLPLPMLTLEGNADFHLNQHQKTRLEAFLDMLKAKKQINL"
FT   gene            complement(542595..542693)
FT                   /locus_tag="DET0592"
FT   CDS_pept        complement(542595..542693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40115"
FT                   /db_xref="GOA:Q3Z8W5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W5"
FT                   /protein_id="AAW40115.1"
FT                   /translation="MQPAAGENPPELHPQGKALKICQMPYGIKNFS"
FT   gene            complement(542721..544007)
FT                   /gene="eno"
FT                   /locus_tag="DET0593"
FT   CDS_pept        complement(542721..544007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="DET0593"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by similarity to SP:P37869; match to
FT                   protein family HMM PF00113; match to protein family HMM
FT                   PF03952; match to protein family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:DET0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40114"
FT                   /db_xref="GOA:Q3Z8W4"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8W4"
FT                   /protein_id="AAW40114.1"
FT                   /translation="MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAAVPSGASTG
FT                   SHEAVELRDGDKSRYNGLGVQKAVTNVNTAIAKAISGFKASDQQGLDNLLIELDGTPNK
FT                   AKLGANAMLATSLAVAHAAAASCHMPLYRYLNNCDEYILPVPMFNILNGGKHASNSTDF
FT                   QEFMVMPTGAKSFAEALRMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEV
FT                   ILKAIEKAGYRPGEDIFIALDPASSELYQDGKYTLATENKTLSSAEMVDYWCGWVEKYP
FT                   IISIEDGLFEDDWDGWKMLTKKIGSKVQLVGDDFYVTNIKRLERGIKENASNSILIKLN
FT                   QIGTLSETIAAIKMANNSAWTAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRAERT
FT                   AKYNRLLRIEEELGGKAKYPGKEAFFNLK"
FT   gene            complement(544026..544505)
FT                   /locus_tag="DET0594"
FT   CDS_pept        complement(544026..544505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0594"
FT                   /product="conserved hypothetical protein TIGR00725"
FT                   /note="identified by match to protein family HMM TIGR00725"
FT                   /db_xref="EnsemblGenomes-Gn:DET0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40113"
FT                   /db_xref="GOA:Q3Z8W3"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W3"
FT                   /protein_id="AAW40113.1"
FT                   /translation="MDNKRIFIAVIGASKATPEETRLAEEVGKELALRQVTLVCGGMGG
FT                   VMEAACRGASLNGGLTIGILPGNSREEANPYVQIPIISSIGFARNVMVVKSAQAVIAVG
FT                   GAYGTLSEIAYALQSGLPVITLNSWSMSQNGKADGTVIKAGNALEAVTMALDLIN"
FT   gene            complement(544553..545122)
FT                   /gene="pth"
FT                   /locus_tag="DET0595"
FT   CDS_pept        complement(544553..545122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="DET0595"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:DET0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40112"
FT                   /db_xref="GOA:Q3Z8W2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8W2"
FT                   /protein_id="AAW40112.1"
FT                   /translation="MKLIIGLGNPGKEYSGNRHNVGFQCLSRFAKDNHISFDKKCCLSR
FT                   TGSGRINDEEIVLAKPQTYMNLSGKAASQLLRRYNLKAADIIVVQDDLDLPAGKIRLRL
FT                   GGSAGGHNGISSIITDIGTKEFIRLKIGIGKPDSRNNGTEVVDHVLGNFGGEEREIMDK
FT                   AITRASEALTCLLTFGLDTASNRFNS"
FT   gene            complement(545122..547155)
FT                   /gene="ligA"
FT                   /locus_tag="DET0596"
FT   CDS_pept        complement(545122..547155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="DET0596"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:DET0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40111"
FT                   /db_xref="GOA:Q3Z8W1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8W1"
FT                   /protein_id="AAW40111.1"
FT                   /translation="MFSPRTEIENLRREINRHNQLYYVQDNPEISDSEYDALLRRLKEL
FT                   EEAHPELVTADSPTQRVGAEPLKAFGIVNHPYPLLSLANAFSDTELEAWYLRVKKLLGN
FT                   AAFQIDCEPKMDGLAVALTYRNGKFTTGATRGDGFQGENITRNLRTIHSIPLNTEEDAP
FT                   PVFEIRGEVYLPKEGFAKLNRERADKGLSLFANPRNAAAGSLRQLDPSVTAERPLDIFI
FT                   YALGYAEDSLLPDSHWQILEYFSRLGFKINPRNRLVNTLEEAKEYYREMAENRDSLPYE
FT                   ADGVVFKVDSVSLQQKLGDAGREPRWAIAYKFPAEQVTTLLRKIGISVGRTGTLNPYAI
FT                   LEPVNVGGVVVKQASLHNEDDILRKDIREGDTVVIQRAGEVIPEVVAPVLAKRSPESKP
FT                   FSMEETLFNPKLSRPACPVCGGEIYRPAGEAMHYCANVSCPAQFERQLEHFVSRGTMDI
FT                   RGIGESLSVILAQEGLVKNVSDLYYLTAADLLKLPRMGEKSADNIIKAIADSKSRPLDR
FT                   VIFGLGIRHVGNETAALLSSRYGDIWALAGAGLDELQTIPDIGAKIASSIKAYFSEEKN
FT                   IAVIRRLETAGVKLASDQKPSYKPLPLSGVEFVVTGKLDSLSREEAQQKIRSLGGTAKD
FT                   NVTKATRYLVVGADAGSKLAKARSMGVKELSEQEFINMLEQS"
FT   gene            547300..548628
FT                   /locus_tag="DET0597"
FT   CDS_pept        547300..548628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:CT0137"
FT                   /db_xref="EnsemblGenomes-Gn:DET0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40110"
FT                   /db_xref="GOA:Q3Z8W0"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8W0"
FT                   /protein_id="AAW40110.1"
FT                   /translation="MAEVRAFHGLRYNPMFVDDMADVICPPYDIISPEQEKALKERSPY
FT                   NYIRLEYSQPTPQDNIVDNRYTRAAAILEKWIGERVMTAEKKAAIYIHDHYFSVFGKQY
FT                   KRRGIIARVRLEEWDRMVIRPHEGTLSEPKRDRINLISAVRANTSPVYGLYQDIEKNVS
FT                   RLLELQTESKPVVSMNIEGERHELWVVTDEPAISKITALFDKKPIYIADGHHRYESALT
FT                   YRRERLAGNPQLPSDDPVNFVMMTLVDFADPGLVVLPAHRLLGGMDASTLSNLQTKLAS
FT                   FFDVTTIPAKLPGAWDTLDKALKEEGKIRLVMYGLGGTENFTLLTLREIETASNLMPYF
FT                   HSDIYKKLDVSVLDHIILEELMGLKTVEDPRIAFNFDRNDVVSRVKSGEFQLAFILNPM
FT                   KAEVIKAISDVSDRMPRKSTYFFPKLPSGLVVYRFDSEANSKK"
FT   gene            complement(548701..549288)
FT                   /locus_tag="DET0598"
FT   CDS_pept        complement(548701..549288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0598"
FT                   /product="SNO glutamine amidotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40109"
FT                   /db_xref="GOA:Q3Z8V9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V9"
FT                   /protein_id="AAW40109.1"
FT                   /translation="MKIGVLALQGAFREHINMLRTLGAEAVEVRKAEELAELSGLIIPG
FT                   GESTTITKLLYTFGLAKPVKDLARNGMPVWGTCAGMICLAKELSGDISGVKTLELMDIT
FT                   VRRNAFGRQVDSFEAMLKVKALEGGDFPAVFIRAPLVEKTGQWVEVLAKLPDGTMVAVR
FT                   ENNLLATSFHPELSADNRFHRYFVQMAKDYKP"
FT   gene            complement(549361..550941)
FT                   /gene="serA"
FT                   /locus_tag="DET0599"
FT   CDS_pept        complement(549361..550941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="DET0599"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="identified by similarity to SP:P35136; match to
FT                   protein family HMM TIGR01327"
FT                   /db_xref="EnsemblGenomes-Gn:DET0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40101"
FT                   /db_xref="GOA:Q3Z8V8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8V8"
FT                   /protein_id="AAW40101.1"
FT                   /translation="MKKVLVSDALSATGLSPLKEIAQVDVKTGLKPEELVSIIGEYDAL
FT                   LVRSQTQVTADIINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHT
FT                   LALMLSMARHIPRANASLKSGQWKRNEFVGSELKGKTLGIVGLGNIGSEIAKRALALEM
FT                   RVIGYDPFISMERAKKLQVELVPFEDLLKQADFITLHVPMTGQTKGLIGPKELEMMKPT
FT                   VRLINTSRGGIIDEEALAAAIREKRIGGAAIDVFSKEPCTESCLFECDNIIVTPHLGAS
FT                   TAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAESLPVVGPFMPVARTVGSLVSQL
FT                   TDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISEERVNVVNADIVAAQRGLGVTE
FT                   QKESACQNFSSLITVTIDTDNGKSNTVAGSLVRGDVHIVRLNDYWIDIVPTGGYFLFAD
FT                   HIDRPGLIGAAGKITGDADINISYMHLSRQKARGQALMILALDEPLPEKQRQQLLSLPD
FT                   VQTVQVVKI"
FT   gene            complement(550943..552031)
FT                   /locus_tag="DET0600"
FT   CDS_pept        complement(550943..552031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0600"
FT                   /product="soluble hydrogenase, tritium exchange subunit"
FT                   /EC_number="1.12.-.-"
FT                   /note="identified by similarity to SP:P16421"
FT                   /db_xref="EnsemblGenomes-Gn:DET0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40100"
FT                   /db_xref="GOA:Q3Z8V7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8V7"
FT                   /protein_id="AAW40100.1"
FT                   /translation="MQNLRIPGPTPCPEEVLTAMGQQMINHRGPEMAAIMKEVAEKLKY
FT                   FFQTKNDVLVLTGSGTGGLEAAAVNFLSPGETVLSVSIGVFGERFAKIASIFGAKIIAL
FT                   NFEHGKAADPALVKKALAEHPEIKAVLITHNETSTGITNDLKSLASVVKGAGKLLMVDA
FT                   ISSLSSIDLPVDEWGCDVVVSGSQKGWMVPPGLAFISVSPDAWKANAESKMPRFYWDLA
FT                   KHKASIEKGQTPWTPCVSVIVALHKALAMMEKEGMQNIFKRHQKIADFTRKGVKELGLT
FT                   LLAEEKYASNTVTAVLATEGLDPKKLLKVMREEYNTVLAGGQGPLEGKIFRIGHLGWVT
FT                   ENDIKVTLDNLKLALPKAGFRS"
FT   gene            complement(552091..553281)
FT                   /gene="tyrS"
FT                   /locus_tag="DET0601"
