(data stored in ACNUC7421 zone)

EMBL: CP000031

ID   CP000031; SV 2; circular; genomic DNA; STD; PRO; 4109437 BP.
XX
AC   CP000031;
XX
PR   Project:PRJNA281;
XX
DT   17-DEC-2004 (Rel. 82, Created)
DT   28-MAY-2015 (Rel. 124, Last updated, Version 13)
XX
DE   Ruegeria pomeroyi DSS-3, complete genome.
XX
KW   .
XX
OS   Ruegeria pomeroyi DSS-3
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Ruegeria.
XX
RN   [1]
RP   1-4109437
RX   DOI; 10.1038/nature03170.
RX   PUBMED; 15602564.
RA   Moran M.A., Buchan A., Gonzalez J.M., Heidelberg J.F., Whitman W.B.,
RA   Kiene R.P., Henriksen J.R., King G.M., Belas R., Fuqua C., Brinkac L.,
RA   Lewis M., Johri S., Weaver B., Pai G., Eisen J.A., Rahe E., Sheldon W.M.,
RA   Ye W., Miller T.R., Carlton J., Rasko D.A., Paulsen I.T., Ren Q.,
RA   Daugherty S.C., Deboy R.T., Dodson R.J., Durkin A.S., Madupu R.,
RA   Nelson W.C., Sullivan S.A., Rosovitz M.J., Haft D.H., Selengut J., Ward N.;
RT   "Genome sequence of Silicibacter pomeroyi reveals adaptations to the marine
RT   environment";
RL   Nature 432(7019):910-913(2004).
XX
RN   [2]
RP   1-4109437
RX   DOI; 10.1128/AEM.02580-06.
RX   PUBMED; 17526795.
RA   Moran M.A., Belas R., Schell M.A., Gonzalez J.M., Sun F., Sun S.,
RA   Binder B.J., Edmonds J., Ye W., Orcutt B., Howard E.C., Meile C.,
RA   Palefsky W., Goesmann A., Ren Q., Paulsen I., Ulrich L.E., Thompson L.S.,
RA   Saunders E., Buchan A.;
RT   "Ecological genomics of marine Roseobacters";
RL   Appl. Environ. Microbiol. 73(14):4559-4569(2007).
XX
RN   [3]
RC   Publication Status: Online-Only
RP   1-4109437
RX   DOI; 10.1186/1944-3277-9-11.
RX   PUBMED; 25780504.
RA   Rivers A.R., Smith C.B., Moran M.A.;
RT   "An Updated genome annotation for the model marine bacterium Ruegeria
RT   pomeroyi DSS-3";
RL   Stand Genomic Sci 9:11-11(2014).
XX
RN   [4]
RP   1-4109437
RA   Moran M.A., Buchan A., Gonzalez J.M., Heidelberg J.F., Whitman W.B.,
RA   Kiene R.P., Henriksen J.R., King G.M., Belas R., Fuqua C., Brinkac L.,
RA   Lewis M., Johri S., Weaver B., Pai G., Eisen J.A., Rahe E., Sheldon W.M.,
RA   Ye W., Miller T.R., Carlton J., Rasko D.A., Paulsen I.T., Ren Q.,
RA   Daugherty S.C., DeBoy R.T., Dodson R.J., Durkin A.S., Madupu R.,
RA   Nelson W.C., Sullivan S.A., Rosovitz M., Haft D.H., Selengut J., Ward N.L.;
RT   ;
RL   Submitted (21-OCT-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [5]
RC   Sequence update by submitter
RP   1-4109437
RA   Rivers A.R., Smith C.B., Moran M.A.;
RT   ;
RL   Submitted (26-NOV-2013) to the INSDC.
RL   Marine Science, University of Georgia, 325 Samford Dr, Athens, GA 30602,
RL   USA
XX
DR   MD5; 83beef6c4379a05d6a99ca9f2899a406.
DR   BioSample; SAMN02604003.
DR   EnsemblGenomes-Gn; SPO_Sp16SA.
DR   EnsemblGenomes-Gn; SPO_Sp16SB.
DR   EnsemblGenomes-Gn; SPO_Sp16SC.
DR   EnsemblGenomes-Gn; SPO_Sp23SA.
DR   EnsemblGenomes-Gn; SPO_Sp23SB.
DR   EnsemblGenomes-Gn; SPO_Sp23SC.
DR   EnsemblGenomes-Gn; SPO_Sp5SD.
DR   EnsemblGenomes-Gn; SPO_Sp5SE.
DR   EnsemblGenomes-Gn; SPO_Sp5SF.
DR   EnsemblGenomes-Gn; SPO_SprnpB1.
DR   EnsemblGenomes-Gn; SPO_SptmRNA1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ala-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ala-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ala-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ala-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Arg-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Arg-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Arg-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Arg-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Asn-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Asn-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Asp-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Asp-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Cys-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gln-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gln-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Glu-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Glu-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gly-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gly-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gly-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gly-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Gly-6.
DR   EnsemblGenomes-Gn; SPO_tRNA-His-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ile-1.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ile-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ile-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Leu-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Leu-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Leu-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Leu-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Leu-6.
DR   EnsemblGenomes-Gn; SPO_tRNA-Lys-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Met-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Met-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Met-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Met-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Pro-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Pro-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Pro-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Pro-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Pseudo-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ser-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ser-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ser-4.
DR   EnsemblGenomes-Gn; SPO_tRNA-Ser-5.
DR   EnsemblGenomes-Gn; SPO_tRNA-Thr-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Thr-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Trp-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Val-2.
DR   EnsemblGenomes-Gn; SPO_tRNA-Val-3.
DR   EnsemblGenomes-Gn; SPO_tRNA-Val-4.
DR   EnsemblGenomes-Tr; SPO_Sp16SA-1.
DR   EnsemblGenomes-Tr; SPO_Sp16SB-1.
DR   EnsemblGenomes-Tr; SPO_Sp16SC-1.
DR   EnsemblGenomes-Tr; SPO_Sp23SA-1.
DR   EnsemblGenomes-Tr; SPO_Sp23SB-1.
DR   EnsemblGenomes-Tr; SPO_Sp23SC-1.
DR   EnsemblGenomes-Tr; SPO_Sp5SD-1.
DR   EnsemblGenomes-Tr; SPO_Sp5SE-1.
DR   EnsemblGenomes-Tr; SPO_Sp5SF-1.
DR   EnsemblGenomes-Tr; SPO_SprnpB1-1.
DR   EnsemblGenomes-Tr; SPO_SptmRNA1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ala-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ala-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ala-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ala-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Arg-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Arg-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Arg-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Arg-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Asn-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Asn-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Asp-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Asp-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Cys-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gln-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gln-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Glu-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Glu-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gly-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gly-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gly-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gly-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Gly-6-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-His-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ile-1-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ile-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ile-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Leu-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Leu-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Leu-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Leu-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Leu-6-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Lys-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Met-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Met-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Met-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Met-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Pro-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Pro-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Pro-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Pro-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Pseudo-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ser-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ser-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ser-4-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Ser-5-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Thr-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Thr-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Trp-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Val-2-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Val-3-1.
DR   EnsemblGenomes-Tr; SPO_tRNA-Val-4-1.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4127530; 25157246.
DR   EuropePMC; PMC4334477; 25780504.
DR   EuropePMC; PMC4543880; 26347732.
DR   EuropePMC; PMC4809877; 27065955.
DR   EuropePMC; PMC5348524; 28352252.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000031.
DR   SILVA-SSU; CP000031.
DR   StrainInfo; 118527; 1.
XX
CC   On Dec 10, 2013 this sequence version replaced gi:56676665.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4109437
FT                   /organism="Ruegeria pomeroyi DSS-3"
FT                   /strain="DSS-3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246200"
FT   gene            1..1869
FT                   /gene="gidA"
FT                   /locus_tag="SPO0001"
FT   CDS_pept        1..1869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SPO0001"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by similarity to SP:P17112; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93332"
FT                   /db_xref="GOA:Q5LWF3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF3"
FT                   /protein_id="AAV93332.1"
FT                   /translation="MKHSDFDIVVIGAGHAGAEAAHAAARMGMRTALVSLSERDIGVMS
FT                   CNPAIGGLGKGHLVREIDALDGVMGRVADKAGIQFRLLNRRKGPAVQGPRAQADRKLYR
FT                   LAMQEEMRNRPGLTIVEGEVTDFRMQGDRVAGVVLADGSEIASQAVILTSGTFLRGIIH
FT                   IGDVSRPGGRMGDRPSVPLAERLDGFALPMGRLKTGTPPRLDGRTIDWSILERQDGDDD
FT                   PVLFSFLSKGAYARQIACGITHTNAQTHEIIRKNLSRSAMYGGHIEGVGPRYCPSIEDK
FT                   IVRFADKDSHQIFLEPEGLEDHTVYPNGISTSLPVDVQEDYVRSIRGLEQVEILQPGYA
FT                   IEYDYVDPRALTSQLSLPNVPGLYLAGQINGTTGYEEAAAQGMVAGLNAATAILGHEPV
FT                   PFSRANSYIGVMIDDLTTRGVAEPYRMFTSRAEFRLSLRADNADQRLTPLGLELGCVGD
FT                   ERRDVFARKAEKLATASALLDQSSFSPKEIATAGITISQDGNRRNGFAVLAFPDVRFDD
FT                   LVPLIPELADTDAETRAQVERDALYANYIARQERDVEAMKRDEALVIPIDFNFSALDGL
FT                   SNELKQKLTSARPENIAQAGRVEGMTPAALALILARLRRGDRARSA"
FT   gene            1866..2480
FT                   /gene="gidB"
FT                   /locus_tag="SPO0002"
FT   CDS_pept        1866..2480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SPO0002"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93333"
FT                   /db_xref="GOA:Q5LWF2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF2"
FT                   /protein_id="AAV93333.1"
FT                   /translation="MMVPDANTLNVSRETFERLKIFADLVHKWNPRINLVSKRSLEDLW
FT                   TRHIIDSIQVFRNAPKGDLWVDLGSGGGFPGLICAILAAEEKPETQFICVESDQRKSAF
FT                   LRSAARECGIACQVISERIEHLDPLDADILSARALTDLTGLLGFAERHLKIGGTALFPK
FT                   GAAWKKELQDAAKQWNFSYDAVTSLTEPQAVLLKITGVTRV"
FT   gene            2473..3276
FT                   /gene="parA"
FT                   /locus_tag="SPO0003"
FT   CDS_pept        2473..3276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SPO0003"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by similarity to SP:O05189; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93334"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF1"
FT                   /protein_id="AAV93334.1"
FT                   /translation="MSDLSRPAGPRIIAVANQKGGVGKTTTAINLAAALVESGQRVLVV
FT                   DLDPQGNASTGLGVDERELTTYELLVDDAPLNSVIQKTSIDGLSIVPATVDLSSADIEL
FT                   ISNEKRSFLLHDALRQTAMDAYSWDYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFA
FT                   LEGLSQLMLTIREVRQAANPNLRIEGIVLTMYDRRNNLSQQVEKDARDNLGDLVFETKI
FT                   PRNVRVSEAPSFAMPVLNYDPNSLGAMAYRDLAAELMKKHNKIAA"
FT   gene            3299..4189
FT                   /gene="parB"
FT                   /locus_tag="SPO0004"
FT   CDS_pept        3299..4189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SPO0004"
FT                   /product="chromosome partitioning protein parB"
FT                   /note="identified by similarity to SP:O05190; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93335"
FT                   /db_xref="GOA:Q5LWG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG0"
FT                   /protein_id="AAV93335.1"
FT                   /translation="MVSNKPRGLGRGLSALMADVTQPAEAAASEAARRPDRTVPIEKLR
FT                   ANPNQPRRTFTEDALQELAASIKEKGVLQPLIVRPVDGDMYEIVAGERRWRAAQLAQLH
FT                   QVPVLVRELDDTEVLEIAIIENIQRADLNAVEEAAGYRQLMDKFGHTQEKLAEALGKSR
FT                   SHIANLLRLLSLPDDVQTLVVEGKLSAGHARALITSDNPSELAKIVVRDGLSVRATEAL
FT                   VKKQAEGDKPTATARPKSITADKDADTRALEKDLSAILAMKVAINHKPGTETGQVVLTY
FT                   ENLDQLDDLCAKLSR"
FT   gene            complement(4179..4532)
FT                   /locus_tag="SPO0005"
FT   CDS_pept        complement(4179..4532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN55061.1; match to
FT                   protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93336"
FT                   /db_xref="GOA:Q5LWF9"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF9"
FT                   /protein_id="AAV93336.1"
FT                   /translation="MQFIWAALGLVCVALALIGVALPLLPTVPFLLLAAFFFARSSERL
FT                   HTWLVTHRLFGPMILDWQQSGAIRPGAKKAATLSIAAVFGLSLVFAVPSHVLLIQAVVL
FT                   SGVLIFIWTRPNG"
FT   gene            complement(4536..5693)
FT                   /locus_tag="SPO0006"
FT   CDS_pept        complement(4536..5693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0006"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93337"
FT                   /db_xref="GOA:Q5LWF8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF8"
FT                   /protein_id="AAV93337.1"
FT                   /translation="MADDWQHGGFGLYVHWPFCQAKCPYCDFNSHVAREIDQKAWVRAY
FT                   VSELERCAAELPGRVLNTIFFGGGTPSLMMPETVAAVIETVRRLWPTSNDMEITLEANP
FT                   GSVEAGRFAAYRDGGVNRISMGVQALNDRDLHRLGRIHSVAEARAAFDIARRCFERVSF
FT                   DLIYARQDQTPEAWRAELNEALAMAVDHLSLYQLTIEDGTAFGDRYARGKLRGLPADDD
FT                   AADMYLITQEVCATHGLPAYEVSNHARPGSESRHNLIYWRYGDYVGIGPGAHGRITVDG
FT                   QRFATESPLNPGAWLGAVAKGSGELSRVALSLQDQADEYLMMGLRIAEGLDIHRYEALS
FT                   PQPLNRNRLAHLTELGMIEIEGTRLKATAQGRAVLNAVILDLMSE"
FT   gene            complement(5683..6297)
FT                   /locus_tag="SPO0007"
FT   CDS_pept        complement(5683..6297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0007"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93338"
FT                   /db_xref="GOA:Q5LWF7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF7"
FT                   /protein_id="AAV93338.1"
FT                   /translation="MTRAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEP
FT                   EETEDTFVGNARIKAHAAARATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFL
FT                   MAMTRAHDALEAKSAPHPRLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGY
FT                   DPMFVPEGYDVTFAEMDRWEKNKISHRARAVEKFVKGCFGG"
FT   gene            complement(6294..7007)
FT                   /gene="rph"
FT                   /locus_tag="SPO0008"
FT   CDS_pept        complement(6294..7007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="SPO0008"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by similarity to SP:P03842; match to
FT                   protein family HMM PF01138; match to protein family HMM
FT                   PF03725; match to protein family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93339"
FT                   /db_xref="GOA:Q5LWF6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF6"
FT                   /protein_id="AAV93339.1"
FT                   /translation="MRPSGRDLSEMRPVSIETGFTKHAEGSCLIKMGDTHVLCTATIED
FT                   RVPPFIKGSGLGWVTAEYGMLPRATNTRMRREAASGKQGGRTVEIQRLIGRALRAGVDR
FT                   VALGERQITVDCDVIQADGGTRCASITGGWVALRLAVNKLMKAGDVISDPLVDPVAAVS
FT                   CGIYAGQPVLDLDYPEDSEAGVDGNFIMTGSGKLIEVQMSAEGSVFNRAQLDQLLGLAE
FT                   KGVGELVAAQMAATA"
FT   gene            7130..8194
FT                   /gene="hrcA"
FT                   /locus_tag="SPO0009"
FT   CDS_pept        7130..8194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SPO0009"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by similarity to SP:P54305; match to
FT                   protein family HMM PF01628; match to protein family HMM
FT                   TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93340"
FT                   /db_xref="GOA:Q5LWF5"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF5"
FT                   /protein_id="AAV93340.1"
FT                   /translation="MSDARKILDDLNDRSREVFRLIVESYLDSGEPVGSRTLTRTLSEK
FT                   VSAATVRNVMQDLEFLGLLDSPHISAGRIPTQMGLRMFVDGLLEVADLSLDDRAKLDAT
FT                   LGTNAGDVGGTLDRISATLSRVTQGASLVLTPKHEAEIRHIEFVSLAQDRALVVLVFSD
FT                   GHVENRLFAPPPGQTPSSMREAANFLNALIEGKTLSEVRRLMQTEIGARQQEIDQLARQ
FT                   MVESGLAVWDREGEEAARLIVRGRANLLEGTGQEQELERIRVLFDDLERKRDIAEFLQL
FT                   TEDGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVD
FT                   YTAQLVGRLISDRS"
FT   gene            8205..8768
FT                   /gene="grpE"
FT                   /locus_tag="SPO0010"
FT   CDS_pept        8205..8768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SPO0010"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93341"
FT                   /db_xref="GOA:Q5LWF4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF4"
FT                   /protein_id="AAV93341.1"
FT                   /translation="MAKPNNEEFLDDIATAEAEELAEEMAEISDEAAELDTLRAERDAF
FT                   KDKFMRALADAENVRKRGERARREAEQYGGSKLARDMLPVYDNMKRALETVTDEQRAVS
FT                   GALIEGIELTMRALLDVFGKHGIQVLSPQVGDRFDPQMHEAMFEAPVPGTKAGDIIQVS
FT                   AEGFMLHDRLLRPAQVGVSSMPAG"
FT   gene            complement(8822..11455)
FT                   /gene="mutS"
FT                   /locus_tag="SPO0011"
FT   CDS_pept        complement(8822..11455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="SPO0011"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01624; match to protein
FT                   family HMM PF05188; match to protein family HMM PF05190;
FT                   match to protein family HMM PF05192; match to protein
FT                   family HMM TIGR01070"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93342"
FT                   /db_xref="GOA:Q5LWH0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWH0"
FT                   /protein_id="AAV93342.1"
FT                   /translation="MTTVTPMMAQYLEIKEAYADALLFYRMGDFYEMFFDDAVAAAEAL
FT                   DIALTKRGKHEGEDIPMCGVPVHAAEGYLLTLIRKGFRVAVCEQMESPAEAKKRGSKSV
FT                   VRRDVVRLVTPGTLTEDALLEARRHNFLVAYAEVRSGAALAWADISTGDFHVMPVTRPR
FT                   LSPELARLAPSELLVVDEPVFQQLRPLADDHRIPLTPLGKASFDSMAAEKRLCELYKVG
FT                   SLEGFGTFARAELSAMGALIDYLDITQKGKLPLLQPPVQEAEDRVMQIDAATRRNLELT
FT                   RSLSGERGGSLLSVIDRTVTPGGARLLEQRLGSPSRNLDVIHARLSALDFCIDHSTLAA
FT                   DLRAALRKTPDLDRALSRLALDRGGPRDLAAIRNGLGQAEAIAALCDGLELPGLIAGAC
FT                   ADLNGFDELLGLLDTALVAEPPLLARDGGFIAPGYDSDLDEARELRDKGRGVIAGMQQK
FT                   YAEHTGIASLKIKHNNVLGYFIETTATHAAKMLNPPLSETYIHRQTTANQVRFTTVELS
FT                   ELETRILNAGNHALEIEKRLYSSLSGAVLEQAARLNIAARGLAELDLATALADLARAEN
FT                   WCRPSVDPSRAFAIEGGRHPVVEHALRRQGGDPFVANDCDLSADKGAAIRLLTGPNMAG
FT                   KSTYLRQNALITLLAQIGSYVPADSAHIGVVSQLFSRVGASDDLARGRSTFMVEMVETA
FT                   AILNQADDHALVILDEIGRGTATYDGLSIAWATLEHLHATNRCRALFATHYHELTALAA
FT                   TLDGVENLTVAVKEWEGEVIFLHEVRKGAADRSYGVQVAQLAGLPPSVVARARVVLDQL
FT                   EKSEREGGKQKALIDDLPLFSAAPPLPPPAPKTSPADAMLKEIHPDELTPRQALEMLYK
FT                   LKEAAR"
FT   gene            11598..13853
FT                   /gene="maeB"
FT                   /locus_tag="SPO0012"
FT   CDS_pept        11598..13853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="SPO0012"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="identified by similarity to SP:O30808; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF01515; match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93343"
FT                   /db_xref="GOA:Q5LWG9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG9"
FT                   /protein_id="AAV93343.1"
FT                   /translation="MPKAKITNEEALAFHLEPTPGKWEVQATVPMTTQRDLSLAYSPGV
FT                   AVPCEAIAADPGLAYDYTNKGNLVAVISNGTAVLGLGNLGALGGKPVMEGKAVLFKRFA
FT                   DVNSIDIELDTEDPDEFCRAVRLMGPTFGGINLEDIKAPECFIIEQRLKEEMDIPVFHD
FT                   DQHGTAVICAAGLINALHISGKKIEDVKIVLNGAGAAGIACIELLKTMGARHENCIVCD
FT                   TKGVIFQGRTEGMNQWKSAHAIKTELRSLEEAMKGADVFLGVSVKGAVTQEMVQSMADN
FT                   PVIFAMANPDPEITPEEAHEVRPDAIVATGRSDYPNQVNNVLGFPYLFRGALDIHARAI
FT                   NDEMKIACAHALAALAREDVPDEVAMAYGKSLAFGRDYIIPTPFDPRLIHRIPPAVARA
FT                   GMDTGAARRPIIDMDAYELGLKSRMDPTASILRGINARARKAQSRMIFAEGDDPRVLRA
FT                   AVTYQRSGYGKALVVGRHDDVKAKLEAAGLGDAVRELEVVNAANTTHLETYKEFLYSRL
FT                   QRKGFDNKDVHRLAARDRHVFSALMLAHGHGDGLVTGATRKSAHVLHQISHVFDADAAH
FT                   GAAGITALLHKGKIVLIGDTLVHEWPDEHDLATIAERAADVARHMGLEPRVAFVSFSTF
FT                   GYPISERTEKLTKAPKVLEARGVSFEFEGEMTVDVALNPRSKEAYPFSRLTGPANILIV
FT                   PARHSASISTKLMQEMAGATVIGPILTGVDKPIQICSTVSTANDILNMAVLASAEIG"
FT   gene            13857..14729
FT                   /gene="rbsK"
FT                   /locus_tag="SPO0013"
FT   CDS_pept        13857..14729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="SPO0013"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="identified by similarity to SP:P05054; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93344"
FT                   /db_xref="GOA:Q5LWG8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG8"
FT                   /protein_id="AAV93344.1"
FT                   /translation="MAIWNLGSINADMVYAVPHLPGPGETLAASGLERFLGGKGANMSV
FT                   AAARAGSQVRHIGAVGPEGRWAIDRLTEYGVDTRHIATLEAPTGHAIIAVEPGGENLIV
FT                   LLPGANRAISPERVGSVLLDAAPGDLLVMQNETSAQVEAARLGRERGLTVCYAAAPFDA
FT                   QAVRDVLPWLDFLILNAVEAEQLQEATGLTPDQLPVSHVIVTLGSKGARHFDTDKGIST
FT                   EYPAYRVKAVDTTGAGDTFTGYVLSGMDRGLPMPQAITQAMRAAALMVMRHGTADVIPD
FT                   LKEVLAARF"
FT   gene            complement(14726..15388)
FT                   /gene="msrA-1"
FT                   /locus_tag="SPO0014"
FT   CDS_pept        complement(14726..15388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="SPO0014"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by similarity to SP:Q93P63; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93345"
FT                   /db_xref="GOA:Q5LWG7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG7"
FT                   /protein_id="AAV93345.1"
FT                   /translation="MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCV
FT                   EADFEKVPGVLGAVSGYTGGTLDNPTYKQVTRGGTGHFEAVQILFDPDQVSRERLLHMF
FT                   FRSVDPTDAGGQFCDRGDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILTAGR
FT                   FYPAEAYHQDYAKGEKLVLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS"
FT   gene            15491..16264
FT                   /locus_tag="SPO0015"
FT   CDS_pept        15491..16264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93346"
FT                   /db_xref="GOA:Q5LWG6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG6"
FT                   /protein_id="AAV93346.1"
FT                   /translation="MEPAGQGVSVRPKPAIGEQNMKIAMWSGPRNLSTAMMYAFGARTD
FT                   CAVIDEPFYAAYLAMTGLHHPMREEVLAAQSQDPGQVAAMLSGPNPGARPFWYQKHMTQ
FT                   HMIPGIPRDWMRSVCNVFLIRHPARVIASYAEKRENPTLEDIGFRQQAELFDEVSGWGG
FT                   DPLVIDSHDIREDPARMLERLCDRIGVPWSPHMLSWPKGGHKDDGVWARHWYGAVWNST
FT                   GFAGPEGDLPEVPEALQPVLQAAMPFYERMRAVKI"
FT   gene            complement(16332..16613)
FT                   /locus_tag="SPO0016"
FT   CDS_pept        complement(16332..16613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0016"
FT                   /product="sterol carrier family protein"
FT                   /note="identified by match to protein family HMM PF02036"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93347"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG5"
FT                   /protein_id="AAV93347.1"
FT                   /translation="MLQDIADKMQTELAGKSFDGSLKFDCGDDGVIVLADNTASTQDRD
FT                   TDCTIRLSQDNLVKLLTGKLNPMTGVMMGKLKISGNMGVAMKLGQLLG"
FT   gene            complement(16689..17132)
FT                   /locus_tag="SPO0017"
FT   CDS_pept        complement(16689..17132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC49462.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93348"
FT                   /db_xref="GOA:Q5LWG4"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG4"
FT                   /protein_id="AAV93348.1"
FT                   /translation="MIGEDEFDDDDELEMFVEAQDTVWPDVLRELTLGQKTSHWMWFVF
FT                   PQLAELGQSHMAQLYGIGDLDEAAAYLAHPALRARLIEVSRLMLTHAGKRPDDILGSID
FT                   AKKLRSSMTLFAAVPDAPGEFRAVLEAFYDGSPCPLTLRALGG"
FT   gene            complement(17129..18358)
FT                   /gene="argG"
FT                   /locus_tag="SPO0018"
FT   CDS_pept        complement(17129..18358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SPO0018"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93349"
FT                   /db_xref="GOA:Q5LWG3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWG3"
FT                   /protein_id="AAV93349.1"
FT                   /translation="MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEEL
FT                   EPARKKAELLGIKPENIHIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKR
FT                   LVEIAAEHGADAVAHGATGKGNDQVRFELSAYALNPEIRVIAPWRLWDLTSRTRLLEFA
FT                   EAHQIPISKDKRGEAPFSVDANLLHTSSEGKVLEDPGVEAPDYVAQRIVAVEDAPDTPE
FT                   FIEVTFEKGDAVAINGEAMSPATILTRLNELGGKHGIGLLDFVENRFVGMKSRGVYETP
FT                   GGTILLEAHRGIEQITLDSGAGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEH
FT                   VTGTVRLKLYKGSARTVARWSDHSLYSEAHVTFEEDAGAYDQQDAKGFIQLNALRLKLL
FT                   ATRNRRVAGK"
FT   gene            18450..19280
FT                   /locus_tag="SPO0019"
FT   CDS_pept        18450..19280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0019"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93350"
FT                   /db_xref="GOA:Q5LWG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG2"
FT                   /protein_id="AAV93350.1"
FT                   /translation="MKQQSATQVMVEGCFKMLGWRIFLYSIRMVLRNWRHALRLALVPA
FT                   ILGSVAMMTIAWVMQSGPAFEQFFGAGLNDLDKTEMTRQHTLSSLLVLVPQAVASLWIV
FT                   ITWHRFILLEEAQDGWVPPLRPGRTLAYFALSVGIVLIFAAVAFPVVYATVVLAAALGL
FT                   RGMAVALTLAVLLLLSPLSQRALLVLPASAIGQPLSFGDALTLTRDHYWTMLIVAVSGS
FT                   AMQHGLSTVLSFVGGTSTVGPVAALFLTLLLQPLLWASVLTTLYGVFVEKRPLG"
FT   gene            19338..20564
FT                   /gene="ilvA"
FT                   /locus_tag="SPO0020"
FT   CDS_pept        19338..20564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SPO0020"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93351"
FT                   /db_xref="GOA:Q5LWG1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG1"
FT                   /protein_id="AAV93351.1"
FT                   /translation="MSDFMTRARAAEQAMREVFPATPLQRNDHLSARYGADIWLKREDL
FT                   SPVRSYKIRGAFNAMRKQPGQGLFVCASAGNHAQGVAFMCRHMGVRGVIFMPVTTPQQK
FT                   IQKTRMFGGDQVEIHLTGDYFDQTLAAAQAWCAQEGGHFLSPFDDADVIEGQASLAVEI
FT                   EEQLGGVPDHVVLPVGGGGMSAGVATWFGDRSHCIFVEPEGGACLRAALAAGHPVKLDH
FT                   VDNFVDGAAVGRIGEKTFELLKSRHMSDVLVMPEDRICTTIIEMLNVEGIVLEPAGALS
FT                   VEAVADVQSFVRGKTVVCVTSGGNFDFERLPEVKERAQRYLGVKKYFLLRLPQRPGALK
FT                   EFLNILGPDDDIARFEYMKKSARNFGSVLIGIETARPENFERLYARLDEAGFTYTDITR
FT                   NETLAQFVI"
FT   gene            complement(20571..20924)
FT                   /locus_tag="SPO0021"
FT   CDS_pept        complement(20571..20924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0021"
FT                   /product="Hpt domain protein"
FT                   /note="identified by match to protein family HMM PF01627"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93352"
FT                   /db_xref="GOA:Q5LWI0"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI0"
FT                   /protein_id="AAV93352.1"
FT                   /translation="MGQRERRCAMIHWPRVTQLREEVGAEDFEEVVDLFLEEVEEVITR
FT                   LRQAPDRSLLEKDLHFLKGSALSLGFQSFSALCQDGERQSAAGHADTVDLDAIINSFEA
FT                   SKSVFQSELPGHI"
FT   gene            21005..22342
FT                   /locus_tag="SPO0022"
FT   CDS_pept        21005..22342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0022"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93353"
FT                   /db_xref="GOA:Q5LWH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH9"
FT                   /protein_id="AAV93353.1"
FT                   /translation="MLTGTCLAWAVSLALVKSGQTTVLHGREMEAQTDMEPGAIRRVLV
FT                   VDDSRLQRRILSSSLKKWGFEVIEAESGEEAMEICARAMPDLVLSDWVMPGMSGVDFCE
FT                   AFRQLNSDRYCYFILLTSKSEKNEVAQGLDAGADDFLIKPVSSDELRARISAGDRVIGM
FT                   QRELSAKNEVIEQALDDLKRAHDAIDKDLIQARKIQESLVPDFSQDFGSSRISLLLKPC
FT                   GHIGGDLVGMFSPGPNRVGFYSIDVSGHGITSAMMTARLGGYLSSRYFDQNVAMEKRFN
FT                   KFFALRQPQDVAETLNSRLIADTGIEEYFTMVYAIMDLRSGMLRMVQAGHPHPLLLRRD
FT                   GTAEFIGEGGVPIGLLPGVPFTQVEVQMEVGDRLLLYSDGFTECRLANGEMLEPEGLLA
FT                   LVNECNPEQGGQEFLDDLFWRLTQVMSPEHGLEDDVSATFFEFNGP"
FT   gene            complement(22329..22781)
FT                   /locus_tag="SPO0023"
FT   CDS_pept        complement(22329..22781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0023"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93354"
FT                   /db_xref="GOA:Q5LWH8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH8"
FT                   /protein_id="AAV93354.1"
FT                   /translation="MIRRFGESPEPGRRYTRRVGAYALLPRGSDLLLTSQYDPDPDLQL
FT                   PGGGIDPGESPVAALHREVYEETGWLIAAPRRIGAFRRFAYMPEYNLWAEKICLIYRAR
FT                   PVRRIGPPTEPDHAALWMPAHSAAQLLGNAGDRHFAARHLARITAR"
FT   gene            22858..23838
FT                   /gene="hslO"
FT                   /locus_tag="SPO0024"
FT   CDS_pept        22858..23838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="SPO0024"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="identified by similarity to SP:P45803; match to
FT                   protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93355"
FT                   /db_xref="GOA:Q5LWH7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH7"
FT                   /protein_id="AAV93355.1"
FT                   /translation="MTLGTKIAWDDTVLPFQLDLPDMRGRVARLDGVLDGILKQHDYPT
FT                   VVEALVAEMALLTALIGQTIGLRWKLSLQVQSKGAVRMIATDYYAPRAEGEPARIRAYA
FT                   GFDADRLTDGAPFDQVGEGYFAILIDQGKGTQPYQGITPLAGGSLSACAEAYFAQSEQL
FT                   PTRFQLRFGKSTEPGVPEHWRAGGVMLQHMPKASPFAAGGPGTGDILTAADLVDGAEGE
FT                   NWNRVNILLDTVEDLELIGPALPPTDLLVRLFHEEQPRVYDAQSVRFGCTCSEERVRQS
FT                   LSIYSVKDIGHMTTDEGTVTADCQFCGAHYVLDPASVGFEADQGD"
FT   gene            23831..24427
FT                   /locus_tag="SPO0025"
FT   CDS_pept        23831..24427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0025"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93356"
FT                   /db_xref="GOA:Q5LWH6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH6"
FT                   /protein_id="AAV93356.2"
FT                   /translation="MTDPIDSLMAALARTGPGSSDFDLNPGTILPEGRRLRPAGVLVPV
FT                   TLAHGAPRVILTKRSSALKHHPGQIAFPGGKQDEGDADVIAAALREAEEEIGLTRTLPQ
FT                   VLGTLPAHETVTAFTVTPVVAVVERTFDVRPEPGEVEEVFSVPLAHLMRPENYSVQSRR
FT                   WRGQRRHYFTVPFGPYYIWGATARMLRGLAERMQQ"
FT   gene            24424..25578
FT                   /locus_tag="SPO0026"
FT   CDS_pept        24424..25578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0026"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93357"
FT                   /db_xref="GOA:Q5LWH5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH5"
FT                   /protein_id="AAV93357.1"
FT                   /translation="MTRIDEAWLTEPATQQVCRALTEGGAQALFVGGCVRNALLGAPVS
FT                   DIDITTDAHPERVMALAAAAGIKAVPTGIAHGTVTLVANSIPHEVTTFRRDVETDGRRA
FT                   VVAFSDSIHEDAARRDFTMNALYARPDGTVLDPLDGLPDLQARRVRFIGDATDRIREDY
FT                   LRSLRYFRFHAWYGDAEAGFDAEALAAIAGNLDGLSRLSRERVGAEMLKLFAAPDPAPS