FT   CDS_pept        complement(552091..553281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="DET0601"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:DET0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40099"
FT                   /db_xref="GOA:Q3Z8V6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V6"
FT                   /protein_id="AAW40099.1"
FT                   /translation="MNQAENRIDQILKRGVAEVIVEEDFKKLLLSGKKLRLKEGFDPSS
FT                   PDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSAEQVKANAKT
FT                   YLEQFFKIVDKDKTEVRWQSEWYANFKLEDVVRLSSKFTVAQMLARDDFAKRYAAGKPI
FT                   SVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEMLGQKPQQVLMVPILVGT
FT                   DGVHKMSKSLGNYIGVAEEPTEIFGKCMSIPDELILQYFELVTDIPATEIADFKNQMAN
FT                   GLVNPMVLKKRLARELITQLYSAAAAEEADAQFTRVVQRGEIPEDMPECRLENGESICV
FT                   IDFIIKADLAKSKSEARRLLEQGGVEINSAKISDPGTTVKCGDIIKAGKRRYSKAV"
FT   gene            complement(553288..554205)
FT                   /gene="ribF"
FT                   /locus_tag="DET0602"
FT   CDS_pept        complement(553288..554205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="DET0602"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="identified by similarity to SP:Q59263; match to
FT                   protein family HMM PF01687; match to protein family HMM
FT                   TIGR00083"
FT                   /db_xref="EnsemblGenomes-Gn:DET0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40098"
FT                   /db_xref="GOA:Q3Z8V5"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8V5"
FT                   /protein_id="AAW40098.1"
FT                   /translation="MTLLEEEIIRHSSDQNTLITIGVFDGVHLGHQHLINELKKQAKER
FT                   NLQSCLITFKDHPSKVLGQDDIKLILSLEERNLALSQMGLDQIIMLSFTPEISTVSATD
FT                   FVGYLLDHLHMKGIVVGSDFALGRNRAGDATALRRLSHIMDFSVSVVSPVVIENQIVSS
FT                   TAIRRALLSGNVSKARLMLGRNYHIRGTVQNGANRGTKLGFPTANLTLPGYLALPADGV
FT                   YAAKAFLGEKEYNAVANIGSCPTFGQEEHRLEVHLLDFAGDIRGQVLKVEFVEFLRPEI
FT                   CFADAEALKTQISADISKARDILR"
FT   gene            554608..558426
FT                   /gene="rpoB"
FT                   /locus_tag="DET0603"
FT   CDS_pept        554608..558426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="DET0603"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P30760; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565"
FT                   /db_xref="EnsemblGenomes-Gn:DET0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40097"
FT                   /db_xref="GOA:Q3Z8V4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V4"
FT                   /protein_id="AAW40097.1"
FT                   /translation="MVSMLPKADAATGITRKSYAQLPEVVNVPNLIEMQLQSFVWFQEE
FT                   GLRELIEEISPIKDFVGNRLELEFIGYEFREPRLSEYECTQRDQTYSVPLYVKARLIVK
FT                   TTGEIKEPFDLFFGDIPLMTALGTFITSGTERVVVSQLLRSPGVYFTISDDPATGRPLC
FT                   HTNLIPSRGAWLEFETSNRDVISVKIDGRRKIPVSTLLRAIGYSDDLDILNLFEVIDND
FT                   PERHYIQSSIDRDPLIKDEISALIDIYSRLRPGDPPNADNARKLINEMFFDPQHYDLGK
FT                   VGRYKVNRRLELPDREVGDNRALTREDIVAIIKRIIMVNNGQDTPDDIDHLGNRRIRTV
FT                   GELVQNQFRIGLVRLERVARERMSIVNLEVVTPSALVNIRPVVSAVKEFFGGSQLSQFM
FT                   DQTNPLAEITNKRRLSAMGPGGLSRERAGFDVRDVHYSHYGRICPIETPEGPNIGLIGS
FT                   LATYSRINRYGFVETPYRKVYSKLKNNDKKLVGLKLAAAVSDKDKVLASAGSVVSEENF
FT                   KLISKLPECDIQVMPFVSAEVKYMPADEEDRYIIAQANTRLDENGYFLDERIEARLAER
FT                   YVIEPPEKIDYMDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQAVPLLRAEAPMV
FT                   ATGMEREAARYSGQVIFAKRAGVAASVTSEKIIIRTAEGQDDEYLLKKFVRTNQGTCIN
FT                   QHAVINKGQKIEAGQVLADSSATENGELALGQNCVVAFMSWQGFNYEDAIILSERLVRE
FT                   DAFTSIHITKHELEAHDTKLGGEEITRDIPNVGEESLRELDEDGIIRIGAEVGPDDILV
FT                   GKITPKGETELSAEEKLLRAIFGEKAREVKDTSLRMPHGEWGKVINVRVFSRENGDDLP
FT                   ARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVISIIAPVEDMPYLPDGTPVDVVLNPIG
FT                   VPSRMNLGQILETHLGWAGHLLGFRVATPVFDGADDTAIEDALARSWLSAKAGATDMSP
FT                   ENKRPSTDTAKAVEWIKQQGFDGKKVFDERHPGLAKEVSLKLWLKDMGVDASSLSGAEL
FT                   EKKAYEVSSQSRLPSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARAT
FT                   GPYSLISQQPLGGKAQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYES
FT                   IVKGEDVIQPGVPESFKVLVKELQSLGLAVEVINEEVKIAPSEKVAALTEANLPGSEDV
FT                   SAEILPETLYAGAEDIEDSMMSVIDTDDQDLAMSSNDEEVSENDERS"
FT   gene            558413..562300
FT                   /gene="rpoC"
FT                   /locus_tag="DET0604"
FT   CDS_pept        558413..562300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="DET0604"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998"
FT                   /db_xref="EnsemblGenomes-Gn:DET0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40096"
FT                   /db_xref="GOA:Q3Z8V3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V3"
FT                   /protein_id="AAW40096.1"
FT                   /translation="MNEVNDFDAIRISLASPDQIRSWSYGEVTKPETINYRTLKPERDG
FT                   LFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVGHI
FT                   WFTRGIPSRVGLLLNLSTRSLERIIYYSHFIITGVNDEAREKAIKDLEVISSQRVADKG
FT                   SEVDTRVAQMEAEDATVEAINQVRRDFSTEREQMEEDIQLLIDQLKDLQIGNLLTENQY
FT                   YELKQRFSNVFEASMGAEALLKLLSYIDMDKERSKLIQETRSTSGQRRKKAGKQLQLVE
FT                   AFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLQHLME
FT                   IGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQGRFRQNLL
FT                   GKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLVRDGLAPNIKSARRLVE
FT                   RARPEVYDILEEVVKERPVMLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADF
FT                   DGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTTRPGA
FT                   KGEGKIFSDFEEAKHYYEMGIIDLRAIIKVRDGKGNMLETTTGRIIFNDVLPKEVEFQN
FT                   MDIPKSAIKKIIGRCYKILSSQDMAVMLDKIKQLGFKYATSSGISIAMSDISVPREKAK
FT                   LVAAADERTAISEGQFARGLITEDERYNSIIETWMETTDRITDAIQAGFDKQGSVYMMA
FT                   NSGAKGNISQIRQMAGLRGLMTNPSGRIIDFPIKSSLREGLTTLEYFISTHGARKGLAD
FT                   TALRTSGSGYLTRRLIDVTQDVIILQEDCGTSNGTWIVEPKEKGMLPPLVDRVLGRWAA
FT                   HNVVHPQTGEIIVGNNEEIDEAKAKAIGEAGITEVFVRSPLTCEATHGMCRRCYGRDLG
FT                   RVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGVVGVDITTGLPRVEELFEARPPKV
FT                   QSIISEIDGEAEVIENENGRHIRIFSDEVYQDEYELPSGWKTQVQSGQWVDSGMVLASP
FT                   EMEGKSKAVVQSDQNVVARVAGEVSVDGSLITIKYSESEEREYAIPAAMQIKVKTGDSV
FT                   RAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYSQGVHINDKHIEVIARQMLIK
FT                   VRIDSSGDTDLVPGELVDKFRYEDINAKVLAEGGEPATAHTVLMGITRASLSTESWLAA
FT                   ASFQETTRVLTDAAIYGKVDKLSGLKENVIIGKLIPAQCKSCKEATVERAERIAAAAAA
FT                   PAVSTLPENCL"
FT   gene            complement(562272..562415)
FT                   /locus_tag="DET0605"
FT   CDS_pept        complement(562272..562415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0605"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40095"
FT                   /db_xref="GOA:Q3Z8V2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8V2"
FT                   /protein_id="AAW40095.1"
FT                   /translation="MFDGSYALRTDKTGYIGIIKRGALRPSFQDYNNRSLFKPKGNFPA
FT                   EC"
FT   gene            562474..563523
FT                   /gene="ruvB"
FT                   /locus_tag="DET0606"
FT   CDS_pept        562474..563523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="DET0606"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF05491"
FT                   /db_xref="EnsemblGenomes-Gn:DET0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40086"
FT                   /db_xref="GOA:Q3Z8V1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V1"
FT                   /protein_id="AAW40086.1"
FT                   /translation="MSEEKERLISGKLAADDAKLDTSLRPRCLSDFIGQKRLKDNLGVA
FT                   IQAAKQRGEALDHVLLYGPPGLGKTTLSHIIALEMGVNIRITSGPAIERQGDLAAILTN
FT                   LKPFDILFIDEIHRLSRNVEEVLYPAMEDYALDIMVGKGPGARSLRLKLPHFTLIGATT
FT                   RYAMLSAPLRDRFGSIFRLDFYDEDAIHDIVSRSAHILGVEAEENGIRQIACRSRGTPR
FT                   VANRLLRRVRDYAQVKGNGLITGDMAAESLACLEVDRLGLDEIDHKVLKTIIHKFGGGP
FT                   VGLETIAAAISEEADTIMDVYEPYLLQLGFLERTPRGRQATRLAYQHLNIPYPADKNNQ
FT                   QGLWAENGT"
FT   gene            563513..564061
FT                   /locus_tag="DET0607"
FT   CDS_pept        563513..564061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02677"
FT                   /db_xref="EnsemblGenomes-Gn:DET0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40085"
FT                   /db_xref="GOA:Q3Z8V0"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8V0"
FT                   /protein_id="AAW40085.1"
FT                   /translation="MAPKLLLHGCCAHCTAYSFKYWQEQGFAVSVYWYNPNIHPFMEHQ
FT                   SRLEAMRKLSAEMGFELITEPSYHMAEYFKNVSANVDGRCRICFDMRLGQTAAYAAGHG
FT                   YEYFSSSLFISPHQKHQDAVCSAEALAKETGVRFAYADLRKRYSDSRHITKPLDLYRQQ
FT                   YCGCVYSEYERFGKPNSPA"
FT   gene            564136..564777
FT                   /gene="rimI"
FT                   /locus_tag="DET0608"
FT   CDS_pept        564136..564777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="DET0608"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:DET0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40084"
FT                   /db_xref="GOA:Q3Z8U9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U9"
FT                   /protein_id="AAW40084.1"
FT                   /translation="MTYLIRPIKDQDIPELNQIDKEAFPTMWPATNFKREMENIMAHYM
FT                   VLVDEDISRGASPKISPNIWKRLWDCIRRDSNAAGTLADNPKVIGYSAIWVMAGSAHLV
FT                   SVAVRDAFRRKGFGELLLISSLKEAIKYKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIR
FT                   KKYYLDNHEDALIMTLDSIDSPDFPSKLDEYKNSHTRKWKTTPGMAELAS"
FT   gene            complement(564795..565022)
FT                   /locus_tag="DET0609"
FT   CDS_pept        complement(564795..565022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40083"
FT                   /db_xref="GOA:Q3Z8U8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U8"
FT                   /protein_id="AAW40083.1"
FT                   /translation="MMVRIPCPDCGVIGSFSLADEVYEGPYKCWKCRKLFKIRIERGSV
FT                   QLCEPIDEAEFERLKSLGDLKRKSRGGDEE"
FT   gene            complement(565087..565626)
FT                   /locus_tag="DET0610"
FT   CDS_pept        complement(565087..565626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0610"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GP:20905475"
FT                   /db_xref="EnsemblGenomes-Gn:DET0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40082"
FT                   /db_xref="GOA:Q3Z8U7"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U7"
FT                   /protein_id="AAW40082.1"
FT                   /translation="MANNSCERGSGSSMIIPTIILAVVAVVVSIIAYNKNGAHTEGFKA
FT                   AWDIFIQVLPMMVLAFIIAGMLRVIIPQETISQWLGQESGFKGVLIGTALGGLMPGGPY
FT                   SCMPIAAGLLGRGAGAGTMVAFMTGWSLLAVNRLPLEIGMLGWKFALIRLAVTALMPIA
FT                   AGMLANALFSKVNLLE"
FT   gene            complement(565655..566329)
FT                   /locus_tag="DET0611"
FT   CDS_pept        complement(565655..566329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:5199108"
FT                   /db_xref="EnsemblGenomes-Gn:DET0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40081"
FT                   /db_xref="GOA:Q3Z8U6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U6"
FT                   /protein_id="AAW40081.1"
FT                   /translation="MNEQNFTSQEQVFDQIADGWYSFRHRSIFSHELSALAAKWQTGKL
FT                   LNAGCGCGADFIPFKDSFELYGIDFSAEMIEQAGKYARKHGFKPNLSVADMQNLPFKDA
FT                   EFDWLIAVASFHHLKGQDAQEKALKEFGRVLKDGGQVFLTVWNRLQPRFWFKGRETLVP
FT                   WKSQDRVLMRYYRLYTCWEIEALVKKAGFRVVSSFGEKNHRGPKYFARNICLVLEKQTL
FT                   KK"
FT   gene            566373..567752
FT                   /locus_tag="DET0612"
FT   CDS_pept        566373..567752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0612"
FT                   /product="histone acetyltransferase, ELP3 family"
FT                   /note="identified by match to protein family HMM TIGR01211"
FT                   /db_xref="EnsemblGenomes-Gn:DET0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40080"
FT                   /db_xref="GOA:Q3Z8U5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U5"
FT                   /protein_id="AAW40080.1"
FT                   /translation="MKKLSRTISGVTPVAVMTKPLPCPGKCVYCPTFEATPQSYTPESP
FT                   AVLRAKSCEYQAYRQVALRLRIIQDMGHPTDKVELIIMGGTFLAADTAYQYGFIKDCYD
FT                   ALNGVVASSLEEAKAINETAQHRCVGLCIETRPDICGEAEIQRMIDFGTTRVELGVQML
FT                   DDDIYKLVERGHTVADVAESTRLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPR
FT                   FCPDGLKLYPTMVVEGTILEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRD
FT                   IPAVFIRAGLKDSLRDGVRQILESRNQKCKCIRCREYGHRQRKGQTSGEPALKRLDYQA
FT                   SGGKEIFLSFEDASDTLYGLLRLRIPQVSLPVLDKKYGGKTGLVRELHVYGTELSLGEQ
FT                   GEQSAQHRGLGRKLVAEAERLVRDEYGLSSLAILSGVGAREYYRSLGYELVAGYMCKYL
FT                   G"
FT   gene            567776..567868
FT                   /locus_tag="DET0613"
FT   CDS_pept        567776..567868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40079"
FT                   /db_xref="GOA:Q3Z8U4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U4"
FT                   /protein_id="AAW40079.1"
FT                   /translation="MFCLVINAKLRVLILVVYIKIPRVNGKNVF"
FT   gene            567965..568903
FT                   /locus_tag="DET0614"
FT   CDS_pept        567965..568903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0614"
FT                   /product="hydrogenase, group 3, VhuG subunit, putative"
FT                   /note="identified by similarity to GP:1747407"
FT                   /db_xref="EnsemblGenomes-Gn:DET0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40072"
FT                   /db_xref="GOA:Q3Z8U3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U3"
FT                   /protein_id="AAW40072.1"
FT                   /translation="MVRVAEEWFAVCGGCELSLLDIGESLLDILPNLEIVHMPVLMDHK
FT                   LFGQKGDGTKPEIPEADLGLITGGIRNEENKELALEMRKKCKIIVALGTCACFGGIPAL
FT                   ANLSTTEAMLDQIFNKEKGTDPSSPPSDKSLPKLLDRVYAVDEVIKVDIHLPGCPPTPA
FT                   HIVELLNAVLAGKTFALPERSVCDTCPTIREKQSTGGSIKRPLQNAQFTPGRYDNMRCL
FT                   NEQGLFCLGPVTKAGCNRILGADPSEEIPRCIKAYMPCRGCFGPVRQSSNPTADIMGSL
FT                   SYIGRDPKEIVDRVATINRFIGSGRLRPQDK"
FT   gene            568933..570372
FT                   /locus_tag="DET0615"
FT   CDS_pept        568933..570372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0615"
FT                   /product="hydrogenase, group 3, VhuA subunit, putative"
FT                   /note="identified by similarity to GP:1747408"
FT                   /db_xref="EnsemblGenomes-Gn:DET0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40071"
FT                   /db_xref="GOA:Q3Z8U2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U2"
FT                   /protein_id="AAW40071.1"
FT                   /translation="MKQITIQPVTRIEGAAKVVINLDDNGNVSDARMHIIELRGFEKFC
FT                   IGRPVEEMPRITPRICGVCPLSHHLCSAKACDNVFGVTPPSAGRKLRELANAAAYMEEH
FT                   ILHFFFLAGADLVMGPGENYSMRNVFGIAQKMPELGQKVIRSRHLASKLLDYLLGKDIH
FT                   PVAAVAGGFSKPLTETEREKMMEMAKELLEFAKFSIAYAKENLFGKYEDLIKEIGVIKT
FT                   GFLGTVDKNGALNQYDGHLRLMHPDGKFTEFDPKDYLDHITERVEDWSYAKFPYAKELG
FT                   EFNMDLDNPSGILRVNTLARINVCERIATPLAQKELEEFRSKFGRPAQQSLLFNWARLI
FT                   ELLYNAERAVELLSDPEITSTNTRVPVTPKAGRGVGCIEAPRGTLIHDYTTDENGLVTD
FT                   ANLLVATVMNNAAINMSVKQAAQTLIKGGKYDETILDEIEMVIRAYDPCLSCSTHELNG
FT                   KLAVNLDIVDAKGQLVQTYSN"
FT   gene            570375..570878
FT                   /locus_tag="DET0616"
FT   CDS_pept        570375..570878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0616"
FT                   /product="hydrogenase maturation protease"
FT                   /note="identified by similarity to SP:P19930; match to
FT                   protein family HMM TIGR00072"
FT                   /db_xref="EnsemblGenomes-Gn:DET0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40070"
FT                   /db_xref="GOA:Q3Z8U1"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U1"
FT                   /protein_id="AAW40070.1"
FT                   /translation="MECLPEYCFRKVVVFGCGNILYGDDGFGPAVADYLNAHCRVPDFA
FT                   CVMDVGTAIRELLFNIIISEVKPKVIVLVDAMETGLGVGELGHLRVEQVSPEKINDFSL
FT                   HLMPTLNMLEELHADGGVKIDVLAVKPECIPTEMAQGLTEKVEKAVAETAGYIADTYFS
FT                   QPPL"
FT   gene            complement(570875..571180)
FT                   /locus_tag="DET0617"
FT   CDS_pept        complement(570875..571180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40069"
FT                   /db_xref="GOA:Q3Z8U0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8U0"
FT                   /protein_id="AAW40069.1"
FT                   /translation="MTDILNEASNIAQCKECPWYRACTTPMRYTSEDIRRQVQSGSPGM
FT                   NAPQDEAAMQQMLSMASAAQNSMLEACPIFIDRLRNNPKLAQKIKEIMQNWSQEIT"
FT   gene            complement(571197..571733)
FT                   /locus_tag="DET0618"
FT   CDS_pept        complement(571197..571733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0618"
FT                   /product="thiol-disulfide oxidoreductase, putative"
FT                   /note="identified by similarity to SP:P35160"
FT                   /db_xref="EnsemblGenomes-Gn:DET0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40068"
FT                   /db_xref="GOA:Q3Z8T9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T9"
FT                   /protein_id="AAW40068.1"
FT                   /translation="MKRKLITLSFLLIGSLCLSACNQAAPLPPDDGEALTGIRINNLAP
FT                   DFSLKDLTGQDISLSGLKGSGVVLNFWMISCGYCQDEMPFFEAAYNENKSLPSGIKVFM
FT                   VNIRESQSLIERFMANTGFTFPVLLDTTGDIGQLYNANYIPITYFINAEGIIKAIKFGG
FT                   VSSQADFDNQLKKIT"
FT   gene            complement(571735..572436)
FT                   /gene="ccdA"
FT                   /locus_tag="DET0619"
FT   CDS_pept        complement(571735..572436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="DET0619"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /note="identified by similarity to SP:P45706"
FT                   /db_xref="EnsemblGenomes-Gn:DET0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40067"
FT                   /db_xref="GOA:Q3Z8T8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T8"
FT                   /protein_id="AAW40067.1"
FT                   /translation="MEDISYLLALGGGLAAFFSPCVLPMMPVYLASLTGREILDTRPDF