FT                   VAAMRAAGVLAQLLPGADDRALAPLVHLEDGLGADPIRRLAALGDGEALASLRLSKAQM
FT                   ALLDTLRRAALGTAGAGELGHELGVEAARDALLLRAALLEQPLDPHAPAAIARGAAAVF
FT                   PVTARDLMPAYSGPALGARLATLKARWIASDFSLSRAALLVDKD"
FT   gene            25770..27608
FT                   /locus_tag="SPO0027"
FT   CDS_pept        25770..27608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0027"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93358"
FT                   /db_xref="GOA:Q5LWH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH4"
FT                   /protein_id="AAV93358.1"
FT                   /translation="MFRFFENLVDPFVAYDETDTPPTRLWPFMLDYSQPFLRVFVWTAL
FT                   LSIIVAGVEIGLIYYMGRVVDVLNGEPAEVWARYGTEFIVLALFVLLIRPALHVADVLL
FT                   LNNAILPNFGTLIRWRAHKHVLRQSVGWFENDFAGRIANRIMQTPPAAGEVIFQVFDAI
FT                   SFSLAYLLGAAILLMAADIRLLLPLLIWFALYALLVRWTIQRVGPASQAASDARSTVTG
FT                   RVVDSYTNIHSVKMFAHDDRELTYAREAIEETRRTFQVEMRIFTIMDVVLVTLNGLLIV
FT                   GVVGWAIALWMQGQASVGLVAAASALTLRLNAMTGWIMWALTSFFRQLGVVAEGMETIA
FT                   QPIDLVDAPDARPLELSEGRIELQQLSHHYGRGAGGLDQLDLTIAPGEKIGLIGRSGAG
FT                   KSTLVKLLLRFYDPDSGRILIDGQDIARVTQNSLRSHIGMVQQDSALLHRSVRDNLLYG
FT                   RPDASEDEMIAAAKQAEAHDFILDLEDPQGRRGYDAHVGERGVKLSGGQRQRVTLARVI
FT                   LKNAPILLLDEATSALDSEVEAAIQDTLYGMMEGKTVIAIAHRLSTIAQMDRILVLDQG
FT                   RIVEEGDHADLLAQGGLYAQFWARQSGGFLNTEAAE"
FT   gene            27605..29437
FT                   /locus_tag="SPO0028"
FT   CDS_pept        27605..29437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0028"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /note="identified by similarity to GB:BAB70471.1; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93359"
FT                   /db_xref="GOA:Q5LWH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH3"
FT                   /protein_id="AAV93359.1"
FT                   /translation="MRFADLIDPFRDTDTPPPQRLGAFIRWALSGAWPVLFVAALFSAL
FT                   AGMFEAITAWILGQVVDRAVELGPEGFFEGTNLATILVAVGFFVLIRPVAFGLSAFSNN
FT                   YIVMPNIPPLVLAKLNRWTLGQSVGFFDDDFAGRIAQKQMQTASALSSVVSETISAIVF
FT                   ALASLIGSLALLGSIHPLVMLPFAVWLCGYFLLIRWYLPRVRKRSAARAGARAMVSGQV
FT                   VDTITNIKTVKLFAHAEAEDVTARNAMADLRERSLDFGWLSASFRFFLMLLAGVLPVIL
FT                   LGSALILWRAGDASAGDVVVAGSVSIRIAQMSGWVSFTLMSLYANLGEVQNGMNSLARA
FT                   ERIEDVADARPLVAGAGKIDFEDVGFAYGRKSGGVDALSLTVAPGEKLGIVGASGAGKS
FT                   TLVSLLLRLYEAENGQIRIDGQDITTVTQDSLRRQIGLVTQETAMFNRSARENILYGRP
FT                   NASEAELIAAAQKAEAHDFILDLADAKGRTGYDAHLGERGVKLSGGQRQRIALARAILK
FT                   DAPILVLDEATSALDSEVEASIQTALHRVMEGKTVLAIAHRLSTLSEMDRIVVLDRGRI
FT                   VESGTHEALLARDGLYARFWHRQSGGFIRTQAAE"
FT   gene            29456..30709
FT                   /gene="rumA"
FT                   /locus_tag="SPO0029"
FT   CDS_pept        29456..30709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="SPO0029"
FT                   /product="23S rRNA (Uracil-5-)-methyltransferase rumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P55135"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93360"
FT                   /db_xref="GOA:Q5LWH2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH2"
FT                   /protein_id="AAV93360.1"
FT                   /translation="MPLYQAAMTQEITITRLGHQGDGIAPGPVYVPRSLPGEVVSGTPE
FT                   GDRLADMRVVTPSPHRVAPPCRHYRACGGCQLQHASDGFVAEWKQEVVRAALAAQGIEA
FT                   VMRPVHTSPPQSRRRATIAVRRTKKGALAGFHGRASDVITEIPDCHLLDPALLAAIPMA
FT                   EALAMLGGSRKGVMAVTLTLSVAGLDVAVRGGKPLDGPLEVALGQLAEVQGLARLAWED
FT                   EVIAMRHPPAQNFGKAAVVPPPGAFLQATRDGEQALLAAVRETIAGARRVADLFAGCGT
FT                   FALPLAETAEVHAVEGESAMTAALDRGWRRAQGLKRVTTEARDLFRRPLLPDELAAFDA
FT                   VVLDPPRAGAEAQVAELARAKPPVIAYVSCNPVTFARDAKTLVQAGYSLNWVQVVDQFR
FT                   WSAHVELAAAFSLAHIGG"
FT   gene            30727..31503
FT                   /locus_tag="SPO0030"
FT   CDS_pept        30727..31503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0030"
FT                   /product="voltage-gated sodium channel"
FT                   /note="identified by similarity to GB:CAD24429.1; match to
FT                   protein family HMM PF00520"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93361"
FT                   /db_xref="GOA:F7IVA8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:F7IVA8"
FT                   /protein_id="AAV93361.1"
FT                   /translation="MQRMQAFIDRPGFGRFITAVIMLNAVVLGMETSPYLMERWGGLIL
FT                   AADRICLGIFIVEIALKLTAQRQRFFLNGWNLFDFVIVGIALIPAAGGLSVLRALRILR
FT                   VLRVISVAPRLRRVVEGFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLG
FT                   LSAYTLFQIMTLESWSMGIVRPVMQVYPYAWLFFVPFIMITTFAVVNLLVGLIVNSMQD
FT                   AHHAEDGERTDAYRDEVLARLEQIDQRLNALGETKK"
FT   gene            31568..32086
FT                   /locus_tag="SPO0031"
FT   CDS_pept        31568..32086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0031"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93362"
FT                   /db_xref="GOA:Q5LWI9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI9"
FT                   /protein_id="AAV93362.2"
FT                   /translation="MDRRHFGLGAAAALGLSACGSQDSKFRRYYGPAVTSIVINKGARK
FT                   MYLLNNEKVLKEYKVELGFAPAGHKQFEGDGKTPEGTYLIDRRNPNSAFHLSLGISYPN
FT                   SRDVAYAQAMGKKPGGEIFIHGEPNGLRDRKKAKKQPDWTAGCIAVKNDEIEEIYAMVR
FT                   DGTVITLRA"
FT   gene            32458..33366
FT                   /locus_tag="SPO0033"
FT   CDS_pept        32458..33366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0033"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93364"
FT                   /db_xref="GOA:Q5LWI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI7"
FT                   /protein_id="AAV93364.1"
FT                   /translation="MRLPPLNALRAFEAAARHNGYIAAAEELCVTRGAVSRHIKLLEDH
FT                   LGVTLFHRNHRGVELTAAGRQLLPVLTETFARIAREAEQISAMTRDVRIICPPALSIRW
FT                   LFPRLEEFQAAHPDIRVRLTTEFYGAKGFDDTEHDLGVSVEHVSGRGAGIASMPLFPMV
FT                   LSPACSPALLRQRPLSAPADLARMTLLHESPQRRDWAHWLSSFGVRGVDAGSGPTFPNL
FT                   DMAARAATMGAGVVMADLALCQEELRAGTLVLPFPEMTCTTPQGGYVLLGARARWDEPH
FT                   LRAFRDWAASSSADLVACMGA"
FT   gene            complement(33377..34816)
FT                   /locus_tag="SPO0034"
FT   CDS_pept        complement(33377..34816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM48703.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93365"
FT                   /db_xref="GOA:Q5LWI6"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI6"
FT                   /protein_id="AAV93365.1"
FT                   /translation="MSSPFDYFVVFAEMRTGSNFLEANLNALDGVACVGEAFNPHFIGY
FT                   PNKTEILEVSQDMRDADPQCLIDAVRDARGVLAGFRFFHDHDPRVLDLVLSDPRCAKII
FT                   LTRNPLDSYVSWKIAKETGQWKLTNIKRRKEAQARFDAEEFARHVEALQDFQVFLLNSL
FT                   QRSGQTPFYVAYEDLQDLSVMNGLAQWLGVSARLEQLDDSLKRQNPSPVTSKVVNAGEM
FT                   VEALSGLDRFNLTRTPNFEPRRGPAVPTYVTGAVTPLIYLPVRGGPEDEVRRWMADLDG
FT                   VVDAALGTGLNQKQVRGWLKGNEGHRAFTVLRHPLARAHSAFCHRILNKGPGCFTKIRN
FT                   TLRRQFSLPIPEGTPGLDYGRADHRAAFEAFLEFVRMNLAGQTAIRIDGSWCSQAQALS
FT                   SFAEFVSPDLILREDEIATDLPSLARRFGHAEPPEPPRAAPDTPIPLSDIYDDALEALA
FT                   ADVYQRDYIVFGFGKWAGGQA"
FT   gene            complement(34823..36502)
FT                   /locus_tag="SPO0035"
FT   CDS_pept        complement(34823..36502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0035"
FT                   /product="core-2/I-branching enzyme family protein"
FT                   /note="identified by match to protein family HMM PF02485"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93366"
FT                   /db_xref="GOA:Q5LWI5"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI5"
FT                   /protein_id="AAV93366.1"
FT                   /translation="MLVHTALDRAQQVAQHWTASGCPVVIHVDRKVSRKTFKAFHDACV
FT                   KDPLIRFSTRHRCEWGTWGIVAASQAASEQMLAEFADVRHVYLASGSCLPLRPVQELID
FT                   YLAARPRTDFIESATTADVPWTVGGLDQERFTLRFPFSWKKHRYLFDKYVNLQRRLGFK
FT                   RRIPAGLVPHMGSQWWCLTRHTLSAILEDPERTVYDAYFRKVWIPDESYFQTLARQFSA
FT                   NIESRSLTLSKFDFQGKPHIFYDDHLQLLRRSDCFVARKIWPRAERLYQAFLTDQAGAM
FT                   KRTEPNPGKIDRIFAKAVERRTRGRDGLYMQSRFPRHGNENGLTSNPYSVFQGFTELFE
FT                   DFEPWLAKATGTRVHGHLFGPERAEFAGGERLVNGALSDCALLRDYNPTSFLTSLIWNT
FT                   RGERQCFQFGPADNQKIDWLLARDPNAQISVITGAWAVPLFKSNRNFADLRKEAARLQR
FT                   IESKHLEILRSVWTKARVRIWTMAEFVEAPMEPIQTIVDEIGQSSPRRLTEAPTMVDLT
FT                   GFGQFLQNLKNQGMHPYLMGDFPVEPAPINNPKPTRKPYLVR"
FT   gene            complement(36520..37542)
FT                   /locus_tag="SPO0036"
FT   CDS_pept        complement(36520..37542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC46616.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93367"
FT                   /db_xref="GOA:Q5LWI4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI4"
FT                   /protein_id="AAV93367.1"
FT                   /translation="MDSSVSLWDSYRMRVRRKRRLLRCIRKSRELRAVQNNTAAIRPSD
FT                   VLLVSTVRNEKIRLPYFLRYYRELGIDHFLIVDNDSTDGTLDYLGGQSDVSVWHTTHSY
FT                   KSATFGVDWMNWLKRSYAHDHWVLVVDPDEFFIYPFCDTRPIQALTDWLDNSSIRSFSA
FT                   MLIDVYPKGRIDDVPYVEGQNPLEIANWFDSGNYMIKKNPEYGNLWIQGGPRSRVFFPD
FT                   NPKKAPALNKTPLVKWNRRYAYVSSTHALLPRGLNQVYDEWGGEKASGALLHTKFLDTF
FT                   TVKAAEELTRRQHYSNSVEYKAYADRVQDQPDLWCKWSEKYINWRQLEILGLMSKGNWA
FT                   "
FT   gene            complement(37703..38752)
FT                   /locus_tag="SPO0037"
FT   CDS_pept        complement(37703..38752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC46616.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93368"
FT                   /db_xref="GOA:Q5LWI3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI3"
FT                   /protein_id="AAV93368.1"
FT                   /translation="MTSSPAPPLSPIGWADAYRLRWKRQRLLWRAFRSRRALTALADRT
FT                   AAIRPGQVLAVTTLRNEVLRLPWFLDYYRTLGVGHFLMVDNGSDDGSVEMLAAQPDVSL
FT                   WQTGASYRDARFGLDWMTWLQIRHAHGHWCLMVDVDELLIYAHHDRRDLHALTGWLERQ
FT                   GRNCFGAHMLDLYPKGPVAAQTHAPGEDPLDILHWFDAAPYRAQRQQPLGNLWVQGGAR
FT                   ERMFFADDPRRSPTLNKIPLIRWDRRYAYVNSCHSALPRQLNAVYGGPGDSAPSGVLLH
FT                   TKFLPDIVSRSAEEKTRQQHFHTPADFDHYYDDLTASPDFWTPSSTRFTGWRQLHDLGL
FT                   LSPGGWEEG"
FT   gene            complement(38766..39566)
FT                   /gene="kdsB"
FT                   /locus_tag="SPO0038"
FT   CDS_pept        complement(38766..39566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="SPO0038"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93369"
FT                   /db_xref="GOA:Q5LWI2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI2"
FT                   /protein_id="AAV93369.1"
FT                   /translation="MSVLIAIPARYASTRYPGKPLVSLTGASGTEMTLIERSWRAAMAV
FT                   SGADRVVVATDDDRIRAVAEGFGAEVVMTSSDCVNGTERCAEAHAVLGGGFDIVVNLQG
FT                   DAPLTPHWFVEDLIAGLRAAPEADIATPVLRCDGMALNGFLNDRKHGRVGGTTAVFAAD
FT                   RSALYFSKEVIPFTSQIYADDAPTPVFHHVGVYAYRPGALADYPTWPMGPLETLEGLEQ
FT                   LRFMENGRKVLCVEVEARGRQFWELNNPEDVARIEEMMAAMGLD"
FT   gene            complement(39567..40364)
FT                   /gene="cysQ"
FT                   /locus_tag="SPO0039"
FT   CDS_pept        complement(39567..40364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="SPO0039"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by similarity to SP:P22255; match to
FT                   protein family HMM PF00459; match to protein family HMM
FT                   TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93370"
FT                   /db_xref="GOA:Q5LWI1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI1"
FT                   /protein_id="AAV93370.1"
FT                   /translation="MTYEELIPVIRRLALEAGDVIMSIYNADDFGVKVKSDSSPVTEAD
FT                   EAADALISAGLRAAFPDILLVTEEQAASHSQTGDTFLIVDPLDGTKEFINRRGDFTVNI
FT                   ALVENGTPTRGVVYAPAKGRMFYTLADGSSVEETGGLDKETPGDLSPIRVAEADNAALL
FT                   VVASKSHRDQATEDYIGKYAVKDSKSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGH
FT                   AVLAGAGGKVVRFDNHQPLTYGKDGYANPFFIAYAPSVTLKEA"
FT   gene            40483..41304
FT                   /locus_tag="SPO0040"
FT   CDS_pept        40483..41304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0040"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93371"
FT                   /db_xref="GOA:Q5LWJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ9"
FT                   /protein_id="AAV93371.1"
FT                   /translation="MFRYRQHKSLLSGAITMAELIFHNVVRGVRQGHSNAYAALGKNMM
FT                   QILVFVLVFYMMFSMLGLRGSAIRGDFLLYIMSGIFLFMVHIKTVGAVAGAEGPNSAMM
FT                   KHAPMNTIIAILSAALGSLYTQLLTLFLILFGYHVAFKPVEIADPAGAFGMLMLAWFTG
FT                   CAVGLVFLSIKPWAPMLVGVMTTLYQRANMIASGKMFVANTLPGYMLAMFDWNPLFHAI
FT                   DQCRGFVFRNYFPHNSNWHYSLWLGIILIMIGLMGEFYTRRHVSASWYARR"
FT   gene            41301..41885
FT                   /locus_tag="SPO0041"
FT   CDS_pept        41301..41885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E82361"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93372"
FT                   /db_xref="GOA:Q5LWJ8"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ8"
FT                   /protein_id="AAV93372.1"
FT                   /translation="MRWLVALLLVLAAPLAADPVPALFDVTGVAADDVLNVREDPSAGS
FT                   EVIGTLAPDAVGVEVVDLTFGGDWGRVNVNETSGWVSMRYMQQQPESDGVWMTPRFTCS
FT                   GTEPFWSLTVEQGVGARFQIMGEAEQALPAGLLRPGAGLIDRFALPLGHNLAILRQMQC
FT                   HDGMSDRAYGLDVGLMLNGSLYAGCCTLLPN"
FT   gene            complement(41882..42478)
FT                   /locus_tag="SPO0042"
FT   CDS_pept        complement(41882..42478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0042"
FT                   /product="alkylated DNA repair protein, putative"
FT                   /note="identified by similarity to SP:P05050; match to
FT                   protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93373"
FT                   /db_xref="GOA:Q5LWJ7"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ7"
FT                   /protein_id="AAV93373.1"
FT                   /translation="MLNLRGVEIRKGALDGPAQARLIEALRPVLKAAPLFTPTMPNGKP
FT                   LSVRMTSAGSLGWVTDKGGYRYQPTHPKGMAWPAIPPEVLDLWHGVTGQDRAPDCCLIN
FT                   YYGEGARMGLHQDRDEADLTWPVVSLSLGDDALFRIGNTSRGGKTESVWLNSGDVVVMG
FT                   GPARLIYHGIDRIRFGSSRLLPKGGRLNLTLRVAG"
FT   gene            42698..44611
FT                   /gene="dnaK"
FT                   /locus_tag="SPO0043"
FT   CDS_pept        42698..44611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SPO0043"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by similarity to SP:P04475; match to
FT                   protein family HMM PF00012"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93374"
FT                   /db_xref="GOA:Q5LWJ6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWJ6"
FT                   /protein_id="AAV93374.1"
FT                   /translation="MGKVIGIDLGTTNSCVAIMDGAQPKVIENSEGARTTPSIVAFTDE
FT                   ERLVGQPAKRQAVTNPSNTIFGVKRLIGRRVDDAEVTKDKKMVPFTIVNGGNGDAWVEA
FT                   KGEKYSPSQISAVILGKMKETAESYLGEEVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGLDKKNSQTIAVYDLGGGTFDVTILEIDDGLFEVKSTNGDTFLG
FT                   GEDFDMRIVNYLADEFKKEHGVDLSGDKMALQRLKEAAEKAKIELSSTTQTEINQPFIS
FT                   MGANGQPLHLVMKLTRAKLESLVGDLIKKSMDPCKAALKDAGISPSDVDEVVLVGGMTR
FT                   MPKVFEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETL
FT                   GGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFNLEDIP
FT                   PAPRGMPQIEVTFDIDANGIVSVSAKDKGTGKEHKITIQASGGLSDEDIEKMVKDAEEN
FT                   AEADKARKELVEARNQAESLIHSTEKSVEEHGDKVDPTTVEAIELAIAALKDDLDKDGV
FT                   SAEKIKSGLQNVTEAAMKLGEAIYKAQSEGGDDEPAAADARPSDDDIVDAEFEDLGEDK
FT                   RK"
FT   gene            44687..45832
FT                   /gene="dnaJ"
FT                   /locus_tag="SPO0044"
FT   CDS_pept        44687..45832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SPO0044"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by similarity to SP:P08622; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93375"
FT                   /db_xref="GOA:Q5LWJ5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWJ5"
FT                   /protein_id="AAV93375.1"
FT                   /translation="MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDAES
FT                   LFKEVNEAYEVLKDAEKKAAYDRFGHAAFEGGMGGGQRPGGGFGSGDFSSAFSDVFEDL
FT                   FGDFMGGQRGGGGRRAARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTGAEG
FT                   GVEPTTCPTCSGMGKVRAQQGFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEKDRALS
FT                   VNIPAGVETGTRIRLAGEGEAGMRGGPPGDLYIFVEVAKHELFERDGVNLYCRVPVSMA
FT                   KAALGGAIEVPTIDGGRGRVQVPAGSQSGRQMRLRSKGMPALRGGGIGDMFIELAVETP
FT                   VNLTSKQKDLLREFDELSEDNNPETKSFFSSVKSFWDGMKG"
FT   gene            46122..46925
FT                   /gene="thiD"
FT                   /locus_tag="SPO0045"
FT   CDS_pept        46122..46925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SPO0045"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by similarity to SP:P76422; match to
FT                   protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93376"
FT                   /db_xref="GOA:Q5LWJ4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ4"
FT                   /protein_id="AAV93376.1"
FT                   /translation="MVPIALTIAGSDSGGGAGIQADLKAMSALGIYGASVITAVTAQNT
FT                   CAVTAVHEIPTEIIRAQIEAVLDDLDVRAIKIGMLATPEIIGAVADAIAGFDGPVVLDP
FT                   VMVAKSGDALLAAEAVASLKERLLPRATLLTPNLPEAARLLSLRDAADQDEMVSQARAL
FT                   IALGAEAVLMKGGHAKGAICHDLLVGRAGVLAEFSAPRRMTKNTHGTGCTLSSAIAAGL
FT                   AKGRTLKAAVRDAHTYLQGAIVAADRLGVGKGHGPVHHFHRVWSA"
FT   gene            46922..47899
FT                   /locus_tag="SPO0046"
FT   CDS_pept        46922..47899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0046"
FT                   /product="thiamine biosynthesis oxidoreductase ThiO,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93377"
FT                   /db_xref="GOA:Q5LWJ3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ3"
FT                   /protein_id="AAV93377.1"
FT                   /translation="MTLWSVIGAGVAGLTVATEMVARGARVQVFDPGGPPGPHGCSWWA
FT                   GGMLAPWCEYENAEEPVLRLGQQAIGWWEQHTTVTRRGTLVVANPRDLPDLRRFGRRTE
FT                   GFREINQTEILGLESDLGAFSKGLHFPDEAHLDPRRALSDLYRGLLDKDVDFHRKPAPA
FT                   GLENAIDCRGLHAREVLHDLRGVKGEMLVIRAPDVALTRPVRLLHPRMPLYVVPRADHV
FT                   YMLGATMIESEDSGRITARSMLELLSAAYALNPAFGEAEVLEIGVDLRPAFPDNLPRIR
FT                   RLGRTIYANGLYRHGYLLAPALAQGVADLALNNTHTELVDEDRA"
FT   gene            47883..48077
FT                   /gene="thiS"
FT                   /locus_tag="SPO0046a"
FT   CDS_pept        47883..48077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="SPO0046a"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0046a"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97128"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ2"
FT                   /protein_id="AAV97128.1"
FT                   /translation="MKIVLNGEPREVEAETLAALLAECGLSGRVATAVNESFVPSSLRG
FT                   AHRLNDGDRVEVLAPMQGG"
FT   gene            48081..48845
FT                   /gene="thiG"
FT                   /locus_tag="SPO0047"
FT   CDS_pept        48081..48845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="SPO0047"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by similarity to SP:P30139; match to
FT                   protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93378"
FT                   /db_xref="GOA:Q5LWJ1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWJ1"
FT                   /protein_id="AAV93378.1"
FT                   /translation="MRAFYGTELPNPLMLGTAQYPSPAILEQAFRASGAGVATVSLRRE
FT                   SGAGQTFWSMIRDLGVLILPNTAGCHTVKEAVTTAHMAREVFGTPWIKLELIGHTDSLQ
FT                   PDVFGLIEAARILTEDGFQVFPYTTDDLIVGERLLAAGCEVLMPWGAPIGSGRGLNNEY
FT                   ALRAMRAEFPDTPLVVDAGIGLPSHAARALELGYDAVLLNTAVARAGDPVEMARAMALA
FT                   IQAGQLAHRADPIEARDMASASTPVIGKAFLS"
FT   gene            48842..49438
FT                   /gene="thiE"
FT                   /locus_tag="SPO0048"
FT   CDS_pept        48842..49438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="SPO0048"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by similarity to SP:P30137; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93379"
FT                   /db_xref="GOA:Q5LWJ0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ0"
FT                   /protein_id="AAV93379.1"
FT                   /translation="MTLDRFYPIFDHTDWLRRMLPLGVKLVQLRIKDQSDPVIRAEIDT
FT                   ARDLCRAHGAVLVINDYWQAAIDAGCDWLHLGQEDLDQADLPAIRKAGLRLGVSTHDDD
FT                   ELERVLGMDPDYVALGPVYPTILKQMKWHQQGLPRVTEWKARVGSIPLVGIGGMSVERA
FT                   PGVLGAGADIVSVVTDITLNADPEARVHQWIEVTR"
FT   gene            49417..50400
FT                   /locus_tag="SPO0049"
FT   CDS_pept        49417..50400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0049"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93380"
FT                   /db_xref="GOA:Q5LWK8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK8"
FT                   /protein_id="AAV93380.1"
FT                   /translation="MDRGHEMSRYARQMILPQAGGEGQARLAGARVLVVGAGGLAASAL
FT                   PLLAGAGVGQIDIFDGDHIELSNLHRQTLFAEGDVGRAKAEVAAERCGALNSGIVLTGT
FT                   KRSITPENVILACRDTDLVLDCADSYAASYLLSDTCQALGKPLISASVLGLGGYVGGFC
FT                   GGAPSLRAVFPDAPDSAASCATAGVLGPVVSILGSIQAQMALSALLELAPSPLGQMVQI
FT                   DALSWRNSTFRFDGAPEPATAFRFVAPSDLSADDLIVELRTEGEAPQPAHPSARRMTVS
FT                   EIEISDTNKEKRLALCCATGLRAWRSAEQLQPIWPGEIVLVAAATS"
FT   gene            50309..51349
FT                   /locus_tag="SPO0050"
FT   CDS_pept        50309..51349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0050"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="Assignment based partly on membership in ABC
FT                   transporter gene cluster."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93381"
FT                   /db_xref="GOA:Q5LWK7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK7"
FT                   /protein_id="AAV93381.1"
FT                   /translation="MPPASGPGALRNSCNRFGRARSFSLRPPHHERKRDMKHLVTALAL
FT                   LAATPALAQDKMTLLLDWFINPDHGPIIVAQEKGYFAERGLEVEIVAPADPSAPPRLVA
FT                   AGQADLAVSYQPQLHLQIHEGLPLKRVGTLVATPLNCLLVLDNGPIKSPADLKGKKIGF
FT                   SVAGVEEAILTTVLGKYDVALSDVEMINVNFSLSPALMSGQVDAVIGAYRNFELNQMDI
FT                   EGEPGRCFYIEEEGVPSYDELIYVANPDRMDAGKIARFLEATEKATQFIVNNPQASWEI
FT                   FSATSPELQDELNKRAWADTLPRFALRPAGFDAGRYARFETFLKDSGMIDSVNSVSAIT
FT                   IDVTAE"
FT   gene            51382..52026
FT                   /locus_tag="SPO0051"
FT   CDS_pept        51382..52026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0051"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93382"
FT                   /db_xref="GOA:Q5LWK6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK6"
FT                   /protein_id="AAV93382.1"
FT                   /translation="MRAAAGQPWRDYTRHAFVEGMKDGSLARDAFVHYLRQDYVFLIHF
FT                   ARAWALAVVKGETHAEMLAAVGTVNTLVVEEMQLHVGVCEAAGISKDALFATPERPENL
FT                   AYTRFVLEAGYSGDLADLLAALAPCVMGYGEIGARLATEATSEAYKDWIDTYAGPEYQA
FT                   ACKAVGELMDQALTRRIGADFEASPRWERLCRTFRTATELEVGFWQMGLTP"
FT   gene            51960..52751
FT                   /locus_tag="SPO0052"
FT   CDS_pept        51960..52751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0052"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93383"
FT                   /db_xref="GOA:Q5LWK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK5"
FT                   /protein_id="AAV93383.1"
FT                   /translation="MPDLSHRDRARGRFLADGVDPVTPAPAITVAGSASIDGARLFAPL
FT                   TLTLEAAQWTCLLGGSGVGKSTVLRLIAGLETGAEFSGAITASDDAPVLKRVAYMAQDD
FT                   LLLPWATVAQNVGLGARLRGEQVDRARLDDLLRRVRLTAHAAKRPAELSGGQRQRVALA
FT                   RTLMEDKPVVLLDEPFSALDARTRADMQELAAELLAGRTVLLVTHDPAEAARLGHSIQV
FT                   MTAAGLTPVAPPTAQIPRAVDDAATLECQAALLRMLREGVQ"
FT   gene            52706..53482
FT                   /locus_tag="SPO0053"
FT   CDS_pept        52706..53482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0053"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93384"
FT                   /db_xref="GOA:Q5LWK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK4"
FT                   /protein_id="AAV93384.1"
FT                   /translation="MSGRAAQDAAGGCAMTRWLPAVAATLFALAIWQAVVSLTDLPRFI
FT                   LPGPVLVAETWWQSRWLIAEHTAVTALEVLIGLACGAVLGVATALQLASSRIARVLVQP
FT                   MLVFTQALPVFALAPILTLWLGYGLWSKVAMAVLIIYFPITAAFFDGLMRTPVGYLDLA
FT                   RTMQASPRAVLWHIRVPAALPQLASGLRLAAVYAPIGAVIGEWVGASKGLGYLMLLANG
FT                   RAKTDLMFAAMLTLGVLSVLLHLAMRRATRRMAGER"
FT   gene            53600..54274
FT                   /gene="radC"
FT                   /locus_tag="SPO0054"
FT   CDS_pept        53600..54274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="SPO0054"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by similarity to SP:P25531; match to
FT                   protein family HMM PF04002; match to protein family HMM
FT                   TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93385"
FT                   /db_xref="GOA:Q5LWK3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWK3"
FT                   /protein_id="AAV93385.1"
FT                   /translation="MPSYIRDHRKRLRERFMTGGAAALPDYELLELVLFRSIPRQDVKP
FT                   LARLLLDTFGDFNRVLTAPVERLAEVKGVGEAVITDLKILEASAHRMARARVMQRQVIS
FT                   SWDALLDYCHTTMAHRETEQFRVFYLDRKNVLIADEEQARGTVDHVPVYPREVAKRALE
FT                   LNASALILVHNHPSGDPTPSQSDIDMTARIRSACEALGLTLHDHLIIGKSVELSFRAEG
FT                   YL"
FT   gene            complement(54337..55893)
FT                   /locus_tag="SPO0055"
FT   CDS_pept        complement(54337..55893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0055"
FT                   /product="OmpA domain protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93386"
FT                   /db_xref="GOA:Q5LWK2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK2"
FT                   /protein_id="AAV93386.1"
FT                   /translation="MNWLRAAALAALSVFPAVPAAAQDITLTSHDGKVEISGNLLGFDG
FT                   EFYRVETRFGELTVDGSGVTCDGPACPNLTDFVAELALSGSSTMAEVLLPALIEGFALR
FT                   NRMQTRRETDSEARFSYLLFQAGSDRPQARFTFRVSTTDEGFADLLADEADLVMALREI
FT                   RPDERRRALELGLGDMTDSNRSRVLALDAMVPVVAPVNPVRQVSVPQLAQVFAGEIDNW
FT                   AQLGGPDAPIALHLPAAGSGLAQAVEDRLLLPAGKSLPETVARHDRSSLLARAVAIDPF
FT                   AIGIASYSETGTARALTLTGDCGFSLAATRRNIKTEDYPLNSPMFLYMPARRLPKLARE
FT                   FMAYMRSPAAQIVIRRAGFVDQAPELIPVAVQGNRLANAIAAAGTEVPLTELQRLVSTL
FT                   SGMQRLSLSFRFETGSSRPDAQSRTNISQLAQELESGAYDARQLLFVGFSDGDGAAEGN
FT                   TRIALKRAEAVRDAVLQTAETLDPARVEVSVDAFGEALPMACDDSDWGRQVNRRVEVWV
FT                   K"
FT   gene            complement(55919..56911)
FT                   /locus_tag="SPO0056"
FT   CDS_pept        complement(55919..56911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93387"
FT                   /db_xref="GOA:Q5LWK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK1"
FT                   /protein_id="AAV93387.2"
FT                   /translation="MAQRRKILTAGGTVLCAALIGFLMQQNAARETQQVAARKSFIQQS
FT                   VLKPSGASDVDDFAQFELHAIKLTSAQPALEQPRRLPEPALEGALPLPARDILLPDAPS
FT                   DPEEPQLGCAIIANAAPAPMASVALDVSAPCYGNQRVTVHHSGLIFTDTTDDAGTLSVT
FT                   VPALSETAVFVVAFQNGRGAVAMSPVEGLDRIDRVVVQWSGAAGFQLHAREFGAGYGET
FT                   GHVWSQSTDQGIGQVIRLGEPDTLEPQLAEIYSYPNGESDTAGTITLSIEAEVTATNCG
FT                   RDISAQSLELRGAGSLTTHDLDMSMPDCSAAGDFLVLNNLVEDLKIAAR"
FT   gene            complement(57011..59716)
FT                   /gene="secA"
FT                   /locus_tag="SPO0057"
FT   CDS_pept        complement(57011..59716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SPO0057"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF02810; match to protein family HMM PF07516;
FT                   match to protein family HMM PF07517; match to protein
FT                   family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93388"
FT                   /db_xref="GOA:Q5LWK0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWK0"
FT                   /protein_id="AAV93388.1"
FT                   /translation="MLGLGTLAKKVFGTPNDRKIKATRPVVAQINALEEEFAKLTDEGL
FT                   KQKTDELRKRALDGESLDALLPEAFANCREAGKRALGLRAFDTQLMGGIFLHQGNISEM
FT                   KTGEGKTLVATFPAYLNALTGKGVHVVTVNEYLAKRDSEWMGKVFAALGMTTGVIWSGQ
FT                   PDAEKMAAYESDITYATNNELGFDYLRDNMKGELSEVYQKQHNFAIVDEVDSILIDEAR
FT                   TPLIISGPAQDRSDLYVAIDALLPALSDDHFELDEKTRNVTFTDEGNEFLEAQLVARGL
FT                   LPEGQSLYDPESTTIVHHVNQGLRAHKLFQRDKDYIVRDGEVVLIDEFTGRMMPGRRLS
FT                   DGLHQAIEAKENAQIQPENVTLASVTFQNYFRLYDKLSGMTGTALTEAEEFAEIYGLGV
FT                   VEVPTNRPIARTDEDDQVYRTAAEKYGAMIDETKKAHEKGQPVLLGTTSIEKSEMLSQM
FT                   LTKEGIEHNVLNARQHEREAQIVAEAGRYGAVTIATNMAGRGTDIQLGGNVEMKVLEAL
FT                   AENPEADPVELRAAEEARHAEEKQKVLDAGGLYVMASERHESRRIDNQLRGRSGRQGDP
FT                   GRTVFYLSLEDDLMRIFGSERLDKVLTTLGMKEGEAIIHPWVNKSLERAQAKVEGRNFD
FT                   MRKNVLKFDDVMNDQRKVIFNQRREIMATEDLSDVVADMREQVIDDLIDEYMPPKTYAD
FT                   QWDTQGLYAAVIEKLGIDVPVIEWAAEEGVDDDEIRERLIKASGDYMESKAADFGAENM
FT                   RNIEKQVLLQTIDSKWREHLLKLEHLRSVVGFRGYAQRDPLNEYKTESFQLFEGLLDSL
FT                   RETVTQQLSRVRMLSEEEQRQMMAQMMAQQNQAEQAAVQAEAVAEAKASGDARPGFVED
FT                   DPSTWGNPARNDLCPCGSGKKFKHCHGRLA"
FT   gene            59912..60742
FT                   /locus_tag="SPO0058"
FT   CDS_pept        59912..60742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0058"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93389"
FT                   /db_xref="GOA:Q5LWL7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL7"
FT                   /protein_id="AAV93389.1"
FT                   /translation="MPSLAFALVMALPVAAETKAEADTVVARVNGEEITLGHMIIARAS
FT                   LPQQYQQLPDDVLFDGILDQLVQQTLLKQQQKGETPKQIVLSLENEERSLLAGETIEEI
FT                   MAVATTETAIQAAYDAQYADGFGGEEYNASHILVPSEDEAKAVKELLDNGADFAATAKE
FT                   KSTGPSGPNGGALGWFGAGAMVPEFEQAVVALNAGQVSDPVQTQFGWHVIILNDKRKSE
FT                   APALDEVRDELAGRIQQDAIEARLAELTKDSEIEKPELTGVEPAVLRQLELVRE"
FT   gene            60750..61976
FT                   /gene="argJ"
FT                   /locus_tag="SPO0059"
FT   CDS_pept        60750..61976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="SPO0059"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by similarity to SP:P38434; match to
FT                   protein family HMM PF01960; match to protein family HMM
FT                   TIGR00120"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93390"
FT                   /db_xref="GOA:Q5LWL6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL6"
FT                   /protein_id="AAV93390.1"
FT                   /translation="MAKITKVSPLAPAAFPTLPVIDGVRLASIAAGVRYQGRTDVMLAV
FT                   LDPGTSVAGVFTRSATRSAPVLDCQAKIGGASDGPAAILVNSGNSNAFTGHYGQTSVAE
FT                   VTQAVADVTGVPVGRVFTSSTGVIGEPMKHERIVAKLGDLNAALSPDALEDAARAIMTT
FT                   DTFAKGASRTVGIDGKMVKIAGIAKGSGMIAPDMATMLVYIFTDARVEQGALQAMLSAM
FT                   TDKTFNCITVDSDTSTSDTLLLCATGASGVDAEGNAEFAAALEAVMLDLAQQVVRDGEG
FT                   ATKFVEIRVTGAANDVDAKVHGLAIANSPLVKTAIAGEDPNWGRVVMAIGKSGAAADRD
FT                   LLSISFGDILVAEKGWVSPNYREEDAAAYMKGQDLVIGVDLGLGAGKSTVWTCDLTHGY
FT                   IEINADYRS"
FT   gene            61973..62371
FT                   /gene="mutT"
FT                   /locus_tag="SPO0060"
FT   CDS_pept        61973..62371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SPO0060"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93391"
FT                   /db_xref="GOA:Q5LWL5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL5"
FT                   /protein_id="AAV93391.1"
FT                   /translation="MKTVLVSAVALIDVDGRVLLAQRPEGKSMAGLWEFPGGKVEPGET
FT                   PEVALIRELHEELGINTWASCLAPLTFASHGYDDFHLLMPLFACRKWEGIPQSREGQAL
FT                   KWVRATELRNYPMPPADVPLIPILRDWL"
FT   gene            complement(62848..65355)
FT                   /gene="infB"
FT                   /locus_tag="SPO0061"
FT   CDS_pept        complement(62848..65355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SPO0061"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by similarity to SP:P02995; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM PF04760; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93392"
FT                   /db_xref="GOA:Q5LWL4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL4"
FT                   /protein_id="AAV93392.1"
FT                   /translation="MSDTDGKKTLGLRGSRPGNVKQSFSHGRTKNVVVETKRKRVVVPK
FT                   PGAGKPSAGGSSPAGDPSRRPAGISDAEMERRLNALKAAKARESEEAAQREAEEKARAE
FT                   ERERRRAEQEAKEREQREAEQRAREKAEEEERQRREAEEEAKRAAVRAAAEQEAPKAER