FT                   AVSFKTLPHSAAFVAGFSLVFTSLGALAGLGGVIINPSELWIRILSGGILVIFGGYMLL
FT                   SLRFPSLSFEKHLFGQQSLRGGSYVRSFLSGAIFTLAWTPCISPILGSILSLTFGGESP
FT                   LYGSALLAVFSLGMGIPFLVLGLLLQKTLPLIRKHSRYSGAVYGISGGILIVIGILILS
FT                   NQIGFFSTLQI"
FT   gene            572520..573659
FT                   /locus_tag="DET0620"
FT   CDS_pept        572520..573659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0620"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:28410532"
FT                   /db_xref="EnsemblGenomes-Gn:DET0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40066"
FT                   /db_xref="GOA:Q3Z8T7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T7"
FT                   /protein_id="AAW40066.1"
FT                   /translation="MRPLSYSQIDQYQSCPLKYRFLYIDGLKPPAKGYFSFGTTLHDCA
FT                   EYFFRVKVPPPPSLENLMEYYCLHWRSEGYESAEAEENYRQLGGKILADFHRIHSADFH
FT                   MPLAVEHQYTVNLDGVKLTGKIDRVDKLPSGELCIIDYKSNKDLFSAEYVQNNLQLSLY
FT                   QLAVEQIWFLPVGELCLYHLRSNTAMRCPARSKEVIADARNLVLEVAEKIEKAIFPACE
FT                   NSFCPCDFAHLCPLYRHKYAPPPQLPQAPPVDISHAVEEYVELQSRKGEIEARIDTLKE
FT                   AIIEYCRANSLGRVFGSEHALSYKEVLRTAYNNKAVRDLLEPLGLWNQVSSLDKTLLEE
FT                   YLETDACGQELKKRILALKEVISSSPRLYVKQISKDQDN"
FT   gene            573681..574169
FT                   /locus_tag="DET0621"
FT   CDS_pept        573681..574169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0621"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to OMNI:NTL01BH1315"
FT                   /db_xref="EnsemblGenomes-Gn:DET0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40065"
FT                   /db_xref="GOA:Q3Z8T6"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T6"
FT                   /protein_id="AAW40065.1"
FT                   /translation="MFFQVIGVFLLALLEIWLAIPAGLIWGLNPALVILLVCGGTLSGV
FT                   GVILLLSEKIRAGSNRWLDKNRTGDASLSLSALFAQIIISLQERLRSGRLYKVWLKYGI
FT                   IGLGLLSPVLTSAPIAAFLGVMLNAGRLKLFVWIAIGVAVWTTGLTLAMHFGLILLGI"
FT   gene            574360..575109
FT                   /locus_tag="DET0622"
FT   CDS_pept        574360..575109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0622"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40056"
FT                   /db_xref="GOA:Q3Z8T5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T5"
FT                   /protein_id="AAW40056.1"
FT                   /translation="MKVYHLAYEPSYHSMDFHFWTECNLKCRGCYTNYEVYDFGLMDDP
FT                   VAEIITHERQAPPTEFLSFDQVMEKIDGYTIKYAVFLGTEAVLDPELPKLAKAVHEKYG
FT                   SYNILLTNGIRMPDLTDIDQVIFSLKAYSEDIYRDYTSRSNKSALENLKKIHAALGDRK
FT                   LHVEVVYIPDYIAKDEIEKVAQFLASIDKDMSFRIDAYFPIPGCPWRAANKEEVEEAAE
FT                   AARKYLNNVVVLTLDMKRIGDKAIKVF"
FT   gene            575110..576909
FT                   /gene="nrd-3"
FT                   /locus_tag="DET0623"
FT   CDS_pept        575110..576909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrd-3"
FT                   /locus_tag="DET0623"
FT                   /product="ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to OMNI:TM0118"
FT                   /db_xref="EnsemblGenomes-Gn:DET0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40055"
FT                   /db_xref="GOA:Q3Z8T4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T4"
FT                   /protein_id="AAW40055.1"
FT                   /translation="MTVEFGRQSVLADVRLSTTAKRVLEKRYLKKDANGRVIETPEDMF
FT                   RRVARVVASAECKYAPGADTSRIEDEFYQAMSRLEFLPNSPTLLNAGRQVGQLSACFVL
FT                   PVEDSIESIFDAVKQTALIHKSGGGTGFSFSNLRPAGDKVGELTEVAGGPVSVINIFSA
FT                   AADYVRQGGVRRGCNAAILDVTHPDILKFISCKGDPNALTNFYISVVVTREFMTKVRSG
FT                   EDYDIINPHTGEVVQRLNAACVFDCIVDQAWKTGDPGLVFIDRINDDNPTPELGRIRHV
FT                   SGCGEQTLLPYESCNLGSISLPRMLKRDGERVVVDYEKLGRTVKMAIRFLDNVIDVNRF
FT                   PTPEIEKATLRNRKIGLGVMGFADMLVLMGIPYNSEEAIFQADQIMEFIKETSHRASSK
FT                   LAEARGSFPAYEGSIYDVPGGRPMRNATCTSIAPTGTLSIIAGVSSGIEPSFAMVFVRN
FT                   ILDGENLLEINPYFEEMARREGFHSKELFEKLVSSNHLHDMECVPDWLKRLLVTAHRIR
FT                   PEWHIRIQAAFQKYTDNAVSKTVNFSHEATREDMANVFNLAYDKGLKGITVYRDGSRAA
FT                   QPLCTSESGVKLVDQYLDNCSCH"
FT   gene            complement(576906..577910)
FT                   /locus_tag="DET0624"
FT   CDS_pept        complement(576906..577910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0624"
FT                   /product="response regulator"
FT                   /note="identified by similarity to OMNI:TM0186; match to
FT                   protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:DET0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40054"
FT                   /db_xref="GOA:Q3Z8T3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T3"
FT                   /protein_id="AAW40054.1"
FT                   /translation="MTTKNETVLTVDDEDTIRRLLYQKLTSEGYKCLTASNATEAMEII
FT                   KSQDVSLAILDIKMPGLSGMDIFPEIRTISPDTAVIMATAISDTDTAIACMKLGAYDYV
FT                   TKPFKLDAVMMSIERALEKRRLVLDNRDYQQHLEIKIKDQAEKIRSSFFNAITSLAYAL
FT                   EAKDSYTIGHSQRVAETSVSIASAMELPVAAIEQIRLAGLVHDIGKIGIRSACLNKAGN
FT                   LTEEEYTHIKTHPGIGERILSPITEDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGAR
FT                   IMALADAYDAMTSLRPYRKAMTDKEAWEELKRCSGTQFDPEILAVFSRVNNNT"
FT   gene            complement(577937..580498)
FT                   /locus_tag="DET0625"
FT   CDS_pept        complement(577937..580498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0625"
FT                   /product="sensory box sensor histidine kinase"
FT                   /note="identified by match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:DET0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40053"
FT                   /db_xref="GOA:Q3Z8T2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T2"
FT                   /protein_id="AAW40053.1"
FT                   /translation="MQDQYKSCRTNAEQSVLPESACLAEILSMIESTRTMAFIFETSSP
FT                   FRLIYASSNTPALSGYLPADYLSNPALLDEILKPAGLNLDTQTPKQFKTPLGPIPCYIP
FT                   SKTGLPLSGELLCKLYSGKLICLIHCHGQVQNNPNQLAFFDEAPTLMPLIIGFEPDGKL
FT                   LFANRIFEEATGYPASEISGDKWQSCGLFSEEARERIAQMLQNSQNDSIQPFEIRLIHK
FT                   NGQTCWLSGHSQIINPGTVSPYLQLSARDITICKKSEKMLLLTRFAVERATDAIFWTDA
FT                   GGKFVDVNQSACDSLGYQREDLLKLKVTDIDTLITSQTDWEKHWEKLKARTYLHFESVH
FT                   RNIQGGSIPVEITANYLQYDKMEYNIAIVRNIRQRKEAEKHLKFTSFSMEHSADLIIWV
FT                   NQNGNIIGANRSAYQSLGYTHDELCSLTVEDINPVCTPERWKTLWGRLKHDIKYAMETA
FT                   LITKNGQKLPIDVMCNFLEFEGVDYCCAVVRNITERKNVYAKLLHAAEEWRITFDNISE
FT                   IVFLLDNDFNIQRANRAFAKALNCQPQEILNKKCYEVLHHTNCPQVNCPKLVASDTQKT
FT                   QYINYFEETIEKHFQETIDPILDTDGQSLGTVHILKDLTEHHKMAAQLMITDRLASVGE
FT                   MAAGLAHELNNPLTSVIGFSELLQEKKLPEDLQRDIQIISQEALRAAEVIRNLLAFARR
FT                   HEPSKDWVDMNVLIHKVLDICNYEQRVNNIHIVTNLDADLPEIKADYFQMQQVLLNIII
FT                   NAEYFITKAHGEGTIVISSSRFGDNIRISIKDDGPGMSENVLNRIFDPFFTTKEVGKGT
FT                   GLGLSIGHGIITQHGGKLYAESSEGKGATFFIELPINPPAQ"
FT   gene            complement(580653..580985)
FT                   /locus_tag="DET0626"
FT   CDS_pept        complement(580653..580985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0626"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:SAG1430"
FT                   /db_xref="EnsemblGenomes-Gn:DET0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40052"
FT                   /db_xref="GOA:Q3Z8T1"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T1"
FT                   /protein_id="AAW40052.1"
FT                   /translation="MSDIENTEVFECRRCGNCCSHFQPHLEMDEAQRIAGHLSLSLEEF
FT                   KQKYADKRWPGQRTMLIRHNENGCIFLGRGVDNLSLCTIHDFKPQACRDYQPSLKHREC
FT                   REGLQP"
FT   gene            580984..582333
FT                   /locus_tag="DET0627"
FT   CDS_pept        580984..582333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40051"
FT                   /db_xref="GOA:Q3Z8T0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8T0"
FT                   /protein_id="AAW40051.1"
FT                   /translation="MGFIIDAGLCYYQGNVEYSCVSDIIIKNMKKKKDYIIRLLATLVI
FT                   SGVLFLGSPVVNKAALEGELSFSDIILKVGAELTVYGQNFLRQSDIKLYFDDEEVAFGA
FT                   TNQLGEFTLSFVVPPSGRGLHLIKALDADYNTGSGLVLIESWIDLSKSEAAIGETVNIN
FT                   GTGFTPLASVNFYYNNTPLEVIPANVKADITGSFSVSFAVPERFAGVYLVEVRQGDYIN
FT                   SQSLKANVWLDINPEIGLGKLIDVGTQLNISGKGFKPNGQVDLQYDGVSLLKVSVDDKG
FT                   TFFAQIVIPSSASASHSLILDDGQNRIVREIWLENTPPPAPDITIPVSGEALDDPFTFG
FT                   WAGVSDSSGVTYTLQVASDSGFGNILFELKDIKTSQYILADNQDINNSSADTFYWRVQA
FT                   VDGAGNASAWSETGTFTRTSLVQNLGLVVGVGVGLVAIIIFMWWAIRNRR"
FT   gene            582476..583795
FT                   /locus_tag="DET0628"
FT   CDS_pept        582476..583795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0628"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM TIGR00238"
FT                   /db_xref="EnsemblGenomes-Gn:DET0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40050"
FT                   /db_xref="GOA:Q3Z8S9"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S9"
FT                   /protein_id="AAW40050.1"
FT                   /translation="MTTTEENKNTQSDDPLGAGAVETYGKVDDEPPSRLGQTKRFRLKY
FT                   FPKVSDQNWNDWHWQFKNRVTSVTEIARFFHLSAEEYRDMEAVSAVFPLSATPYYLSLV
FT                   DFDNVNDPVKCQLMPDTAELNFDTRCCSDPLEEAHSSVVPGLVHRYPDRVVMVLTDICP
FT                   VLCRHCTRKREWKNGGWVHTQAEIDAMLAYIRQHQVIRDVIISGGDPLTLSTPRLESVL
FT                   SALRSIPHVEIIRIGTRYPVVLPQRIDDELCNMLSKYGPIWLNTHYNHPNEITEESRQA
FT                   CDRLVRAGVPVNNQSVLLKGINDSVSVQKSLCHKLLMSKVRPYYLFQCDNVQGTEHFHT
FT                   PIETGVGIIEGLRGYTSGLAVPNYVIDLPGGGGKITIQPDYVLDKQADEYIIRNYKGDI
FT                   IRFKNPGDPKVYSNTGRTDLLNNAAKIKRETDADRAVIRS"
FT   gene            583767..584783
FT                   /locus_tag="DET0629"
FT   CDS_pept        583767..584783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0629"
FT                   /product="D-ala D-ala ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:DET0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40049"
FT                   /db_xref="GOA:Q3Z8S8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S8"
FT                   /protein_id="AAW40049.1"
FT                   /translation="MQIGLSYDLKQALNPVSGGPDDALEEYDSPETVEAITNALTQAGH
FT                   TVYRLGGGKEFLRRVQEQKLDLVFNIAEGLGNYRSREAQIPGILEMLDIPYTGSDPQTL
FT                   AVCLDKPLTKKLVADAGIKTARWQLVTSCEELSAIDWSGFPLPAFLKPACEGSSKGVRF
FT                   ASRAGSAKEIVSMAAELLTAYEQPVLIEEFISGEEITVGVIGNIQPKVLGIMRVVPKTK
FT                   TDYFVYSVEVKRNWRQMVEYEVPAALPAETLSRIEKATLDAYKVLGCRDLCRMDFRVSP
FT                   DGIPYFLEVNPLPGLNPVSGDLPIMASKLGISHAELVLKILDTALARHSLTAANCLP"
FT   gene            584917..585348
FT                   /locus_tag="DET0630"
FT   CDS_pept        584917..585348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0630"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40048"
FT                   /db_xref="GOA:Q3Z8S7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S7"
FT                   /protein_id="AAW40048.1"
FT                   /translation="MPTIQSRIRQNKYKITPQRQAVLKVLSAATQPLSPSEVHELVQAA
FT                   KPSTGMATVYRSLQLLSELGLVCELHTAGNCHRYLLRRIDSHHHHLICSGCGQVIHVEG
FT                   CGLKEITENLSRQTGFAIDAHLLEFIGRCRNCQKEAGKV"
FT   gene            585345..586217
FT                   /locus_tag="DET0631"
FT   CDS_pept        585345..586217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0631"
FT                   /product="cation ABC transporter, periplasmc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40040"
FT                   /db_xref="GOA:Q3Z8S6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S6"
FT                   /protein_id="AAW40040.1"
FT                   /translation="MKLRTLFLSLALGVTLLSSLLLAGCQEDSSSAAKLKIAVSIVPLK
FT                   EFTQQIAGDKAEVILMVPPGAEPHTYQPLPSQMVDISQADMYVKLGSDFGFEQTWISKI
FT                   LALNHSMLMVDSSVNITLESSSEGDGADPHIWLSPRNAIQMVKNITTGLMSLDPENKSY
FT                   YVANRDAYLAKLEQLDNEITLALSHLHNRTFLVFHPAWAYFARDYNLKELSIEIEGKEP
FT                   TPQQMIEIIDLAIQNNISIVFASPQFSSRSAESIASEIGGQVIMIDPLAQDYIKNMEFV
FT                   YKQMQEVMS"
FT   gene            586220..586984
FT                   /locus_tag="DET0632"
FT   CDS_pept        586220..586984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0632"
FT                   /product="cation ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q9XDA6"
FT                   /db_xref="EnsemblGenomes-Gn:DET0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40039"
FT                   /db_xref="GOA:Q3Z8S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S5"
FT                   /protein_id="AAW40039.1"
FT                   /translation="MSDTPALVFRGVSAGFDGLTVLEDITFSQPAGRMLGIIGPNGGGK
FT                   TTLLKLILGLIQPDCGSIKVLGKSPEDARPEIGYVSQYHLFDRDFPISVLEVVLMGRYA
FT                   KRGLARRYSSGDVALAKEYLDKVGMLPFAHRQIGQLSGGQQKRVFIARALVNQPKLLIL
FT                   DEPTAGVDAAMQTGLYELLETLKKEMTIIMVTHDISAVAVCIDDIACLNKHLSYHHAEE
FT                   GLTAEALSETYNCPIQLIAHGQVPHRVLKEHV"
FT   gene            586981..587802
FT                   /locus_tag="DET0633"
FT   CDS_pept        586981..587802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0633"
FT                   /product="cation ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:5019735"
FT                   /db_xref="EnsemblGenomes-Gn:DET0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40038"
FT                   /db_xref="GOA:Q3Z8S4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S4"
FT                   /protein_id="AAW40038.1"
FT                   /translation="MIEALGYGFIQNAIWAGLLAAIGCGIIGSYVVVKKLVSISGGIAH
FT                   ASFGGIGLGYLLGISPVLGALVFSLLAAAGMGAITRRGRISEDTVIGMLWSLGMALGVI
FT                   FIGLTPGYAPDLFSYLFGNILTVPSSDLLLMLVLDALIIGVVWLFYKEFLGISFDEEFC
FT                   RVSGMPTGLLYIIMLGLIALTVVMLIRVVGIILVIALLTIPAAVARRFTDNLFKMMLLS
FT                   IGFGMVFCLGGLWLSYVLDLASGATIILFSAAVFLLVWAFKNKKKQEPVRD"
FT   gene            complement(587799..587936)
FT                   /locus_tag="DET0634"
FT   CDS_pept        complement(587799..587936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40037"
FT                   /db_xref="GOA:Q3Z8S3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S3"
FT                   /protein_id="AAW40037.1"
FT                   /translation="METAAKLFQTKANRAECFSPNQTSGYTLVFLTRKEGLYPERVQPV
FT                   "
FT   gene            complement(587852..588202)
FT                   /locus_tag="DET0635"
FT   CDS_pept        complement(587852..588202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40036"
FT                   /db_xref="GOA:Q3Z8S2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S2"
FT                   /protein_id="AAW40036.1"
FT                   /translation="MELDEFLKQSAVDYTSRQIILLFSKHPFARFDRSAIASTIEGGSD
FT                   ILPTLQSLVSSGIIKLCQKGGAELYYLTSEPELREMVTRLGNMEWKQQQNFSRRKLIGL
FT                   NVFPQTRPLGTH"
FT   gene            complement(588319..589449)
FT                   /gene="ftsZ-2"
FT                   /locus_tag="DET0636"
FT   CDS_pept        complement(588319..589449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ-2"
FT                   /locus_tag="DET0636"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by similarity to SP:P17865; match to
FT                   protein family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:DET0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40035"
FT                   /db_xref="GOA:Q3Z8S1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S1"
FT                   /protein_id="AAW40035.1"
FT                   /translation="MSKKVYVPSGAKIKVIGCGGAGSNAVTRMVRDNIQGVEFIAVNTD
FT                   AQHLAITEAATRIQIGERCTRGLGAGGNHTMGKAAAEESMSELKENVIGADMVFVTAGM
FT                   GGGTGTGSAPVVAKIAKESGALTIAVCTKPFCFEGAHRMQTAEEGINNIVDSVDTLIII
FT                   PNDRLLDMVDQKTGVDGAFKLADEVLCNGVKAIAEVITVPGIINLDFADVKAVMKDAGP
FT                   AWMSIGKGAGQNRASDAARAALASPLLDIAVDGAKGVIYNVCGGEDLSLMEVNSAADVI
FT                   RQAVDPEANIIFGVSTDPRMGKEVQITLIATGFATKESMLSNNHEKEMTRMMKGLRSKT
FT                   QEELEVPSFMRYRSAQPSIRKPAPPAHQAPPRFLSR"
FT   gene            complement(589482..590684)
FT                   /gene="ftsA-2"
FT                   /locus_tag="DET0637"
FT   CDS_pept        complement(589482..590684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA-2"
FT                   /locus_tag="DET0637"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by similarity to SP:P28264; match to
FT                   protein family HMM TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:DET0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40034"
FT                   /db_xref="GOA:Q3Z8S0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8S0"
FT                   /protein_id="AAW40034.1"
FT                   /translation="MKRRQIAAIDVGTSKICTVMADTENGDLRILGVGVVASRGMQKGM
FT                   VVNLNEAKEAIRESVSMAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVRQS
FT                   DLQRAIDIASSITMPQDRKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITAASN
FT                   SIENLTKCIRAAGVEIDDLVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAFKGNS
FT                   IYHTSVLPIAGSQVTHDISVGLGIPFEMADDIKQRYSSVIPGECNDASFVESGHTFSYP
FT                   DLCEIVRMRVEELLRLTILELPSDDYSKMVPSGLVITGGTANLPGIAELGSEVLRIPVR
FT                   VGTPPNLFGVSDILNDPACTNVVGMLLWSINNRDASKSHPANEESAKGGFISRMFGNPK
FT                   N"
FT   gene            complement(590745..590954)
FT                   /locus_tag="DET0638"
FT   CDS_pept        complement(590745..590954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40033"
FT                   /db_xref="GOA:Q3Z8R9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8R9"
FT                   /protein_id="AAW40033.1"
FT                   /translation="MGTAIEYQKLMTEIVHINLPGPAEPMPGMSGGELLHGFLAELYRA
FT                   PSTDSKAFIESLSGKWNVHFRQVK"
FT   gene            591194..591883
FT                   /locus_tag="DET0639"
FT   CDS_pept        591194..591883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40026"
FT                   /db_xref="GOA:Q3Z8R8"
FT                   /db_xref="InterPro:IPR035235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8R8"
FT                   /protein_id="AAW40026.1"
FT                   /translation="MANLKGSKPLPPYVSYRTFLNFLLGLQEAIPSRLDRSFWGDKWSG
FT                   STGTQLMAALRFLGLADNEGMPREKLRRLVDAKGEDRTLILRQIALEGYEFVFNSSADP
FT                   ESLTYAQLEELFHNSFKVADDVVRKCIKFFLGLAEDADIPISPFVTKKSRTARSGAGTK
FT                   KVSRKIMPRTASHVLIPDNTMKIPENSDMDKVLLGKFPTFDPAWTDEVKVKWFEAFDVL
FT                   LKKVSKS"
FT   gene            592044..592907
FT                   /locus_tag="DET0640"