FT                   SAERAPAAARPEGGDNARRTTDRDREREQRQTRGKGRQDGRRSGKLTLSQVTDGEGGRQ
FT                   KSLAAMKRKQERARQKAMGGAAEREKVIREVQLPEAIVVSELANRMAERVADVVKELMK
FT                   MGMMVTQNQTIDADTAELIIEEFGHKVVRVSDSDVEDVISDIEDAEEDLKPRPPVITIM
FT                   GHVDHGKTSLLDAIRDAKVVAGEAGGITQHIGAYQVKTDGGATLSFLDTPGHAAFTSMR
FT                   SRGAQVTDIVVLVVAADDAVMPQTVEAINHAKAAGVPMIVAINKIDKPEANPTKVRTDL
FT                   LQHEVVVEAMSGEVQDVEVSAKTGEGLDELLEAIALQAEILELKANPDRPAQGAVIEAQ
FT                   LDVGRGPVATVLIQKGTLRQGDIFVVGEQYGKVRALINDKGERVSEAGPSVPVEVLGLN
FT                   GTPEAGDVLNVTSTEAQAREIAEYRAQVAKDKRAAAGAATTLEQLMAKAKADENVAELP
FT                   ILVKADVQGSAEAIVQAMEKIGNDEVRVRVLHSGVGAITETDVGLAEASGAPIMGFNVR
FT                   ANASARNTANQKGVEIRYYSVIYDLVDDVKAAASGLLSAEIRENFIGYANIKEVFKVSN
FT                   VGKVAGCLVTEGVARRSAGVRLLRDNVVIHEGTLKTLKRFKDEVAEVQSGQECGMAFEN
FT                   YDDIRPGDVIEIFEREEVTRTLT"
FT   gene            complement(65364..65987)
FT                   /locus_tag="SPO0062"
FT   CDS_pept        complement(65364..65987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK22031.1; match to
FT                   protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93393"
FT                   /db_xref="GOA:Q5LWL3"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL3"
FT                   /protein_id="AAV93393.1"
FT                   /translation="MTRGGAHKDRTEGPERKCIATGESQPRFGLIRFVAGPDGQLVPDI
FT                   AGKLPGRGTYVAADREALQKAVDKKLFARGLKQQVQVPDGLVDEVERQLIRRVVDLLSL
FT                   ARKSGDAVSGYEKVKTWLDKEEAQVLIQASDGSGRGKTKLSTPHFGKYIGWLTADELGM
FT                   AFGRQTVIHAALASGGLAKRVVEEAQRLRGMRKTDDGGKGRAEG"
FT   gene            complement(66012..67637)
FT                   /gene="nusA"
FT                   /locus_tag="SPO0063"
FT   CDS_pept        complement(66012..67637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SPO0063"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM TIGR01953; match to protein
FT                   family HMM TIGR01954"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93394"
FT                   /db_xref="GOA:Q5LWL2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL2"
FT                   /protein_id="AAV93394.1"
FT                   /translation="MAITSANQLELLQTAEAVAREKMIDPGLVIEAMEESLARAAKSRY
FT                   GAEMDIRVSIDRKTGKATFTRVRTVVADEELENYQAEFTVDQAKQYMENPQIGDTFVEE
FT                   VPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVG
FT                   AGEAILRRNEKIGRESYRPNDRIRCYIKDVRREPRGPQIFLSRTAPEFMAELFKMEVPE
FT                   IYDGIIEIKAVARDPGSRAKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDII
FT                   PWNEDQPTFLVNALQPAEVSKVVLDEEAGKIEVVVPEEQLSLAIGRRGQNVRLASQLTG
FT                   LDIDIMTEAEESARRQKEFESRTNLFMETLDLDEFFAQLLVSEGFTNLEEVAYVELDEL
FT                   LVIDGVDEGTAEELQARARDYLEAQAKAALDNARALGAEDSLIQFEGLTPQMVEALAKD
FT                   DVKTLEDFATCADWELAGGWTTVDGQRVKDDGILEPFGVSLEDAQDMVMTARVMLGWVD
FT                   PTELLEEAEETEEGETATDEEAGA"
FT   gene            complement(67637..68263)
FT                   /locus_tag="SPO0064"
FT   CDS_pept        complement(67637..68263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q8UJ48; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93395"
FT                   /db_xref="GOA:Q5LWL1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL1"
FT                   /protein_id="AAV93395.1"
FT                   /translation="MTNNLIAKAAIDRRLAEIVSPVIADLGYELVRIRLMSGKSTTLQI
FT                   MADKPDGGIEVDDCAAISNAVSATLDVEDPILDAYTLEVSSPGIDRPLTRLKDFEMFEG
FT                   YEAKIETTEMIDGRRRFRGELAGIEGNEVLINLDQNGETVTIGLEFDWLSDAKLVLTDD
FT                   LIKEMLRQRKAAGVLNEDQFDEIVEEAPETGATTMARDGSEEETK"
FT   gene            complement(68420..69241)
FT                   /locus_tag="SPO0065"
FT   CDS_pept        complement(68420..69241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0065"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93396"
FT                   /db_xref="GOA:Q5LWL0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL0"
FT                   /protein_id="AAV93396.1"
FT                   /translation="MTRIDRRALFASGAAAALLASAGMSLADRPRAGGSLRLAVPRDDS
FT                   LERIARGAVFDTLTEIAPDGTLRGELATGWQPDDSARVWSFDLREDVTFHDGTRFSASD
FT                   AAASLAEIGLAEALGPTRLRLELAEADPGLPFRLADTRFAITRAGGAVTPLEQANGTGC
FT                   YRVERAQDGRHFLGRKVVGHYKQGQAGWADTVEVIVIPDPAVRAEALRDGYVDVAALPL
FT                   PDGLRDRTRFRYHPSEDDMALAAAVSVGLPRQISSRSALDDGRLAERWWVG"
FT   gene            complement(69238..70188)
FT                   /gene="pip"
FT                   /locus_tag="SPO0066"
FT   CDS_pept        complement(69238..70188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="SPO0066"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01249"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93397"
FT                   /db_xref="GOA:Q5LWK9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK9"
FT                   /protein_id="AAV93397.1"
FT                   /translation="MQYLHPPIEPFDQRMLDVGQGHRIYVEQSGNPNGIPVVVLHGGPG
FT                   GGCSPAMRRYFDPSVYRVILFDQRGCGRSRPHASVTDNTTWHLVADIERIRKTLEIDSW
FT                   IAFGGSWGATLALIYAQTHPDRVTHLVLRGVFLMTQAELDWFYGGGAGRFWPEPWSRFA
FT                   ALIPENERGDMIAAYHKRLFSGDMAQEIRYARAWSAWENALASIQSNGTTGESPGDYAR
FT                   AFARLENHYFINDGFLEFDGQILANMGRISHIPGHIVQGRYDMICPPNSAWKLSELWPN
FT                   ADLRMIRNAGHALSEPGISAELVRIMDAIAEEVTA"
FT   gene            70268..71014
FT                   /gene="ubiG"
FT                   /locus_tag="SPO0067"
FT   CDS_pept        70268..71014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="SPO0067"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="identified by similarity to SP:P17993; match to
FT                   protein family HMM TIGR01983"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93398"
FT                   /db_xref="GOA:Q5LWM6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWM6"
FT                   /protein_id="AAV93398.1"
FT                   /translation="MQAHPNTVDPSEIAKFEAMAAEWWDPHGKFKPLHMLNPCRLDYIT
FT                   RQIAGEFDRDLGTERPFAGLRLLDIGCGGGLLSEPMARLGAEVVGADAAEGNLPVARIH
FT                   AEQSGLEIDYRHTTAEALAEAGEQFDVVLNMEVVEHVADPLSYLRATHDLLKPGGLQIC
FT                   STINRNPKSYAMAILGAEVVMRWLPRGTHDWSKFITPDELFDLLRQAGLEPVDRKGFVF
FT                   NPISWQWSISDRDLSVNYVTASLRPR"
FT   gene            complement(71105..71545)
FT                   /locus_tag="SPO0068"
FT   CDS_pept        complement(71105..71545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0068"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93399"
FT                   /db_xref="GOA:Q5LWM5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM5"
FT                   /protein_id="AAV93399.1"
FT                   /translation="MADEIHTLAVSLFSEILTADQLLRNRLSRVLPKGMEISHFSVLNH
FT                   LVFVGDERTPAQLASTFHVTRGAMTNTLAKLEWAGYIHIRPDWDDARRKMVAISPAGRQ
FT                   ARDQAISMISPLIDQVVGELGAERVRLALPVLRDLRIKLEIN"
FT   gene            complement(71558..72388)
FT                   /locus_tag="SPO0069"
FT   CDS_pept        complement(71558..72388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0069"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93400"
FT                   /db_xref="GOA:Q5LWM4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM4"
FT                   /protein_id="AAV93400.1"
FT                   /translation="MKTALLQLTSSDDPAANLDMVRGMVAEAAAQGARWVLTPEVTNCV
FT                   SNSTTRQREVLQHEEDDITLAGLRAQATELGIWLLIGSLGLKTHDADGRFANRSFMIGP
FT                   DGGIVARYDKIHMFDVQVTETETFRESANYRPGDRAVLAPTEFGTVGMTICYDLRFPHL
FT                   HAALAQAGATVLTVPAAFSPVTGAAHWESLLRARAIETGCWVLAPAQTGTHPNSRGKPR
FT                   RTHGHSLVVAPWGEVRIDAGSEPGIHIFDLDDTSVTEARRRVPSLTHKRAFDGP"
FT   gene            complement(72385..72645)
FT                   /locus_tag="SPO0070"
FT   CDS_pept        complement(72385..72645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0070"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93401"
FT                   /db_xref="GOA:Q5LWM3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM3"
FT                   /protein_id="AAV93401.1"
FT                   /translation="MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMI
FT                   QRAGGRRTVPQIFIDGQHVGGCDDLYALEQDGKLDPMLASR"
FT   gene            complement(72738..73466)
FT                   /locus_tag="SPO0071"
FT   CDS_pept        complement(72738..73466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0071"
FT                   /product="competence protein F, putative"
FT                   /note="identified by similarity to GB:AAK22815.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93402"
FT                   /db_xref="GOA:Q5LWM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM2"
FT                   /protein_id="AAV93402.1"
FT                   /translation="MWQQIQTAIETVYPPRCLGCGDLVTSDFGLCGKCWRDTPFIDGTV
FT                   CDSCGAPLPGARDGHRIECDDCMAHPRPWSDGRAALLYTGRARRMVLALKHGDRPELAR
FT                   PGGLWMARAAAPLLQPNMLIAPVPLHWSRLLRRRYNQSALLAQSVGRQTGLPVCPDLLV
FT                   RDRATPMLEGMSMTERAKTLSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQAC
FT                   LNAGADQVFVLVLARVTREA"
FT   gene            73483..74316
FT                   /locus_tag="SPO0072"
FT   CDS_pept        73483..74316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE26039.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93403"
FT                   /db_xref="GOA:Q5LWM1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM1"
FT                   /protein_id="AAV93403.1"
FT                   /translation="MTTPGSSLPPALVDRTALAARRARMRDAALFLHHAALDEVQDRLS
FT                   LVNRTFTDMAVVTPAPALWAGSFPMARFVAEDEMLDLAPQSCDLVVHAMALHWANDAVG
FT                   QLIQCRRALRPDGLLLAICFGGQTLHQLRAALAEAEAQVSGGISPRVAPMAEIRDLGAL
FT                   LQRAGLALPVADSLTLTAEYRDLPHLMRDLRQMGEANALSARLRHPTQRAVFERAEEIY
FT                   AAHFATPDNRLPATFELICLTGWAPDDSQPKPLRPGSASARLAAALGTSETPLPD"
FT   gene            74429..75424
FT                   /gene="hemH"
FT                   /locus_tag="SPO0073"
FT   CDS_pept        74429..75424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SPO0073"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93404"
FT                   /db_xref="GOA:Q5LWM0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM0"
FT                   /protein_id="AAV93404.1"
FT                   /translation="MGRVGVLLANLGTPDDYSYWPMRRYLNEFLSDKRVIDYPAWKWQP
FT                   ILQGIILTKRPFSSGAAYESIWNHDKGESPLMTITKDQTAKLRAALAERYGDRVMVDFC
FT                   MRYGNPSTKSKVRQMVTEGCDRILFFPLYPQYAGATTATANDQFFRALMDETWQPAART
FT                   VPAYFDQPAYVDALAQSIERAYAAMDSRPDVLVCSYHGMPERYLMQGDPYHCQCVKTTR
FT                   LLRERLGWDESEVVSTFQSRFGPEEWLKPYTVDHVAELARQGKRNIAVVAPAFSADCIE
FT                   TLEEINEEIRESFEHAGGERFTYIPCLNDEDAHIAALAGVVASNLGGWLD"
FT   gene            complement(75521..75706)
FT                   /locus_tag="SPO0074"
FT   CDS_pept        complement(75521..75706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0074"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93405"
FT                   /db_xref="GOA:Q5LWL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL9"
FT                   /protein_id="AAV93405.1"
FT                   /translation="MKKLVLAAALTAAASTAFAGNLSEPVVEAPVIVEETQSSSSGILL
FT                   PLILLVLVGAAVAANN"
FT   gene            complement(75848..76474)
FT                   /locus_tag="SPO0075"
FT   CDS_pept        complement(75848..76474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0075"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein/Tat domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93406"
FT                   /db_xref="GOA:Q5LWL8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL8"
FT                   /protein_id="AAV93406.1"
FT                   /translation="MNFCVKVLLMVKKPTTLSTRRSFLVGAATALGTPALAQFTPEDPL
FT                   RPAPEPEAPVRRNTSSFRALDWRPYFSNTRNGAILVDTVSRALHYWSEDQSVYRLFPSS
FT                   VPLTDELTRRGRTSVIRKVVGPSWAPTPSMKKRNPEWPDYIPPGPDNPLGTHALYLSWK
FT                   YYRIHGTHDTRKIGRRSSNGCIGLYNEHISQLFDLTKVGTQVLLI"
FT   gene            76609..77127
FT                   /locus_tag="SPO0076"
FT   CDS_pept        76609..77127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0076"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93407"
FT                   /db_xref="GOA:Q5LWN5"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN5"
FT                   /protein_id="AAV93407.1"
FT                   /translation="MTMTRLISLLLAGFLALAACTDTGGSGQLGSDGKPLPKVYRIRGD
FT                   ASKLQFRMLDSVNALRQASGLGVVQLSPELNAAAATHARDMSVQNRPWHFGSDGSSPID
FT                   RARRAGYTGIFLGEAISETYETEVETLAAWMEEPGSRSVILDPKAIMMGFAWFQENNGK
FT                   IWWALEMGS"
FT   gene            complement(77195..77659)
FT                   /gene="ptsN"
FT                   /locus_tag="SPO0077"
FT   CDS_pept        complement(77195..77659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="SPO0077"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR01419"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93408"
FT                   /db_xref="GOA:Q5LWN4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN4"
FT                   /protein_id="AAV93408.1"
FT                   /translation="MELSSILKPNAVRVIGAASSKKRLFQEITDLAEATLKLDAQETLE
FT                   ALLERESLGPTGVGHGVALPHARVAGLDQVAGVFVLLEKPLDFGAVDRQPVDLAFALFA
FT                   PEDAGVEHLKALALVSRTLREQAVCTKLRANPDPTKLYAILTESHPLQAA"
FT   gene            complement(77723..78286)
FT                   /locus_tag="SPO0078"
FT   CDS_pept        complement(77723..78286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0078"
FT                   /product="ribosomal subunit interface protein, putative"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93409"
FT                   /db_xref="GOA:Q5LWN3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN3"
FT                   /protein_id="AAV93409.1"
FT                   /translation="MRYQISGKQIDIGAALQSHVQTELGEVVSKYAQRPTDAHVVFSRS
FT                   AHEYVCEATVHLSTGLTAQAKAHATEIYAAFDGCCEKMDKQLRRYKRRLKDHHKDRAEP
FT                   VELFGASSYILASEEPDAQSEPDSLQPMIVAEMETKIPSLSVGEAVMQMELAGAPVLVF
FT                   RNESKDGLNVVYRREDGNIGWIDP"
FT   gene            complement(78536..79294)
FT                   /locus_tag="SPO0079"
FT   CDS_pept        complement(78536..79294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0079"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GB:AAM48706.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93411"
FT                   /db_xref="GOA:Q5LWN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN2"
FT                   /protein_id="AAV93411.1"
FT                   /translation="MSKPQLTVTEGSSGLRIEKLRKSYRKKTVIRDVTMTLGRSEVVAL
FT                   LGPNGSGKTTTFYSVAGLVFPEAGKVSIDGQNVTTLPMYRRARMGIGYLPQEMSIFRGL
FT                   SVEDNILSVLDITQKHAHKRRERLEELLSDFSIEHLRRAPALALSGGERRRVEIARCLA
FT                   ADPKYLLLDEPFAGVDPISVGDIRHLVSDLRNRGIGVLITDHNVRETLEIVDRAYILHD
FT                   GQVLMSGSPEEVVENENVRRVYLGENFRIS"
FT   gene            complement(79294..79785)
FT                   /locus_tag="SPO0080"
FT   CDS_pept        complement(79294..79785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03968"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93410"
FT                   /db_xref="GOA:Q5LWN1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN1"
FT                   /protein_id="AAV93410.1"
FT                   /translation="MIEIRALILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTAD
FT                   SLDVSQEDGSAEFQGNVLVSQGEMRLSAKRVLVIYNQEASGIERLEATGDVVLVSGSDA
FT                   AQAQRADYTIGTGVIVMTGDVLLTQGKNALSSGKMTVNLTSGTAQMVGRVKTILNSGSD
FT                   "
FT   gene            complement(79789..80397)
FT                   /locus_tag="SPO0081"
FT   CDS_pept        complement(79789..80397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM48708.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93412"
FT                   /db_xref="GOA:Q5LWN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN0"
FT                   /protein_id="AAV93412.1"
FT                   /translation="MAIDSYSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFA
FT                   EDEIADRTRGQQITGPFFTAVTPKGEQIQVQATLARPGGENAPAEATDLIAELLLLGGK
FT                   RIRLTSDLGTVQLDKDLAIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGP
FT                   IGEFTAGSMQMGAENEDGPIHIRFKNGVKLLYDPKAAER"
FT   gene            complement(80401..81369)
FT                   /gene="kdsD"
FT                   /locus_tag="SPO0082"
FT   CDS_pept        complement(80401..81369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="SPO0082"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /note="identified by similarity to SP:P45395; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR00393"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93414"
FT                   /db_xref="GOA:Q5LWM9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM9"
FT                   /protein_id="AAV93414.1"
FT                   /translation="MTDRSSFIDTARQVVLDEARALDALSESLGDGFAEAVELILRTKG
FT                   RVIVSGIGKSGHIGHKIAATLASTGTPAYFVHPAEASHGDLGMLSGDDVVLAISNSGEA
FT                   PELANLLAFTRRFAIPLIGLSSKSESSLMQQADVHLLIPALGEACGFGMVPSISTTLTL
FT                   AMGDALAIALMKYRDFRPENFRVFHPGGKLGARLSRVSDLMHGGEAVPLIAADTPMSEA
FT                   LLEISRKGFGVVGVTDGAGHLAGIVTDGDLRRHMSGLLDKTAAQVMTANPTTIAPDSLA
FT                   EEAVAIMNARKITSLFVVDPAEPGVARGLLHIHDCLRVGLG"
FT   gene            complement(81366..81980)
FT                   /locus_tag="SPO0083"
FT   CDS_pept        complement(81366..81980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0083"
FT                   /product="exonuclease, putative"
FT                   /note="identified by match to protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93413"
FT                   /db_xref="GOA:Q5LWM8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM8"
FT                   /protein_id="AAV93413.1"
FT                   /translation="MANHLYKNDLPDGLDLGPVVAIDCETMGLNPHRDRLCVIQMSGGD
FT                   GNTHIVQVEKGQTAAPNLCAMLENPEVLKLFHFGRFDIAALYHAFGALTAPVYCTKIAS
FT                   RLVRTYTDRHGLKNLCQELLGVDISKQQQMSDWGAETLSEAQLDYAASDVLYLHRLREA
FT                   LDGRLAREGRADLAQSCFDFLPTRARLDLVGWPETDIFAHS"
FT   gene            complement(82247..83701)
FT                   /gene="betB"
FT                   /locus_tag="SPO0084"
FT   CDS_pept        complement(82247..83701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="SPO0084"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="identified by similarity to SP:P54222; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01804"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93415"
FT                   /db_xref="GOA:Q5LWM7"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM7"
FT                   /protein_id="AAV93415.1"
FT                   /translation="MKFQPEASHFINGAYVEDTAGAVIDVIYPATGEVIARLHSATPAI
FT                   IDQALEAARQAQAQWAAMTGTERGRILRRAADIMRARNHDLSVIETHDTGKPIQETTVA
FT                   DATSGADALEYFGGLAGSLTGEHIPLGGGDFAYTVREALGVCVGIGAWNYPTQIACWKG
FT                   APALACGNTMVFKPSETTPLSALKVAEILIEAGAPKGIYNVVQGYGDVGASLVTDPRVA
FT                   KVSLTGSVPTGRRVYAAAAESIKHVTMELGGKSPLVVFDDADIENAVSGAILGNFYSSG
FT                   QVCSNGTRVFVQKGIKEAFLSRLAERLATAVIGDPMDPATNFGPMVSEAQMNIVLGYVD
FT                   KGKAEGARLVYGGTRLDRDGFYLLPTVFADVTDDMTIAREEIFGPVMSVLDFDTEEEVL
FT                   ERANATEFGLAAGVFTRDITRAHRMVAGFEAGTCYINSYNLAPVEAPFGGSKQSGVGRE
FT                   NSKLAINHFSEMKTVFVSMNDIQAPY"
FT   gene            83874..84212
FT                   /locus_tag="SPO0085"
FT   CDS_pept        83874..84212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE29577.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93416"
FT                   /db_xref="GOA:Q5LWP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP4"
FT                   /protein_id="AAV93416.1"
FT                   /translation="MDAMTQHYDAMPQMGPSNDYHLLPVTEKQLRFARSIAARASLDIP
FT                   IEAQRDRRMLSAWISAHRAPESSPFDRYPSGKQVAYAERIARAKRRAVPSECFHDKAAM
FT                   SAWIDRNK"
FT   gene            84326..85588
FT                   /locus_tag="SPO0086"
FT   CDS_pept        84326..85588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0086"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by similarity to GB:CAC41759.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93417"
FT                   /db_xref="GOA:Q5LWP3"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP3"
FT                   /protein_id="AAV93417.1"
FT                   /translation="MKTRVFAAAALALSCSVPAWAADRAAVLTTYADIAEAKYQDSLIT
FT                   ARALQVAVDALIADPSAQTLAAAKQAWLAARDPYQQTEVYRFGNAIVDDWEGKVNAWPL
FT                   DEGLIDYVDASYPGASDENGYAALNVIATPVFDLSGTTVDASQITPELLSGTLHEADGV
FT                   EANVATGYHAIEFLLWGQDLNGTGPGAGNRPWTDYAPGADCTGGNCDRRGAYLQAATDL
FT                   LISDLEWMAAQWAPGGDARTSVTADETAGLVAMLTGMGSLSYGEQAGERMRLGLLLNDP
FT                   EEEHDCFSDNTHNSHYFDGLGIRNVYLGSYTRVDGTVISGASLSDLVADADAALDAEVK
FT                   DRLNITMDALGAIRSAAKGGFAYDQMLARGNAEGEALIMAGVDGLVEQARSFQRLFPVL
FT                   GLDDIAFEGSESLDNPGAVFH"
FT   gene            85616..86671
FT                   /locus_tag="SPO0087"
FT   CDS_pept        85616..86671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93418"
FT                   /db_xref="GOA:Q5LWP2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP2"
FT                   /protein_id="AAV93418.1"
FT                   /translation="MPAKLLIQESSIMTYRHFAALTGAAALFAGAVQAQEAPGFTWEGS
FT                   LELEYARTFKSDTPGNEFGAATGTLELSGAYRFNDTFSVFAALTGESLNDPTPGDRNFT
FT                   DWGLYIKELGVQIETGSASFQLGKVSPSFGIAWDQTAGFFAADLAEDYELTEQLGALVA
FT                   VDLGAAGMLHAGLFYADDTALSRSAGFRRARNSTASGGAGNTGQLDNGAVTWIKSFGGT
FT                   ELRLGVRHLSRGAGDVKSENGVVASLFHSFHHMPLDLFAEVASFSGYGGTADDATYATL
FT                   NAAYALGDVTLSGTYARRDIDSTGLTELFSIGAEYEFGERYLVGAALARVEEAGATDHV
FT                   FGINFEIALGV"
FT   gene            86668..88158
FT                   /locus_tag="SPO0088"
FT   CDS_pept        86668..88158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB51963.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93419"
FT                   /db_xref="GOA:Q5LWP1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP1"
FT                   /protein_id="AAV93419.1"
FT                   /translation="MNIWGPHIVQARRAVAIFCRGLLVLMPALSLLGLTAEAEPRSADD
FT                   RQRIAAVTAPATGFTVAEPFEQLPGGAATVSGDLGRDAFSRPSANMSFERELDFHLGQA
FT                   LFDKLWVASPSSTKASDGLGPLYNARSCQACHIRDGRGQVSGGPGLVLRIGRVRGDGVL
FT                   PDPLFGLQIQDSAVPGLRPEARIAVSQAETEVTLNGGEVAVLRKPRYRLDAAEGTLHAE
FT                   STLSPRLAPQMIGLGLLEAIPEAEILARADPDDRDGDGISGRPNRVHDPETGQEALGRF
FT                   GWKAGAASVLDQTAAAFASDIGISSPLRPAPWGDCTELQVECRAALHGDGDPRGAEIDG
FT                   PALALTAFYSRNLAVPARRDVDDPDVLRGKRVFYGIGCPACHVPKHVTAQLSDQPEQSF
FT                   QLIWPYTDLLLHDMGAGLADELPQGLASGREWRTAPLWGIGLTEQVSGQARFLHDGRAR
FT                   TLLEAVLWHGGEAAAQRDRVIALAPEDRAALIRFLESL"
FT   gene            88160..89155
FT                   /locus_tag="SPO0089"
FT   CDS_pept        88160..89155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE32220.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93420"
FT                   /db_xref="GOA:Q5LWP0"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP0"
FT                   /protein_id="AAV93420.1"
FT                   /translation="MKQLVALILCLAAAAASADPVDQVLDVHVLPGFARLADETALLAN
FT                   AADAGCEERDPDLRAALNGALRAWAGVSHLRFGPTEAENRAFALAFWPDSRGMTPKALA
FT                   GLIAAEDPVVQEAEGFAQVSVAARGLYALEFLLYDEGQAGNDPYHCALIRAIVRDSAGL
FT                   ARAMAADWHDRYAALMRAPGPDSPYRSRDEAMQELFKALGTGLQITADLRLGRPLGSFA
FT                   RPRPNRAEAWRAGLSLLLVIEALHSQRQLALLLAEEDAGLKARLTDAFDRALGDAAALD
FT                   DPALAGVATPAGRFRVEALQQRVNEIRQVVAQELGPKLGVSAGFNALDGD"
FT   gene            89159..90235
FT                   /locus_tag="SPO0090"
FT   CDS_pept        89159..90235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE37570.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93421"
FT                   /db_xref="GOA:Q5LWN9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN9"
FT                   /protein_id="AAV93421.1"
FT                   /translation="MTTRRGFLAGLAAAGLTPRAGWADAGAPAFLSAGRVADGAYNLYG
FT                   LDRRGRPLFHLPIPDRGHAAAAHPQRAEAVAFARRPGRFALVLNCVSGAEIARLSAPEG
FT                   RHFYGHGAFDAEGRVLFTTENDYEAGQGRIGLWDAGAGYRRIGEVASGGVGPHDIRLMP
FT                   DGQTLVVANGGVETHPDTGRVKLNLPVMQPNLSYLSLAGEVLEVVRMPPEHRMNSIRHL
FT                   DLRADGLVAFAMQWQGEGTELRPVLGLHRRGTAPVAVTGNEAEMRAMNGYGGSVIFYDQ
FT                   GRRVAVSSPRGGIVQLSDVAAGRIIGGVAITDVCGLGVTGGGLVASSGSGVFTRVGGKE
FT                   ASRSEIAWDNHLVAVNRA"
FT   gene            complement(90242..91147)
FT                   /locus_tag="SPO0091"
FT   CDS_pept        complement(90242..91147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0091"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93422"
FT                   /db_xref="GOA:Q5LWN8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWN8"
FT                   /protein_id="AAV93422.1"
FT                   /translation="MYTIAALYHFTRFADPADLKPALLDLCLAQGVKGTLLLAKEGING
FT                   TIAGPRAGIDAVLAHIRALPGCSDLEWKEATSDHPPFGKMKVRLKQEIVTMGQPDVDPR
FT                   ARVGHYVEPEDWNDLIRSDDVVLIDTRNDYEVAIGTFEGAIDPMTESFRDFPAWWEANK
FT                   ERFHNKRVAMFCTGGIRCEKSTNYLLGQGVEDVYHLKGGILRYLEEVPAENSTWQGECF
FT                   VFDNRVSVGHGLVEGPHELCHGCRRPILPEDRNRPEYEHGVSCHLCIDETSEADKMRFR
FT                   ERQKQIALARARGEDHLATH"
FT   gene            complement(91224..92447)
FT                   /locus_tag="SPO0092"
FT   CDS_pept        complement(91224..92447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0092"
FT                   /product="heat shock protein, Hsp70 family"
FT                   /note="identified by similarity to SP:P36928"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93424"
FT                   /db_xref="GOA:Q5LWN7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN7"
FT                   /protein_id="AAV93424.1"
FT                   /translation="MARLGVDFGTSNTAAGLVQAGHPRVLPLEPGAQTLPTAVFIDFAA
FT                   RRYVYGTDAARAMMDGQEGRFLRGLKSILGTPLAREPRMFLNERLTLIEVIARFLAEIR
FT                   TRAERLSGERFDRALSGRPVHFHSASAERDAQACTDLHDAYLMAGFSEVCFLPEPEAAA
FT                   LAVAGQGRMLIVDIGGGTSDFTLCDRRGTTTRMLASRGLRIGGTDFDRVLSLDHAMPLL
FT                   GYEAQIGAELGEASHSAPRALFHDLASWEKIAFVYDPATLREVRRWVRLAEQPRLFERL
FT                   AEVLESHLGHDVAYAVEAGKIAANGAAAGRIALDIVERGLGADLGNAAMQAALAGFADE
FT                   IATCAMQTVRDAGVGPDSVDQVVFVGGSSLMGVIRAALARVLPGAEQQDSEVFTAVVHG
FT                   LALASEDQ"
FT   gene            92595..93185
FT                   /gene="pncA"
FT                   /locus_tag="SPO0093"
FT   CDS_pept        92595..93185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="SPO0093"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="identified by similarity to SP:P21369; match to
FT                   protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93423"
FT                   /db_xref="GOA:Q5LWN6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN6"
FT                   /protein_id="AAV93423.1"
FT                   /translation="MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQ
FT                   DWHPAGHSSFASSHPGQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILR
FT                   KGFRAAIDSYSGFFENDRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGF
FT                   AVEVRMQACRAIDLDGSLAAAIAAMKAGGIALT"
FT   gene            93264..95495
FT                   /locus_tag="SPO0094"
FT   CDS_pept        93264..95495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0094"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00785; match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93425"
FT                   /db_xref="GOA:Q5LWQ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ3"
FT                   /protein_id="AAV93425.1"
FT                   /translation="MHVAGSPDVDHLSEYERRYSRRGLLIRYARGRVRNFAGRQIMTFA
FT                   GSFILAMTEGLHTAMLAAFAALLGEVIDCLYLHRLPERLRQGQGYRRLLIGSTLTALVQ
FT                   ALTISFCVWLAWTGARSGLSPLFIGSFLAGAAINAGLVLPFHRPAAVARLAVYAGIGQY
FT                   LFLIEAMEPGRLGDALLLNAAGAVMLAFMVGLFLNFVNWGFRQHRRTTLDLIEQGRDLL
FT                   RHQKEAQLLSLVARNANDSVILADSEGRIVWTNESFTRTTGYSLDEAKGRYPGELLNGD
FT                   KTDLEVSNAIADAVEAGRPFRTEILNVTKDGREIWMETNLVPVLDRNGKVEVTVAIERD
FT                   VTAAKAQAEELAAARVAAEEGARAKAEFLATMSHEIRTPMNGVVGMAELLSETKLSIEQ
FT                   RQYVDTIRSSSTALLAIINDILELSRLDARKMELHPVNFDPVSCVRDTMRLLKPQAQAK
FT                   GLRLSLETGADVPPLVYGDDGRLRQVLINLLGNAIKFTERGGVTLRLRSEAQDPGYLLT
FT                   LEVEDTGIGIAAEKIERVFERFSQADADTTRLYGGTGLGLTISRELVALMGGRITVDST
FT                   LGQGSCFTLCLPLGSPDDDAGQSDGQVLSPAELDRLRGLRVLVADDNRVNRLLMGKFLA
FT                   DLPIRLDFAHDGQQAVAMTQRQKPDIVFMDMSMPVMSGIEATRQIRAAEGRQPLIVALT
FT                   ANTFDSDREACLAAGMDDFLSKPVGRADLFRCLLHHLPPTDAAPRTASG"
FT   gene            95526..96869
FT                   /gene="pncB"
FT                   /locus_tag="SPO0095"
FT   CDS_pept        95526..96869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="SPO0095"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by similarity to SP:P18133; match to
FT                   protein family HMM PF04095"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93426"
FT                   /db_xref="GOA:Q5LWQ2"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ2"
FT                   /protein_id="AAV93426.1"
FT                   /translation="MAVRLAYPWVIHSERGPSVDIATRVYNHKWKIDPIVRSLIDTDFY
FT                   KLLMCQSVFRNKPDTQVTFSLINRTMRIPLARIIDEGELREQLDHIRSLRLSRGESTWL
FT                   RGNTFYGKRQMFRPDFMEWFEGLQLPPYHLERRDDQYELTFEGNWPEVMLWEIPALAVL
FT                   MELRSRAVLHDMRRFELQVLYARAMTRVWEKIERLRGIDGLTIADFGTRRRHSFLWQDW
FT                   CVQAMIEGLGAKFTGTSNCLIAMRREVEAIGTNAHELPMVYSALAETDTELARAPYDVL
FT                   SDWHEEHDGNLRIILPDTYGTKGFLDRAPDWLAGWTGIRIDSGDPAEGAETAISWWKDR
FT                   GENPTDKRIIFSDGLDVDKIAELHARFSGRAKISFGWGTLLTNDFRGLVPDDGLAPFSL
FT                   VCKAVSANGHPTVKLSDNPEKAMGPADEVARYKRVFGVGRQTSYAVEV"
FT   gene            complement(96926..97840)
FT                   /locus_tag="SPO0096"
FT   CDS_pept        complement(96926..97840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0096"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93427"
FT                   /db_xref="GOA:Q5LWQ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ1"
FT                   /protein_id="AAV93427.1"
FT                   /translation="MNARSGDNVVLAILLSLLALVLFDMMGLIIKYLSPRYGAAELSAY
FT                   RNFFGVFPSVIALWSSPGWHRAGRPWRIRQWRLGLMRGVYVTFAQFLFYYSLGKLAFAT
FT                   ASTITYANAVFMTALAVPLLGERVGLMRWAAVLLGFAGVLLVMKPGSDSFTPDALAPLG
FT                   AAFLYALTGVSARQMDSAVPSALINLYSVVAALVGALALALLSGGFTPLAQWSDLGWIA
FT                   AMGGFGGTAVLCLVASYRMTEQSNLAPFSYFGIPIAFVAGWLVFDETPWADLFPGAFFI
FT                   AGGGLMIVWRERIRSRAGRRISN"
FT   gene            complement(97843..99294)
FT                   /locus_tag="SPO0097"
FT   CDS_pept        complement(97843..99294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0097"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93428"
FT                   /db_xref="GOA:Q5LWQ0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ0"
FT                   /protein_id="AAV93428.1"
FT                   /translation="MTLPLWFDPTLCLIGGRWQAPRGGDTLPLINPSDGTEICRIARGT
FT                   APDIDTAVTAAEAALAGDWGRMTATERGRILSRLGQLVLERVEDLAVIEAWDVGKPLTQ
FT                   ARADAVALARYCEFYGGAADKVMGETIPYLEGYTVYTLREPHGVTGHIVPWNYPMQIIG
FT                   RSVGAALAMGNACVLKPAEEACLTALAFADLAKQAGLPAGALNVVPGLGAEAGAALSAH
FT                   PGVHHISFTGSVATGALVQQAAGRNVVPVTLELGGKSPQLVFDDADLDTALPFLVNAGC
FT                   QNAGQTCSASSRILAQRGVYEEVKARMAASYAELTVGPAMEDLRVGPLISARQKEIVTG
FT                   FLDKGADLTIAAQGRIVDHAPETGAYVRPTLFADVPPDHALARDEIFGPVQVLIPFDTE
FT                   EEAIAIANGTDYGLVASIWTRDGARQMRLAKRLRAGQVFVNNYGAGGGVELPFGGVGKS
FT                   GHGREKGFEALYGFSQLKTVAARHG"
FT   gene            complement(99759..101357)
FT                   /locus_tag="SPO0098"
FT   CDS_pept        complement(99759..101357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0098"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93429"
FT                   /db_xref="GOA:Q5LWP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP9"
FT                   /protein_id="AAV93429.1"
FT                   /translation="MSLLQITDLSLSIHAYDILKRVSLTIDAGEIVAVTGESGSGKSMT
FT                   ALAVMQLLPGGARASGSIRLDGQEILTLPEAEMCALRGAAVGMVFQEPMTALNPVKTIG
FT                   DQVMETILIHKAMTPIRAEERAREVLTRVGLPPDRFPLSRYPHELSGGQRQRVVIAMAI
FT                   ALRPKLLIADEPTTALDVTTQAQILDLLKGLVQEYGMGMLMITHDLAVVADMADHITVM
FT                   RHGEVVEAAPTQRLLTGMSHPYTKMLFAASDHRVTLPAPPPPAPLLEVSEVVRDYALPR
FT                   TRLFAHPGHHRAVDHVSFALNRGERLGLVGESGCGKSTLTRAILGLEPVQGGEIRLAGQ
FT                   PVYDGKRANPEIRRRMQVVFQDPYGSFNPRHRVDRLVTEPFHLLDAPPTGSDRSDRIAE
FT                   MLTAVGLSPDDAGKYIHEFSGGQRQRIAIARALIIRPQLILFDEAVSALDVSVRAQILD
FT                   LLAQLCSEYDLTYLFISHDLSVVRTITDRVLVMQSGRIVEQGETAQVFSDPAHPYTRAL
FT                   IAAAPRLPETGARRA"
FT   gene            complement(101354..102169)
FT                   /locus_tag="SPO0099"