FT   CDS_pept        592044..592907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0640"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40025"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8R7"
FT                   /protein_id="AAW40025.1"
FT                   /translation="MYFKRILVALDGTKTAEKTLPIAECMAGAAETQLLLVSICDPKPK
FT                   ITDERQKYLDIKAAELQAKGIKSSGKMFCGELLPLILKCIRDNDIDLLCVASHGYTGIK
FT                   KMVLGSVSEKLIKSTNLPVLLVKDGYDADKAAFGNILLPLDGSLFSEACLKQVSVLARD
FT                   FKSKLTLLVVIQPPCIPSDRSPSIQPSWDEYYQALLEELKQQAQAYLERLTGELRENGI
FT                   ETEFRMEVSDNIPETILSTAEDINASLISFTTHNRSGIEKWYYGSVAAGLIENSPRPML
FT                   LWRNSI"
FT   gene            592961..593587
FT                   /locus_tag="DET0641"
FT   CDS_pept        592961..593587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0641"
FT                   /product="cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40024"
FT                   /db_xref="GOA:Q3Z8N2"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8N2"
FT                   /protein_id="AAW40024.1"
FT                   /translation="MKKIYDLSPEIRPEMISWPGDGPPQIKLLHSIRGGFPTNLGQLTM
FT                   TLHNGSHIDAPLHFFEDGDGVGEIPLEILIGNVRVLCFSGVKTITRDMLEQAELRGVTR
FT                   LILATDNETLWDKPDFDRNYTYIDIGAARYLTEIGIRLLGIDYLSVEDFEETQGVHKHL
FT                   LSRGVVILESLQLAGVAEGDYELFCLPLKLGKVDGAPARVILIER"
FT   gene            593592..594254
FT                   /locus_tag="DET0642"
FT   CDS_pept        593592..594254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0642"
FT                   /product="ribulose-phosphate 3-epimerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40124"
FT                   /db_xref="GOA:Q3Z8N1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8N1"
FT                   /protein_id="AAW40124.1"
FT                   /translation="MKDVKIVPAVLTDDPAAFECMLNQLESFAPSAQIDIMDGQFVPSL
FT                   SIPPEVLGRYKPRFASEIHLMTLNPEEYLTYCKQHGAFRVIFHFEATTRPEYVISRIKE
FT                   LGFQAGLAVNPETPVSDFAYLVPQLDMVLFMSVIPGFYGAPFIPEVLLKVKEFKRRFPE
FT                   TEIGLDGGAKEGNIPEIVAAGVNDICVGSAIFRQTDPKSSYLYLDKLAKNASKEAGI"
FT   gene            complement(594251..594709)
FT                   /locus_tag="DET0643"
FT   CDS_pept        complement(594251..594709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0643"
FT                   /product="ribose-5-phosphate isomerase, putative"
FT                   /note="identified by match to protein family HMM TIGR00689;
FT                   match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:DET0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40123"
FT                   /db_xref="GOA:Q3Z8N0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8N0"
FT                   /protein_id="AAW40123.1"
FT                   /translation="MSNISVAIGADHGGYGLKTDLLPFLNQLGIKVLDLGACTYDSADD
FT                   YPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEHDD
FT                   MNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRLEKLLQAEKEG"
FT   gene            complement(594702..596702)
FT                   /gene="tkt-1"
FT                   /locus_tag="DET0644"
FT   CDS_pept        complement(594702..596702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt-1"
FT                   /locus_tag="DET0644"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:DET0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40122"
FT                   /db_xref="GOA:Q3Z8M9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M9"
FT                   /protein_id="AAW40122.1"
FT                   /translation="MSNTKSDSLCINALRFLAVDAVQKANSGHPGAPMGMAAMAYALWQ
FT                   NFLKHNPQDPAWPNRDRFILSAGHASALLYSLLHLTGYDLPLDELKNFRQWGSKTPGHP
FT                   EYGLTPGVEMTTGPLGQGFASGVGMAMAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLME
FT                   GVASEAASLAGHLALGKLIYLYDDNEISIEGSTELAFTENTALRFESYGWQVIGPVDGL
FT                   NPEAVSGAIKEAQSDSARPSLIICKTVIGFGSPNKAGKASAHGEPLGTDEVAKSRKSLG
FT                   WDYEPFVIPPEALAEFRMALDKGKTAQQVWQSKLDYYSSRYPEKAALLQDRLSGKLPDN
FT                   WDNELDKLFDKAMASREASGLIINTLASRLPALMGGSADLSPSNKTVIKDGGEYEPPHY
FT                   EGRNIHFGVREHAMGAIANGLALHGGIIPYVATFLIFYDYMRPAVRLASLMGQRVIYIF
FT                   THDSIGLGEDGPTHQPIEQLAGLRSVPGLVTIRPADSYETAQAWKTAILRKDGPTAIAL
FT                   SRQKLPLLDNSQANSVNLAKGAYILAETDSRPQVALVASGSEVSIAVQAAEILKNKGVS
FT                   SRVVSFPSWQLFEAQPRTYRQSILPASLPRVIIEAGSAQGWCKYLGANGDIISIDHFGA
FT                   SAPAPVLYQHFGLTPENMAEKALKLLENEDE"
FT   gene            complement(596747..597262)
FT                   /locus_tag="DET0645"
FT   CDS_pept        complement(596747..597262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0645"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40121"
FT                   /db_xref="GOA:Q3Z8M8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M8"
FT                   /protein_id="AAW40121.1"
FT                   /translation="MDTLEAIFSRRSTRHYQNGDVSPSELDTLLRAGMAAPSAGNQQVW
FT                   HFVVIDERRILDKIPDIHPYSKMLKEAPMAIMVCADTSAETKPGYWIQDCAAASQNILL
FT                   AAEALGLGACWLGLHPREERKKGISQLLNLPANISPLSLIAIGKKGEVKPPAGRYLESH
FT                   IHKNGWQV"
FT   gene            597389..598231
FT                   /locus_tag="DET0646"
FT   CDS_pept        597389..598231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02MA4536"
FT                   /db_xref="EnsemblGenomes-Gn:DET0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40120"
FT                   /db_xref="GOA:Q3Z8M7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M7"
FT                   /protein_id="AAW40120.1"
FT                   /translation="MFKKLADINNKPELYQQYSAPVLWNDPHISSRMLEFHLNPDIEPA
FT                   SRKAVFIEKSARWIAEYFGLGDGKRVCDFGCGPGLYTSHLAAAGADVTGIDFSSRSIAY
FT                   ARESASAHNLDIHYIEQNYLEFAAPKKFDLITLIYCDYCALSPAQRCRLLSVWRKCLKD
FT                   GGQILLDVFSLSAYEGRAESAAYGHRLMDGFWSGHDYFGFVNTFKYPLEKVVLDKYTII
FT                   EADREWQVFNWLKYFSAAELKDELAENGFEVTGVFSDVAGKVYCETSPEIAVVARKKN"
FT   gene            598326..598493
FT                   /locus_tag="DET0647"
FT   CDS_pept        598326..598493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40119"
FT                   /db_xref="GOA:Q3Z8M6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M6"
FT                   /protein_id="AAW40119.1"
FT                   /translation="MQLYILKPYKREASVMIKPTKLIPPFPQMTIGVMGSAGGAMSDET
FT                   KKIYVVWVSA"
FT   gene            598583..598999
FT                   /locus_tag="DET0648"
FT   CDS_pept        598583..598999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0648"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL04PA0672"
FT                   /db_xref="EnsemblGenomes-Gn:DET0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40118"
FT                   /db_xref="GOA:Q3Z8M5"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M5"
FT                   /protein_id="AAW40118.1"
FT                   /translation="MGISPALNLEEHVEKYHSPTRGYDAIIYTGSGLMGREIENIRSCD
FT                   VVIFAGGRSGTLGEFAIAYDEGKVIGVLRGSGGIADHLDKIIAMVDKETGARVYYESDP
FT                   HKLLDVLEAVYRERIFPRHKLLLENHSPDGIYDG"
FT   gene            complement(599284..599463)
FT                   /locus_tag="DET0649"
FT   CDS_pept        complement(599284..599463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40117"
FT                   /db_xref="GOA:Q3Z8M4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M4"
FT                   /protein_id="AAW40117.1"
FT                   /translation="MPHYSRRYCAGIAPVLHSKFKALLFFIYSARHKKYLCLIGQRYFS
FT                   HFKMTTLPIPRSAW"
FT   gene            599608..600624
FT                   /locus_tag="DET0650"
FT   CDS_pept        599608..600624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0650"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, periplasmic binding protein, putative"
FT                   /note="identified by similarity to OMNI:NTL01TT0342"
FT                   /db_xref="EnsemblGenomes-Gn:DET0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40108"
FT                   /db_xref="GOA:Q3Z8M3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M3"
FT                   /protein_id="AAW40108.1"
FT                   /translation="MLSDIKMKLNSKSARLGTAVASIFLSLVLLLGLAGGCKTADDTEN
FT                   EDDTPVVTEVSYPLTVTDQLGRTVTIQSEPQTIVSLSPSNTETIYAMGLEDKLVGVTTY
FT                   CNYPEAAADKPKVGGFSTVDVEAVTAIGPDIILASNLHESTVIPQLEQLGLTVIAISPD
FT                   NLEEVISSIELIGKCLNQVEKANSLVDGMQTRIDAVTAKVKNLSDSQKPRVLYIVWHEP
FT                   LMSVGSTAFITGLITAAGSVSITADSVEAYPTISLETVLGANPQVIVVGTGMGSGADAP
FT                   LIFMQDEPRLAAIDARINGNIYSINTDLIGRTGPRIVDALEQLAQMLHPEIFGAFSG"
FT   gene            600763..601767
FT                   /locus_tag="DET0651"
FT   CDS_pept        600763..601767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0651"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, permease component"
FT                   /note="identified by similarity to PIR:S54438"
FT                   /db_xref="EnsemblGenomes-Gn:DET0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40107"
FT                   /db_xref="GOA:Q3Z8M2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M2"
FT                   /protein_id="AAW40107.1"
FT                   /translation="MLGLLGLLLLAAIFAISFGSVEVPFFTTISIIISKIPFIHISPDW
FT                   TVNTQTIIWDIRLPRVLLAGVVGMALAVAGATYQGLFCNPLADPYLIGVAQGAAVGAVL
FT                   GLILGIGFDILGIFATPLFAFVGAFGAVGVVYMLARVGNRLTVTTLILAGVALGSFLTA
FT                   VVSYLITVSGDKIHSVMFWLMGSFSMAAWDSVKIVVPIVIIGTIVILLFARSLNLIQLG
FT                   EEQAQELGVDVERMKIFLLTAATLITAAAVSFVGIIGFVGIIVPHAVRLIWGADYRFLL
FT                   PLSALVGAVFMIMADIASRTLVAPNEIPVGAITALVGAPFFLYLLRKRTRMLF"
FT   gene            601779..602603
FT                   /locus_tag="DET0652"
FT   CDS_pept        601779..602603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0652"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system, ATP-binding protein"
FT                   /note="identified by similarity to SP:P23878"
FT                   /db_xref="EnsemblGenomes-Gn:DET0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40106"
FT                   /db_xref="GOA:Q3Z8M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M1"
FT                   /protein_id="AAW40106.1"
FT                   /translation="MFELEVRDITLAYGAVDVLRNVSFKTMPGEMIGLVGLNGSGKSTL
FT                   IKSLARVIEPRLGHIYINGRDSRTIPRLELAKMVGVVPQIPVLPSAFTAFEIVLMGRNP
FT                   HMGTFQYESRKDIAIAWEAMERAGVLHLAERQIGELSGGEIQSVVIARSLCQKTEAILL
FT                   DEPTSNLDIGRQIEVLDLIKSECRERNITVIAALHDLNLAAHYCERLILIDHNGIHADG
FT                   SPAEVITTENISRVYGPGSYVHTHPLSGLPAVLPRLGNTRCANGEKGGTGAR"
FT   gene            602593..603363
FT                   /locus_tag="DET0653"
FT   CDS_pept        602593..603363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MJ1613"
FT                   /db_xref="EnsemblGenomes-Gn:DET0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40105"
FT                   /db_xref="GOA:Q3Z8M0"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8M0"
FT                   /protein_id="AAW40105.1"
FT                   /translation="MPAEKVNIRTVAEFHGIKAEVIEHEVWGVPANALVVTFPEERRAL
FT                   SGRQGYRKVKAVCNIYLPDAIWPRLHNDKLSWNGYYRQVFSKALSAIGIPLSKVLVLST
FT                   GVTMDHLAFHEEKQGDLWVVVLATAGVESNALRIGQDKSSGIDRNGKFKPFGTINTIIL
FT                   TSESLPQSALASCFITATEAKTIALDELGVMSAYTPGLKASGTGTDQIVAVSGTGDKAT
FT                   YVGGHTLLGELMGRSVTLAIKEALTKRMASRKGH"
FT   gene            603365..604291
FT                   /gene="cobD-2"
FT                   /locus_tag="DET0654"
FT   CDS_pept        603365..604291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD-2"
FT                   /locus_tag="DET0654"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="identified by match to protein family HMM TIGR00380"
FT                   /db_xref="EnsemblGenomes-Gn:DET0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40104"
FT                   /db_xref="GOA:Q3Z8L9"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L9"
FT                   /protein_id="AAW40104.1"
FT                   /translation="MEVLFIFLLALIIDLVFGDPPNAFHPVAYMGRVIALFERAGFKGG
FT                   RVYQFVYGIVMVFIAMALFFIPVYFLLDWLHGVNSVVYIIVSAVLLKMCFTVTGLRKAA
FT                   LLIKQLLEKDDIAQARFELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLFFFL
FT                   IFGVPGVMAYRVVSTFDSMVGYRGKYEYLGKFAARFDDVLNFIPARLSALCILIASLFG
FT                   RYSPAGAWRIMWRDHAKTQSPNAGWPMATAAGALEVCLEKVGHYSLGDNIRELVPQTIS
FT                   RSLLLINSAAFIWVLISAGVIYFVRIA"
FT   gene            604275..605381
FT                   /locus_tag="DET0655"
FT   CDS_pept        604275..605381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0655"
FT                   /product="histidinol-phosphate aminotransferase, putative"
FT                   /note="identified by similarity to SP:P17731"
FT                   /db_xref="EnsemblGenomes-Gn:DET0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40103"
FT                   /db_xref="GOA:Q3Z8L8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L8"
FT                   /protein_id="AAW40103.1"
FT                   /translation="MSVSPKPQVEKLKPCYHGGPNYAELRKLGISPDAVMDFSVSSNPY
FT                   PAPVELKNALCSLVIDRYPDSDSAELKEYLAGRLSLKPENLIMGNGSMEIIRLVAGAYF
FT                   GVGDTVLILKPTFGEYELAAEVAGADIIEQWADEESGFKFDLDLTCRIIKKHQPKAVFI
FT                   CNPNNPTGVYLSKADIEKVLSVCTDTLLVLDEAYIAFAEGGWKSTDLLETGNIIVIRSM
FT                   TKDCALAGLRLGYGMASAEIITNLKKVCPPWNVNSAAQKAGLVCLCHPSYLAESEKKIK
FT                   ASKEYLRQGFAGLGFRVLPSETNFFLLKVKKAADFRSALLKHGLMVRDCTSFGLPQYVR
FT                   IAPRTQSECERLLAVAAELKSKSEIYPA"
FT   gene            complement(605514..605723)
FT                   /locus_tag="DET0656"
FT   CDS_pept        complement(605514..605723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0656"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40102"
FT                   /db_xref="GOA:Q3Z8L7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L7"
FT                   /protein_id="AAW40102.1"
FT                   /translation="MVIISMVVFQAMLSLSSSGACPNKKGAGTSQNIFKMSRPLYHQVS
FT                   GLVLTRLLASGLSPGSALPIRVLP"
FT   gene            605751..606809
FT                   /gene="cobT-1"
FT                   /locus_tag="DET0657"
FT   CDS_pept        605751..606809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT-1"
FT                   /locus_tag="DET0657"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="identified by similarity to SP:P36562"
FT                   /db_xref="EnsemblGenomes-Gn:DET0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40094"
FT                   /db_xref="GOA:Q3Z8L6"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L6"
FT                   /protein_id="AAW40094.1"
FT                   /translation="MELLNATLAKIHGLDKEAMTKAQAHQDILTKPQGSLGKLEAIAVQ
FT                   LAGIQGNAKPQTARKAIITMAGDHGIIDEKFHNWPKEVTAQMLQNFAHGGAAINVLSRQ
FT                   VGARNVVVALGVATPMAEDPNIINRNIAPGTNNMVYGPAMTREQAVKAIETGIEIVNAE
FT                   VKKGLDLVGTGDMGIGNTSPSAAICSVITGRSLEEVTGRGTGASDEQMKLKRNAIAKAI
FT                   ALNKPNAQDALDVLSKVGGYEIGGLAGVILGAAANRVGVVVDGFISGAAALIAYTICPQ
FT                   AKDFMFAAHQSVEPGHRILLEHMGLDAILKMDMRLGEGTGAALAMNIIEASNRIQHEMA
FT                   SFADAGVSEKQS"
FT   gene            606847..607611
FT                   /gene="cobS-1"
FT                   /locus_tag="DET0658"
FT   CDS_pept        606847..607611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS-1"
FT                   /locus_tag="DET0658"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="identified by similarity to SP:P36561; match to
FT                   protein family HMM TIGR00317"
FT                   /db_xref="EnsemblGenomes-Gn:DET0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40093"
FT                   /db_xref="GOA:Q3Z8L5"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L5"
FT                   /protein_id="AAW40093.1"
FT                   /translation="MGSFLAAFRFLTNIPVPWLKEDWQGEKSHLDFARSLGFYPLVGLI
FT                   VGLILAVLGWVFSLFLPDVLTAALLTVSLVVITGGLHLDGLTDTFDGIAAGHKSFERAQ
FT                   EVMHLPGVGAIGVLAAICLLLSKFAAIVSLPSGSFITGLILFPVISRWAMVYAVVCYPY
FT                   VRSQGLGKELKGGSAKASLWLATIFCLAVCVILGGWAGLLAMFGSWLLIMYLASFFRRR
FT                   LGGLNGDTYGSINEFTEVAALIFIVALSGYFS"
FT   gene            607631..608233
FT                   /locus_tag="DET0659"
FT   CDS_pept        607631..608233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0659"
FT                   /product="alpha-ribazole-5-phosphate phosphatase, putative"
FT                   /note="identified by similarity to SP:P52086"
FT                   /db_xref="EnsemblGenomes-Gn:DET0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40092"
FT                   /db_xref="GOA:Q3Z8L4"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L4"
FT                   /protein_id="AAW40092.1"
FT                   /translation="MKLILVRHGETETDNCRCYWGHSDIGLSDSGHAQANSLREYLSAV
FT                   RIDAIYSSPLKRCMETAETIAYGRPLSVNKNNDLKEIDFGRVEGLTYDDVLERYPDIAQ
FT                   KWAEGSFDVHFPDGEGMEHFAQRVVKFVKMLSKHREDETLLLVGHGGVFRILICHFLGI
FT                   DYKHWWQFTLGVGSVTVLDIYPEGSILEKLNDKSHLG"
FT   gene            608287..608853
FT                   /gene="cobU-1"
FT                   /locus_tag="DET0660"
FT   CDS_pept        608287..608853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU-1"
FT                   /locus_tag="DET0660"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanylyltransferase"
FT                   /note="identified by similarity to SP:P46886"
FT                   /db_xref="EnsemblGenomes-Gn:DET0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40091"
FT                   /db_xref="GOA:Q3Z8L3"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L3"
FT                   /protein_id="AAW40091.1"
FT                   /translation="MNYLLIGGARSGKSSYAEELAKSIGGNIVFVATAEAGDDEMKTRI
FT                   LRHQQARPPEWGLIEASLGVGEKISAHGKNADVIILDCITLLVNNIMCRYMLEHGDELT
FT                   GDAADYLDAAVKKEINDVIKAMEKTGASFIVVTNDVGAGLIPPNAMARIYRDLLGRANQ
FT                   MLGAYVEYVYLMVAGLPMQVKPLLR"
FT   gene            complement(608931..609254)
FT                   /gene="trx-1"
FT                   /locus_tag="DET0661"
FT   CDS_pept        complement(608931..609254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx-1"
FT                   /locus_tag="DET0661"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:DET0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40090"
FT                   /db_xref="GOA:Q3Z8L2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L2"
FT                   /protein_id="AAW40090.1"
FT                   /translation="MVMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLST
FT                   KYEGKFKFCKLNVDENKTTAAQYRVMSIPTLLFFKSGQVADMVVGAVPESALSQKIDQL
FT                   LQK"
FT   gene            complement(609345..610490)