FT   CDS_pept        complement(101354..102169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0099"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93430"
FT                   /db_xref="GOA:Q5LWP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP8"
FT                   /protein_id="AAV93430.1"
FT                   /translation="MSRNLILGAGLSSLVVLAALISFIWTPYDHAALNIPAKLQTPNAR
FT                   HWFGTDHFGRDMFSMIMVGARTSIAVALLAVGIGMSLGVPLGLAAAARKGSWLDELIMR
FT                   GNDLVFAFPSLVIAILITAVFGAGAVNAIIAIGIFNIPVFARITRGAALSLWEREFILA
FT                   ARVAGKGAARISAEHILPNVANLLIVQGTIQFSLGILAEAGLSYVGLGAQPPTPSWGRM
FT                   LADAQTMVSFAPHLALIPGLAIILTVLGLNLMGDGLRDWLDPRLRVART"
FT   gene            complement(102166..103113)
FT                   /locus_tag="SPO0100"
FT   CDS_pept        complement(102166..103113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0100"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93431"
FT                   /db_xref="GOA:Q5LWP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP7"
FT                   /protein_id="AAV93431.1"
FT                   /translation="MLRYSLKRALSLAISLAVASLVIFAVIEIAPGDPASFMLGVNAQP
FT                   DTLAALRTELGLDQSKAERYVSWVTGMLRGDFGTSYTYRTPVSQMIADRLWVSLPLALY
FT                   ALALSTAIALPAGIYAAARRGKPGDLAVMGATQLGVAVPNFWFAMMLVLIFAINLRWFN
FT                   AGGFAGWDKGLTAGLHSLTLPAIALALPQAAILARVMRSALLDILGEDFMRTARAKGLT
FT                   RRQALWRHGLRNALIPVLTIIGLQFSFLLAGSIIIEQVFYLPGLGRLVFQAISARDLIV
FT                   VESVVMLLVFAVIVVNFLVDLAYALVDPRLRTRT"
FT   gene            complement(103222..104709)
FT                   /locus_tag="SPO0101"
FT   CDS_pept        complement(103222..104709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0101"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93432"
FT                   /db_xref="GOA:Q5LWP6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP6"
FT                   /protein_id="AAV93432.1"
FT                   /translation="MKRFVKQGVVSGLALSAALFAGAAWAKDDITIAMQLEPPHLDPTS
FT                   AAAQAIDSVVYVNIFEGLTRFMGDGSIVPALAESWEISGDGTVYTFRLHAGVTFHDGSA
FT                   MDAEDVKFSLDRARAEDSANAQKALFAGIDSVDVVDPLTVKVTLKEPNGNFLFNMAWGD
FT                   AVIVAPESIENIKTAPVGTGPYTLGEWVQGDKIVLNRNTGYWGDQPALAQATFKFISDP
FT                   TAAFAAMMAEDVDVFTGFPAPENLPQFEADPRFQVLVGSTEGETILSTNNKQAPFDNVK
FT                   VRQAMAHAIDRQAIIDGAMFGYGTPIGTHFAPHNPAYVDLTGTSAHDPDKAKALLAEAG
FT                   LPNGFETTLHLPPPSYARRGGEIIAAQLAEVGIKAEIINVEWAQWLETVFKGKDFGLTI
FT                   VSHTEPMDIGIYARPEYYFQYDNATFQELMGTLNSTTDPDKRTELMQQAQRIISEDYVN
FT                   GYLFQLAALSVAKAGVQGLWVNAPTAANDLSAISWSE"
FT   gene            104880..105719
FT                   /gene="panB"
FT                   /locus_tag="SPO0102"
FT   CDS_pept        104880..105719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SPO0102"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93433"
FT                   /db_xref="GOA:Q5LWP5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWP5"
FT                   /protein_id="AAV93433.1"
FT                   /translation="MSATARKTAPNAQDIRARKGGVPLVSLTAYTTPMARLMDGHCDFV
FT                   LVGDSVGMVLHGLNSTLGVTMEMMILHGQAVARGLDRAMLVIDMPFASYEEGPAQAFRN
FT                   AARLMAETGAGAVKLEGGVEMAETIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDD
FT                   QAQAVLADARAVADAGAFSVVLEKVPATLADRITAEVAIPTIGIGASAGCDGQILVVDD
FT                   MLGFFTAFKPKFVKRYADLGPLAEAAIAEYAAEVRARSFPAAEHVFGDQAPAKGAKA"
FT   gene            105716..106573
FT                   /gene="panC"
FT                   /locus_tag="SPO0103"
FT   CDS_pept        105716..106573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SPO0103"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by similarity to SP:P31663; match to
FT                   protein family HMM PF02569; match to protein family HMM
FT                   TIGR00018; match to protein family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93434"
FT                   /db_xref="GOA:Q5LWR2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR2"
FT                   /protein_id="AAV93434.1"
FT                   /translation="MSAPILRKLADLRAATAGWKRAGESIGVVPTMGALHDGHLSLVAA
FT                   AKAGCDRVVVTIFVNPKQFNNPEDLAKYPRTELADASKLAPYGVDAIYVPDPDQIYPEG
FT                   FATTVSVSGLTDVMEGACRPGHFDGVATVVAKLFLQTGADQAYFGEKDYQQMMLVTRMA
FT                   QDLDIPITVVGCPTVREASGLAMSSRNMRLSAEGLERAGRLHPVMRQVAERLAAGASFG
FT                   DLAPGAREALGAAGFVDIEYFDLRAADSLRALDRPTEPARLLVAAWLDGVRLIDNIAVS
FT                   QLND"
FT   gene            106644..108122
FT                   /gene="glpK"
FT                   /locus_tag="SPO0104"
FT   CDS_pept        106644..108122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="SPO0104"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93435"
FT                   /db_xref="GOA:Q5LWR1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR1"
FT                   /protein_id="AAV93435.1"
FT                   /translation="MTFILAIDQGTTSSRAILFDGEMRRVATAQREFTQHFPEAGWVEH
FT                   DAEEIWQTTVEVCREVIAGQGIGPEQIAGIGITNQRETTVVWDKAGGAPVHRAIVWQDR
FT                   RTAAICERLRHAGCEDDFTAQTGLLLDPYFSGTKVKWILDTVPGARDRAAAGELLFGTI
FT                   DSFLIWRLTGGRVHASDATNAARTLMFDIHQGEWSKDICELLDVPMSMLPEVRDCAADF
FT                   GTTDLFGGQVPILGVAGDQQAATIGQACFQPGMMKSTYGTGCFALLNTGTQPVASQNRL
FT                   LTTIAYQLDGQRTYALEGSIFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILV
FT                   PAFTGLGAPYWKPDCRGAMFGLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADAD
FT                   VILRVDGGMSASDWAMQGLADRLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAA
FT                   TWALDARFTPKMVEGDREAAYRRWKAAVAAAMMV"
FT   gene            complement(108119..109378)
FT                   /locus_tag="SPO0105"
FT   CDS_pept        complement(108119..109378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0105"
FT                   /product="monooxygenase family protein"
FT                   /note="identified by match to protein family HMM PF01360"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93436"
FT                   /db_xref="GOA:Q5LWR0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR0"
FT                   /protein_id="AAV93436.1"
FT                   /translation="MTVLIAGAGIAGLSLGLTLHQIGVPFRIYEATAVLRPMGVGINLQ
FT                   PNAVRELLDLGLEAELDRIGVRTRQLGFYSKLGKTIWEEPRGIWAGYAWPQYSVHRGAL
FT                   QMMLYEALIARAGADCVVTGARAAGFETGPESATLILSDGRRVEGRLLIAADGIHSALR
FT                   AQMYPNEGEPIWNGRVLWRATTRAPAYFGGGAMAMIGHDDLRLVSYPISEPDGDGMVEM
FT                   NWIAEKRFPLDAAWKKEDWNRAADIGDFLPDFADWRFDWIDVPALIQGAEVVYEYPMVD
FT                   RDPLPRWTGGSVTLMGDAAHPTYPVGSNGASQAILDARIIGARLLEHGITPRALAAYEA
FT                   EVRPVTTAVGQANRAGGGPDGVLQRVEDLCGGDFDDIDTVIPHAELAAHAARYKSIAGF
FT                   SIEELNARPRTIAEGARIPA"
FT   gene            complement(109440..110210)
FT                   /locus_tag="SPO0106"
FT   CDS_pept        complement(109440..110210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q9A321; match to
FT                   protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93437"
FT                   /db_xref="GOA:Q5LWQ9"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWQ9"
FT                   /protein_id="AAV93437.1"
FT                   /translation="MLVVISPAKRLDWAERDVATTEPAFQDDAVRLAKTARNLTLGDLK
FT                   KLMGLSDDLARLNRDRFREFADAPGADVTRPAALAFAGDTYQGLEAASLDSEEMDWAQQ
FT                   HLRILSGLYGVLRPLDAIQAYRLEMGSRLKTRRGTSLYDYWGDQLSRTLNAQADEIGTD
FT                   VLVNCASQEYFGAVDPKALKLRVITPVFMEDKGGAPKIVSFFAKKARGAMARYIVQRRL
FT                   TDPQALSEFDSGGYQYNADLSAPDKPVFLRPYQG"
FT   gene            complement(110244..112283)
FT                   /gene="recQ"
FT                   /locus_tag="SPO0107"
FT   CDS_pept        complement(110244..112283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SPO0107"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93438"
FT                   /db_xref="GOA:Q5LWQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ8"
FT                   /protein_id="AAV93438.1"
FT                   /translation="MFDAAPLLRDVFGFDAFRPGQEEIAQAVAEGENVLAIMPTGGGKS
FT                   LCFQLPALMREGVTVVISPLIALMRDQVRSLQEAGVEAGALTSGNTPEETEAVWQALEA
FT                   GRLKLLYMAPERLASGAAMGMLRRIGVSLIAVDEAHCVSQWGHDFRPDYLRIGELRRAL
FT                   GVPLAAFTATADAETQAEIVAKLFDGEEPRSFLRGFDRPNIHLAFAAKDSPRRQILDFA
FT                   GARRGQSGIVYCGTRAKTETLAQALREDGHSACHYHGGMEAEDRRIVETRFAREDGLIV
FT                   VATVAFGMGIDKPDIRWVAHADLPKSIEAYYQEIGRAGRDGGPAETLTLFGPDDIRLRR
FT                   SQIDEGLAPPERRAADHARLNALLGLAEAMTCRRQTLLGYFGETEITCGKCDLCDSPAE
FT                   RFDGTTAVRMALSAMLRTEEWFGATHLIDILLGNQTDKIRDRRHDQLPTYGVGTEWNRA
FT                   QWQAIFRQMMGRDLVRPDPERHGALRMTEAALPILRGEAGIELRKDTVSKAARRPAVKA
FT                   MVNDEDAPLLSALKAKRRALAEAARVPAYVIFPDRTLIEMAEKRPASLDQMARIGGIGA
FT                   KKLERYGAMFLEVVSGAAEMLHPARRKLAGRQTGNIYDRLLAVQADLARGPDGIDKPLS
FT                   CSASQLAKVAQMRPDDRSGLEALLGDRRWERFGEAFLDVLGQTT"
FT   gene            complement(112680..112952)
FT                   /locus_tag="SPO0108"
FT   CDS_pept        complement(112680..112952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0108"
FT                   /product="transposase, truncation"
FT                   /note="identified by similarity to GB:AAR33383.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97110"
FT                   /db_xref="GOA:Q5LWQ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ7"
FT                   /protein_id="AAV97110.1"
FT                   /translation="MQISKRPRWRWQRCGATRPCRRHLDNIVIERLWRSLKQEAIYLEE
FT                   ITDSFQVRRISKGWMAFYNTRPHSALDRQTPDDAYRPGLNERNAA"
FT   gene            complement(113139..114266)
FT                   /locus_tag="SPO0109"
FT   CDS_pept        complement(113139..114266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0109"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93439"
FT                   /db_xref="GOA:Q5LWQ6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ6"
FT                   /protein_id="AAV93439.1"
FT                   /translation="MWQWLTNVFRLGLKELNSLRADPVLILLIVYVFSFAVYSVATGAK
FT                   LEVSNASVAYVDQDRSALTGRILGAILPPEFNPPQEISAGEIESVMNSGKFVFVLSFPP
FT                   SFEADVLSGHKPQIQLNVDATAMAQAGNGSVFLQQIILAEVAKFVSGDDITTTRLIDLV
FT                   VRTKFNPNLNSIWFSSVMQIINNITILSVLLTGAALIREREHGTIEHLLVMPVTPSEIM
FT                   VAKIWANGLVIVVAAILSLWIVVQTVLAVPIAGSIPLFVCGAVLYLASVTGLGILLATF
FT                   TTSMPQFGLLSLPVLVIMNLLSGSTTPMESMPVWLQNVMQLSPSTHFVSFSQAILYRDA
FT                   GLDIVWPDMVVMVALSAVFFFIALKRFRVTMATVR"
FT   gene            complement(114268..116994)
FT                   /locus_tag="SPO0110"
FT   CDS_pept        complement(114268..116994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0110"
FT                   /product="ABC transporter, ATP binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93440"
FT                   /db_xref="GOA:Q5LWQ5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ5"
FT                   /protein_id="AAV93440.1"
FT                   /translation="MTPAPVASLSAVTHRYGSTLALSDVTLDIPAGCMAGLIGPDGVGK
FT                   STLLALIAGVRKLQAGGAIVLGGDITDRHHLRACNHRIAYMPQGLGRNLYPTLSVYENL
FT                   DFFGRLFGQSEAERRARINNLLTATGLDPFPDRPAGKLSGGMKQKLSLCSALIHDPDLV
FT                   ILDEPTTGVDPLSRQQFWDLIDHIREERPAMSVIVATAYMEEAERFDWLAAMNAGQVIS
FT                   TGSPIEIRNAAGQPTLEKAFIAMLPEADRQGHRIDEVPPRRPVIGPPAIEAKGLTCRFG
FT                   DFIAVDHVEFQIEPGEIFGFLGSNGCGKTTTMKMLTGLQKASEGKALLFGEALNPDDMA
FT                   TRRQVGYMSQSFSLYGELTVRQNLELHARLYQLPIETRAERVAQMLHDFDLAEEADKRP
FT                   DGLPLGIRQRLQLAVAVIHSPEVLILDEPTSGVDPVARDGFWRHLIKLSRDDGVTIFVS
FT                   THFMNEAARCDRISLMHAGKVLAVGTPEDLARSKDTDDLEEAFVGYLREAAGNTDGRAS
FT                   ETPAAKLPDRLEKPDRLFDLARLWAFARRESIEILRDPMRLAFAFLGPVILMLTFGYGI
FT                   SFDVQELPYAVLDRDKSAESRNLMQSFSGSRYFVERPAAGSVTELDIRMRSSELVIAVE
FT                   VPPGFGKSLLRGDQPEVRVAVDGAMPFRAETTRGYLQGLAASYMSDQTERLYGHAFDPS
FT                   AASVETRFRYNQAFKSVFALIPSVIMLMLVLIPAMMAAMGVVREKETGSIANFRSTPVT
FT                   RTEFILGKQLPYVAIAMLSFASLIIVSYGVFGVLIKGSVLALLVGTLLYVLATTGFGVL
FT                   VSTFTRTQVAATFAAAVISIIPAVNFSGLLVPVSSLSGGGRLIGLSFPSSWYQQISMGT
FT                   FTKGLGFPELWLNHVALAGFAALFIAVSVLALNKQET"
FT   gene            complement(116991..118055)
FT                   /locus_tag="SPO0111"
FT   CDS_pept        complement(116991..118055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:H82993"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93441"
FT                   /db_xref="GOA:Q5LWQ4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ4"
FT                   /protein_id="AAV93441.1"
FT                   /translation="MCLRGTAAKLSSGSLGDLAGTEMRRRPMQWKRYGTVAVILSVLLG
FT                   GAYVFWLDSQTAELPAGIVRSNGRIEAERIDVATKLPGRIAEVRVSEGQWVEAGSLVAH
FT                   MDTAEIDAQLRQAKAAVAQAEQQKLQTEALLNQRLSEQEFAQAEFARAEQLAARGHAPQ
FT                   ELVDQRKSALTTADAGVAAARAGIDLATATIASADATVERLQSIRADADLVAPHDGRVQ
FT                   YILAKAGEVVGAGGRVVTLTDLTDIYMTIFLPARDAGLLAIGSEARIVLDPIPEYVIPA
FT                   TVTFVASTAQFTPKSVETADERDQLMFRVKLTIPEDLLKAYQEQAKAGVAGVGYVRTDD
FT                   TAPWPDVLSVKLPQ"
FT   gene            118243..120084
FT                   /locus_tag="SPO0112"
FT   CDS_pept        118243..120084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0112"
FT                   /product="poly(3-hydroxyalkanoate) polymerase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF07167"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93442"
FT                   /db_xref="GOA:Q5LWS0"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS0"
FT                   /protein_id="AAV93442.1"
FT                   /translation="MGQARLKAVNTPRELGAKTGSGGKPLTPPISLDSPKQKTGSKPYP
FT                   DTGLPEFLDRALKARMARVTKGLSPAALAGAYLDWIVHLATSPGKQIELSENAYRKWLR
FT                   LSRHAATCSVNSNDTAPCIEPLPQDRRFRSDAWQKWPYNLIYQSFLLNQQWWYNATTGV
FT                   RGVTRQHENVMEFATRQILDMFSPSNYLLTNPEVQERTLKEGGLNLLRGFQNWLDDLDR
FT                   LQSGKPPAGAKAFRPGQEVAVTPGKVVYRNHLIELIQYTPTTDTVRPEPILIVPAWIMK
FT                   YYILDLSPENSMVKFLVDQGYTVFMISWRNPSAEDRDLGLDDYRKMGVVDAIGAVQGIV
FT                   PDQKIHGVGYCLGGTLLSISAATMGRDGGDPFASLSYLASQIDFTEPGELQLFINESQL
FT                   TFLEDMMWDHGYLDTTQMSGAFQMIGSADLVWSRSLHSYLMGDEPAMFDLLAWNADGTR
FT                   MPYRMHSEYLRSLYLNNELTEGAFVVEGRPISVTDIRVPVFSVGTVKDHVAPWPSVYKM
FT                   HLYLDTDLTFVLTSGGHNAGIVSEPGHRNRSYQIATARHGDRYVDPETWAAQTPKKDGS
FT                   WWLEWMSWLGERSGKPVPPPAMGNALTDAPGTYVHQK"
FT   gene            120115..120879
FT                   /gene="fabI-1"
FT                   /locus_tag="SPO0113"
FT   CDS_pept        120115..120879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI-1"
FT                   /locus_tag="SPO0113"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by similarity to SP:P29132; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93443"
FT                   /db_xref="GOA:Q5LWR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR9"
FT                   /protein_id="AAV93443.1"
FT                   /translation="MGLLDGKRGLVVGIANERSIASGCAQAFHREGAELAVTYLNEKAR
FT                   PFVQPVAEALDAEIFMPLDVTADAEMDALFEAIASSWGRLDFILHSVAYCPKEDLHGNV
FT                   LDCSREGFSAAMDISVHSFMRLARRARPLMQNGGCLLTVSYYGAEKVVDHYNVMGPVKA
FT                   ALESTVKYMAAELGPEGIRVNALSPGPLMTRAASGIAHFDALIDEARARAPQQRLVTIE
FT                   DVGNMAAGLVSDAARNVTGNISYVDAGYHVMS"
FT   gene            120897..121097
FT                   /locus_tag="SPO0114"
FT   CDS_pept        120897..121097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93444"
FT                   /db_xref="GOA:Q5LWR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR8"
FT                   /protein_id="AAV93444.1"
FT                   /translation="MIKMSFNCTPDATFPTGKGATEQRFTATVGGDELEIDTHPWGEAD
FT                   LKINDKLVAHVDGDRSGVSSG"
FT   gene            121130..122524
FT                   /locus_tag="SPO0115"
FT   CDS_pept        121130..122524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0115"
FT                   /product="maoC family protein/phosphate acetyl/butaryl
FT                   transferase"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93445"
FT                   /db_xref="GOA:Q5LWR7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR7"
FT                   /protein_id="AAV93445.1"
FT                   /translation="MQYIENKTFDEIRIGDSAELTRKLKADDIELFAVMSGDVNPAHVD
FT                   EEYARSDMFHEVVAHGMWGGALISAVLGTELPGPGTIYLNQNLSFRRPVGLGDTVTVRV
FT                   TVASKDAGTKRLKLDCLCVNQDGETVIKGQAEVIAPSEKVRRPRVVLPDVHLHERGARY
FT                   RDLIAATHAMAPVRTAIVHPCDALSLTGALEAASQGLIVPILVAPRVKLEAVAEEAGLV
FT                   LDGVEIVDVPHSHAAAERAVALVRCGKAEALMKGKLHTDELMDPVVDRDTGLRSERRMS
FT                   HIFALDVPHYPKPLFVTDAAINIFPDLDTKRDIVQNAIDLAQALGIDRPKVAILSAVET
FT                   VYPKIPSTIEAAALCKMWDRGQITGGVLDGPLAFDNAVSKSAAKAKGIVSEVAGDADIL
FT                   VVPDLEAGNMIAKQLIHLAGAEAAGIVLGARVPIILTSRADGVMSRLASSAMAQLYIHH
FT                   AKKVVS"
FT   gene            122521..123705
FT                   /gene="ackA"
FT                   /locus_tag="SPO0116"
FT   CDS_pept        122521..123705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SPO0116"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93446"
FT                   /db_xref="GOA:Q5LWR6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR6"
FT                   /protein_id="AAV93446.1"
FT                   /translation="MTDVVLVLNAGSSSIKFAVYPSGTNTVPLIRGKVAGVGRDPVFSA
FT                   VRADGTAIDMVMPKNIDAAADHEALISLLLDWLAEHRADRRLVAVGHRVVHGGRDFLKP
FT                   VIVDDSVLSQLEQLIPLAPLHQPHNLAAIRAISRLQPTVPQVACFDTSFHQTQDRLAQL
FT                   FALPRDLSDEGIIRYGFHGLSYEYIAGILPDHLGERAEGRVIVAHLGNGASMCAMKNRQ
FT                   SVATSMGFTALDGLMMGRRCGALDAGVVLYLMQSKGLNATEIETLLYRRCGLLGVSGIS
FT                   NNMRELERSDDPKAREAIELFCFRAASVLGGLVTALGGLDAIVFTAGIGENSALVRKLI
FT                   CDRLACFGVDLDPNSNEGNSPRIGSVQSSIDVLVLPTDEEIVISNATNETVALG"
FT   gene            124395..125957
FT                   /pseudo
FT                   /locus_tag="SPO0117"
FT                   /note="'transposase, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P37248'"
FT   gene            126237..127478
FT                   /locus_tag="SPO0118"
FT   CDS_pept        126237..127478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93447"
FT                   /db_xref="GOA:Q5LWR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR5"
FT                   /protein_id="AAV93447.1"
FT                   /translation="MSQKYQLQTLARFSSLVLVSSYFRGRRLAMKTLLTTLFSLSALAA
FT                   ALSIVALFTAEAQISDYGVAAFFFAMTIALYLLARWYLIRFGRIGLLKPKLFRREPRGN
FT                   ALKAQTTISSAGWITDSLSAVMRKRNGVDLDIHTLVRLEIAKIKEVGLHGKARTFEEIL
FT                   TETLLLRFVETDNRDRSKPPISILRQVRDTKDFWRLREMVDEHYAKSAAKGAAYRAWED
FT                   AVGDVDQSHLLKDGWIPFLKSLPGPDINLWHGVATDFHEISEDRLDAAFWIVEQDACDR
FT                   TTASEFIMGFLQARMDIGIYDPDGTRGRLPPDPRLERFVGVINLYNDGFYKFHSLNAGV
FT                   FSAVNLEDQVANDLLTNNEKYTGLSGLPRPRKIVKEGEKPVHSGPRGYDSPYAYWDEAG
FT                   LHLKYPGDDWQKTG"
FT   gene            complement(127691..128194)
FT                   /locus_tag="SPO0119"
FT   CDS_pept        complement(127691..128194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0119"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93448"
FT                   /db_xref="GOA:Q5LWR4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR4"
FT                   /protein_id="AAV93448.1"
FT                   /translation="MYVAQSNSRKKEKEPSNLRSKESVLDSIDAAILRELCADARIPRA
FT                   ELSRRVGLSAPSVGDRVRRLEDIGIITGYGARIDPARLGYGLTILIRARPLPGEMANMI
FT                   EAIQDTPQIVACDRVSGEDCFVARAHVRDVAEMEAVIDRIVPFGATNSSIVQSSPVEER
FT                   LVEL"
FT   gene            128242..129201
FT                   /locus_tag="SPO0120"
FT   CDS_pept        128242..129201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0120"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93449"
FT                   /db_xref="GOA:Q5LWR3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR3"
FT                   /protein_id="AAV93449.1"
FT                   /translation="MSNQARTNSASAPGTMSRMSEAVPPHAWFGVSAVFHYLGPAFAVL
FT                   LFPVVGVLGVAWFRIASAALIFAPITKPWRTFKTSTPRERLLLLALGGCLAVMNSSFYL
FT                   ALDRLPISLVAAIEFMGTIGIALWGLRTGRNYLAFALAIIGVALLIDVASLRAMDGPDP
FT                   TSDLLGLFWALLNGSLFVLYIILGHKISEGGASGGVERLGAAMTAAFIFVMPLGFLQAL
FT                   EAFGAPLLVLAGIGVGICSSVIPYVCDQLAMARLPRASFAFLLALLPATATIIGAVVLR
FT                   QIPSAMDVLGVALVMIGVAVHKPAPMASRAAAEMGSAS"
FT   gene            complement(129255..130018)
FT                   /pseudo
FT                   /locus_tag="SPO0121"
FT                   /note="'transposase, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAN56270.1'"
FT   gene            complement(130161..130448)
FT                   /locus_tag="SPO0122"
FT   CDS_pept        complement(130161..130448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0122"
FT                   /product="YGGT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93450"
FT                   /db_xref="GOA:Q5LWS8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS8"
FT                   /protein_id="AAV93450.1"
FT                   /translation="MQSLFQILMLILDVIWFFILAHVIMSWLINFQVLNMRQQLVAQIW
FT                   YGLNRVLEPIYGPIRRILPPMGGLDLTPLVVLLAIMALRIVLINNAALFY"
FT   gene            130602..131966
FT                   /locus_tag="SPO0123"
FT   CDS_pept        130602..131966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0123"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93451"
FT                   /db_xref="GOA:Q5LWS7"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS7"
FT                   /protein_id="AAV93451.1"
FT                   /translation="MADISARKRIWGWYFFDWASQPYHTLLVTFVFSPFFAAVAADYFL
FT                   GQGMADEAAKAQAQVVWSQCLTITGLIIGFGAPFLGAMADISGRRMTWITLFCGMYVVG
FT                   AWGLWYMDPTGGNLWWMMASFGIGFIGAEYALIFINAQLPSLGTKEEVGQISGSGFAFG
FT                   YLGGVVALFIMLLLFVEQGNGKTLVGLDPVLGLDPDTREGTRAVGPFTALWFVIFMIPY
FT                   FLWVREPAGSGRRGSFAEAVAMVVQSVKNLRHRGSLASYLASSMFYRDALNGLYGFGGV
FT                   YARLVLGWEITMIGVFGIIAAISAAAFSWLGGLADRRVGPKPVIVGSILVLILVCATIV
FT                   GMDRTQIFGIPLAEGSGLPDFVFFFCGVLIGGFGGIVQAASRSLMVRHTDPEMPTESFG
FT                   LYGLSGRATAFLAPALIGAATAATGSARLGVSPVVGLFILGLILLIWVKPQGDQK"
FT   gene            131966..132847
FT                   /gene="mepA"
FT                   /locus_tag="SPO0124"
FT   CDS_pept        131966..132847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="SPO0124"
FT                   /product="murein endopeptidase"
FT                   /note="identified by similarity to SP:P14007"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93452"
FT                   /db_xref="GOA:Q5LWS6"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS6"
FT                   /protein_id="AAV93452.1"
FT                   /translation="MFFQVIAVFLLALIPVLGAVPAQAEPLAKELFGAQKSASRQKPAA
FT                   YGSYAKGCAAGLEQLPETGPTWQAMRLSRNRNWGHPETIDFIRDLSGFAARQKGWSGLY
FT                   IGDISQPRGGPMLTGHRSHQLGLDIDIWMLQANNLRLSGQHRENISSISLRRAKGAYVN
FT                   DNWTRQHHAIMREAARDKRVARIFVFPGAKVWMCNNEKGDRSYLRKIRPWWGHHYHFHV
FT                   RLSCPRGSRGCVDQTPPPQGDGCAEAQEWVNNILNPPPPKPRDPNAPPPKKRREYVLAD
FT                   LPKQCASVLRSQ"
FT   gene            132820..133704
FT                   /locus_tag="SPO0125"
FT   CDS_pept        132820..133704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:F98281"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93453"
FT                   /db_xref="GOA:Q5LWS5"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS5"
FT                   /protein_id="AAV93453.1"
FT                   /translation="MRLRLALAIAAALVLSGPGLAVDRGEAQHLGSFTWRGSQPWFGGF
FT                   SAIEMTPDGMGMTVLSDRATILTARLRRDGDQIIGVEIDAVHKVRSSKNKVLKGRVGDS
FT                   EGLAIGPDGVIYISFEGVARVARYARPDAPAVVLPRPDAFRHMARNGAFEGLAMDARGR
FT                   LYTLPESSRAADGSIPVYRWDGRAWSTAFHLEQLGGFLPVAADFGPDGRFYVLERDTGA
FT                   IGFRSRLRRWNVTAKGITGEEILFQSRLAAHDNLEGMSVWRDGQGRLRATMVSDDNFLM
FT                   LQRTELVEYLLPD"
FT   gene            133714..134445
FT                   /locus_tag="SPO0126"
FT   CDS_pept        133714..134445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0126"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93454"
FT                   /db_xref="GOA:Q5LWS4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS4"
FT                   /protein_id="AAV93454.1"
FT                   /translation="MLRAKRPACPRSRRTKSPHPCQNGPRNMTRAFLPGILAMAAIVVA
FT                   SNILVQFLILDGLLTWGAFTYPLAFLVTDVMNRVYGAEAARRVVFAGFVTGVICSLIGS
FT                   QIVLQGDGYTYAAVPLRIAVASGSAFLIAQLTDVAVFNRFRGGRWWRAPLVSTLIGSAL
FT                   DTALFFTIAFSASITLFGPDADTAVNWAWEAVPFMNKGAPMPLWVTLAFADWLVKLSLA
FT                   LIALVPFRVIVQRLAPARATA"
FT   gene            134704..135123
FT                   /locus_tag="SPO0127"
FT   CDS_pept        134704..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0127"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by similarity to GB:AAM35138.1; match to
FT                   protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93455"
FT                   /db_xref="GOA:Q5LWS3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS3"
FT                   /protein_id="AAV93455.1"
FT                   /translation="MLYVTDDIAIQDWELSESFMRASGPGGQNVNKVSSAVELRFEAAR
FT                   SPSLPAPVKARLKRLAGRRWTGEGAIVLQCDETRSQARNREIVRARLVELIARALVAPK
FT                   RRIATKPTRGSVRRRLDSKKARGEVKALRGKIGDE"
FT   gene            135168..135923
FT                   /locus_tag="SPO0128"
FT   CDS_pept        135168..135923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0128"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93456"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS2"
FT                   /protein_id="AAV93456.1"
FT                   /translation="MNHMRLDGKTAIVTGGAQGFGAGIVAKFVSEGARVMVADINLDTA
FT                   RETAAQMDGDAFAHQVDVSDGNSVDAMAAAALRRFGHVDILVNNAGVTHLPTAMEDVSE
FT                   ADFDRVYRVNMKSVYLTARALVPHMKDRGKGAILNVASTAGVSPRPRLNWYNASKGWMI
FT                   TATRTMAVELAPNGIRVNALNPVAGETPLLKSFMGEDTPEMRAKFLSTIPLGRFSTPQD
FT                   MGNAACFLCSDEASMITGVAMEVDGGRCI"
FT   gene            135951..136958
FT                   /locus_tag="SPO0129"
FT   CDS_pept        135951..136958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0129"
FT                   /product="peptidase, T4 family"
FT                   /note="identified by match to protein family HMM PF03576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93457"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS1"
FT                   /protein_id="AAV93457.1"
FT                   /translation="MVPGPRNLITDVPGLLVGNAQDDALKSGATVLSAEAPFMASVHVM
FT                   GGAPGTRETDLLAPDKSVARIDALVLSGGSAYGLDACSGVSDALRAAGRGYRIADAVIP
FT                   IVPGAIIFDLLNGGDKDWADNPYRALGRAAFDAAGRDFALGTTGAGTGALTAMLKGGLG
FT                   SASLVLPDGTTVGALVAANPMGSVTTPGDRHFWAAPFEIDGEFGGLGPDPSGGLGRQLE
FT                   SRKIRMMSAQAQDRANTTIAIVATDADLTKAQCQRMAVAAHDGIARATVPAHSPGDGDL
FT                   VFSVSTGARPMAAPERDLTLLGHAAALCLARAIARAIYLARPAPGDLLPCWHQA"
FT   gene            137081..137494
FT                   /locus_tag="SPO0130"
FT   CDS_pept        137081..137494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0130"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93458"
FT                   /db_xref="GOA:Q5LWT7"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT7"
FT                   /protein_id="AAV93458.1"
FT                   /translation="MNRFVAAAFACVLAVPALAEGDAAKGEKGFNKCKSCHMIESPAGE
FT                   TIVKGGKTGPNLYGVVGRAAGTYEGYKYGDSLVAAGEKGLVWDEESFVAFTQDPKSFLN
FT                   TYLGETAAKSKMTFKLKSGGEDVFAYLQSVAAE"
FT   gene            137668..138210
FT                   /locus_tag="SPO0131"
FT   CDS_pept        137668..138210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0131"
FT                   /product="isopentyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by similarity to SP:P26173; match to
FT                   protein family HMM PF00293; match to protein family HMM
FT                   TIGR02150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93459"
FT                   /db_xref="GOA:Q5LWT6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT6"
FT                   /protein_id="AAV93459.1"
FT                   /translation="MGILIPAWVDDRLVPVDKLEAHEKGLKHKAVSVFAVRDMDILIQR
FT                   RALGKYHTPGLWANTCCTHPDWDESASTCAVRRLREELGITGLYPEYRHRLEYHADVGN
FT                   GMVENEVVDVFLAHVRGPLQVVPNPDEVMEIRWIGYHDLLAEVQRYPERFTPWLKIYLH
FT                   HHADTIFGPDLIISAKA"
FT   gene            complement(138223..140442)
FT                   /locus_tag="SPO0132"
FT   CDS_pept        complement(138223..140442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0132"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93460"
FT                   /db_xref="GOA:Q5LWT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT5"
FT                   /protein_id="AAV93460.1"
FT                   /translation="MSLVNKLAEERRARLAAERLLELKQAELSAANRKLGRHALALTKQ
FT                   IGEKQAEVATVRDENEKVKSDLTVANAKIEVAERRLWHSIQTIQDGFAFFDSDSKLIGA
FT                   NTAYLNVFDGLDEVAPGISYMRILQLMTEEGIIDTGELAAEEWRQMMHERWISPTPEPV
FT                   VIRMWNDQYVKMIDQRGHGGDVVSLALNITSTVRYEAELRAAREKAEAANRAKSAFLAN
FT                   MSHEIRTPMNGVVGMAELLCDTALDEEQQLYASTIKNSGEALLVIINDVLDYSKIEAEK
FT                   MMLHPEPFDLERCIHEVAMLMQPIVRDKGLTLLVDYDLFLPTLFVGDPGRVRQVLTNLL
FT                   GNAVKFTTKGHILIRVTGVPDPATGRCAIHVAIEDTGIGIPREKLAHIFGEFNQVENER
FT                   NRQFDGTGLGLAISQRLIQMMGGTVWVESEEGRGSCFGFRVTLPMSEEAQPVLPNLPGR
FT                   LQHVLIVDDLAVNRAILEKQLAQLGVRVTCCASGAQALEKMSDCVDLVLSDHNMPEMDG
FT                   LELAEALRGAGWSDLPIFLLSSNPGMAHADPAKRHVQGILQKPIPRAELFARLSDMRTE
FT                   ITSVQDPAAVSAPVTKPAQDAPGEPTERRQMRVLAAEDNRTNQLVFRKMVKTLDIDLRF
FT                   ANNGLEAVEIWQDFQPDLIFMDISMPKMDGKQATGEIRRLEAGTGRHVPIVALTAHAMA
FT                   GDAEGILAAGLDQYLTKPLRKALIHQHIAEACPAGALPVEPESGE"
FT   gene            140575..146001
FT                   /locus_tag="SPO0133"
FT   CDS_pept        140575..146001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0133"
FT                   /product="PAN domain protein"
FT                   /note="identified by match to protein family HMM PF00024;
FT                   match to protein family HMM PF01835; match to protein
FT                   family HMM PF07703"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93461"
FT                   /db_xref="GOA:Q5LWT4"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT4"
FT                   /protein_id="AAV93461.1"
FT                   /translation="MRRFGFLAILSLQLAFFGVSGLSAQEAAPGFRYLATRDMDFYGED
FT                   LDALFDTDLQSCIRACSANNACNAFTFNARSNACFPKRGVSEQTPYQGALSAVKLPSPA
FT                   AVRDRARQQAARLAFLPDRDLTRAVAQARDLGLRYAAGGMELDQVIAAMRNAGEGAQAA
FT                   GWAGLAVSLSDRADLWAEYARLLLSVRSDDSSIKRDHARRAVSAAINAYLRADRPGAEV
FT                   SALALLAQALERDGRGRDMVPVLRLASDIQPREDVLAALDRAIGKYGFRVVETTVESDS
FT                   AQPRICAQFSDPLARSGVDYEPFVHSPEGDLVVQADGNQLCLDGVEHGKRYRITLRAGL
FT                   PAGSGEALWKDVTLTHYVRDRSPAVRFPGRSYVLPKSADAAIPVETVNATTLDLILRRV
FT                   SDRNLLRAVQEGYFARPLSYWEDEHFASDIAQEVWTGSAEVASTLNRDMTTRLPLAEAI
FT                   SGQAAGIYTLTARVPGADPYDNPGATQWFVLSDLGLSSISGNDGLHVSVRGLSDAAPRA
FT                   AVDLTLISRANAVLGRVQTDAQGLARFEPGLTRGTGAAAPALILATAGDTDLGFLSLID
FT                   PAFDLSDRGVEGRKPAGPVDVFLTTDRGAYRAGETIHATALSRDGTARAIDGLPLTAIL
FT                   TRPDGVEYGRKVSDGGVAGGHVFALTTGASAPRGTWRLDIKADPDGPALASQTLLVEDF
FT                   LPERIDFDLALPDAPILPGDSPPLSIEARYLFGAPGADLSIEGQVQLRAADQIAGWPGY
FT                   RFGRHDAGLQTRTSHFGDARTDAAGNARLAVEIPQIDAEGKPLEAVVTARLADGAARPV
FT                   ERRISVPVSPATPVIGIKPLFEDVVSEGTEAGFQVIGLTPDLTPQPMRIKWTLNRVETR
FT                   YQWYQLYGNWNWEPVTRRTRIATGEADLGSDPLSLSQPVEWGEYELLVERLDGAYVASS
FT                   ADFYAGWYQAADAAATPDRLELSLDKDSYRPGDTARLRIVPRMAGTALVTVLSDRVIAR
FT                   QAVEVAAGESVIPLTVTEDWGTGAYVTATVIRPMDVAAGQNPARALGLAHATIEPVGKA
FT                   LTVAIDAPEVAKPRATQPVRLTVAGAQAGDEVWLTLAAVDLGILNLTGFQSPDPQGHYF
FT                   GQRRLGVEMRDVYGRLIDGMNGAMGIVRSGGDADNGLRMQSPPPTQDLMAVFSGPVQVG
FT                   ADGGVSVDVPLPAFNGTVRLMAVAWSDQAVGQAERDMIVRDPVVVTATVPRFLAPGDSS
FT                   RLRLEVVHADGPPGEMALKLASAPGLQLGAAPDRFTLTEGGKAVFEVPVTATALGDPVL
FT                   TVELETPGGQELRQVLRLPVRANDPVVAQTRRFALGAGDSFLFSRDVFTGLRPGSARAI
FT                   LSAGPLARFDAPGLLGVLDRYPYGCTEQVTSQAMPLLYLGAVAQAAGLGTGPQVAERID
FT                   AAIRRILTRQSANGAFGLWRAESGDFWLDAYASDFLSRARAEGYALPDRAFAMAMDNLR
FT                   NRLNYAPDFDEGGEDIAYALMVLAREGAAAMGDLRYYADVKADAFTTPLGAAQLGSALA
FT                   MYGDQTRADAMFARAARMVAGQRPEAPVWRADYGTSLRDAAGLLTLAAEAGSAVIDRDS
FT                   LISRISQPAGEMSTQEAAWSLLAAQALVKQPEQSGLRVNGAAVDGPFVQVLAGTSDEVL
FT                   NITAVDGGATDITLTMLGVPEVPLPAGGTGYTITRARYTMDGAPIQRDAFAIGERFVTV
FT                   LTVTPFEASGGRLMVNDPLPAGFEIDNPSLLRSGDVRALDWLSLDEASHTEFRSDRFLA
FT                   AVDLYGTRPVTLAYVTRAVSPGAFHHPAASVEDMYRPRYRARTDTGRIRVGQ"
FT   gene            145998..146564
FT                   /locus_tag="SPO0134"
FT   CDS_pept        145998..146564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50328.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93462"
FT                   /db_xref="GOA:Q5LWT3"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT3"
FT                   /protein_id="AAV93462.1"
FT                   /translation="MSGREAVATAHWRRLDGEGSDRCTLSRVAQGWIMVGHAHWRDEGC
FT                   DTTLSYDIRCAPDWRSLSADVAGERGGRPLSMRIEATPMGWRMDDVLQPGTEDCSDLDL
FT                   SFTPATNLMPIRRLGAFAGDELRVAAAWLMPDLDCVARLDQIYTRLPDGRVHYASAGFA
FT                   ADLDLHGSGFTTLYPGLWQGWVDDA"
FT   gene            146554..148593
FT                   /gene="pbpC"
FT                   /locus_tag="SPO0135"
FT   CDS_pept        146554..148593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="SPO0135"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="identified by similarity to SP:P76577; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02073"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93463"
FT                   /db_xref="GOA:Q5LWT2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT2"
FT                   /protein_id="AAV93463.1"
FT                   /translation="MMPRPARWLMVLALVLWAGAALRDGANRWIDATQLPPVLTETGVE
FT                   IRDRNGALLRAYQVGDGIWRLAPGAVDSGFTRMLIRYEDKRFADHAGVDPLAMLRAAGQ
FT                   ALWYRRPVSGGSTLTMQVARLIEDGPTGRWAGKLRQIRVALALERRLDKQRILALYLTH
FT                   APYGGNLEGVRAAALAWFGKEPHRLTPAQSALLVALPQAPEARRPDRHPRAARAARDRV
FT                   LHRMLAQGVLSGEAMQAALGEAIPQAQRPFPLLAPHLADRLRAADPAARRHDVTLDAGL
FT                   QSRFEDLLAKAALEAGGRLSAALMVVDHRSGEIFASVGSAGYSAERQGFVDMTRALRSP
FT                   GSTLKPFVYGLAFDQGLAHPDTLILDSPVMFGRYAPRNFDGEFRGELRVREALQLSLNI
FT                   PVVRLTDDLGPVRLMAALRRGGATPRLPGGTPGLAIALGGVGLTLQDLVQLYAGLAQGG
FT                   QGPLLRHALGEAAQPAGRLFSPSAAWQVGDILAGLAPPPGARRGVLAYKTGTSYGHRDA
FT                   WAVGFDGAHVIGVWLGRADGTPVPGAFGGDLAAPVLFEAFGRLKPAFDPLPPPPPDTLI
FT                   LPTAELPLPLQRYRPRGAVFEVEPDAPQLLFPPDGAVLTTDGGPVTVKLRGGQAPFTLL
FT                   ANGRPLATGIFVREFDVPSPGSGFATLIVLDARGRASRAELRLE"
FT   gene            complement(148600..150645)
FT                   /locus_tag="SPO0136"
FT   CDS_pept        complement(148600..150645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC47727.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93464"
FT                   /db_xref="GOA:Q5LWT1"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT1"
FT                   /protein_id="AAV93464.1"
FT                   /translation="MTGDLLLDPLVPLPLLIALAALSLAGIALALWRGLSGWALRGLAA
FT                   LVLLAALAGPVWQVEDRAPLSDIVLMVEDQSASQGLSDRPDQTTSAADQLAASIESRPN
FT                   TELRRIIVGDGEGDTGTQLMAALNEALNEEPRARIAGILALSDGQVHDLDRAPALPAPM
FT                   HLLLSGRATDWDRRLIVRNAPAFAIIGEPVTLSLRIEDSGAVPAGQGALAELQISVDGG
FT                   PPERLTLPVGQDLELPVTLPHGGRNVVQFSVPVAEGELTDRNNTALIQMNGVRDRLRVL
FT                   LVSGQPHPGGRTWRNLLKSDSSVDLVHFTILRPPEKQDGVPVDELSLIAFPTRELFLEK
FT                   IDDFDLIIFDRYKRRGILPAIYLDNVANYVNRGGAVLVAAGPDFATADSIYRTPLSPVL
FT                   PARPTARVIEEAYRAQVTEEGARHPVTAQLDSAGEWGRWLRQIEVTQDSGHVLMSGVEG
FT                   RPLLVLDRVGEGRVALLATDHAWLWGRGYEGGGPQLELLRRLAHWMMKEPELEEDALWA
FT                   EAQGQTMRIIRRTLDTSVGSVTITRPDGGEDVLPMEEVSPGRFEALYQGPEIGLYRLRE
FT                   GDQSAVIGLGPAAPREFEATIATAALMEPLITPLKSGIFRLEDGLPTIRNVREGRPAAG
FT                   RGWLGLTPRGAYETRDVRQTPLAPAWLVLLLASGFVIAGWLREGRR"
FT   gene            complement(150642..153404)
FT                   /locus_tag="SPO0137"
FT   CDS_pept        complement(150642..153404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D97630; match to
FT                   protein family HMM TIGR02226"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93465"
FT                   /db_xref="GOA:Q5LWT0"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT0"
FT                   /protein_id="AAV93465.1"
FT                   /translation="MTVLGGIGFTAPWLLLALVALPILWLILRAVPPAPIRRLFPAVSL
FT                   LLGLRDDESVSDRTPWWLLLLRVLAVAAVILGLAGPVLNPRQQAEGDQPLLMVMEASWA
FT                   GAARWTQQIDLLEARLTEAGRASRPVAVLRLGAPEDLVFQSAAAWRSRLPGLSPMPWQP
FT                   GAAELAAATQAIAAQTGGFDTLWLSDGLDYAGRAELLDTLGARGAVTVYQSPNPVLGLR
FT                   PASFADGAVQLTLLRAEAGEERIQPVLALGPDPAGTVRVLNRSEARFASGETEAQLALA
FT                   LPSELRARITRFELEGQRAAGAVALTDDSLARHEVALYAGRQDREGLELLSPLHYLTQV
FT                   LAPNSDFIDGALLDVLPANPDIVVLADVVTLATLERSALTEWVEQGGILVRFAGPRMAA
FT                   SDIGRDNADPLLPVRLRSGGRTVGGAMSWGEAKTLAPFGDTSPFYGLTIPDDVTVSTQV
FT                   MAQPDPDLADRVIAALSDGTPLVTRKALGLGQVVLFHVTADAEWSSLPLSGLYVEMLDR
FT                   LAVSSAAKSADAINMEGTVWSPLRVMDGFGQLDDAGNLPGIDGTALATAPIGPEMRPGV
FT                   YANDSRRLARNVLGADSVLTPATWPASVPVLGLSIAAEQPLGGWLLSLALVLLALDVAA
FT                   SLALSGRLGPLGRAAALLALLLHAPVAEAQLTEADMFARDATREMVLAHVLTGNRAVDD
FT                   LALAGLRGLSDTLFFRTSVEPAAPFSVDLERDELAFFPLLYWPVTPDQPQPSDAAYARL
FT                   NTYLRLGGMILFDTRDADIARFGASSPNGRKLQQLAAPLDIPPLEPVPGDHVLTRTFYL
FT                   LQDFPGRHASADIWVEAAPLDAEQIEGMPFRNLNDGVTPVVIGGNDWAAAWAVDDNGRA
FT                   MLPVGRGYGGERQRELAYRFGVNLVMHVLTGNYKSDQVHVPALLDRLGQ"
FT   gene            complement(153401..154276)
FT                   /locus_tag="SPO0138"
FT   CDS_pept        complement(153401..154276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN30463.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93466"
FT                   /db_xref="GOA:Q5LWS9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS9"
FT                   /protein_id="AAV93466.1"
FT                   /translation="MSAAPALRHRAETAAAPLPPLLARAEYLAGTVLLGDHGRRRAGLG
FT                   DDFWQYRPAQPGDSRRMIDHRRSARGDLQYVREREWQIAQSVMLWVDQGASMRFSSDKR
FT                   LEAKADRARLLALAVAILLVRGGERVGLTGTTLPPRRGNAQVHRLAEAWSRDAEADYAP
FT                   PEHRAMIPHARALFVSDFLGDLKEVELALSKAADRGVRGVLMQVLDPAEESFPYRGRTL
FT                   FESVGGTLRHETLKAGELRERYLVRLAERRDALMALTRATGWQLGLHHTGDSAQSALLW
FT                   LWRALDGRVR"
FT   gene            complement(154273..155280)
FT                   /locus_tag="SPO0139"
FT   CDS_pept        complement(154273..155280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0139"
FT                   /product="ATPase, MoxR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93467"
FT                   /db_xref="GOA:Q5LWU6"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU6"
FT                   /protein_id="AAV93467.1"
FT                   /translation="MSEPADLIGEIDALGIKLQEARASITRRFIGQERVVDLTLTALLC
FT                   GGHALLIGLPGLGKTRLVETLSTVMGLHGNRIQFTPDLMPADILGSEVLDTAEDGSRRF
FT                   RFIPGPIFCQLLMADEINRASPRTQSALLQAMQEKTVTVAGENRPLGTPFHVLATQNPI
FT                   EQEGTYPLPEAQLDRFLVQIDVDYPDRATEREILLATTGVEEAEAHQVMSQADLLGAQV
FT                   LLRRMPVGESVVEMILDLVRAFRPDEPGVSDRVRDTVAWGPGPRAAQALMLTVRARALL
FT                   QGRLAPSPEDVLDMARPVLSHRMALNFAARARGDTLAGLIDETAASLTRTEAAA"
FT   gene            155346..155927
FT                   /locus_tag="SPO0140"
FT   CDS_pept        155346..155927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E83277; match to
FT                   protein family HMM PF06938"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93468"
FT                   /db_xref="GOA:Q5LWU5"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="PDB:2RE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU5"
FT                   /protein_id="AAV93468.1"
FT                   /translation="MSGQKPVKPSADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIA
FT                   RDGTWFYQGTPINRPAMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAG
FT                   QGRKQVLTFTTHVGDSAVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLM
FT                   DLGEIEDGWFGLWSSGSFFPLMTVEELERG"
FT   gene            complement(155946..156515)
FT                   /locus_tag="SPO0141"
FT   CDS_pept        complement(155946..156515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0141"
FT                   /product="DNA binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93469"
FT                   /db_xref="GOA:Q5LWU4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU4"
FT                   /protein_id="AAV93469.1"
FT                   /translation="MTENSDDILNRLPARLKEARRAQGLSLEAVANLSGVSRSMVSQIE
FT                   RGESSPTIATLWNLTRALQVDFAGLLEAAEAADRIDTLRASEVPSIDNMGQGCRIRILS
FT                   PPEDAGGHEVYDISFKPGGTLNSQPHARGTREQLTVLDGAVRVTSGAAAQDLGPGDTAR
FT                   YAADIPHKISASGDGPARVFLIVKTA"
FT   gene            156963..158138
FT                   /gene="bktB"
FT                   /locus_tag="SPO0142"
FT   CDS_pept        156963..158138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bktB"
FT                   /locus_tag="SPO0142"
FT                   /product="beta-ketothiolase"
FT                   /note="identified by similarity to GB:AAC38322.1; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93470"
FT                   /db_xref="GOA:Q5LWU3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU3"
FT                   /protein_id="AAV93470.1"
FT                   /translation="MTDIVILDGARTAIGTFGGALASTAPIDLATVVTEAALERSGVEG
FT                   GQIGHVVFGHVINTEPRDMYLSRVAAMQAGIPNGTPAMNVNRLCGSGAQAIVSAVQSLM
FT                   LGDAEFAVAGGAESMSRSPFIMTQARWGAKMGDVKSLDMMLGALNCPFGTGHMGVTAEN
FT                   VADEHQISREQMDQFAMTSQERAAAAIAAGHFDGQITPVQVKVKRDMVDFKVDEHPKAT
FT                   SVEVLAGLKPVFKKDGRVTAGNASGINDGAAAMVLATADAAEKAGLKPKARILGYAHAG
FT                   VRPEVMGIGPVPAVQNLLARTGLSIGDFDVIESNEAFAAQALAVNKELGLDAAKVNPNG
FT                   GAIALGHPVGATGAIITLKTLYELERTGGSKGLITMCIGGGQGIAIAIELL"
FT   gene            complement(158208..159194)
FT                   /locus_tag="SPO0143"
FT   CDS_pept        complement(158208..159194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0143"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93471"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU2"
FT                   /protein_id="AAV93471.1"
FT                   /translation="MARTNPHRPFVPDPEQAALAPGVSGNDINGLGETAFRRPRMVYWA
FT                   PDPDDIPHGSLQRYFYRQSAKEPDFASRRAARQAVLDAPLPLLADTVVIRDPADWTAAL
FT                   TQFVDSGLCDLTGVAEMNPDWVFEGHEIPQSRVIMIGVAHDYNVIATAPKPSAGLEVMT
FT                   QYTRAAQAAKTIAGWLRQQGWQAEPLTGPMTGALAMIPPALACGFGELGKHGSIINPDL
FT                   GASFRLSAVLSDAPFAPTPAQDHGIDGFCQNCHICQDACPPEALFAQKQTVRGARKWYV
FT                   DFDKCLPFFNQTHGCAICIAECPWSRPGIGPNLAAKLARKRNRDATG"
FT   gene            complement(159233..160762)
FT                   /gene="ubiB"
FT                   /locus_tag="SPO0144"
FT   CDS_pept        complement(159233..160762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="SPO0144"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by similarity to SP:P27854; match to
FT                   protein family HMM PF03109; match to protein family HMM
FT                   TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93472"
FT                   /db_xref="GOA:Q5LWU1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU1"
FT                   /protein_id="AAV93472.1"
FT                   /translation="MRGPHNIIRLIRTGATLERNGAMAAVLDAFDAPRPLRILARALGK
FT                   PFQWLGFKGDPSLPPATRALMAMGPAYIKFGQVLSTRPDVVGQDLADQLRVLQDQLPPF
FT                   PRAVAMREVEKELGRPLPEMFSEFSEPIAAASIAQVHRARLADSGEDVAVKVLRPGIER
FT                   AFRKDVDAFYFAARIVDLFAPGARRLRPMEVIEHFDGVVRGELDLRLESAAASEFADNT
FT                   KEDAGFRLPPVRWSLSARRVMTLGWADGVPLGDNAALDAAGHNRRDLGERVLRLFLLHA
FT                   LRDGFFHADMHQGNLKVAADGDIIAYDFGIMGHIDEYTRRVYAEILFGFIRRDYKRVAE
FT                   VHFEAGYVPATQDVDEFARALRAVGEPIFGMDATHISMGRLLSYLFEVTERFGMETRTE
FT                   LILLQRTMVVVEGVARSLDPHINIWQVARPVVEDYIKQSIGPRAVLADLGKTALVVARF
FT                   GPRLPDLVERALVAQSQPGLVEKPGRSAAFWPALGGALIGGGVVLLASLFI"
FT   gene            complement(160766..161539)
FT                   /gene="ubiE"
FT                   /locus_tag="SPO0145"
FT   CDS_pept        complement(160766..161539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="SPO0145"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /note="identified by similarity to SP:P27851; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93473"
FT                   /db_xref="GOA:Q5LWU0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU0"
FT                   /protein_id="AAV93473.1"
FT                   /translation="MRGTARPMSDRSDKTTHFGFETVPEHEKAGRVQGVFGSVASKYDV
FT                   MNDVMSMGIHRVWKDAMMDWLAPRPGQRLLDVAGGTGDISFRFLKRAGHGHATVLDLTE
FT                   PMLVEGRKRAEAERMADSLDWVVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAY
FT                   RVLRPGGRLMVLEFSQLPNDGLQKLYDLYSFNVIPRMGQLIANDSASYQYLVESIRNFP
FT                   NQETFLGMVQAAGFGNAKYRNLSMGIAALHSGWKI"
FT   gene            161604..162455
FT                   /gene="mutM"
FT                   /locus_tag="SPO0146"
FT   CDS_pept        161604..162455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="SPO0146"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93474"
FT                   /db_xref="GOA:Q5LWT9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT9"
FT                   /protein_id="AAV93474.1"
FT                   /translation="MPELPEVETVRRGLAPAMEGAVIARAEVNRPDLRWPFPDRMAERL
FT                   TGQRVERLRRRSKYILADLSGGETLLIHLGMSGRMTVSGDPLGQFVHDHPAAQKHDHVV
FT                   FHMDNGARITFNDPRRFGAMDLMATATADEHKLLMVLGPEPLGNDFHEDYLVAALKGRN
FT                   TPVKSALLDQGIVAGLGNIYVCEALFRAGVSPRRKAGQIAAARVSALVPIIRQVLSEAI
FT                   EAGGSSLKDFRQADGELGYFQHSFDVYGREGEPCRRAGCDGTVQRITQSGRSSFYCAQC
FT                   QR"
FT   gene            162522..163298
FT                   /locus_tag="SPO0147"
FT   CDS_pept        162522..163298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0147"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="identified by similarity to SP:P14604; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93475"
FT                   /db_xref="GOA:Q5LWT8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT8"
FT                   /protein_id="AAV93475.1"
FT                   /translation="MAFETIIVEVEDHVALIRLNRPDALNALNTQLLGELCTALEEADG
FT                   NDKVRCIVITGSDKAFAAGADIREMSQKTYVEVYSENLFAAANDRVSAIRKPIIAAVAG
FT                   YALGGGCELAMLCDFIIAADTAKFGQPEINLGVIAGIGGTQRLTRLVGKSKSMDLNLTG
FT                   RFMDAEEAERAGLVSRVVPAKKLVEEALSAAQKIAEKSMISAYAVKEAVNRSYETTLSE
FT                   GLLFERRVFHSMFATEDQKEGMAAFLEKRAAQFRDK"
FT   gene            163518..163781
FT                   /gene="rpsT"
FT                   /locus_tag="SPO0148"
FT   CDS_pept        163518..163781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SPO0148"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93476"
FT                   /db_xref="GOA:Q5LWV5"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWV5"
FT                   /protein_id="AAV93476.1"
FT                   /translation="MANSPQAAKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKD
FT                   AATAALRAAQPELMRGVSKGVFHKNTASRKMSRLSSRVKALG"
FT   gene            164331..165737
FT                   /gene="dnaA"
FT                   /locus_tag="SPO0149"
FT   CDS_pept        164331..165737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SPO0149"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93477"
FT                   /db_xref="GOA:Q5LWV4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWV4"
FT                   /protein_id="AAV93477.1"
FT                   /translation="MTQEKWGLLCQKLLKTVGQNNFTTWIEPLEFQALENGVAVFTVPT
FT                   NFMGNYVSQNFSDLILYELNNAGEAVQRLAFRVAANSPMRPARAARPAAAAAAAAAAVE
FT                   APQVSAPRATDTSDVLDGLQAAPLDPRFTFDSFVVGKPNELAHAAARRVSEGGPVTFNP
FT                   LVLYGGVGLGKTHLMHAIAWELKVKRPELNVLYLSAEQFMYRFVQALRERRMMDFKHLF
FT                   RSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVKSR
FT                   LQCGLVVDLHPTDYELRLGILQTKVQMYRTTYPDLVIADGVLEFLAHRISTNVRVLEGA
FT                   LTRLFAFASLVGREIDMELTQDCLADVLRASERKITVEEIQRKVSDYYNIRLSDIIGPK
FT                   RLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVKRIEELKLTDGQIAED
FT                   VEMLRRALEA"
FT   gene            165999..167117
FT                   /gene="dnaN"
FT                   /locus_tag="SPO0150"
FT   CDS_pept        165999..167117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPO0150"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93478"
FT                   /db_xref="GOA:Q5LWV3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV3"
FT                   /protein_id="AAV93478.1"
FT                   /translation="MKISIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGEGAQFR
FT                   ATDLDIEVVDKAPAMIERAGATTVSATTLHEIVRKLPDGALVTLTADAAAGRLTVEAGR
FT                   SNFSLATLPREDFPVMASSEYQSNFTANAAVLRRLFDKSKFAISTEETRYYLNGVYMHV
FT                   ADGDGGKVLRCVATDGHRLARIDADLPAGATDMPGVIVPRKTVGELRKLLDDDEMDIAV
FT                   SVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQANTRRLEVDASEFAKAVDRVATVSS
FT                   ERSRAVKLQLDEDKLVLSVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEIASQVDRE
FT                   NAVFLFNSSGDPTLMREGNDQSAVYVVMPMRV"
FT   gene            167177..168277
FT                   /gene="recF"
FT                   /locus_tag="SPO0151"
FT   CDS_pept        167177..168277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SPO0151"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P13456; match to
FT                   protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93479"
FT                   /db_xref="GOA:Q5LWV2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV2"
FT                   /protein_id="AAV93479.1"
FT                   /translation="MALALTAITISHFRSHRLLRLSLDERPVAIHGPNGAGKTNILEAV
FT                   SMFSPGRGMRRASAAEMTRRPEVLGWKLSAELVAGHQRHEIETWSEGGAARQVRIDDKA
FT                   ASQVALGRLVRMVWLVPSMDRLWIEGPEGRRRFLDRMTMSFEPDHAEAVLVYEKAMRER
FT                   NRLLREQVRDAHWYLALETQMAAAGHRIHAARQSTLTALAAAQTQAETSFPTAELELIQ
FT                   TEGALPESEGDLREALAESRFRDLAAGRTLVGPHRSDLYGVYAAKGVPASDCSTGEQKA
FT                   LLVSLILANARALARQVGAPPVLLLDEIAAHLDAGRRAALYDEICALGAQAWMTGTGPE
FT                   LFSELGARAQTIALCERDGQSEVVET"
FT   gene            168274..168894
FT                   /locus_tag="SPO0152"
FT   CDS_pept        168274..168894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0152"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93480"
FT                   /db_xref="GOA:Q5LWV1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV1"
FT                   /protein_id="AAV93480.1"
FT                   /translation="MTLSAVDLALYAGAVFVLFLTPGPVWLALTARTLSGGFQAAWPLT
FT                   LGVVVGDSLWPVLAVLGIGWITAASTQIALALKVVAVLVFVTLGIVTIRNADRTIASDS
FT                   RLTRPGIWAGFLAGLVVILGNPKAVLFYMGILPGFFDLSDITTIDLVAIVAVSQVVPLV
FT                   GNLMLAAFVDRVRRVLSSPRALRRMNLTAGGMLIVVGLILPFT"
FT   gene            complement(168887..169474)
FT                   /locus_tag="SPO0153"
FT   CDS_pept        complement(168887..169474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0153"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93481"
FT                   /db_xref="GOA:Q5LWV0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV0"
FT                   /protein_id="AAV93481.1"
FT                   /translation="MTRPPQKRRLETRARLLAEAARLVEAQGYAGLRVEDVVEAAGVAK
FT                   GTLFSHFTDKDGLLAVLIGAEVMRLIDGMETAGPPDDLPQLMHRLAPLLDFIASDRVIF
FT                   DLLLRYSGSTGAERNEVVADGFYRQIDLWAGWIAGMQAAGTVRGDHPPALLAEGIQAFL
FT                   NQIIAIRFCQGGQATGTPAGALYPFLAAWLIT"
FT   gene            169581..170174
FT                   /locus_tag="SPO0154"
FT   CDS_pept        169581..170174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0154"
FT                   /product="NAD(P)H dehydrogenase, quinone family"
FT                   /note="identified by similarity to SP:P45245; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93482"
FT                   /db_xref="GOA:Q5LWU9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU9"
FT                   /protein_id="AAV93482.1"
FT                   /translation="MSTRKIIVLNGHPGQMSLSKSLSEAYAGAARESGHQVRYHDLSQM
FT                   RFDMDYGEGGYKNTKPLEPELEAFLADLEWAEHVVLATPLWWGAIPAKLKGLFDRALLP
FT                   GRAFDSRNTNFLGLPAPLLKGRTARVLMTSDTPAMLLGLFYSNAIKKVLARQILGFVGI
FT                   KPARFSTFAPATGAEGDRVRKWLRKAAQMGAKAA"
FT   gene            170259..172676
FT                   /gene="gyrB"
FT                   /locus_tag="SPO0155"
FT   CDS_pept        170259..172676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SPO0155"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93483"
FT                   /db_xref="GOA:Q5LWU8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU8"
FT                   /protein_id="AAV93483.1"
FT                   /translation="MSEIEQPGNEYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHADHVTVKIHADSSVSVADNGRGIPVDIHAEEGVSAAEVIMTQL
FT                   HAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIWRHGKEHVARFERGDTVEHLRVV
FT                   GECGDRTGTEVRFLASTTTFSNLDYVFETLEKRLRELAFLNSGVRIILIDERPAERIET
FT                   ELFYEGGVREFVKYLDRSKSPVMPAPIYFKGERDDIGVEIAMWWNDSYHETVLPFTNNI
FT                   PQRDGGTHVAGFRGALTRTINNYAQSSGIAKREKINFTGDDAREGLTCVLSVKVPDPKF
FT                   SSQTKDKLVSSEVRPAVENLVNEKLAEWFEENPNVAKQIVGKIIEAALAREAARKAREL
FT                   TRRKTAMDVNYLAGKLKDCSEKDPSKTEVFLVEGDSAGGSAQTGRDRRTQAVLPLRGKI
FT                   LNVERARFDRMLGSQEIGNLVMALGTGIGRDEFNISKLRYHKIVIMTDADVDGAHIRTL
FT                   LLTFFYRQMPELIEGGYLYIAQPPLYKVARGKSEVYLKDQAALDDYLIHQGVEGAVLKL
FT                   GNGEEIVGQDLTRVVEEARQLKRVLDAFPTHYPRHIMEQAAVAGAFVAGAVDADLQGVA
FT                   DKVAARLDLIALEYERGWLGRITQDHGIRLARILRGVEEVRTLDGPMLRSGEARKTGSF
FT                   TRSLQEIYTQPAMLVRRDRTQAIHGPLTLLKAILDEGEKGLTLQRYKGLGEMNPEQLWE
FT                   TTLDPDARTLLQVRVNDMVEADDIFTKLMGDSVEPRREFIQQNALSVENLDF"
FT   gene            complement(172724..174295)
FT                   /gene="rtcR"
FT                   /locus_tag="SPO0156"
FT   CDS_pept        complement(172724..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcR"
FT                   /locus_tag="SPO0156"
FT                   /product="transcriptional regulator RtcR"
FT                   /note="identified by similarity to SP:P38035; match to
FT                   protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93484"
FT                   /db_xref="GOA:Q5LWU7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU7"
FT                   /protein_id="AAV93484.1"
FT                   /translation="MRNVVIGFLGTQLDSGKRKRWKPSVSLCNQPDFPVDRLELLYDQK
FT                   FLRLAENVRREIEVTSPKTEVLLRQLNLSDPWDFQEVYGKLFDLARDYGFDEDRERYFV
FT                   HLTTGTHVAQICWFLLTESRHVPAKLAQTGPPRDEKDGPGKLDIIDLDLSRYNALQQRF
FT                   DLLAREYSDLLKGGIETKSAAYNAVIDRIELVASSSDAPILLLGDSGTGKTELAQRIYE
FT                   LKLQRRRVKGRLVQINCATLRGSSALATLFGQRRSHTGQAGSERSGLLHEASGGVLFLD
FT                   EVDELGLDEQAALLHAIETGRYYPLGSDHEVTSRFQVIAGTSRDPVHLTAEGRFRPDLL
FT                   ARLNMWSFRLPALRDRREDIEANLIFELARAERELGTQVGFNTDARDLFLRFARDPATL
FT                   WPGNFRDFGSAIRRLCTLAPRGRITRAMVEEEIKGLRTGWQRAAGDGDHRLLIGILGNQ
FT                   AAEIDPFDRVQLAEVIRVCRTSASLSEAGRRLFAVSRTQRRTTNDADRLRKYLQRFGLE
FT                   WAMIAE"
FT   gene            174344..176026
FT                   /locus_tag="SPO0157"
FT   CDS_pept        174344..176026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0157"
FT                   /product="TROVE domain protein"
FT                   /note="identified by match to protein family HMM PF05731"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93485"
FT                   /db_xref="GOA:Q5LWW2"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW2"
FT                   /protein_id="AAV93485.1"
FT                   /translation="MPNSAISVIYAQKQHTRLISCFSRRFPNPMSQSPRTKEDEREMAN
FT                   KSVFASIKGRLLPKATTRNAEGAPAYAYSDAHALAQVAVTGTFGGMFYTDPRDELEYVV
FT                   DLAEAVEPCFLAQAAIYARQSGYMKDMPAVLLAVLARRDPALFRRVFGRVVDNGKMLRT
FT                   FVQVMRSGQTGRKSLGSAPKAMVQNWLNTASDRALLAANIGNDPSLADVIRMVHPKPET
FT                   KEREALFAWIVGRPCNLALLPQALQDWLAFKAGAKGPVPDVPFQMLTQLDLTPQHWARI
FT                   ARKGSWQMVRQNLNTFQRHGVFNVAKNVAHVAALLRDPEAIGKARAFPYQLMVAAQNLS
FT                   ADMPREIVEALHDAMEIAVRNVPKIDGQVVVCPDVSGSMTCAVTGYRPGATSVVRHVDV
FT                   AALVAAAFSRVNRGCQVLPFDFEVRDVRLEPRDTILTNAERLAALGGGGTTCSAPLKWL
FT                   NDRGRSPDLVVFVSDNQSWVDARAGGQGTAMLAEWEKVKRRNPKARLVCIDIAPYGTSQ
FT                   VQTREDVLNIGGFSDAVFDQIAGFAAGRTGPDHWVGEIEKIEL"
FT   gene            176231..176306
FT                   /locus_tag="SPO_tRNA-Gln-1"
FT   tRNA            176231..176306
FT                   /locus_tag="SPO_tRNA-Gln-1"
FT                   /product="tRNA-Gln"
FT   gene            176312..176389
FT                   /locus_tag="SPO_tRNA-Pro-2"
FT   tRNA            176312..176389
FT                   /locus_tag="SPO_tRNA-Pro-2"
FT                   /product="tRNA-Pro"
FT   gene            177007..178419
FT                   /locus_tag="SPO0160"
FT   CDS_pept        177007..178419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D75521"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93486"
FT                   /db_xref="GOA:Q5LWW1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW1"
FT                   /protein_id="AAV93486.1"
FT                   /translation="MTEESKTYDPVTGEHLKDWGHRPGKQFPALLARANEMRAAGLGLV
FT                   RIRMELEVEIPPAPVTHDLRAPGEVPFHENIDIAGPDEEDNVQKVRETMTALMRTPTIE
FT                   AGAIMPDACPAGPVGTIPVGGVAAARNAIHPGMHSADICCSVMITDLGHADPKTVLDAA
FT                   QSVTHFGPGGRPQGNRFTVSLDLLDAFRANAFLSNPKALRMAQEHLGTQGDGNHFLFVG
FT                   RSRKTGRTAIVTHHGSRGPGAVLYKLGMEVAERFRRELSPGTAKQNAWIPADTDEGRDY
FT                   WAALQLIRKWTKANHNAIHQATVEAARAEAGDRFWNEHNFVFRRGDIYLHGKGATPAWG
FT                   DYAADATGLTLIPLNMSEPVLVVRGKDAARGLGFSPHGAGRNFSRSEHKRRMGKMTPEA
FT                   MLKAETEGLDIRFHAGGVDASELPSSYKKAGSVVDQIRSYDLAEIEDYIDPYGCIMAGE
FT                   VPPFWAKKKTRR"
FT   gene            complement(178533..179147)
FT                   /locus_tag="SPO0161"
FT   CDS_pept        complement(178533..179147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0161"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93487"
FT                   /db_xref="GOA:Q5LWW0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW0"
FT                   /protein_id="AAV93487.1"
FT                   /translation="MRILLADDHALVRDTISVYLQSEGDAEVVAVPDLGAAMRAADTEG
FT                   PFDLILLDFNMPGMNGLDGLRAAIRHAPDTPVALLSGSAPNRVAQEAVDAGAAGFVPKT
FT                   LAAKSLLHAVRFMIAGEVFVPSTVLQAPEAPSDGGLTATLSRREKQVLGGLCRGLPNKE
FT                   IARELDLQEVTIKLHVRTLCKKLNAKNRTQAAMIARDAGFE"
FT   gene            179479..179967
FT                   /locus_tag="SPO0162"
FT   CDS_pept        179479..179967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ59886.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93488"
FT                   /db_xref="GOA:Q5LWV9"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV9"
FT                   /protein_id="AAV93488.1"
FT                   /translation="MRMRAIGRVPILVAGLLLASVGQVAKAGEEVLAVTGSDGSAISFD
FT                   LDALRALPVSEIRTSTIWTDGIQVFQGVSLRDLLDHVDAVEGTITAVALNDYLIDIPTS
FT                   DATRPGPVVAYLRNGEQMSVRDKGPLWIIYPYDDNPDYNTEEYYARSIWQLIRLEVPK"
FT   gene            180023..182494
FT                   /locus_tag="SPO0163"
FT   CDS_pept        180023..182494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0163"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93489"
FT                   /db_xref="GOA:Q5LWV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV8"
FT                   /protein_id="AAV93489.1"
FT                   /translation="MKTGFWIALVLVLIGYSALLGREAMVRLDTLSTAASDDIRWNMSQ
FT                   LEVELLRLQSAALKARDGGQGDIQQLRTRFDIFYSRTQIVLRGALYDQAREIPEVQERL
FT                   QSLRAFLAESVPIIDAPEPILADRLPELAHLVEQVSPEVRDLALTIVNTSARAADTQRL
FT                   KVSETLRRLALSVLGLLVALTIVALLLLRLYRSSQVVSAEKEAVKSRFEAAVKSALDAV
FT                   LVVDTEGHIIEFNGGAEAMFGYSRSEALGQPMSDLIIPPHYRARHEEGMRRFREHGTSR
FT                   VVGRGHLRLEGMRKSGEVFPIELSISLAETSDQLVFISFLRDITNRLKTEDDLREARDT
FT                   AQAGAQAKAQLLTVMSHEMRTPLNGILGSLDLMERDELSPKQVRLVRAIRVSGELLLTQ
FT                   VNRVLDLSRLESGMIEFPKEPFALLPMVRRLTESLTAAAEERGNRLQTTLVGDDPGVVL
FT                   GNRIALQQALVNLLGNAIKFTRNGEISLEVERLNDDRMIEFRISDTGLGIPAKDIERIF
FT                   DEFVTIDTAYARENPGTGLGLSITRRLVWAMGGEIEVESIEHEGSLFLIRLPLEPGEAV
FT                   ELASEKERGQPEPGPLKGKRVLVIEDNDINRMLLLDMLEEFGCQVVLARDGFEGVAAAK
FT                   SARYDLLLVDISMPGKDGLETLREIRAQEGPNGPVRAIAITANVRDEDKERFAAAGFDG
FT                   FLAKPISMLQLQEMLSGLLLRPEAEAERSTAREFIRRFGMAEYQRHLLGMVDALHAVCD
FT                   DLANTELSETLKARVHEQAGSAAILGRADLHSLLQEIEATDAADWPARRGGMLDRLKTE
FT                   LARTRAVSLGG"
FT   gene            complement(182491..184470)
FT                   /locus_tag="SPO0164"
FT   CDS_pept        complement(182491..184470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0164"
FT                   /product="oxidoreductase, FMN-binding/pyridine
FT                   nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93490"
FT                   /db_xref="GOA:Q5LWV7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV7"
FT                   /protein_id="AAV93490.1"
FT                   /translation="MSFKHVFAPVQLRHKQLKNRIVFGAHTTNMAHDGLPGDQHLAYYL
FT                   ERALGGAAMIVVEPMPVHAAAVLTRGNFRHSSDDVIPHFARITQACKAHGTVMIQQLYH
FT                   VGAHGDWDNSWHANWSPSGGPSYHDNDGSHAMTEDEIEETIQGFVDAAVRCQKSGFDGV
FT                   EVWAAYHCLLDQFWTPFSNQRSDQWGGSLENRTRLSREIMARIRAACGPDFIIGLSVND
FT                   DSDKPVCLSHDEMVEIVALHDAQGLMDYVTVGAGSYFNFYKLLPSFQYAENLGADLAER
FT                   LKQANLTALVTAEANIRTPDNANTVLGAGRADLVSIVRAQIADPHLVAKAERGAPEDIR
FT                   GCLSCNQQCWGRRGRDYYISCLVNPSAGHEYLWGGDRFTPAQTPKTVLVVGGGPAGLEC
FT                   ARVAAERGHRVILAEAGPELGGQFRLAGLQPRRAQITDLIGWYERQLRQLQVEIRHNTY
FT                   LDAQDVATIGADAVILATGSAPPETGFQKALPQVTRLPGIERGQVWSIHDVMTRAARLG
FT                   DHVVLLDEAGNWRGIGTAWHLAEKGHKVTIVTPDPMIGRELARSATDFPARATLAGLGV
FT                   RFVTESALTGWSDAGAEVVSLLTGETEVLTADSLVLATANTPETGLAQELRAMGIEATS
FT                   IGDAAAPRLAAAAIHEGRKTGLAL"
FT   gene            complement(184467..185198)
FT                   /locus_tag="SPO0165"
FT   CDS_pept        complement(184467..185198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0165"
FT                   /product="pyrroline-5-carboxylate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93491"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV6"
FT                   /protein_id="AAV93491.1"
FT                   /translation="MRIGVIGTGTIATAVVHGIAGDGHAITVSERSAANAQALAAAYPN
FT                   VRVASNQVVVEECDILTLGLMAEQAPEILGPLPFRADQQVITLMAGATLEQVAQMVAPA
FT                   RAAAIMMPFPSIAQGGSPIMMQGDADLVAALFGARNRIFAVRDAAEMAAYLCAQAVLSP
FT                   VARMVDDAAGWLATRVSDPVQGEAFLRALVASSLADTDSASLIEALNTPGGYNQRLRLH
FT                   MEGAGMGDSLRAGLDALETGA"
FT   gene            complement(185200..187245)
FT                   /locus_tag="SPO0166"
FT   CDS_pept        complement(185200..187245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0166"
FT                   /product="N-methylproline demethylase, putative"
FT                   /note="identified by similarity to SP:O87278; match to
FT                   protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93492"
FT                   /db_xref="GOA:Q5LWW9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW9"
FT                   /protein_id="AAV93492.1"
FT                   /translation="MSRDPLLQPFQLKHLTLKNRIMTTAHEPAYPEDGMPKQRYAAYHA
FT                   ERARAGVALAMTAGSAAVSRDSPPVFNNILAYKDEVVPWIRQLTDACHDHGCAVMIQLT
FT                   HLGRRTGWNKGEWLPSVSSSRHREPAHRAFPKLAEDWDIARIISDFADAAERMKEGGMD
FT                   GIELQVYGHLLDQFWSPLTNDLDGPYGGQTLESRMKMPLDVLRAVRARVGDDFIVGLRY
FT                   TADEAAEGGIGPEEGIEISKRLADTGMVDFLNVIRGRIHTDPAMTDVIPVQGMKSAPHL
FT                   DFAGEVKKATGMPTFHAARIPDVATARHAVASGLLDMVGMTRAHMADPHIVQKIVEGRE
FT                   DDIRPCVGATYCLDRIYQAGEALCIHNPATGRELTMPHTIPSAQTRKRVVVVGAGPAGL
FT                   EAARVAAERGHHVTVFEAQPDPGGQVRLTAQNPRRREMIGIIDWRMAQCAARDVEFRFN
FT                   TWAEAADVTALNPDVVIVATGGLPNTELFETGRENNLVVSAWDLISGDVKPAQNVLIYD
FT                   ESGDHPALMAAEVAANAGAKVEVMTPDRMFAPDIMGMNLVPYMRALQDKDTTFTVTRRL
FT                   LDVTRDGNQLRARIGTDYSSFTKDQTYDQVVVNYGTMPMADLYFELRPLSRNGGEVDYD
FT                   ALIAGNPQTVETNLDGAFQLFRIGDAVSARNTHAAIYDALRLMKDI"
FT   gene            complement(187255..188823)
FT                   /locus_tag="SPO0167"
FT   CDS_pept        complement(187255..188823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0167"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF06253"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93493"
FT                   /db_xref="GOA:Q5LWW8"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW8"
FT                   /protein_id="AAV93493.1"
FT                   /translation="MSEQTPLRSRRSRRASGKAGRSAEPGQNLHLRVPYITRKIPTYDL
FT                   LGEESLDKIEATADRILAEIGIELRDDEESMRLYKRAGAQVTELRADAWNIRFEPGMLR
FT                   EILKTAPARFTQHARNPANNVDIGGDAMVFAPAYGSPFVMDMDNGRRYGTIQDFQNLIK
FT                   LGQSSPWLHHSGGTICEPTDIPVNKRHLDMVYSHMRYSDRAFLGSITAPERAADSVEMC
FT                   RILFGADFVDQNCVIMGNFNTTSPLVIDGVTAAGIRTYAAAGQGSIHLPFLLGGAVSPL
FT                   TMAGAVAQCLAESMASSALTQLVRPGAPAILAGFLSSMSLRSGSPTFGTPEPALGSLVM
FT                   GQLARRLNMPLRCAGNFSTSKAPDGQAMQQAMMSMMSAVQGGANYILHSAGFVDGLLSM
FT                   SYEKFVMDTDMCGALHSYLAGIEVNEDTLGFDALAQNGPGEHLFGTDHTLRHYETAYWD
FT                   SGLNDDQTHETWSEQGSADYAIRANKRWKDILNTYEAPVMDDATDEALREFIDRKKASM
FT                   PDAWY"
FT   gene            188930..189568
FT                   /locus_tag="SPO0168"
FT   CDS_pept        188930..189568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0168"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93494"
FT                   /db_xref="GOA:Q5LWW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW7"
FT                   /protein_id="AAV93494.1"
FT                   /translation="MSLAPKPTGSESAWLDAAYELLTESGVEAVKIMPLAQKLGVSRTG
FT                   FYWYFKDRETLLEAMIQRWEEKNTGNLVARAEAYAESIVEAMFNLFDCWLDDGLFDARL
FT                   DLAIRNWARNDPGLHQRLDQADQARQDAVAGMFLRFGYPENQARVRSLTVMYTQVGYIS
FT                   MQIEEHPDIRIANMPDYVEVFTGVTPDQADVDRFLSRHAAKWRAAANQM"
FT   gene            189622..190320
FT                   /locus_tag="SPO0169"
FT   CDS_pept        189622..190320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0169"
FT                   /product="transglycosylase, Slt family"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93495"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW6"
FT                   /protein_id="AAV93495.1"
FT                   /translation="MPLNLITRFAAFVWLSVLFAAAPALAKLDPGVSSLCDQAARSAAN
FT                   RHGVPLDVLRAITRVETGRRSDGQLAPWPWTVNMEGTGHWFPTEFAARKFVFERFKSGA
FT                   RSFDVGCFQINYRWHSQGFSSIEEMFDPERNADYAARFLNDLFGELGSWSAAAGAYHSR
FT                   TQSLADAYASRFDRTRAALGEGPMPNPHRTPDTGGAQPLFARQEAPPGPARLGSLFATG
FT                   SGARPFISFN"
FT   gene            190330..192417
FT                   /gene="flhA"
FT                   /locus_tag="SPO0170"
FT   CDS_pept        190330..192417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="SPO0170"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by similarity to SP:P76298; match to
FT                   protein family HMM PF00771"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93496"
FT                   /db_xref="GOA:Q5LWW5"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW5"
FT                   /protein_id="AAV93496.1"
FT                   /translation="MPKLTTETLFSPTVLLAIALMAIIVMMILPMPAWVLDIGLAASFA
FT                   LAILIFTLTLFIERPLDFSAFPTILLASLMLRLSLNVSSTKLIIGQGHTGPNAAGDVIE
FT                   GFAQFVMGGSVFLGLVVFGVLLIVNFMVITKGAARMAEVGARFALDGMPGKQLAIDSDM
FT                   SAGAIDHQEAKARRELEQQETTFFGSLDGASKFVKGDAIAGLLITLLNLVMGLIMGVVV
FT                   HGMPMSAAFETYAILTVGDGLVSQIPAVIISIASALLLARGGTQGATDNALFAQLGKHP
FT                   AALATVALLMVLFALVPGLPFLPFISGGAVLGYAAWRMRLKQKQEAESAARITEEQTPV
FT                   ARQGIGDILDLDDVHLEFAPDLVGMALDPGTGLDARIANMRTHVASIYGLILPDIRLTD
FT                   QAELPQGTYVIKVQGVEQVRGVLHPDLVLALMTDHPDALPAGEDVTEPVYGAPARWILP
FT                   KDQEAAALSGATIVSPPEILATHLLEVIKQNFARLLTLKSLRRLLSEMTRLSDPVRSEA
FT                   NQKLLDELIPDKVPIDTLHAVLRLLLEERVSIRNMPLILEAVAEARLATTQPEAICEHV
FT                   RQRLGFQLVAEMKRADGSIPLVQLAPEWEDAFATYQVDGAGGGLDIALPPDLFNKLADG
FT                   VAKRLSQTAGQGIFAALVTSTRRRRFLRTILRARGIPNPVLSFEEIGMEARPALVGQVP
FT                   A"
FT   gene            192414..193187
FT                   /gene="fliR"
FT                   /locus_tag="SPO0171"
FT   CDS_pept        192414..193187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="SPO0171"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by similarity to SP:P35537; similarity to
FT                   SP:Q45975; match to protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93497"
FT                   /db_xref="GOA:Q3V7J6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J6"
FT                   /protein_id="AAV93497.1"
FT                   /translation="MIALPPELLALISGELWQLFAVFLRVSALVSVLPAFGEQSIPMRV
FT                   RLGVAAAFAVIVAPATPQAPEITNVLQFAMLAGTEALAGLVMGLGIRLFAMALQVAGMI
FT                   AAQATSLSQLLGNAVAEPTPAMGHLLMMDGLALAVMSGLHVRVAEFLIHSYTIFPIGKL
FT                   PHPGDLSQWGVAQIGRMFALAFALAAPFVIASLIYNLALGAINRAMPQLMVAFVGAPVI
FT                   TFGGMALLLVGTPLLLSVWLDALWSFFQDPVGARP"
FT   gene            193184..194272
FT                   /gene="flhB"
FT                   /locus_tag="SPO0172"
FT   CDS_pept        193184..194272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="SPO0172"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by similarity to SP:P35538; match to
FT                   protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93498"
FT                   /db_xref="GOA:Q3V7J5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J5"
FT                   /protein_id="AAV93498.1"
FT                   /translation="MSGQDDDSDKSYEPTPQKLQKAREKGEVAKSADLSVVAAYAGLLL
FT                   ALSALGAASITKLGTALTVLIGQADGLSRLVFEGRAVGPVGGLMGTVGASILPWFLVPA
FT                   AAVILSVVAQRAFVMAPSKLVPKISRISILQNAKNKFGRGGLFEFAKSFVKLLLYSVCL
FT                   GFFIKLNLSDIVSSAGMEARQSVLLMARLLMRFMFLVATVALVIGAIDYLWQHAEHIRK
FT                   NMMSRKELMDETKDAEGDPHMKQKRRQKGQEIAMNQMLADVPGADVVIVNPTHYAVALK
FT                   WSRLPGAAPVCVAKGVDEVAAAIRRSAAEAGVPIHSDPPTARALHAGVEIGQEISEEHY
FT                   RPVAAAIRFAEAMRKRAKGRAW"
FT   gene            194266..194679
FT                   /locus_tag="SPO0173"
FT   CDS_pept        194266..194679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93499"
FT                   /db_xref="GOA:Q5LWW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW4"
FT                   /protein_id="AAV93499.1"
FT                   /translation="MVRHSILDQMTRVGEALYLREYERIRAVLEEEARIAAQIARLDDQ
FT                   VVRIRAEGSGDHGYRSVGADILWQSWESRTRRQLNSDLARARAKRLSMMDDLKRAFGRK
FT                   QAIAQIAQDDKSARAKARRKAQLDALTRDAALR"
FT   gene            complement(194774..195310)
FT                   /locus_tag="SPO0174"
FT   CDS_pept        complement(194774..195310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93500"
FT                   /db_xref="GOA:Q5LWW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW3"
FT                   /protein_id="AAV93500.1"
FT                   /translation="MLGKLLPVLFLVVGLGAGVGAGVFLGPKPSQDSAHASDQASDHGE
FT                   EKPSKAKPGDQAKSEPSEDHDAEDSGNEYVKMNKPFVVPLVHKDQISGLATVSLSLEVQ
FT                   PGFSENFYAKEPKLRDGFLQVLFDHANIGGFDGAFTRPGNLDPLRVALLESAQKAFGDN
FT                   IVSVLIVDIARQDSY"
FT   gene            complement(195319..196059)
FT                   /gene="flgH"
FT                   /locus_tag="SPO0175"
FT   CDS_pept        complement(195319..196059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="SPO0175"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by similarity to SP:P75940; match to
FT                   protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93501"
FT                   /db_xref="GOA:Q5LWX7"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWX7"
FT                   /protein_id="AAV93501.1"
FT                   /translation="MMQKCLSPKTLIAALVVLSACGRADHLGKAPSFTPNTESPEHVAM
FT                   LWPGLPLHTQPQRSVDRASLWSGGQNSLLGDQRAMKKGDILTVVIEIDEKAEISNDTNR
FT                   SRSGSESLGVPHLLGLPQRIDEKLPEGASMSNAVAVDSSSASGGKGSVKRKEKLTLRVA
FT                   ATVVDVLPNGVLSITGSQELRVNFELRELLVSGYVRPEDISRQNEITYDKIASARVSYG
FT                   GRGQITDVQQPRYGQQVLDMVLPF"
FT   gene            complement(196056..196472)
FT                   /gene="flgA"
FT                   /locus_tag="SPO0176"
FT   CDS_pept        complement(196056..196472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="SPO0176"
FT                   /product="flagellar basal-body P-ring formation protein
FT                   FlgA"
FT                   /note="identified by similarity to SP:Q44339; match to
FT                   protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93502"
FT                   /db_xref="GOA:Q5LWX6"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX6"
FT                   /protein_id="AAV93502.1"
FT                   /translation="MRYLGPILALVLAQTAAAEVLVPTRTIRAKEIIGAEDLMLKSAEV
FT                   PGSFTDPAEVIGQEARVALYAGRPIRYADIGPPAIVDRNDLVTLFFDNGPLVITTEGRA
FT                   LGRGAAGDVIRVMNLTSRTTVSGQIRPNGSIEVK"
FT   gene            complement(196472..197257)
FT                   /gene="flgG"
FT                   /locus_tag="SPO0177"
FT   CDS_pept        complement(196472..197257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="SPO0177"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by similarity to SP:P75939; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93503"
FT                   /db_xref="GOA:Q5LWX5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX5"
FT                   /protein_id="AAV93503.1"
FT                   /translation="MRALKIAATGMSAQQMRVETISNNLANMNTTGYNARRAEFADLHY
FT                   QQIARAGTVNASDGTVLPTGVQLGLGVRPAAVTVHLEQGALSATGNDLDLAIEGRGYFE
FT                   VTLPSGQSAFTRDGSLKRSAEGLIVTSDGLSVVPEITIPSDARSISINAAGEVYAYFDD
FT                   AAEGQLLGQVTLAGFTNAKGLEAIGSNLFKETEASGSPITGNPGEDGLGTLRQGYLEDS
FT                   SVDAVREVTELIEAQRGYEMNAKVISAVDQMMSATTQVR"
FT   gene            complement(197281..197931)
FT                   /gene="flgF"
FT                   /locus_tag="SPO0178"
FT   CDS_pept        complement(197281..197931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="SPO0178"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by similarity to SP:P23446; match to
FT                   protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93504"
FT                   /db_xref="GOA:Q5LWX4"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX4"
FT                   /protein_id="AAV93504.1"
FT                   /translation="MANNIANSATSGYRQQGLVFSEFVRGGLGTSSLSMARGQVRNTSQ
FT                   EQGVLTQTGGDFDLAIDGEGFFMLETPGGERLTRAGSFTPNAQGDLVNPDGYRLIDANG
FT                   APIFVPPDIDGVRIGPDGTISGAGRLLGQIGLFKPVDPHGLIREGGVFFRADDGTEPIE
FT                   GASIMQGFLEGSNVNAIDQVARLVEVQRAYELGQSFLQAEDERIRNAVNSLLR"
FT   gene            complement(197995..198267)
FT                   /gene="fliQ"
FT                   /locus_tag="SPO0179"
FT   CDS_pept        complement(197995..198267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="SPO0179"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by similarity to SP:P35535; match to
FT                   protein family HMM PF01313; match to protein family HMM
FT                   TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93505"
FT                   /db_xref="GOA:Q3V7J7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J7"
FT                   /protein_id="AAV93505.1"
FT                   /translation="MMSEGLFYDTVRQGLWIAVITSVPILSVALIAGLAVGLFQALTSI
FT                   QEMTLTFVPKLAAIVIVFWISMGFMTQTLVNYFTTTLIPLISGGV"
FT   gene            complement(198271..198561)
FT                   /locus_tag="SPO0180"
FT   CDS_pept        complement(198271..198561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0180"
FT                   /product="flagellar hook-basal body complex protein FliE,
FT                   putative"
FT                   /note="identified by similarity to SP:P24502"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93506"
FT                   /db_xref="GOA:Q5LWX3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX3"
FT                   /protein_id="AAV93506.1"
FT                   /translation="MDIRSLSAAQAYASARPATQADPKDDSATQGLRGTFQDFAATLQH
FT                   SEELAQSAMIGKADPHALVQALAQSELAVETAVTVRNKVVEAYQEILRMPV"
FT   gene            complement(198574..198981)
FT                   /gene="flgC"
FT                   /locus_tag="SPO0181"
FT   CDS_pept        complement(198574..198981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="SPO0181"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by similarity to SP:P24501; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93507"
FT                   /db_xref="GOA:Q5LWX2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX2"
FT                   /protein_id="AAV93507.1"
FT                   /translation="MREAEMSEFSKSLSVTASALRAQATRLRHVSENISNADTPGYRRK
FT                   TVPFEVERGRDDGVERVTTGRVKLDRRQLPDIFDPSHPLADETGHYQGSNVDLMIEIAD
FT                   AREAQRSYEANLKLFDQARQMSASLMELLRK"
FT   gene            complement(198978..199394)
FT                   /gene="flgB"
FT                   /locus_tag="SPO0182"
FT   CDS_pept        complement(198978..199394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="SPO0182"
FT                   /product="flagellar basal-body rod protein; FlgB"
FT                   /note="identified by similarity to SP:P24500; similarity to
FT                   SP:P75934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93508"
FT                   /db_xref="GOA:Q5LWX1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX1"
FT                   /protein_id="AAV93508.1"
FT                   /translation="MKLIEGEAPMFSDLNVFKMAYAMATHAGTRQAVIAQNMANADTPG
FT                   YRERDIAPFAETFARETAGTAMQASRTSHLNGTAASAASWAPFETNAAGDPNRNNVSIE
FT                   EQMLKAVEVKRQHDRALAIYKSSMNMLRVGLGRG"
FT   gene            199455..200792
FT                   /gene="fliI"
FT                   /locus_tag="SPO0183"
FT   CDS_pept        199455..200792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="SPO0183"
FT                   /product="H+-transporting two-sector ATPase,
FT                   flagellum-specific"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P26465; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93509"
FT                   /db_xref="GOA:Q5LWX0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX0"
FT                   /protein_id="AAV93509.1"
FT                   /translation="MTAPDPLALKAEFDSLSLVRHVGRVTGVAGGVIQIQGLARQAQIG
FT                   DRVELKRNFGPSLGGEVLQVEGSTINMLPDSAPEGVSLGNRVVLHPIPGFAPGRHWLGR
FT                   VVDPFGRPLDGRPLMRGSKARDLMRAPPPAVQRKPLGQRMATGLAALNTLLPIVRGQRV
FT                   GLFAGSGVGKSSLLATLAKSMQADAVVVALIGERGREVNEFVAKALGPEGLARSVIVAA
FT                   TSDQSALVRRRCAWAAMTVAESLRDEGLNVLYLADSITRFAEAHREISAAMGEAPALRG
FT                   YPPSVTPLITGLCERAGPGTEKQGDITGVFSVLVAGSDMDEPVADILRGVLDGHIVLNR
FT                   EIAERGRFPAIDISRSVSRSLPDAATPEQNALIGEARRLIGAYEQSEVMIKAGLYSEGA
FT                   DPLLDQAVRVWPELDAFLARLDPQGIEHSFSRLQLVLRRSKSGPRH"
FT   gene            complement(200811..202328)
FT                   /locus_tag="SPO0184"
FT   CDS_pept        complement(200811..202328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0184"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01970"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93510"
FT                   /db_xref="GOA:Q5LWY6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY6"
FT                   /protein_id="AAV93510.1"
FT                   /translation="MLEGLMIGLGTAFSLTNILMVIGGCLIGTFIGMLPGLGPMSIIAI
FT                   MIPVAITIGDPSAALILLAGVYYGAIFGGSTSSILINAPGVASTVATSFDGYPLARQGK
FT                   AGKALTVAAISSFCGGTIGAILLMVFAPALASVALLFHSAEYFALMVVGLSAIAAFAGS
FT                   GQVGKALLMTLLGLIMATVGEGALFNMPRFTMGVMDLQSGFGFITLAMAMFALPEALYL
FT                   VLDPSRSTQGGESGEIKDLRITRAEAKSIAPVIGRQSVQGFLIGVLPGAGATIASFLGY
FT                   AVERNIAPKAEQEEFGKGSLKGLAAPESANNAACTGSFVPLLTLGIPGSGTTAILLGAL
FT                   IALNVTPGPRLMVDDPQIFWAVIISMYLGNLILLILNLPLIPYIAKILAVPRSFLIPFI
FT                   LFFTLMGAYIGQNNSTELLILVGLGVCATVLRFADYPLAPLLIGFILGSMLENNFARAM
FT                   QLYDGLGFILERPMTVGLLVLAALLVILPSYRARRARLRAEGVADAD"
FT   gene            complement(202330..202956)
FT                   /locus_tag="SPO0185"
FT   CDS_pept        complement(202330..202956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0185"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93511"
FT                   /db_xref="GOA:Q5LWY5"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY5"
FT                   /protein_id="AAV93511.1"
FT                   /translation="MTSARGVKVNILFPLAGNIPGESPAGAAGAAPPCTLNPTEPETPM
FT                   ALDRWIALVILMICLAYGYAAFFTMDAGLAPFMKRNPIWPSTFPKILSVLAVLAALSIL
FT                   LGLEKGAAAPKPMEINYRRLTEYKLGQALALLALMVAYALLLRPLGFLLSTLAFLSIGS
FT                   LILGERRFHILLPVAAAAAGLVWYLVQVVLGIFLSPWPAFMVNGG"
FT   gene            complement(203121..204098)
FT                   /locus_tag="SPO0186"
FT   CDS_pept        complement(203121..204098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0186"
FT                   /product="bordetella uptake gene family protein"
FT                   /note="identified by match to protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93512"
FT                   /db_xref="GOA:Q5LWY4"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY4"
FT                   /protein_id="AAV93512.1"
FT                   /translation="MKTNLTRRVMMAAASAAFAFSTPSWAEPVVDSIHFLIPGGAGGGW
FT                   DGTARGTGEALTAAGLAGTASYENMSGGGGGKAIGYLIENAASNHGTLMVNSTPIIIRS
FT                   LTGVFPQNFRDLTLVAGTIGDYAAIVVGKDSPVNSMTDLLASFDADPSGTAIGGGSVPG
FT                   GMDHLVAAMVMEAAGKDSLAVKYIAYDAGGKAMAALLSGEIAALSTGFSEAVDLANAGE
FT                   VKIIGVTSDDRVAAYPDAPTMKEQGIDTTFVNWRGFFGAPGLPEDRLAAYQEAIAKMYD
FT                   TPEWEAVRARNGWVNIHNSGDDFRAFLEKQEQQIGDLMRKLGFL"
FT   gene            204208..204873
FT                   /locus_tag="SPO0187"
FT   CDS_pept        204208..204873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0187"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93513"
FT                   /db_xref="GOA:Q5LWY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY3"
FT                   /protein_id="AAV93513.1"
FT                   /translation="MRFLLVEDNQSLASAILDRLRLDGHVVDHAANISLAEEFVITTDY
FT                   DLILLDIMLPDGDGRSFLKMQRDHRSETPVIVLTARSEVSDRVGVLDLGADDYLTKPFD
FT                   FSELEARCRAVLRRRGGRSSNQKRIGGLTFDPLSGLLEVCGLEVPLRNKELRLLEIFLA
FT                   APDQIFSKARLVDRLFSYDEEVSENAIEVYVGRLRKKIAGSGVEIQTVRGLGYRIRLQ"
FT   gene            204870..206255
FT                   /locus_tag="SPO0188"
FT   CDS_pept        204870..206255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0188"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93514"
FT                   /db_xref="GOA:Q5LWY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY2"
FT                   /protein_id="AAV93514.1"
FT                   /translation="MSDRLRSSGSIRRRLTIQLVGSAAVLAALLFLIVQTFTRELAEET
FT                   HDRILLASATSIMDAVSVRAREVSVDLPYAALSMLSNVSDDRVFYRVMLGAETLTGYDD
FT                   LPVPRPEPRAIGAMFETLVYKGESVRMATTVRWLSRNGVSTPLTISVAQTRTGQTERLA
FT                   DLTRTALLLGAGFFAVAVLLAVWTAQSSIRPLRELAGMVSRRGPTDLRPVTRPVPAEMA
FT                   PLVRSLNSFIDRLRLSLSRSEDFIAEAAHRVRTPLATVRTQAENTLHRIERPENRNALR
FT                   EMIRAIDESSRAAGQLLDHAMVSFRADSLERTPFDLTDLVAELVNRLRPVADLKDIELF
FT                   LEISGPHVMSGDPILVQNAVRNLLDNAIKYAPEESRVIVSLAGDATTHVLCIRDAAGGF
FT                   HEDEIDGLTERFVRGRNAEGTVGSGLGLTIAREVAEAHGGRLDIANTKDGAGACVCLHF
FT                   PSA"
FT   gene            206225..207250
FT                   /locus_tag="SPO0189"
FT   CDS_pept        206225..207250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM42620.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93515"
FT                   /db_xref="GOA:Q5LWY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY1"
FT                   /protein_id="AAV93515.1"
FT                   /translation="MRLSALSLCLTLWAAIAGAFEVEEHALFGAADGRVLRILSTTDTH
FT                   ILRPLIDSFLDARPGVAVDYLSVSSAEVMRAIVDEGERFDLVLSSAMDLQIKLANDGYT
FT                   RPHRSAWTPLVPDWGNWRDHVFAFSQETASVVLSRAAFADQDLPRTRQDLIDLLRSDPD
FT                   RFQGRVGTYDVAVSGLGYLFATQDARTAESYWRLMEVLGGLQVKLYCCSGEMIEAVAEG
FT                   RIDMAYNVLGSYARARTDLAESILVIEPEEYTNMMMRTAVIMRDAAEPDLAGAFADHLI
FT                   AAAWSDPPAPDYPFPGPPATDRPEGASLRPISLGPGLLVFLDRLKRQRFLEEWRNAVQQ
FT                   E"
FT   gene            207330..208943
FT                   /locus_tag="SPO0190"
FT   CDS_pept        207330..208943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0190"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93516"
FT                   /db_xref="GOA:Q5LWY0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY0"
FT                   /protein_id="AAV93516.1"
FT                   /translation="MTFDYVIVGGGSAGSALAARLSEDPGRTVCLIEAGGRGDSLLIRA
FT                   PAAVVAMLPGRPRINNWAYETVPQPGLNGRRGYQPRGKALGGSSAINAMLYVRGHRRDY
FT                   DEWAELGCDGWSWDEVLPYFRKSENNQRGADPMHGGSGPLQVSDQQSPRPISRAFVEAG
FT                   AAMQIRQSDDFNTGDNEGIGLYQVTQFHKPGHQGERCSAALAYLYPVMGRPNLTVITRA
FT                   HAKQVLFEGKRAIGVRYRKAGQSHTARAACEVILCGGAFNSPQMLQLSGVGRPEDIAPH
FT                   GIAMVHELPGVGQNLQDHLDFTLAYKSRDTDNFGLGLAGAVNLLRHARAWRRDGSGMIA
FT                   TPFAEGGAFFKTDPGLERPDIQLHFVISIVDDHARKLHMGYGFSCHVCVLRPGSRGTVS
FT                   LASADPLAAPVIDPQFLSDPADLSALMKGVRKTREMMRSQPLSGYIHKELFIDGEPDDA
FT                   GLEQHIRARADTIYHPVGTCRMGRDEMAVVDPQLRVHGVEGLRVVDASVMPRLIGGNTN
FT                   APTIMIAEKAADMIRAAAQA"
FT   gene            209006..209863
FT                   /gene="motB"
FT                   /locus_tag="SPO0191"
FT   CDS_pept        209006..209863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="SPO0191"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P09349"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93517"
FT                   /db_xref="GOA:Q5LWX9"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX9"
FT                   /protein_id="AAV93517.1"
FT                   /translation="MIMKVVEMGAHTNAAPIIIKKKKSGGGDGHHGGAWKVAYADFVTA
FT                   MMAFFMLMWLLNATTEKQRKGLADYFSDSIPINPVSGGGDGSFGGDSMFSENAMVTTGT
FT                   GGVNRRRADADRSRGSTGVDRQGGEGEPLEEFKTLEAALQGRGGESLVSEQLRKHIVTR
FT                   VTDEGLIVELISTDESPLFETNSDRPTQLMKELAKVVVRAADMVSNGIAVGGHIRAHPV
FT                   VLARNPVWELSTARAERTRVLFEGLGMKEERIQRVTGHADRKLTDPNPMAARNDRIEII
FT                   FLRS"
FT   gene            209965..211260
FT                   /locus_tag="SPO0192"
FT   CDS_pept        209965..211260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0192"
FT                   /product="flagellar hook protein FlgE, putative"
FT                   /note="identified by similarity to SP:O07884; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93518"
FT                   /db_xref="GOA:Q5LWX8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX8"
FT                   /protein_id="AAV93518.1"
FT                   /translation="MTISSSLNAGVAALSANASRLATISDNIANSSTYGYKRVETDFHA
FT                   LVNASGRGKYTAGGVRTTTQRLIDQRGSLVSTSNSTDLAVRGRGMLPVMRSSQLALPQQ
FT                   DMLLATTGSFRTDDEGYLKSEAGLVLMGWRANPDGSIPNLPRDTSDGLVPVQLSVNQLS
FT                   GAPTTEMVLRMNLPATATEAGSAGDTQPLSVEYFDNLGKSENVQIELVPTVPATGESNE
FT                   WTMILRDTASGGAVVGEYTLTFSDARTDGGTLASVTATTGGAYDATTGSVVINVAGGPM
FT                   EINIGQLGASDGITQLSDTFAPVSITKDGTAVGTMSRVEVDENGFVYAFFDNGVSRRVF
FT                   QIPLVDMPNPNGLVALDSQTYEPSRESGTFFLWDAGDGPTGDLVSFAREESTTDVATEL
FT                   TAMIQTQRAYSSSAKVIQTVDEMLQETTNIKR"
FT   gene            211299..212750
FT                   /locus_tag="SPO0193"
FT   CDS_pept        211299..212750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0193"
FT                   /product="flagellar hook-associated protein FlgK, putative"
FT                   /note="identified by similarity to SP:P33235; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93519"
FT                   /db_xref="GOA:Q5LWZ4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ4"
FT                   /protein_id="AAV93519.1"
FT                   /translation="MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAG
FT                   NTIGGAGVRILGVVRNSDPVLLASRRGADAAQGYADGVSGFHTRMARLVGNVNDPRSVP
FT                   NLIAEFESSLIAAASTPSVQTRLDAVATAASELATALNAASNGLREARNDADRSIGQQV
FT                   DRLNTVLQNVETLNGRIQSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVAL
FT                   FTDGGAILLDGPAAQLSFTPTLQTMPHMTLENGLLSGLELNGMPLRLSGPTSAIRGGSL
FT                   AAAFEVRDDLAIEAQQDLDAVARDLIERFEAPGLDPTAAPTDAGLFTDNGARFSASAQT
FT                   GLAGRLKLNASVDPGQGGQSWRLRDGLGAAVPGAVGNAQQINAFHQALTATRTPSDPRF
FT                   GTGDMTANQVGAALLSRVAQNESLATERLTFASASRTEMQKLELEQGVDTDVELQMLMQ
FT                   IEQAYAANARMIETVGEMMDTLLRL"
FT   gene            212754..213761
FT                   /locus_tag="SPO0194"
FT   CDS_pept        212754..213761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0194"
FT                   /product="flagellar hook-associated protein FlgL family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93520"
FT                   /db_xref="GOA:Q5LWZ3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ3"
FT                   /protein_id="AAV93520.1"
FT                   /translation="MAMNSLGDLAQNLMLRSYGARIRTEINTLTRELSTGKVADVTKRL
FT                   RGDFSHLADMDRSLRRLSAFATANAETRLLASASQTSLGIVEQTVTDLSDSLLSVSLSN
FT                   QAVSHAQAGVKAQGALETMISALNTSVGGRSLFAGVATDQTALASADTLMAGLRSALTG
FT                   LSTPADIMQAAQDWFDDPAGFAATVYTGSDQSLGSTQVSEDTKVSLNRRADDPAFRDAM
FT                   RLASVAALAEDPALGLSSTTKTALFEQIGVGLLGARDGVVTLQAEIGDVEGRIEKAATR
FT                   NGAAKSGLELARGELLSADPYETAIRLEAVQFQLESLYTTTVRNSRLSLVNFLR"
FT   gene            213758..214858
FT                   /gene="flgI"
FT                   /locus_tag="SPO0195"
FT   CDS_pept        213758..214858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="SPO0195"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by similarity to SP:P33979; match to
FT                   protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93521"
FT                   /db_xref="GOA:Q5LWZ2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWZ2"
FT                   /protein_id="AAV93521.1"
FT                   /translation="MTLIRLLACLLFLPCLAQAGAVRLKDLVEFDGVRGNDLVGYGLVV
FT                   GLNGTGDGLRNAPFTEEIMSNILERLGVNVTGEDFRPKNVAAVFVTAALPPFARVGSQI
FT                   DITVSAIGDSKSLLGGTLIMTPLNAADGQIYAVAQGTVLAGGASAEGQAASVVQGVPTS
FT                   GVIPAGARVEREIEFDLGSLTQLRLALREPDFTTAGRIETAVNSAFNGRVAVMRDSGTV
FT                   ELDIAATQARSPAHVIGRIENILVEPERKARVVVDQRSGTIVMGADVRISRVAVSQGSL
FT                   TLRVEEAPIAVQPNPFADGDTVVVPRTNAEIEQEPGIKLAEVPESASLSDVVAGLNALG
FT                   VSPRDMIDILKTIKAAGALHAEFVVR"
FT   gene            complement(215016..215759)
FT                   /gene="fliP"
FT                   /locus_tag="SPO0196"
FT   CDS_pept        complement(215016..215759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="SPO0196"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="identified by similarity to SP:P35528; similarity to
FT                   GB:BAC51081.1; match to protein family HMM PF00813; match
FT                   to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93522"
FT                   /db_xref="GOA:Q3V7J8"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J8"
FT                   /protein_id="AAV93522.1"
FT                   /translation="MRRAAPVLAAITLLTGAMLAGPVAAQDISLSLGEGGSVSARTIQL
FT                   ILLITVLSLAPGLAIMITCFPFLVTVLAILRQGIGLQQSPPNMLIVSLALFLTYFVMEP
FT                   VFTEAWTTGIAPMMAEELALEPALEKAIAPFKAFMAARLDADTFFAMANLRPDGAALTA
FT                   TPEAPLSVLVPSFMLSEIARAFQIGFLVFLPFLIIDLVVAAVLMSMGMMMVPPATVSLP
FT                   FKLAFFVLADGWSLIASALVRSYMP"
FT   gene            complement(215756..216085)
FT                   /gene="fliN"
FT                   /locus_tag="SPO0197"
FT   CDS_pept        complement(215756..216085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="SPO0197"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by similarity to SP:Q03593; match to
FT                   protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93523"
FT                   /db_xref="GOA:Q5LWZ1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ1"
FT                   /protein_id="AAV93523.1"
FT                   /translation="MRWTPSCIRPKRYRDMSDPQKPIEAKNPFNSVPIEITVSVGRARP
FT                   LIRDLIGLGENAVLTLDKRVEDPVDLYVGDRLVARGQLEELTGEQAGQLAVRLTEISDL
FT                   ASDLG"
FT   gene            complement(216042..216632)
FT                   /locus_tag="SPO0198"
FT   CDS_pept        complement(216042..216632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0198"
FT                   /product="ABC transporter, ATP-binding protein, flagellar,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93524"
FT                   /db_xref="GOA:Q5LWZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ0"
FT                   /protein_id="AAV93524.1"
FT                   /translation="MTIAHLLEDFEINLMDPSRVRLMDEDTLEEYRLTAFEQGYSAGWD
FT                   DAVSARSEEQGQLNATLARNLEDLSFTYHEALSQMTQSLEPMFKSLIGTVLPQTMDRSY
FT                   THHIVEQLKSMAREQVAQPALLIVPSGVSATLKPILSEEFSFPVQLVEESSLPAGQACL
FT                   RVGTAERDVDCSALLSSISDAMDSFLHQAKEVS"
FT   gene            complement(216632..218236)
FT                   /gene="fliF"
FT                   /locus_tag="SPO0199"
FT   CDS_pept        complement(216632..218236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="SPO0199"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by similarity to SP:P25798; match to
FT                   protein family HMM PF01514; match to protein family HMM
FT                   TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93525"
FT                   /db_xref="GOA:Q5LWY9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY9"
FT                   /protein_id="AAV93525.1"
FT                   /translation="MQQIRSVWASLDKKKQFIVIGAALVVFLGVLGLTRMAGSPNMQLL
FT                   YAGLESGSAGEVVRSLEQQGVPYEVRGGSIYVPAARRDELRLTLASEGLPANGGRGYEL
FT                   LDSLSGFGTTSQMFDAAYWRAKEGELARTIVASPHVAQARVHIANSSSNPFQRSIEPTA
FT                   SVSVVPSGSEVTPAQANAIRYLVASAVSGMVAEGVTVVDSNGNVIGTPETPTSSTSEDR
FT                   AQQMRERVLRLVEARVGRGNAIVEVSLDTVTETESIRERRFDPNGRVAISTDVEERSDA
FT                   SKNQTTDVTVASNLPDGDGAVGDESNSSTSATRERVNYEVSETETEILRTPGAIKRLSV
FT                   AVLVNGLPGAAQDGSSQFTPRPEEELAALRELVESAVGFNQDRGDVITLKSMELPNLEP
FT                   QGTLASSSMLQGLTFDLMSLIQMATLALVTLVLGLFVVRPILTKPAVSAPLLAVAPPPN
FT                   QSGAQSAGPALTGEIDDGSPRQNQLPGAATQQRGTVPALVGSSGTPVDRLRAMIGDKQE
FT                   ETVEILRSWLEENEEKA"
FT   gene            218355..218861
FT                   /gene="fliL"
FT                   /locus_tag="SPO0200"
FT   CDS_pept        218355..218861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="SPO0200"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="identified by similarity to SP:P34008; match to
FT                   protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93526"
FT                   /db_xref="GOA:Q5LWY8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY8"
FT                   /protein_id="AAV93526.1"
FT                   /translation="MTDATADEVEPEKKSGKKGLIVGLVLALVGAGGGFYATVSGLIPL
FT                   GAQPAEEHGESGGDHGAVVPDALPNVAYVDLQPIMVSLLGEGGQRHLRFHAQLEVPEQY
FT                   LADVEKIRPRIVDVLNGYLRAIEISDLSDPLALTRLRGHMQRRINIVAGEGRVKDVLVM
FT                   EFVLN"
FT   gene            218871..219290
FT                   /locus_tag="SPO0201"
FT   CDS_pept        218871..219290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAF27716.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93527"
FT                   /db_xref="GOA:Q5LWY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY7"
FT                   /protein_id="AAV93527.1"
FT                   /translation="MELIADILLVAGALGAGLYCFVLGRRLKRFNDLERGVGGAVAVLS
FT                   SQVDELNRTLAAAREASDNSGAALGDLTGRAEAVAQRLELMMASMHDVAPAQEVSAPPE
FT                   VVRQEPKPARPDEAKPAPAGVMFMRHDRGNSGTTP"
FT   gene            219287..219877
FT                   /locus_tag="SPO0202"
FT   CDS_pept        219287..219877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E83956"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93528"
FT                   /db_xref="GOA:Q5LX02"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX02"
FT                   /protein_id="AAV93528.1"
FT                   /translation="MKRKKSGTAGRGGALLLISVFMIGSAVIRIALEAGPALARGAVEE
FT                   PVSDLARKDERATPAAADLHALLATLRQREQDLEQRESRVMERMRALEIAEVAIDRKLA
FT                   ELTQAEEALREAVATASVAAENDLSKLTEVYEKMKPKESAALFEEMDATFAAGFLARMR
FT                   PEAAADIMAGLSPKVAYTISVVLAGRNANVPTE"
FT   gene            219941..220810
FT                   /gene="motA"
FT                   /locus_tag="SPO0203"
FT   CDS_pept        219941..220810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="SPO0203"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P09348; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93529"
FT                   /db_xref="GOA:Q5LX01"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX01"
FT                   /protein_id="AAV93529.1"
FT                   /translation="MIGILGIVVIFVMVFGGYLAAGGKMTIILKSLPFEMMMIGGAATG
FT                   AFLISNDMGGVKHTLKDVGKVFKGPKWKPEDYRDLLCLLFSLIRIARQNPVEVEQHIED
FT                   PASSALFSKYPRIQADHEAVDLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHAMHSS
FT                   HALQTVADGLPALGIVAAVLGVIKTMGSIDQPPEVLGRLIGGALVGTFLGVFLAYGLVG
FT                   PFASKVKAVVEEDNHFYLLIKEVLVANLHNHNPAMCIEVGRQNTPSHIRPGFTDLEQAL
FT                   KDLKQDAA"
FT   gene            220807..223038
FT                   /locus_tag="SPO0204"
FT   CDS_pept        220807..223038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93530"
FT                   /db_xref="GOA:Q5LX00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX00"
FT                   /protein_id="AAV93530.1"
FT                   /translation="MMQRILAVFLLLYLALPVAAAEVEVRSGEHQSFTRLVMRIPSQTK
FT                   WTLENSTGSARLKVDLPDLKLDYGEVFDRVPRKRLSELHQEKAGAPLELQFACDCEARA
FT                   FVQGGTLLVIDIRDRPASDPPLVLPLVPERVLASGDGVGADHPIEDREEDSGVAVNPRS
FT                   QPSGGASQHTFLDFSAPMAGERTVENRLYSRIMRGVDQEVLALSPREATDPDDQISAAQ
FT                   AALTETLAAGLGLPNLRVTTVVDRDLRAAREGTASPTIARKCVDDQKLAVPDWADDSPF
FT                   STQYAVLRDGLYGEFDRINAQAALALVRFYIHFGFGDEAKVNLELLQPASPDRQLLASL
FT                   AAAVEGRPAPVDNPLAGLQGCDNDAAMWSVLSERHAPETTNTNAVLRSYGRLPVHLRAY
FT                   LGPVLGEYLTDAGFVDAAQQLVRAVERSDEGDKASIAVVEAKLAGLKNEPAVQEQKLTE
FT                   VIEDASASTHAPLALIDLIEKRWVEGGDVTEQELLLAASFVHEYRRSEIGPQIQTAYVI
FT                   AQALSAQFDEAMKTLLDPGQDRKSQVWRETVDRIVKRITSHGDDITFLRHVAMLESDLF
FT                   LSVNTDTVTQVARRLNDLGFFEDALRYADRPQDRKSRPARVEIIARATLGTGRPHRALL
FT                   ELETASGPEVERLRAQAMREAGALEQAAEALTRAGDLEAASRYLWLAGAEAPIDGGEET
FT                   RFGGIHLMGRALLEEREPSSGTPLAAAREMVDDSARVRDQIDSLLNRLP"
FT   gene            complement(223341..224723)
FT                   /locus_tag="SPO0205"
FT   CDS_pept        complement(223341..224723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0205"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="identified by similarity to GB:AAO56546.1; match to
FT                   protein family HMM PF03972"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93531"
FT                   /db_xref="GOA:Q5LWZ9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ9"
FT                   /protein_id="AAV93531.1"
FT                   /translation="MTKQQSSLSPTFGRIAAFALDTRSEDIPAPVREAAALMMLDTLGV
FT                   IAAASPLDAGVIARDSATLLYGSADPRYQARMMFDGRAVSLAGATYAAATQTDNLDGHD
FT                   GYNPTKGHIGVVVIPTLATLAQHLPDLSGPEALAAVTVGYEVAGRAGIALHATVSDYHT
FT                   SGAWNCLGVAAMAARLRGQDPETLRQAMGIAEYHGPRSQMMREIATPTMLHDGSGWGAL
FT                   VGTSAAILAERGFTGAPAITAEAEEAAPYWADLGRFWQMQHQYVKPYPICRWAHAAIDG
FT                   VRQVMLDHRLSHADIAQVHVNSFHQAACLYQGLPPTTAIAQYALPFPVAVQIAYGRIGV
FT                   EHVAGSGLTDPLVAEIMQRITVSEDPRHSSRFPAGRWADVEITTTDGRVLKSGDINARG
FT                   GPEAPMTRDELTDKFMDFAVPCLGRARASALRDATLGLTAPDSRFCDVMDLLFDPIGQT
FT                   IV"
FT   gene            224915..225808
FT                   /locus_tag="SPO0206"
FT   CDS_pept        224915..225808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0206"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93532"
FT                   /db_xref="GOA:Q5LWZ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ8"
FT                   /protein_id="AAV93532.1"
FT                   /translation="MKHLPHLTFLRSFEAAARHLSFTAASEELHCTQSAVSNHVRSLEE
FT                   FLGRPLFVRLPRTLALTELGEAYLPSVRRALQEIDIATEALLSQRHRREVVVSCPTSLA
FT                   SLWLASVLRAFQREHPEVQVTVHGTVWADVEADVSDISITIHHVDDIPEGALQLWSETL
FT                   ALVCAPGFEVEGAPLTTPTQLGQARRIEVMGRPAYWDLVAQNFGLPGFEMAGGPKTDVS
FT                   TLAAELAAQGAGCAVLPRVLVRPYLERGALVEPFATEIANPWAYCARFKARTPAPSVRL
FT                   FRSWLLEAAARVGEGD"
FT   gene            complement(225805..228222)
FT                   /locus_tag="SPO0207"
FT   CDS_pept        complement(225805..228222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0207"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93533"
FT                   /db_xref="GOA:Q5LWZ7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ7"
FT                   /protein_id="AAV93533.1"
FT                   /translation="MKTHAQAVVIGGGLVGCSILYHLAKLGWRDVVLLERDELTSGSTW
FT                   HAAANIHGLHDNNNVTRIQHYTMNLYKELEKETGQGCGVFQAGSLYLAQTEAREHQLRL
FT                   QEAKARYYGLNFYEIDKDRAKELHPLAQFDDIRCIMYEPDGGNVDPSGVTYAYAAGARA
FT                   MGATIERFCPVIGTEPQPDGSWIVRTEKGDIHTQWVVNAAGLWGREVAALAGITLPLQP
FT                   TEHQYFVTEAIPEVAALGRRLPSIADRDGEYYFRQEGNGLLIGAYEKDMKFWAENGTPL
FT                   DFAHDLFPDDLDRIMENVIRATERVPVAATAGVKRVINGPMIWSPDSSALWGPVPELRN
FT                   YFVCGGIIPGFSQSGGLGLLAAQWMIEGEPQNDMFAWDLARFGDWADKTFTKARVQDQY
FT                   THRFAIHFPNEERSAGRPARVRPAYEMQQQMGAVFGMNCGWEHPLWFADQPGVSETVGF
FT                   TRQNWWEPVGREARMLREQVGVIDISNFANYEIKGPGAHDWLDRLVANRVPTVEGRSCL
FT                   TPLIGVRGGIAGDFTITMTGEDAYMMVGSGMAERYHQRFFNMVDLPEGTTCEVATNRIA
FT                   GYNVAGPRAREMLQRLTNADLSNAGFPFMRSATIEVAGVACLAIRVSFTGDLGCELHCA
FT                   EGDQVRLYTALIAAAREVGGGPVGSRALGSLRIEKGYGSWGREYSPEYWPQEVGLDRLI
FT                   KADKDFLNKAAWLKIKDYPVREVLSVFEIEAVHGADASGGEPIFTPDGRPAGRVTSGAY
FT                   GYSVGKSLAIGFVNPAVAQPGDVLEVFILGKPHRAVLLAEPPFDPAGARLRG"
FT   gene            complement(228692..228768)
FT                   /locus_tag="SPO_tRNA-Pro-3"
FT   tRNA            complement(228692..228768)
FT                   /locus_tag="SPO_tRNA-Pro-3"
FT                   /product="tRNA-Pro"
FT   gene            228804..230498
FT                   /locus_tag="SPO0209"
FT   CDS_pept        228804..230498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0209"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF02690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93534"
FT                   /db_xref="GOA:Q5LWZ6"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ6"
FT                   /protein_id="AAV93534.1"
FT                   /translation="MQEGFRRAGLKNTGLPPCPSLARLRVRGAQEMAGNLYFLIGGIGM
FT                   FLLGMELMTAALRDTAGSRLRGVLTRFTTTPLRGVMTGAAATAVVQSSSATTVMTVGFV
FT                   GAGLMTMPQALGILYGANIGTTATGWLVSLLGFKLKLGNLALLLLFPAALADLLARGPL
FT                   ARAGRTVAGLCLLLIGLDLMQSGASDLTAYLTPESLPGSGMGGLLLLVGLGATVTIVMQ
FT                   SSSAAMALALVMLSGGAITLLQAAAIVIGMNIGTTFTAVLASTGGSVPMRQTALANLIF
FT                   NIVTSVLAFPLLLLLRPVFESAAGLGDDLSVLLLFHTGFNLVGTALFLPLTGCFAGLVA
FT                   RLLPERESDQLFVPDRSLLKDANAALLAAQSGTRTVAERMFSALGAGLAPAPDYRPIAA
FT                   LTPCVRALEDLRAFLSEIRLPPDRAQDIETFSDILHQIDHLTRLLDRARQTGNIDTLLH
FT                   DRLLRRSALGAGAALRRSGAALGALPEGMRLERLRHLIGARRKRHRRAMMLGEHVGLFS
FT                   LDQVFAHTDAMRWLDRVLHHAERVAHYHRAAAARLPAADAPPRAETG"
FT   gene            complement(230495..231598)
FT                   /gene="leuB"
FT                   /locus_tag="SPO0210"
FT   CDS_pept        complement(230495..231598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SPO0210"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by similarity to SP:Q51375; match to
FT                   protein family HMM PF00180; match to protein family HMM
FT                   TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93535"
FT                   /db_xref="GOA:Q5LWZ5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWZ5"
FT                   /protein_id="AAV93535.1"
FT                   /translation="MSNPSLLILPGDGIGPEVMAEVRKIIGWFGDKRGLNFDVSEDLVG
FT                   GAAYDVHGVPLADETMAKAQEADAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLFS
FT                   NLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGNERVGINTQR
FT                   YTESEIERVARSAFELAMRRSKKLCSMEKANVMESGILWREVVTRVAKDYPEVELSHMY
FT                   ADNGAMQLVRAPKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKAL
FT                   YEPVHGSAPDIAGQGKANPIACILSFAMALRYSFDQGAEADRLEAAVEQVLADGVRTAD
FT                   LLGTEGVTPVSTTEMGAAILAKLDASL"
FT   gene            complement(231701..232597)
FT                   /locus_tag="SPO0211"
FT   CDS_pept        complement(231701..232597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0211"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93536"
FT                   /db_xref="GOA:Q5LX11"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX11"
FT                   /protein_id="AAV93536.1"
FT                   /translation="MDELSDIGDWSLIQSFLAVAETGSLSAAARQLDRSQPTLGRHVQA
FT                   LEQALGLSLFDRHARGLKLSADGARILPLAQQAHRAMTAISVTAAGQSQSLAGTVRITA
FT                   SVFASHHILPPILADIRAAEPAIELELVPSDTTENLLFRAADIAVRMYRPRQVDIVARH
FT                   IGDVPLCACAATSYLERKGRPTRAEDLLDFDLVGYDADPIIVKTMQALGWPVTRHSFAM
FT                   RCDNQSAYWQLIRAGCGIGFGQRSIVAADPLVEVLPFELPVPPLEMWLAAPQAMRLTPR
FT                   IRRVWDLLAAGLLAAPL"
FT   gene            232689..233597
FT                   /locus_tag="SPO0212"
FT   CDS_pept        232689..233597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G97622"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93537"
FT                   /db_xref="GOA:Q5LX10"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX10"
FT                   /protein_id="AAV93537.2"
FT                   /translation="MTQTVLVLGASGRFGRNAAEAFGRAGWTVRQFDRKRDDLDAAARG
FT                   ADVIVNAWNPPYPDWAATVPGLHARVIKTAQATGATVIIPGNVYVFGADTPAPWGPDSP
FT                   HAATNPLGRIRIDMEAAYRASGVRTILLRAGDFLDTCASGNWFDQVMIKRLDKGRFTYP
FT                   GNPDIPHAWAYLPDLARATVTLSERRETLPVFCDLTYPGYTMTGRQIATGLEQVTGRRV
FT                   ALKRMNWLPLHLARPVWSLAGSLLEMRYLWNTPHSLDGAAFAKVLPEFVQTPFEQALAS
FT                   AIPARLLAAQVHPDQAVAAGL"
FT   gene            complement(233547..234620)
FT                   /locus_tag="SPO0213"
FT   CDS_pept        complement(233547..234620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM40439.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93538"
FT                   /db_xref="GOA:Q5LX09"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX09"
FT                   /protein_id="AAV93538.1"
FT                   /translation="MIRLAALVLCLLPVAAAAEVLRVATFNTELSRKGPGLMLRDIAGG
FT                   RDTQVAAVVSVIASARPDILALQGLDWDHEGRALDALAAQLAAAGWEMAHIFAAQPNSG
FT                   RATDLDLDGDRRIGGPGDAQGYGRFTGQGGIAILSRHPIAQAEIQDFSALRWRDLPGAT
FT                   LPESGGHAFPSEAAQAAQRLSSTGHWLVPIDTDMGRMVLLTYQAGPPVFDGPEDRNGLR
FT                   NRDETRFWQLLLDGVVGAMPDLPFVLAGGANLDPQDGEGYRGTIRALLADPRLQDPAPE
FT                   SSGAARAGPQGHAGPDARDTVDWPGIGRFRVDYVLPSTHWRVVGSGVVWPAPDDPSAGP
FT                   VSEASRHRLVWVDLSRQ"
FT   gene            complement(234617..235450)
FT                   /locus_tag="SPO0214"
FT   CDS_pept        complement(234617..235450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0214"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93539"
FT                   /db_xref="GOA:Q5LX08"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX08"
FT                   /protein_id="AAV93539.1"
FT                   /translation="MIARISGAALRGFLVALVVVIPALYLPSAATTATEIVVLLAILAF
FT                   VLTFAEYNSTFPSFIEFRDAPPLNRMRFIALLTMITFLTLICKERVEPTNITALFSGFG
FT                   LLIAHIADFPYSPVRLVVLMLPVGAAPELIYDVRVTAAVAYVIALLTVVAFWFAVRVRG
FT                   WPTANGAFNVWINLPLFDPTTGGDVVARLQRDGRINMVLGVLLPFLIPAMIKMASDLFD
FT                   PINLYSAQTLIWTMSAWAFLPASMIMRGLAMMRIAELIEEKRRRVYSNAEAMQTA"
FT   gene            complement(235799..236404)
FT                   /gene="leuD-1"
FT                   /locus_tag="SPO0215"
FT   CDS_pept        complement(235799..236404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD-1"
FT                   /locus_tag="SPO0215"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P96196; match to
FT                   protein family HMM PF00694; match to protein family HMM
FT                   TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93540"
FT                   /db_xref="GOA:Q5LX07"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX07"
FT                   /protein_id="AAV93540.1"
FT                   /translation="MEKFTKIQGIAAPMPLVNIDTDMIIPKVFLKSIQRTGFGKNLFDE
FT                   MRYNRDGTEIPDFVLNKPQYRDAEILVAGDNFGCGSSREHAPWAIADFGIKCIISTSFA
FT                   DIFFNNSFKNGILPIVLPQEQVDILMKDAEKGANARMTVDLEAQEITTSDGEVIPFEVD
FT                   AFKKHCLLNGLDDIGLTMEKAAAIDTFEAQAAQARPWV"
FT   gene            complement(236489..237895)
FT                   /gene="leuC-1"
FT                   /locus_tag="SPO0216"
FT   CDS_pept        complement(236489..237895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC-1"
FT                   /locus_tag="SPO0216"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P30127; match to
FT                   protein family HMM PF00330; match to protein family HMM
FT                   TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93541"
FT                   /db_xref="GOA:Q5LX06"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX06"
FT                   /protein_id="AAV93541.1"
FT                   /translation="MSPKTLYDKIWDAHLAHEAEDGTCLLYIDRHLVHEVTSPQAFEGL
FT                   RMAGRKVRAPEKTIAVPDHNVPTTEGREDPAQMTEESRIQVQALDKNAREFGVHYYPVD
FT                   DIRQGIVHIVGPEQGWTLPGMTVVCGDSHTATHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKSKNMKVEITGKLNPGVTAKDITLAVIGATGTAGGTGYVIEYCGEAIRDLSMEGRMTV
FT                   CNMAIEGGARAGLIAPDQTTFDYVKGRPHAPKGAQWEAALAWWKTLYSDDGAHFDKIVT
FT                   LKGEEIEPVVTWGTSPEDVLPITGVVPSPEDFTGGKVEAARRSIEYMGLTPGQKLTDIE
FT                   IDTVFIGSCTNGRIEDLRAVAEVVKGKKIKSGLRAMVVPGSGLVRAQAEEEGIADILKD
FT                   AGFEWRLAGCSMCLAMNPDQLAPGERCAATSNRNFEGRQGYKGRTHLVSPAMAAAAALT
FT                   GKLTDVRELI"
FT   gene            complement(237948..238112)
FT                   /locus_tag="SPO0217"
FT   CDS_pept        complement(237948..238112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93542"
FT                   /db_xref="GOA:Q5LX05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX05"
FT                   /protein_id="AAV93542.1"
FT                   /translation="MAGLSRQTQDLARLRADMYLDSMTPHDAPSMDLQDRARLRERFFG
FT                   ATRSVLARL"
FT   gene            238133..239485
FT                   /locus_tag="SPO0218"
FT   CDS_pept        238133..239485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0218"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93543"
FT                   /db_xref="GOA:Q5LX04"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX04"
FT                   /protein_id="AAV93543.1"
FT                   /translation="MSEDILPATLDELIATLLTEGHRLVGLFLTPGWRQYQLLIIVLLI
FT                   GAALLLSLLTRTHWEAWARSRAGWPKWRLRTLVLLMRRLSLLYFVVLSWMTYLVMQQMT
FT                   WPSRSYVIGVVATLATALLVIALVARAVRNRTIRLVFRWSMWVYATLVALNLTDDVARF
FT                   LDGISIEIGALHISVLGVMKAVLLVGALLVLVRLASQGASNALARNDDISPSMQVLLAK
FT                   AVQVLLYGWVFIVAIRTLGFDLTGLAFLSGAIGVGIGFGLQKVVSNLISGIIILMDRSI
FT                   KPGDVISLGETFGWINALGARYVSVVTRDGREYLIPNEDLITSQVVNWSHSDQYVRLDL
FT                   NFGTSYGDDPHKVRAVSIAAARSVGRVLSGSGRDPVCHIVGFGDSSVDYVLRFWITDPT
FT                   AGLTNIRGNVFLALWDAFQAEGISIPFPQREVRMLENEGGLPQFAGQGGAD"
FT   gene            239625..240011
FT                   /locus_tag="SPO0219"
FT   CDS_pept        239625..240011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0219"
FT                   /product="iojap-related protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93544"
FT                   /db_xref="GOA:Q5LX03"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX03"
FT                   /protein_id="AAV93544.1"
FT                   /translation="MPAHAGAKMMAQGTYTSEQLLDRILTSLNDDKAEDLVQIDLRGKT
FT                   SMGDYMVIASGRSTRQVSAMAEKLVQRLKDEFGLNSKIEGKDAGDWVLIDTGDVIVHIF
FT                   RPEVREFYQLEKMWMPQGAKTSAN"
FT   gene            240058..240528
FT                   /locus_tag="SPO0220"
FT   CDS_pept        240058..240528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q92LB0; match to
FT                   protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93545"
FT                   /db_xref="GOA:Q5LX20"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX20"
FT                   /protein_id="AAV93545.1"
FT                   /translation="MRVSILAVGRLRTGPEKSLIDDYLTRFDRTGRALGLGPARVVEVE
FT                   DKKNAGMGAEAALLRKALPAGAVLCTLDERGKQLSSPDFADRMAGWRDTGRQDLALVIG
FT                   GADGIDPSLRAEADFSISFGAMVWPHMLVRVMLAEQLYRAATILAGSPYHRV"
FT   gene            240537..241022
FT                   /locus_tag="SPO0221"
FT   CDS_pept        240537..241022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE38612.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93546"
FT                   /db_xref="GOA:Q5LX19"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX19"
FT                   /protein_id="AAV93546.1"
FT                   /translation="MAELLIVYHSRTGGSRQMAEACAAGAQSEIATTLLTAEAAGPEDL
FT                   LRASGYVFCCPENLAAISGAMKEFLDRCYYPVLGRIEGRAYAQMICAGSDGQNAARQLA
FT                   RIATGWRLKEVQPPLILCTHAQTPEAIQAPKHIPEAELGQCRDLGQALGAGLAMGMF"
FT   gene            complement(241109..242224)
FT                   /gene="ald"
FT                   /locus_tag="SPO0222"
FT   CDS_pept        complement(241109..242224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="SPO0222"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by similarity to SP:P30234; match to
FT                   protein family HMM PF01262; match to protein family HMM
FT                   PF05222; match to protein family HMM TIGR00518; PMID:
FT                   16541231"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93547"
FT                   /db_xref="GOA:Q5LX18"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX18"
FT                   /protein_id="AAV93547.1"
FT                   /translation="MKIGCPKEIKPQEFRVGMTPNAAREAVSHGHEVIIETNAGAGAGF
FT                   DNADYVDAGARIVDTAAEVFATADMIVKVKEPQAIERKMLREGQLLFTYLHLAPDPDQT
FT                   HDLLASGATCIAYETVTDRNGGLPLLAPMSEVAGRLAPQVGAWTLQKANGGRGVLMGGV
FT                   PGVGPAKVLVIGGGVVGTHAAKIAAGMGADVTVLDRSIPRLRYLDDVFGGTFKNSYASA
FT                   GNTIELARQADMIIGAVLIPGAAAPKLISRAQLSELKPGAALVDVAIDQGGCFETSKAT
FT                   THQDPIYEVDGIMHYCVANMPGAVARTSTIALGNATMPFMLALADKGWKQACADDVHLL
FT                   NGLNVHAGKLTYAAVGEALGLDVVSASQLVQ"
FT   gene            242364..242822
FT                   /locus_tag="SPO0223"
FT   CDS_pept        242364..242822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0223"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93548"
FT                   /db_xref="GOA:Q5LX17"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX17"
FT                   /protein_id="AAV93548.1"
FT                   /translation="MSLDATDRKILTALQAKGRMSNAELSDKANLSPSACHRRVQRLEA
FT                   EGYIRNYVALLDARKMGLPTTVFVEITLQGQADEVLDAFEKAVARIPDVLECHLMAGTA
FT                   DYILKVVAENTEDFARIHRQHLSRLPGVAQMQSSFALRTVFKTTALPV"
FT   gene            242986..243903
FT                   /locus_tag="SPO0224"
FT   CDS_pept        242986..243903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0224"
FT                   /product="polyphosphate kinase, putative"
FT                   /note="identified by similarity to GB:AAN87337.1; match to
FT                   protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93549"
FT                   /db_xref="GOA:Q5LX16"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX16"
FT                   /protein_id="AAV93549.1"
FT                   /translation="MTHESDDPSLDWLEAELEDSLDEDFEIEFSEPMLSMEIRRIYKDQ
FT                   RPDLLDRQVYFRNLLRLQAELIKLQDWVQHTNSKVLIIMEGRDAAGKGGVIKRITQRLN
FT                   PRIARVVALPAPSRREQSQWYFQRYVPYLPSGGEMVLFDRSWYNRAGVERVMGFATEDQ
FT                   VEQFFQDVPEFERMLVRSGIILLKYWFSITDEEQQLRFLMRVHDPMKQWKLSPMDLESR
FT                   IRWEQYTKAKEQMFSRTNIPEAPWYIVEGNDKKRERLNCIEHLLSKIPYEDIPHEKVTL
FT                   PDRRYNPDYERQVLPDELYVPKVY"
FT   gene            complement(243987..244499)
FT                   /locus_tag="SPO0225"
FT   CDS_pept        complement(243987..244499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0225"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93550"
FT                   /db_xref="GOA:Q5LX15"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX15"
FT                   /protein_id="AAV93550.1"
FT                   /translation="MTDDLSDDLFLVHPDGTPNGPAAATLSFTRSPTVLLTFAGNRFTR
FT                   AAARHYQTEFGIGAMDWRMLVMLTREPGSSVSHAARTIGIDKAAVSRSLHRLDALGLAR
FT                   AEDGNERRRHWTLTKAGRQMHARILDSALDRQRRLLDGFTPEEVDAFTTYLRRILINIE
FT                   TLGATDP"
FT   gene            244548..245786
FT                   /locus_tag="SPO0226"
FT   CDS_pept        244548..245786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0226"
FT                   /product="cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93551"
FT                   /db_xref="GOA:Q5LX14"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX14"
FT                   /protein_id="AAV93551.1"
FT                   /translation="MTTRTPQNTHCVDMTTGSRAMSDAPVYEIDLAAFWADPYPDLKRM
FT                   RAEAPIAYVPQLGATLITRRDEIFAQEKRIEIFSSDQPQGLMTVLMGQNMMRKDGDAHM
FT                   AERKAIFPTVSPKTVKQVWVAQFRAAAQRVLDDLAPRGACDLVRDYAMPVSAEALKAIT
FT                   GLTNMTAAEMDRVSQGMIDGCANYAGDPLVEARCHDCTASIDAHIDAMIPVLDARPDHS
FT                   LLSVQRRAGLSDAQTRANIKLAISGGQNEPRDAIAGTAWAVLSHPDALARLQSGAVPWL
FT                   RAFEEYARWISPIGMSPRRVAQRATVQGVTLEPEDRVFLMFGSGNRDESVFANPDRFDL
FT                   DQDIAPAISFGAGPHFCAGAWASRALIGEVALPLLFERLPGLALDGEARFGGWAFRGPI
FT                   TVPVRWEPAPREG"
FT   gene            complement(245787..247157)
FT                   /locus_tag="SPO0227"
FT   CDS_pept        complement(245787..247157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0227"
FT                   /product="PaxA, putative"
FT                   /note="identified by similarity to GB:AAF15370.1; match to
FT                   protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93552"
FT                   /db_xref="GOA:Q5LX13"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX13"
FT                   /protein_id="AAV93552.1"
FT                   /translation="MSQASTLEREMLELINNERTSRGLNPVTLELKLNDASEDHSKWML
FT                   ERDVFSHTGVNGSSPGDRIEKTGFKFEGNSIWAENIAWQSERGAPGLSDDVKNLHESLM
FT                   NSPGHRANILNPDVTLVGIGIERGNFEGYDAVMVTQNFARTAAEVELDTGAPTPEPEPK
FT                   PEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP
FT                   KPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPENACEGSDGSD
FT                   LIFTDDTGGAAHGKGGNDIMIGGRGMDIFWGDGGQDILIGGRGMDKLSGGDGDDVLLGG
FT                   RGKDMLDGGAGNDLLIGGRGKDALDGGEGDDHMLGGAGADTFHFSTGKDVVFDFGVRGQ
FT                   ADLVDLGKADGIADFDDLKANHLSEVDGDAVITDAAGNSLTLLGVQMDMLDAQDFLF"
FT   gene            247265..248473
FT                   /locus_tag="SPO0228"
FT   CDS_pept        247265..248473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0228"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93553"
FT                   /db_xref="GOA:Q5LX12"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX12"
FT                   /protein_id="AAV93553.1"
FT                   /translation="MRPGHWAGRRTANPPFQPPAERRARPTRLLAENRSLVTAPGRFAT
FT                   PLSPPDKTGDSIRGEMERRQGKDTMTAADPNLSAGADQPEGATTLTGILFLLLATTIFP
FT                   IQDVIIKSLSSEFAVHQIVFWRSVFALPIAAAMALYEGSLWPWKIGSWPLQLTRAVAAF
FT                   SSYLVYYMALAAIGLAETAAITFSTPIFVTLLAAVFLGEKIGLWRWLAVFLGMAGVLVI
FT                   VQPGASVFEPAALLALAAALFYAISIIATRRLGNRTNGGTMTLVTLLVYIVGGTVLGLV
FT                   FSGLETASPHPSLAFLYRDWIAPAPMDWLALAALGVTSGIGFFALSQAYRMAEASVVTP
FT                   FEYTYLPWAVLWGYLVFGVLPVMSTWIGLTLIVGSGLLILFRETMRGRRIVRRRGLGVM
FT                   RQR"
FT   gene            complement(248574..248780)
FT                   /gene="rpsU"
FT                   /locus_tag="SPO0229"
FT   CDS_pept        complement(248574..248780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SPO0229"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93554"
FT                   /db_xref="GOA:Q5LX29"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX29"
FT                   /protein_id="AAV93554.1"
FT                   /translation="MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAR
FT                   EKAEAIRRARKLARKKAQREGML"
FT   gene            248890..249570
FT                   /locus_tag="SPO0230"
FT   CDS_pept        248890..249570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25258.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93555"
FT                   /db_xref="GOA:Q5LX28"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX28"
FT                   /protein_id="AAV93555.1"
FT                   /translation="MSPTYEEARNHLLDAALTHVAFDGWTEETFRAAAAETGLDMDFAR
FT                   AICPRGAVDLALTYHARGDAAMVERLAAAELSELRFRDRIAAAVRFRLEAVEDKEAVRR
FT                   GVTLFALPAHAGEGAKAIWQTCDVIWSALGDSSEDVNWYTKRATLSAVYSATVLYWLGD
FT                   ETPGHEATWEFLDRRIDNVMQFEKFKADVQKNPLLKPLLAGPNWLFAQMRAPRDKGDLP
FT                   GSLG"
FT   gene            249647..250630
FT                   /locus_tag="SPO0231"
FT   CDS_pept        249647..250630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0231"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93556"
FT                   /db_xref="GOA:Q5LX27"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX27"
FT                   /protein_id="AAV93556.1"
FT                   /translation="MSQQMRAVEISRPGGPEVLQLTQRPRPEPGHGQVLIKVAYAGVNR
FT                   PDALQRAGAYDPPPGASDLPGLECSGEVVAVGPGAEDVAVGDKVCALLPGGGYADYVVT
FT                   PAAHCLPVPQGMALREAACLPETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQL
FT                   AHAFGARVFATAGSDDKCRACLDLGAERAINYRDEDFVKVMRSEGGADLILDMVGGDYI
FT                   PRNVKALAEDGRLVQIAFLQGPVVELNFALMMVKRLTLTGSTLRPQSDLAKADIARDLR
FT                   EAVWPLLDAGRIAPVMDSEFDLGDAAAAHARMESSGHIGKIVLKVG"
FT   gene            250710..251693
FT                   /locus_tag="SPO0232"
FT   CDS_pept        250710..251693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0232"
FT                   /product="quinone oxidoreductase, putative"
FT                   /note="identified by similarity to SP:P40783; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93557"
FT                   /db_xref="GOA:Q5LX26"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX26"
FT                   /protein_id="AAV93557.1"
FT                   /translation="MSETARTVVIEGFGGPEVLQLRDLPVGEPGPGELRIRHQACGLNF
FT                   IDVYQRTGLYPLALPHALGMEAAGIVEAVGEGVTHLKPGDRAAYAATPPGAYAQARVMP
FT                   AAQVCPLPDEISFDQAAAMMLKGLTVDYLFHRTTPLSRGDTVLFHAAAGGVGLIACQWA
FT                   KAEGITLIGTAGSDEKCALAKAHGATHVINYRTENFTDRVRELTDGKGVDVVMDSIGAD
FT                   TFEGSLDCLKPLGMMISFGNASGPVPPVNIGMLGQKGSLKLTRPTLFTHISDHAACQAM
FT                   ARRLFGKVTGGEVKIRIDQRFPLDQVADAHRALEARQTTGSTILEL"
FT   gene            251746..252174
FT                   /locus_tag="SPO0233"
FT   CDS_pept        251746..252174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0233"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93558"
FT                   /db_xref="GOA:Q5LX25"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX25"
FT                   /protein_id="AAV93558.1"
FT                   /translation="MDQLDRQIVAALQHNARESTTKIAARLGVARTTVHERITRMESRG
FT                   VIAGYSVVLREPQDESKVQVVVLLEVQQKETTRIVKRLEAYPEIKLCLSINGEYDLLLS
FT                   AEAPRIEDLDILVDEVGAIPGILRTNTFVVFGRRIDRT"
FT   gene            252290..253396
FT                   /gene="lysdh"
FT                   /locus_tag="SPO0234"
FT   CDS_pept        252290..253396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysdh"
FT                   /locus_tag="SPO0234"
FT                   /product="Lysine dehydrogenase"
FT                   /note="identified by similarity to GB:BAB51119.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93559"
FT                   /db_xref="GOA:Q5LX24"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3IC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX24"
FT                   /protein_id="AAV93559.1"
FT                   /translation="MRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRM
FT                   GVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPIIAKAAKAAGAHYFDLTEDVAATN
FT                   AVRALAEDSQTAFMPQCGLAPGFVGIAGAALAAEFDEIDSLHMRVGALPLYPTNALKYN
FT                   LTWSTDGLINEYCNPCDAIVNGERVKTAPLEDYEILGHDGVEYECFNTSGGLGTLPETL
FT                   DGKARSVSYRSIRYPGHRDILRLLLNDLGLERRRDLLKDIFETALPRTDQDVVLVYCTA
FT                   KGRIGGQLREKSLINKSYSRVIDGQVWSAIQVTTAAGVLGVVDLMRAGTLPAKGFVRQE
FT                   QVKFADFLETEFGRLYRAGDLTAQNKAA"
FT   gene            253400..254914
FT                   /gene="aasadh"
FT                   /locus_tag="SPO0235"
FT   CDS_pept        253400..254914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aasadh"
FT                   /locus_tag="SPO0235"
FT                   /product="alpha-aminoadipic semialdehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93560"
FT                   /db_xref="GOA:Q5LX23"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX23"
FT                   /protein_id="AAV93560.1"
FT                   /translation="MKDIVMTAETVMQQLGLGAADLTGGSIRVTSPIDGRVLGEVHETP
FT                   LSEMAAVLDRAKSAFKIWRSVPAPRRGELIRLLGEELRASKEALGALVSWEAGKITSEG
FT                   LGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPAGPVGVISAFNFPVAVWS
FT                   WNAALAIVCGDPVIWKPSEKTPLTALACQKIFERALARFGDAPDGLLQTLIGGADLGRT
FT                   LVESEDVPIISATGSTRMGRAVAPIVAARFGKCILELGGNNAMIVGPSADLEMAVRAIV
FT                   FSAVGTAGQRCTTLRRLIAHNSIKDELVARLKKAYAGLPIGNPLAEGTLIGPLVDEASG
FT                   NAMTDALKSAKAEGGMVFGGARVSEGVPAGGVYMQPAIVEMPAQSATVKTETFAPILYV
FT                   MGYDSFEEAVHIQNDVPQGLSSCVFTLNMREAEQFLSASGSDCGIANVNIGPSGAEIGG
FT                   AFGGEKETGGGRESGSDAWKAYMRRQTNTVNYSAELPLAQGVKFDI"
FT   gene            complement(255034..255972)
FT                   /locus_tag="SPO0236"
FT   CDS_pept        complement(255034..255972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0236"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   putative"
FT                   /note="identified by similarity to SP:P37965; match to
FT                   protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93561"
FT                   /db_xref="GOA:Q5LX22"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:3L12"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX22"
FT                   /protein_id="AAV93561.1"
FT                   /translation="MNGFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGV
FT                   RALEFDVVMTADGVPVVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGL
FT                   DGRTVYGRRFPDQAFLTGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARA
FT                   EMVAAVLADVRRYRMEPRTVMHSFDWALLGECRRQAPDLPTSYLSQLPENADDPGEDSA
FT                   KPVGPDYDRMTESLPQAVASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDI
FT                   RRMATTGVDGIVTDYPGRTQRILIDMGLSWT"
FT   gene            complement(255969..257024)
FT                   /gene="upgC"
FT                   /locus_tag="SPO0237"
FT   CDS_pept        complement(255969..257024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upgC"
FT                   /locus_tag="SPO0237"
FT                   /product="SN-glycerol-3-phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.20"
FT                   /note="identified by similarity to SP:P10907; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93562"
FT                   /db_xref="GOA:Q5LX21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX21"
FT                   /protein_id="AAV93562.1"
FT                   /translation="MASITLDNLVKAYGDTEVLHHVAGQIEDGEFIVIVGPSGCGKSTL
FT                   LRMVAGLETVTAGQISIGDRVVNQLEPADRDIAMVFQNYALYPHMSVRENMAYGLKIRK
FT                   ISKDEIARRVEEAADILELRPYLDRKPRQLSGGQRQRVAMGRAIVRNPQVFLFDEPLSN
FT                   LDAKLRVQMRLEIRKLQQRLGVTSIYVTHDQVEAMTLGDRLMVLNGGYVEQFGTPIELY
FT                   DRPATTFVAGFIGSPAMNFLPATAAEGSVTLANGARIAGSGTAHGTVTLGLRPEHLLPD
FT                   EGGPVRVRVELVEQLGANSLLHGQLEGTDTEMVVSMPGHMSAAADAVMAFTPTADSLHL
FT                   FDPETGKRIAE"
FT   gene            complement(257035..257886)
FT                   /gene="ugpE"
FT                   /locus_tag="SPO0238"
FT   CDS_pept        complement(257035..257886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="SPO0238"
FT                   /product="SN-glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P10906; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93563"
FT                   /db_xref="GOA:Q5LX33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX33"
FT                   /protein_id="AAV93563.1"
FT                   /translation="MVENRPILNVITHLVLILGIVIVALPIWITFVAATHDAVRMTQAP
FT                   IPMLPGTHFWENFTQTLFGSGLSGTETAPVWRMLLNSLAMAMMIALGKIAISLISAFAI
FT                   VYFKFPFRMFFFWLIFVTLMLPVEVRILPTFEVVADLGMLNSYWGLSIPLIASATATFM
FT                   FRQVFLTIPDEMLESARIDGAGPLRFFWDILIPLSRTNIAALFVILFIYGWNQYLWPLL
FT                   ITTDTDMTTIVMSIKQMLEAAEQSPQWNIIMMTALLAMLPPVFVVVAMQKLFVQGLTET
FT                   DK"
FT   gene            complement(257886..258806)
FT                   /gene="ugpA"
FT                   /locus_tag="SPO0239"
FT   CDS_pept        complement(257886..258806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="SPO0239"
FT                   /product="SN-glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P10905; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93564"
FT                   /db_xref="GOA:Q5LX32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX32"
FT                   /protein_id="AAV93564.1"
FT                   /translation="MPRRFRPRGNENPMLKRVHFPSSLLPYLLVAPQILITLVFFIWPA
FT                   SQAVYQSFLIEDAFGLSTEFVWFENFELLIEDAQYLQSFGRTILFSAAVAVLSMGSALI
FT                   LAGFADRVVRGATTYRTLMIWPYAVAPVLAGALWVFMFNPTLGIFPFLLDMVGIDWNHY
FT                   LNGTQAMTLVIFAAAWKQIAYNFLFYLAAMQSIPRSLIEAAAIDGAGPVRRFVDHIFPL
FT                   ISPTTFFLLVINAVYAFFDTFGIIHAVTQGGPANSTTILVYKVYNDGFVGLDLGGSAAQ
FT                   SVILMILVIAMTVVQFRFIERKVEY"
FT   gene            complement(258851..260236)
FT                   /gene="ugpB"
FT                   /locus_tag="SPO0240"
FT   CDS_pept        complement(258851..260236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="SPO0240"
FT                   /product="SN-glycerol-3-phosphate ABC transporter,
FT                   periplasmic SN-glycerol-3-phosphate-binding protein"
FT                   /note="identified by similarity to SP:P10904; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93565"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX31"
FT                   /protein_id="AAV93565.1"
FT                   /translation="MIAFIKLLLELFFPLRNHPPVHEPREVDMTCKFLTLSASALVLTT
FT                   GMAFAQTEIQWWHAMGGTNGERVDKIAADFNASQSEYKVVPTYKGNYTETMTAAVAAFR
FT                   AKEHPHLVQVFEVGTATMMAAKGAIYPVEQLMSDAGEPFDKSDYLPAVISYYQTSEGEL
FT                   LSMPFNSSTPVLWYNADALKAAGVEVPKTWDDMKTAAKALVDSGMDCGFSFGWQSWVMI
FT                   ENYSAWHNIAMGTKENGFAGFDTELSFNNDEVTARLDDIAAMSEGNLFKYGGRRGDSLP
FT                   MFTNGECGMWMNSSAYYGSIKGQAQFEFGQTMLPLDSAVADAPQNSIIGGATLWALAGH
FT                   EAEEYKGLAKFMTYLSSPEVQAWWHQETGYVPITTAAYELSKEQGFYDSNPGTDTAIQQ
FT                   LSLNTPTANSRGIRFGNFVQIRDVINEELEALWAGDKTAAQALAAATERGNALLRKFER
FT                   SAN"
FT   gene            260302..261231
FT                   /locus_tag="SPO0241"
FT   CDS_pept        260302..261231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0241"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93566"
FT                   /db_xref="GOA:Q5LX30"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX30"
FT                   /protein_id="AAV93566.1"
FT                   /translation="MNFKLRQLEAFRAVAQTGSITRAAQQLGISQPAASRLLADFSASV
FT                   EFPLFVREGGSMSPTPESRYMLAEINRVFEGLAHLEELRHNLKDRTAGHLRIACLPGFA
FT                   TSHLPRVLTAFLKDRPGVTVTLEPDRPERILEWIVGQQYDCAITDGFAGHPATESTDIA
FT                   IRTVCILPPGHPLSDRPEITPHDLRGEKIIHSRRDSPFFRRLAQAFTDSEVELSSWIEV
FT                   RQFTTACTIVAEGQGAAVLSALDAEQYRDRGLVIRPFVPRIAHRLSLLRPVTGSLSPLV
FT                   LDFLEAFTASLAPFIDHEERRANPVGAR"
FT   gene            261910..263364
FT                   /gene="rrsA"
FT                   /locus_tag="SPO_Sp16SA"
FT   rRNA            261910..263364
FT                   /gene="rrsA"
FT                   /locus_tag="SPO_Sp16SA"
FT                   /product="16S ribosomal RNA"
FT   gene            263580..263656
FT                   /locus_tag="SPO_tRNA-Ile-1"
FT   tRNA            263580..263656
FT                   /locus_tag="SPO_tRNA-Ile-1"
FT                   /product="tRNA-Ile"
FT   gene            263730..263805
FT                   /locus_tag="SPO_tRNA-Ala-1"
FT   tRNA            263730..263805
FT                   /locus_tag="SPO_tRNA-Ala-1"
FT                   /product="tRNA-Ala"
FT   gene            264255..267149
FT                   /gene="rrlA"
FT                   /locus_tag="SPO_Sp23SA"
FT   rRNA            264255..267149
FT                   /gene="rrlA"
FT                   /locus_tag="SPO_Sp23SA"
FT                   /product="23S ribosomal RNA"
FT   gene            267353..267470
FT                   /gene="rrfD"
FT                   /locus_tag="SPO_Sp5SD"
FT   rRNA            267353..267470
FT                   /gene="rrfD"
FT                   /locus_tag="SPO_Sp5SD"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(267660..269588)
FT                   /gene="dxs"
FT                   /locus_tag="SPO0247"
FT   CDS_pept        complement(267660..269588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SPO0247"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93567"
FT                   /db_xref="GOA:Q5LX42"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX42"
FT                   /protein_id="AAV93567.1"
FT                   /translation="MSDRPHTPLLDQVTRPADLKRFSDAQLTQLAGELRAETVSAVSVT
FT                   GGHLGAGLGVVELTVALHAVFDTPRDKVIWDVGHQCYPHKILTERRDRIRTLRMKDGLS
FT                   GFTKRSESPYDPFGAAHSSTSISAALGFAVARDLGGVTPEGLGDAIAVIGDGSMSAGMA
FT                   FEAMNNAGHLKKRLIVILNDNEMSIAPPVGALSNYLSRLYAEEPFQELKAAAKGAVSLL
FT                   PEPFREGAKRAKEMLKGMAVGGTLFEELGFSYIGPIDGHDMGQLLPVLRTVKARATGPI
FT                   LLHVLTKKGKGYAPAERARDRGHATAKFDVVTGEQKKAPSNAPSYTAVFGKALVDQAAR
FT                   DDKIVAVTAAMPDGTGLNLFAERYPSRCFDVGIAEQHGVTFSAALAAGGLKPFCAMYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGSFDIAYLANLPGMVVMAAAD
FT                   EAELVHMVATAAAHDDGPIAFRYPRGEGVGVEMPELGKVLEIGKGRMIQKGARVALLSF
FT                   GTRLTEVQKAAEALAARGITPTIADARFAKPLDRDLILNLAHDHEALITIEEGAVGGFG
FT                   SHVAQLLADEGVFDHGLKFRSMVLPDIFIDQSSPADMYAVAGMNAPQIEAKVLDVLGIG
FT                   RIGEKRA"
FT   gene            complement(269616..270482)
FT                   /gene="ispA"
FT                   /locus_tag="SPO0248"
FT   CDS_pept        complement(269616..270482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="SPO0248"
FT                   /product="farnesyl diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by similarity to GB:BAA96458.1; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93568"
FT                   /db_xref="GOA:Q5LX41"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX41"
FT                   /protein_id="AAV93568.1"
FT                   /translation="MFHERLAQDAALIQRSFDTVLGALEPLDITRAMAWTTEGGKRLRG
FT                   FLVLESARLHDVDEARAIWPATAIEALHAYSLVHDDLPCMDDDDLRRGRPTAHVKWDEG
FT                   TAVLAGDALHSLAFELCTRPEVGTAETRATLALTLAQAAGARGMVLGQALDIAAETAPK
FT                   PLTLDQITRLQAGKTGALIEWAAAAGAVLAGADPDPLRQYARALGLAFQIADDILDVEG
FT                   DAEKAGKRLQKDAGAGKATFVSLLGLDAAKARARDLVDQGCAALDGYGERAGTLKEAAR
FT                   FVIARDN"
FT   gene            complement(270485..270703)
FT                   /gene="xseB"
FT                   /locus_tag="SPO0249"
FT   CDS_pept        complement(270485..270703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SPO0249"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93569"
FT                   /db_xref="GOA:Q5LX40"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX40"
FT                   /protein_id="AAV93569.1"
FT                   /translation="MSFEQAMKELETVVGQLERGDVALDQSIALYERGAALKKRCEDEL
FT                   KRAEEKVAAITLDSNGQPTGTKPVEGL"
FT   gene            complement(270724..271650)
FT                   /locus_tag="SPO0250"
FT   CDS_pept        complement(270724..271650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0250"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93570"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX39"
FT                   /protein_id="AAV93570.1"
FT                   /translation="MTTALITHADCLTHVTPTGHPERVARLEHVLHALEPLDLRRVTAP
FT                   LAAEDDLLRIHPAGYVADIRDARPDEGFAQIDGDTFLSPGSVDAAFRAAGAVVRAVDMV
FT                   LGGEAQNAFCAIRPPGHHAERETAMGFCLFGNAALAAKHALDHHGLRRVAVVDFDVHHG
FT                   NGTQDLLWDEARALLITSQQMPLWPGSGRPDEDGAHGQIVNIPLAPGTGGAEMRAAYMA
FT                   QAFPRLRAFKPELIIISAGFDAHQDDPLANLNWSTADFAWLTAELCALAQELCQGRIVS
FT                   TLEGGYDLNALAAATRAHVQELIKAAT"
FT   gene            complement(271676..272377)
FT                   /gene="petR"
FT                   /locus_tag="SPO0251"
FT   CDS_pept        complement(271676..272377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petR"
FT                   /locus_tag="SPO0251"
FT                   /product="DNA-binding response regulator PetR"
FT                   /note="identified by similarity to SP:P31079; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93571"
FT                   /db_xref="GOA:Q5LX38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX38"
FT                   /protein_id="AAV93571.1"
FT                   /translation="MSAFDAHLLIVDDDERIRDLLKKFLMRHGFLVTAARDAEHARRIL
FT                   SGLDFDLIVMDVMMPGEDGVSLTRALRQTLSTPILLLTARGETEHRIAGLEAGADDYLA
FT                   KPFEPRELLLRINAILRRVPDTSAQDAAPKFLQLGPIRYDIERGEMWQGDQLVRLTATE
FT                   NQLMKIFAARPGEAITRTKLVEDLGRDRGQAQERAVDVQITRLRRKIEPNPKQPRYLQT
FT                   VRGAGYMLAPD"
FT   gene            complement(272374..272886)
FT                   /gene="petP"
FT                   /locus_tag="SPO0252"
FT   CDS_pept        complement(272374..272886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petP"
FT                   /locus_tag="SPO0252"
FT                   /product="transcriptional regulator PetP"
FT                   /note="identified by similarity to SP:P31078; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93572"
FT                   /db_xref="GOA:Q5LX37"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX37"
FT                   /protein_id="AAV93572.1"
FT                   /translation="MSEARPSPVFGGESLLFLTDEQLRQGIEAMFFAYRGFTADPDRIL
FT                   AEMAYGRAHHRAIHFINRAPGTTVNNLLAILGVTKQSLNRVLRTLIADGLVESRVGTQD
FT                   KRERHLFLTEAGAALEAKLSDAQRARMRAAYKEAGPEAVTGFRQVLEAMMDREMHRAYA
FT                   KLRDSGS"
FT   gene            273044..273910
FT                   /gene="ilvE"
FT                   /locus_tag="SPO0253"
FT   CDS_pept        273044..273910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="SPO0253"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by similarity to SP:P00510; match to
FT                   protein family HMM PF01063; match to protein family HMM
FT                   TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93573"
FT                   /db_xref="GOA:Q5LX36"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX36"
FT                   /protein_id="AAV93573.1"
FT                   /translation="MASYDDRDGVIWMDGELVDWRDAKVHILTHAMHYASSVFEGERAY
FT                   NGKIFKSREHSERLVASAQALDMPMPYTVDQIEAAKEETLKASGLTDAYVRALVWRGSG
FT                   EDMGVASARNPVRMAIAVWPWGAYYGDAKMQGAKLDIAEWKRPSPETIPVHAKAAGLYM
FT                   ICTISKHKAEAKGCSDALFMDWRGYVAEATGANVFFVKDGEVHTPLADCFLNGITRQTV
FT                   IGMLKDKGITVHERRIKPEEMEGFEQCWLTGTAAEVTPVGQIGPYTFEVGQMTRDIAAE
FT                   YEALVRA"
FT   gene            complement(273966..274406)
FT                   /gene="ohr"
FT                   /locus_tag="SPO0254"
FT   CDS_pept        complement(273966..274406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="SPO0254"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /note="identified by similarity to GB:AAC38562.1; match to
FT                   protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93574"
FT                   /db_xref="GOA:Q5LX35"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX35"
FT                   /protein_id="AAV93574.1"
FT                   /translation="MEPQMTVSPVYTAHARATGGRNGQAQVAESGLDLVLATPPAMGGN
FT                   GKGHNPEQLFAAGYAACYIGAMQFATTQDKTLAKVPADISVDAEVGIGPRAEGGFGLTV
FT                   ALKVSMPGVDAAEAQRIADAGHAICPYSNATRGNIVVTTEIA"
FT   gene            274505..274942
FT                   /locus_tag="SPO0255"
FT   CDS_pept        274505..274942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0255"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93575"
FT                   /db_xref="GOA:Q5LX34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX34"
FT                   /protein_id="AAV93575.1"
FT                   /translation="MLDRALTLDELLCFSLYSANHAMGRLYRPLLARFDLTYPQYLVLV
FT                   ALWQRDGRKVSALGAELQLESNTLTPLLKRMEAAGLIRRARNPEDERSVIVTLTDKGRG
FT                   LEGEAAEISNCILAAADADIAELAELRDRLHRLTARLREAG"
FT   gene            complement(274955..275284)
FT                   /locus_tag="SPO0256"
FT   CDS_pept        complement(274955..275284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0256"
FT                   /product="copper-binding protein, plastocyanin/azurin
FT                   family"
FT                   /note="identified by match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93576"
FT                   /db_xref="GOA:Q5LX52"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX52"
FT                   /protein_id="AAV93576.1"
FT                   /translation="MRLTRRQVCFGAGGAIVGSALPASGSTPVVVDIRSFVFEPAEITI
FT                   RAGETIVWINHDFAPHTATDDEVNWDTGELEKDAQAAIRFDTPGTYPYFCAYHPHMTGT
FT                   VIVTA"
FT   gene            complement(275275..275799)
FT                   /locus_tag="SPO0257"
FT   CDS_pept        complement(275275..275799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:A96030"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93577"
FT                   /db_xref="GOA:Q5LX51"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX51"
FT                   /protein_id="AAV93577.1"
FT                   /translation="MKTLTLAAAIAVGFVAQSASAADKMNDLEIAHTAYTAGQLDIRYA
FT                   HLALAVSDNAEVRAFAETMIRDHTAVNAAAGDLITKLNVTPQDNDLSRTLVKGAADKRA
FT                   ELISLSGKAFDCAYAQNELGYHQVVNKTVEGVFIPAVTVEPLKDLLSDALVTFKVHEGH
FT                   AEQMVNGLQCG"
FT   gene            275937..276917
FT                   /locus_tag="SPO0258"
FT   CDS_pept        275937..276917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0258"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93578"
FT                   /db_xref="GOA:Q5LX50"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX50"
FT                   /protein_id="AAV93578.1"
FT                   /translation="MLDLLSDILTRLSLKGTLYFRTSFTPPFGVHVPSYQNVARFHFAY
FT                   RGECMVHVPAANETLRLTQGDLVLIPHGAEHMLMCQHSRPDSALPLDTVLSRSGYRGEG
FT                   VLVYGGDEEDQDTQLICGHLTYGMHGRSCPGHTLLERLPPYILIRDYGEERGVWLEATL
FT                   RVIAAEAGRDRMGSDLIALKMTEALFAQAIRAHLETVSPDDGALAGFADPNLSRALSAF
FT                   HREPAKDWTVEGLARIAGQSRTGFAQHFAAKMGMTPMQYLTSWRMQIACEGLVDSRLSV
FT                   ADAAELAGYASEAAFSRVFRKQLGVSPAAYRQQFESAKRQALAAS"
FT   gene            276985..277395
FT                   /locus_tag="SPO0259"
FT   CDS_pept        276985..277395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0259"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GB:CAE32384.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93579"
FT                   /db_xref="GOA:Q5LX49"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX49"
FT                   /protein_id="AAV93579.1"
FT                   /translation="MPPSGGSTNLIRTPIMSIRFVTRTVHAYLDYPVALALMGLPVILG
FT                   LGAENPMALWLSVITGFAAFVLTLLTDHHLGVWRVLPYKFHLAVDLTVGIVFLLAPSLF
FT                   GFSGLDALFYWVNGAAVVTVISLSTPEQKPAM"
FT   gene            277569..279137
FT                   /locus_tag="SPO0260"
FT   CDS_pept        277569..279137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0260"
FT                   /product="alkaline phosphatase, putative"
FT                   /note="identified by similarity to SP:P42251; match to
FT                   protein family HMM PF00245; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93580"
FT                   /db_xref="GOA:Q5LX48"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX48"
FT                   /protein_id="AAV93580.1"
FT                   /translation="MTRLLRPSRRAFLAGGTAFTATLAMPSISRAASRPVFTHGVQSGD
FT                   VDTMSGMIWTRTDRPAKVMMEVSSTESFADARRLSPMFATPESDFAVKRLVDNLPADQE
FT                   VFYRFVAADLDDISAVSEPLMGRFRTAPTARRDIRFAWSGDTAGQGWGIDDEGMRTYAT
FT                   MAQHQPDFFIHSGDTIYADGPMKDEVEKDGAVIWKNTTLIDEKRKVAETLAEFRGQWKY
FT                   NLMDEHVQAMNALCPTFFQWDDHEVVNNWSDAKDLSADDRYTEKSVHVLQSRAARAFHE
FT                   MTPLRITPAEPGRVYRKISYGPMLDVFFLDLRSYRGPNGASMEDEITDQSRILGAEQLA
FT                   WIKRELAASTATWKVIASDMPIGLIVWDNWKEKAGAEAISNGDHGPAKGRELEIADLLR
FT                   FIKSAGVRNTVWFTADVHYTAAHHYSPERAQFQDFDPFWEFVSGPLHAGTFGPNDLDRT
FT                   FGPEVKFVKAPTPEQGVNLPPSMGLQFFGLVDIDAASQQMKVRLMDRGNTELWSVTLDP
FT                   VLSAI"
FT   gene            complement(279220..280086)
FT                   /locus_tag="SPO0261"
FT   CDS_pept        complement(279220..280086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0261"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93581"
FT                   /db_xref="GOA:Q5LX47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX47"
FT                   /protein_id="AAV93581.1"
FT                   /translation="MSRQAENLSGSLYMVAAMGAFALEDMFVKSATAVLPVGQVLILFG
FT                   LGGMGIFALLARWRGEAAFVRPDRTLAIRSSFEVMGRICYTLALALTPLTSTSAILQAT
FT                   PLVVAMGAALFLGETVGWRRWVAILIGLAGVLLILRPGMQGFVPASIFAVLGMIGFAGR
FT                   DLATRAARPRLSNAQLGVYGFGALVVSGVLALVWTGGATLPDAHTALQLGAAILFGVLA
FT                   YECLTRAMRRGEISVIAPFRYSRLVFAMILGIVVFGETPDAATWIGSAIIVAGGIYNIL
FT                   REGRSRR"
FT   gene            complement(280092..280691)
FT                   /gene="cobO"
FT                   /locus_tag="SPO0262"
FT   CDS_pept        complement(280092..280691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="SPO0262"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572;
FT                   match to protein family HMM TIGR00708"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93582"
FT                   /db_xref="GOA:Q5LX46"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX46"
FT                   /protein_id="AAV93582.1"
FT                   /translation="MTDAQDHKEKMKAVQAEHRKKVSEAVDPGRGLVLINTGKGKGKSS
FT                   AAFGVVIRALGWGQKVAVVQFIKGKWKTGERRFFEEHNLVTWHTMGEGFTWDTQDRDRD
FT                   IAAATAAFGKARELMESGDYDLVVLDEINIALRYEYLSVDTVLDGLQARSDRTSVFLTG
FT                   RDAPQALRDYADLVTEMTVEKHPFEAGIKAQRGVDF"
FT   gene            complement(280748..281791)
FT                   /locus_tag="SPO0263"
FT   CDS_pept        complement(280748..281791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0263"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93583"
FT                   /db_xref="GOA:Q5LX45"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX45"
FT                   /protein_id="AAV93583.1"
FT                   /translation="MTADSQTCFCVCTMAVTVTNNQAIDLSRAKAQGRAMAKPLTSHRP
FT                   ILAVSLKLGALVLFTSMSALIKVLSADFPAGEMVFFRSLFAIPVIILWLLARGELRQGL
FT                   IVKKPMGHFWRGVLGTGAMGLTFTGLGLLPLPEVTAIGYATPIFTLILAALMLGETIRL
FT                   VRIGAVALGLLGVLIMLWPRLGTGASLDQAATIGALCVLAATVARAFVQIHIRQLVQVD
FT                   HAAAIVFYFSLTATLLSGLTAFFGWVTPTPEQAAILILTGLVGGVAQILVTSSYRFGQA
FT                   SMLAPYDYASMLFAIIIGYIWFDEWPTLVMLAGAMLVIAGNVVVIWRERQLGLERGKAR
FT                   SVTDPKG"
FT   gene            281790..283121
FT                   /locus_tag="SPO0264"
FT   CDS_pept        281790..283121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0264"
FT                   /product="CaiB/BaiF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93584"
FT                   /db_xref="GOA:Q5LX44"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX44"
FT                   /protein_id="AAV93584.1"
FT                   /translation="MDQIASAFGPQGFDVQGEGTWPSRFAVTDLATRCFGAVGAALGAV
FT                   IEARGLGPRPAISVDRRLASLWYSWSIHPQGWQMPGAWDAIAGDYAAADGWIKLHTNAP
FT                   HHRAAALSVLGCGAERATVAEAVRGWQADTLEAAIVGAGGAAAAMRSRAAWLAHPQGAA
FT                   VAAEPLVHWATRAGVLRDFGGTRARPLAGLRVLDLTRVLAGPVATRTLAGYGAEVLRID
FT                   PPSWSEPGVVPDVTLGKTCAHLDLKQAADRARFEALLAGADVLVHGYRPGALDALCSPE
FT                   RRLALAPNLIEVSLCAYGWTGPWAGRRGFDSLVQMSCGIAEAGMGWAGADQPHPLPVQA
FT                   LDHATGYLMAAAVLTALARAARGEGVSAARLSLARTAELLCGLETGEEGPAITGSTPED
FT                   LSDWDEQTSWGPARRLKPALSVEGAEMRWDSAACELGSSPAAWR"
FT   gene            complement(283122..284063)
FT                   /locus_tag="SPO0265"
FT   CDS_pept        complement(283122..284063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0265"
FT                   /product="auxin efflux carrier family protein"
FT                   /note="identified by similarity to GB:AAA99820.1; match to
FT                   protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93585"
FT                   /db_xref="GOA:Q5LX43"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX43"
FT                   /protein_id="AAV93585.1"
FT                   /translation="MSQILTITFPIYAALAVGFLVVRQGWFSSADMRVLGRYVMDIALP
FT                   ALLFNAVASRDVAEVFHPGYMLAFAAAGLATVALSYLWFTLTGTEARRRAVAVMGSSCP
FT                   NSGFVGYPVMLLTFPDLAGVILALNMLVENVLIIPACLILTDMARGRGQGGIGQRIAGI
FT                   LWGVLKRPMVIGLLLGLAVSLAGVPVPQTVTRLMQMLAASASALALVVIGGSLAGLSWK
FT                   GSRWHAVQISALKLLLHPALALLAVILVAAIGLPLDPDMGTALILSAAMPMFGIYAVLA
FT                   QELGHEGMASIALLTATTLAFFTLSGLLWWLT"
FT   gene            complement(284060..284764)
FT                   /locus_tag="SPO0266"
FT   CDS_pept        complement(284060..284764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0266"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93586"
FT                   /db_xref="GOA:Q5LX61"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX61"
FT                   /protein_id="AAV93586.1"
FT                   /translation="MTTCFCTGARSGPTVAISADLHQALRGIVAQRMATDPAHDLAHLD
FT                   RVWVNVQAIASPGADRDVLLAASYLHDLVNLPKNAPDRHTASRRSADEAAPILRDLGFD
FT                   EAQIAATGHAIAAHSFSAGISPESEEARILRDADRLDALGAIGIARNFSVSGSLGRALY
FT                   DPADPFCERRTPDDALYSLDHWRVKLLSLPQGMLTDKGRALAEARIALMLRFLDDFAAE
FT                   IGTPLPEGWTRG"
FT   gene            complement(284706..285806)
FT                   /gene="aroC"
FT                   /locus_tag="SPO0267"
FT   CDS_pept        complement(284706..285806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="SPO0267"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by similarity to SP:P12008; match to
FT                   protein family HMM PF01264; match to protein family HMM
FT                   TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93587"
FT                   /db_xref="GOA:Q5LX60"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX60"
FT                   /protein_id="AAV93587.1"
FT                   /translation="MSMNSFGHLFRVTTWGESHGPALGATVDGCPPGVPIEEAMIQHWL
FT                   DRRKPGQNKYTTQRREADEVKILSGVFEGQTTGTPVQLMIENTDQRSKDYGDIKDKFRP
FT                   GHADITYFQKYGIRDYRGGGRSSARETAARVAAGGLAREAIRALAPNAQITGYMVQMGP
FT                   HRIDRARFDWAQIEQNPFWVPDAQAASDWADYLDGLRKSGSSVGAVIEVVARGVPAGLG
FT                   APVYGKLDTDLAAAMMSINAVKGVEIGEGMAAAELTGEANADEIFMGQNGPQYSSNHAG
FT                   GILGGISTGQDIVVRFAVKPTSSILTTRKTITKSGEETEIITKGRHDPCVGIRAVPVGE
FT                   AMMACVILDHLLLHRGQIGANRGHIG"
FT   gene            complement(285959..286696)
FT                   /gene="ribH-1"
FT                   /locus_tag="SPO0268"
FT   CDS_pept        complement(285959..286696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH-1"
FT                   /locus_tag="SPO0268"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to SP:P50856; match to
FT                   protein family HMM PF00885"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93588"
FT                   /db_xref="GOA:Q5LX59"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX59"
FT                   /protein_id="AAV93588.1"
FT                   /translation="MHDGPPVAPISSCSGERSLASSVSFSGRGEIPHRRYAGLDPASPR
FT                   AAPAHVRGVSRSGERPEPTVTVRMKENARPGHASACARPFVIALGDVSKHKEITMTHTR
FT                   YAFIKANWHADIVDRALEGFLELIPPEQVDVYDVPGAFEMPLLARDLAQTGRYAAVACA
FT                   AFVVDGGIYRHDFVAQAVVDGLMRAGLDTGVPILSVSLTPHQYQETDHHNAIFRAHFVD
FT                   KGREAARAALQITATRSKLAQAA"
FT   gene            286691..287305
FT                   /locus_tag="SPO0269"
FT   CDS_pept        286691..287305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0269"
FT                   /product="negative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93589"
FT                   /db_xref="GOA:Q5LX58"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX58"
FT                   /protein_id="AAV93589.1"
FT                   /translation="MHPNPAFRGESVARNLEFARDRGFGVLAVAVDGAPLISHVPFLVS
FT                   GDGSEVELHLVRSNPIVQALKSPLPARIAVSGPDGYISPDWYGVADLVPTWNYVAVHLA
FT                   GELDLRPESELPGLLDRLSARFEKQLLPKPAWTRAKMTPGAFDRMLRMIVPCRMRVSDV
FT                   QGTWKLGQNKPEAARMGAAEGVAASTIGTELETLAVLMRGA"
FT   gene            287383..287994
FT                   /locus_tag="SPO0270"
FT   CDS_pept        287383..287994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0270"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93590"
FT                   /db_xref="GOA:Q5LX57"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX57"
FT                   /protein_id="AAV93590.1"
FT                   /translation="MKLYYSPTSPYVRKVMVLLHESGQLDDVDLDTAGGTPLAPAEALV
FT                   GKNPLAKVPALERPDGPTLFDSRVICAYLDARGGAGFYPDGARRWDVLTLEALADGMLD
FT                   AALLITYEARLRPEDKRWDSWTDSQWDKIARACSALEERWMAHLSGPLDMGQIAVGCAL
FT                   GYLDLRHDARGWREGHPALAAWFAGFESRPSMMATRPPAG"
FT   gene            288197..288760
FT                   /gene="petA"
FT                   /locus_tag="SPO0271"
FT   CDS_pept        288197..288760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="SPO0271"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR01409; match to protein
FT                   family HMM TIGR01416"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93591"
FT                   /db_xref="GOA:Q5LX56"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX56"
FT                   /protein_id="AAV93591.1"
FT                   /translation="MSHAEDHEGTRRDFLYYATAGAGVVTTGAAVWPLVNQMNPSADVQ
FT                   ALSSIRVDISGVEVGTQISVKFLGKPVFIRRRTQAEIDEARAVDLSDLIDNDSRNPNLS
FT                   GGGDGGDENRSLDENGEWLVMMGVCTHLGCVPLGDGAGDFHGWFCPCHGSHYDTSGRIR
FT                   KGPAPENLHIPVAEFVDENTIKLG"
FT   gene            288773..290101
FT                   /gene="petB"
FT                   /locus_tag="SPO0272"
FT   CDS_pept        288773..290101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="SPO0272"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome B"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P05418; match to
FT                   protein family HMM PF00032; match to protein family HMM
FT                   PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93592"
FT                   /db_xref="GOA:Q5LX55"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX55"
FT                   /protein_id="AAV93592.1"
FT                   /translation="MAGIPHDHYEPKTGAEKWLNSRLPIVGLIYDTIMIPTPKNLNWWW
FT                   IWGIVLAFCLALQIVTGIVLVMHYTPHVDMAFASVEHIMRNVNGGYMLRYLHANGASLF
FT                   FVAVYIHIFRGLFYGSYKAPREITWIVGMLIYLCMMGTAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAIPFVGEAIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVIVHIWAFHTTGNN
FT                   NPTGVEVRRGSKAEAEKDTLPFWPYFVIKDLVGLAIVLVIFWAIVGFMPNYLGHPDNYI
FT                   EANALVTPAHIVPEWYFLPFYAILRAFTSEVWVVQIASFVTGGIIDAKFFGVLAMFGAI
FT                   LAMALAPWLDTSSVRSGKYRPMFKWWFYLLIIDFFALMWLGAMPAEEPYASFSLIASAY
FT                   WFGYFFVILPILGVIEKPLPQPATIEEDFNAHYGTASDATPAE"
FT   gene            290120..290983
FT                   /gene="petC"
FT                   /locus_tag="SPO0273"
FT   CDS_pept        290120..290983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="SPO0273"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:Q02760; match to
FT                   protein family HMM PF02167"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93593"
FT                   /db_xref="GOA:Q5LX54"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX54"
FT                   /protein_id="AAV93593.1"
FT                   /translation="MFKKLAIGAAFALALAPVASHAAGGGEQHIEDFQFSFEGPFGTYD
FT                   QNQLQRGLQVYTEVCAACHGLKYVPLRTLGDEGGIGWTDEQVRAYASETFSVYDPELED
FT                   DRPAIPTDHFPANTGAGAPDLSLMAKARAGFHGPYGTGVNQLVRGMGGPEYIFSILTGY
FT                   EDPPACAPEEMDGYYNVAFAPGGYPDECKIFDDEGVEIGRKAPGSWISMAPPISDEQVE
FT                   FADGHANDLHHMSADVSAFLMWAAEPKMMARKQAGLVGVIFLTILASMLYLTNKRLWAP
FT                   HKGKKH"
FT   gene            291065..291460
FT                   /locus_tag="SPO0274"
FT   CDS_pept        291065..291460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC74098.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93594"
FT                   /db_xref="GOA:Q5LX53"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX53"
FT                   /protein_id="AAV93594.1"
FT                   /translation="MRRAFRPISRRLFRRSKPRSHGSGAGCMASFGTDGGWSACRNFRR
FT                   CPMKPFALIAALALAASPVLALDLTTDTQLGSTPDEIRTSLKDLGYDVRKIEDEDGKIE
FT                   AYVVKDGKMAEVYVDPKTGKISKIEME"
FT   gene            291467..292033
FT                   /locus_tag="SPO0275"
FT   CDS_pept        291467..292033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0275"
FT                   /product="cytochrome b, putative"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93595"
FT                   /db_xref="GOA:Q5LX69"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX69"
FT                   /protein_id="AAV93595.1"
FT                   /translation="MAGTPGGREGAREIRVWDPLVRLTHWGVALGVLVNSALTDPDGAL
FT                   HEQVGYGVLALVVLRLLWCIVGPKPARFSAFPPSPAAALGHLRAMLRGERKVHLSHNPL
FT                   GALMVYNLWLTLLALSATGIMMGTVTFFGVDWVEELHEAAFGWLMFSVALHVGGVLFDQ
FT                   WRTGVPLARAMVTGRKRIQAERLDG"
FT   gene            292054..292551
FT                   /locus_tag="SPO0276"
FT   CDS_pept        292054..292551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0276"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93596"
FT                   /db_xref="GOA:Q5LX68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX68"
FT                   /protein_id="AAV93596.1"
FT                   /translation="MRPGDADERRAAILAWMIVLQALCALFFIGDVLADLRAGNDDTGT
FT                   HLWLEGSVALVLCIGLGVLMYELRQLLMRMERVTTTLRAARGEMAEVIEGFFADWGLTP
FT                   AERDVALMILKGLDNDSIATVRGRAAGTVRAQSAAIYAKAGVDGRTQFLSLFMEELLAD
FT                   PD"
FT   gene            complement(292631..293887)
FT                   /locus_tag="SPO0277"
FT   CDS_pept        complement(292631..293887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0277"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01579"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93598"
FT                   /db_xref="GOA:Q5LX67"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX67"
FT                   /protein_id="AAV93598.1"
FT                   /translation="MSAPKFTTLGCRLNAYETEAMKELSAQAGLDNAVIVNTCAVTAEA
FT                   VRKARQEIRRLRRENPTARLIVTGCAAQTEPETFTAMAEVDAVIGNTEKMRPETWKSMT
FT                   ADFIGETEAVQVDDIMSVTETAGHLIDGFGTRSRAYVQVQNGCDHRCTFCIIPYGRGNS
FT                   RSVPAGVVVDQIKRLVDRGYNEVVLTGVDLTSWGADLPAQPKLGDLVMRILRLVPDLPR
FT                   LRISSIDSIEVDENLMQGIATEPRLMPHLHLSLQHGDDLILKRMKRRHLRDDAIRFAEE
FT                   ARRLRPEMTFGADIIAGFPTETEAHFENSLKLVDDCHLTWLHVFPYSRREGTPAAKIPS
FT                   QVNGKIIKERAARLRAAGDRRVALHLAEQVGRSHRILMESPHMGRTEQFTEVHFDTPQP
FT                   EGQIVTTTITGTSGNALTA"
FT   gene            complement(293884..294693)
FT                   /gene="dapF"
FT                   /locus_tag="SPO0278"
FT   CDS_pept        complement(293884..294693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="SPO0278"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by similarity to SP:P08885; match to
FT                   protein family HMM PF01678; match to protein family HMM
FT                   TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93597"
FT                   /db_xref="GOA:Q5LX66"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX66"
FT                   /protein_id="AAV93597.1"
FT                   /translation="MTFMKMHGLGNDFVVVDARLHPVRITGALARGIAHRHLGVGFDQL
FT                   AVIEPGKGDAHLVFYNADGSTSAACGNATRCIARHLMDETGKTELHLTTDRGDLYARDA
FT                   GDGLTSVNMGAPQLLWHEIPLAEEMDTLELPIEGGPTATGMGNPHCTFFVADAEAIPLA
FT                   EFGARYEHHPLYPQRTNLQVAQITGPDRIRMRVWERGVGITLASGSSSCATAVAAARRG
FT                   LTGRKVQIDLDGGTIWIDWREDGVWMTGPTMHVFSATLTPEFLASLG"
FT   gene            294934..295009
FT                   /locus_tag="SPO_tRNA-Lys-2"
FT   tRNA            294934..295009
FT                   /locus_tag="SPO_tRNA-Lys-2"
FT                   /product="tRNA-Lys"
FT   gene            295170..295337
FT                   /locus_tag="SPO0280"
FT   CDS_pept        295170..295337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0280"
FT                   /product="transposase, truncation"
FT                   /note="identified by similarity to GB:AAC43509.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97111"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX65"
FT                   /protein_id="AAV97111.1"
FT                   /translation="MRLPQMHRWAAIEIMFSGLKEWRPAATRYDRCPKVFLSASVPAAT
FT                   VLYRPRVLVL"
FT   gene            complement(295450..295923)
FT                   /locus_tag="SPO0281"
FT   CDS_pept        complement(295450..295923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC93558.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93599"
FT                   /db_xref="GOA:Q5LX64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX64"
FT                   /protein_id="AAV93599.1"
FT                   /translation="MNTLKSFIGGVALSLTLAGSAMAAGVDLNASSTGLALQGYDPVAY
FT                   FTVGEATEGDWKITAVYDDATYRFANAENKATFEANPEAYLPAYGGYCAFGAAMGFKFD
FT                   GDPDNWKIVDDKLYLNLSDEIQAKWEEDVPGFIVKANANWTDIADKAPAELQN"
FT   gene            complement(296104..296379)
FT                   /locus_tag="SPO0282"
FT   CDS_pept        complement(296104..296379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93600"
FT                   /db_xref="GOA:Q5LX63"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX63"
FT                   /protein_id="AAV93600.1"
FT                   /translation="MNLQELALARLRDWPLGTTIGLSGGRRYAVSKSAYASGRSIKLVA
FT                   TELGGTDYISLNLYELAQAPRLAPCEMPLAKVLAFLSELRPEGKQA"
FT   gene            complement(296376..296987)
FT                   /locus_tag="SPO0283"
FT   CDS_pept        complement(296376..296987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0283"
FT                   /product="putative protein TIGR00023"
FT                   /note="identified by similarity to GB:CAE28560.1; match to
FT                   protein family HMM PF02660; match to protein family HMM
FT                   TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93601"
FT                   /db_xref="GOA:Q5LX62"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX62"
FT                   /protein_id="AAV93601.1"
FT                   /translation="MPAFDTPAMMLILWAVIGYGLGSIPFGLILTRAMGMGDLRQIGSG
FT                   NIGTTNVLRTGNKGAAALTLLLDGGKGAVAVLLARAFAGEDAAQVAALAAFVGHCYPIW
FT                   LGFKGGKGVATFLGLWLALAWPVGVACCLSWLAGAAVTRISSMGALVAAASSTFWLVLL
FT                   DQGAGFVLGIVLTLMVFWRHRANIARLKARTEPKIGQKSA"
FT   gene            complement(