FT                   /locus_tag="DET0662"
FT   CDS_pept        complement(609345..610490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0662"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DET0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40089"
FT                   /db_xref="GOA:Q3Z8P5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8P5"
FT                   /protein_id="AAW40089.1"
FT                   /translation="MKKVFSFFYSQIRRLPRLFANVHIWILILLFTGGFFLHYPQLLPF
FT                   IGQIEPDSFLYLTRHSVGRLIMLLPVTYTALVFGLRPGLLSLVLAIAIIIPNIFVTDTV
FT                   TPDDIIEIIGIIIIGLVVNLWLESYETDKKHRQQAYLKMETAQRELQRMQQNLRFYLKQ
FT                   ITIAQEDERRRIAQELHDDTAQDLIVISRAIDRFVTQNPNLGEDNLAELEELQNHVNRT
FT                   LSEVRRFAQDLRPSVLDDLGLIPALEWLIPDLSKHFGINIDIDVNGEIRRFAPETELVL
FT                   FRIVQESLRNVGKHAQATKAWVYIDFGKYKATLTIKDNGRGFLLPERVGDLAALGKLGL
FT                   TGMQERAQLIGGRLSIQSKPEVGTMVTVAVPNSGNLEDNEV"
FT   gene            complement(610507..611181)
FT                   /locus_tag="DET0663"
FT   CDS_pept        complement(610507..611181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0663"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:DET0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40088"
FT                   /db_xref="GOA:Q3Z8L1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L1"
FT                   /protein_id="AAW40088.1"
FT                   /translation="MQTTQMIKVLLADDHVIVREGTRELIQRESGMMVVGEASDGVEAV
FT                   EMSMKVHPDVVVMDIAMPRLNGIEATKQIKQLLPTTAILILTAYESEQYILAILEAGAA
FT                   SFLLKNVKGTQLLEAIRAVYAGESVLQPSTTRRVIDQLINKATKTEEVSAVNPLTDREI
FT                   EVLKMAARGVSNKDIADQLYLSNRTIQTHLSNIFKKLSVGSRTEAILYGLKRGWFIMED
FT                   LP"
FT   gene            complement(611252..611896)
FT                   /locus_tag="DET0664"
FT   CDS_pept        complement(611252..611896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0664"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DET0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40087"
FT                   /db_xref="GOA:Q3Z8L0"
FT                   /db_xref="InterPro:IPR024264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8L0"
FT                   /protein_id="AAW40087.1"
FT                   /translation="MINSGEGFRLPDQRNFELATQRTLELNRSRFLATQDFNKICQNSG
FT                   AVFQPPFIQLEYFGFKVKVDTRNAAVTSPDTDLSLREEALILHYLLKADRTPVLHEQIS
FT                   FKELPEGANYQPVFYNRVLKGLIALYTADKAKLSLSALSLGGKKTDQADMSFLFQALPR
FT                   LPLWLVFWQGDDEFPPEGNIIFDRSISHYLDTEAITEICQNLGHRLSQKTP"
FT   gene            complement(611915..613261)
FT                   /gene="acsC-1"
FT                   /locus_tag="DET0665"
FT   CDS_pept        complement(611915..613261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsC-1"
FT                   /locus_tag="DET0665"
FT                   /product="corrinoid/iron-sulfur protein, large subunit"
FT                   /note="identified by similarity to SP:Q07340"
FT                   /db_xref="EnsemblGenomes-Gn:DET0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40078"
FT                   /db_xref="GOA:Q3Z8K9"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8K9"
FT                   /protein_id="AAW40078.1"
FT                   /translation="MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLAGGRAELSACPYV
FT                   SEEAKQKLEEASAPPVRTVSIGTGDYSFKTGGETVMHRHEKRFEHQPGIALLISDSLSE
FT                   TEQDAKLAAFTRFQYKRVGAILKPDMLALRADSGSGEKYLKLVKLAAGKCPASLMLMCA
FT                   DTAVLDESLKICAERKPLLYAATAENSSEMAELAKKYNCPLVAKAANLADLADLSVKLQ
FT                   SLGIKDIVLDSSAENLKQALSDNVAIRRSAILKKFRPMGFPVINFPGQMTQDPMKESLF
FT                   AGILTAKYAGILVLSDFSGETLFPLLVTRMNLYTDPQRPLATTEGIYEINNPDANSPVI
FT                   LTCNFSLTYFIVSGEMENSRVPCYLMIKDTEGLSVMTAWAAGKFGADTIGKFVKNSGIA
FT                   AKINHRKLIIPGYASMESGGLEEELSGWEIMVGPREAAHIPAYLKQFKP"
FT   gene            complement(613282..615483)
FT                   /locus_tag="DET0666"
FT   CDS_pept        complement(613282..615483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0666"
FT                   /product="carbon monoxide dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.7.4"
FT                   /note="identified by similarity to SP:P27988; match to
FT                   protein family HMM TIGR00316"
FT                   /db_xref="EnsemblGenomes-Gn:DET0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40077"
FT                   /db_xref="GOA:Q3Z8K8"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="InterPro:IPR041350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8K8"
FT                   /protein_id="AAW40077.1"
FT                   /translation="MSNTVAEASINSARNIVNASYKIFKQELAANCPDTAVGFPNTAYF
FT                   LPVIYGILGIQVEKLSDMEAVFDKCFKMLPPPEVKAEEITELGAVLEAGLATLFAEEML
FT                   EALRYLSQPEYYTNTEDPTPDNIWLGAADDIILRKRGVEFVDGTAPGFAAIIGAAPDNA
FT                   TAESIAAELQQKNLYTFMCGESQGKRFASQLADAGVELGWTPRLVSFGDEPTAAIFAFG
FT                   FAVRVALSFGNVEPGNRAKLFEYSQERIKAFVMPLGDISDEWYANAAGALNFGFPIIAD
FT                   KSVLPILPGVDTVDSVLAGIPYDRIVSKAMDVRGIKVNITKVPVPVAYGPAYEGERVRG
FT                   EQIYLECGGGRTQMVELVTTAGMDDVTDGKIELFGQDIANVPEGSRLPLAIVVEAAGHK
FT                   MNEDYEPILERQIHHLLNYAQGVMHIGQRDIAWLRVSKGAAAKGFSLKHIGSILHAKLH
FT                   QDFGGIVDKIQIKLYTTPEKVAEISGQSKKIYAKRDERIEGMTDENTETFYSCTLCQSF
FT                   APSHVCIVSPERTGLCGAYNWMDCRASNEINNLGPNQPVNKGAVIDAKLGQWSGINQFV
FT                   EKTSGGVVSHYNLYSIIHDPMTTCGCCECIAAILPLCNGVMTVNREYAGMTPCGMKFTT
FT                   LAGTIGGGITTPGFLGHSKYNITQRKFISAEDGLLRLVWMPKSLKDEIRERFNARAAEL
FT                   GIPDLLERIADESVGTTEEEILPFLEAKQHPALTLEPLI"
FT   gene            complement(615543..616484)
FT                   /gene="acsD-1"
FT                   /locus_tag="DET0667"
FT   CDS_pept        complement(615543..616484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsD-1"
FT                   /locus_tag="DET0667"
FT                   /product="corrinoid/iron-sulfur protein, small subunit"
FT                   /note="identified by similarity to SP:Q07341"
FT                   /db_xref="EnsemblGenomes-Gn:DET0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40076"
FT                   /db_xref="GOA:Q3Z8K7"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8K7"
FT                   /protein_id="AAW40076.1"
FT                   /translation="MAFEIPKINYNGRIKEITLGEGPKAVTVGGETSMPFYLFEGEMPR
FT                   KPKIAMEIQDTPPEDWPEDVLKPFGDAVNNPVSWAKKCVDTYGAELICLQLESTDPNGL
FT                   DRSAEESAKIVREVADAVDVPLIVWGTANHEKDTEVLRKASEACPDKKLILGPVEEGDY
FT                   KKIAAQAMAYKHTIIASSPIDINLAKQLNILLGNLGVPAEGLIMDPTVSSIGYGIEYSY
FT                   SVIERIRLAALTQQDERLQYPLICNIGREAWKTKEAKIPEAESPEMGNTEKRAIMIEAM
FT                   SAAILLIAGADILVIRHPESMRLAGELIDELS"
FT   gene            complement(616520..617410)
FT                   /gene="folD-1"
FT                   /locus_tag="DET0668"
FT   CDS_pept        complement(616520..617410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD-1"
FT                   /locus_tag="DET0668"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /note="identified by similarity to SP:P54382"
FT                   /db_xref="EnsemblGenomes-Gn:DET0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40075"
FT                   /db_xref="GOA:Q3Z8K6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z8K6"
FT                   /protein_id="AAW40075.1"
FT                   /translation="MSAHIINGTEIAAAIREEIRSEVTALKAKHGIVPGLATVLVGDDP
FT                   ASHSYVDSKIKMCQNLGIYSEHHPLPQSATNEDLLTLIARLNADPKISGILVQVPLPVQ
FT                   ISENLVLNAINPDKDVDGFHPVNVGRMCLGEPCFLPCTPHGVQELLIRSGIKIEGTHVV
FT                   IVGRSNLVGKPLANILLQKAPGANATVTICHSGTKNLPLITSQADILVSAMGKPKFITA
FT                   DMVRQGAVVIDVGTTCIGYTPEGKRILSGDVDFEAVKEKAFAITPVPKGVGPMTIIMLM
FT                   LNTLTAAKRAAGLVK"
FT   gene            complement(617410..618192)
FT                   /gene="acsF-1"
FT                   /locus_tag="DET0669"
FT   CDS_pept        complement(617410..618192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsF-1"
FT                   /locus_tag="DET0669"
FT                   /product="carbon monoxide dehydrogenase nickel-insertion
FT                   accessory protein"
FT                   /note="identified by similarity to GP:20467243; match to
FT                   protein family HMM PF00991"
FT                   /db_xref="EnsemblGenomes-Gn:DET0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40074"
FT                   /db_xref="GOA:Q3Z8K5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z8K5"
FT                   /protein_id="AAW40074.1"
FT                   /translation="MTYTIALAGKGGVGKTSVSSLIIRQLLKNSLTPVLAVDADANANL
FT                   GESLGLDVPQTVGGLIASFNNVKLNLPPGMTKEAYLEYQLNTTLAESTGLDMISMGRGE
FT                   GDGCYCYPNSILRSYIDKLSQNYRYVVMDNEAGMEHLSRRTTQNVDHLFIVSDHSVKGV
FT                   RTLGRIRQLVDEMKLNVSQISVIINMVTGTLDPRLEAEINKLGIAYTDTVPADEMIREF
FT                   DLKQTPLLKLPDNSPAVQAVAKILSTRLGIKNRTEVSE"
FT   gene            complement(618189..620111)
FT                   /locus_tag="DET0670"
FT   CDS_pept        complement(618189..620111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DET0670"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DET0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40073"
FT                   /db_xref="GOA:Q3Z8K4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT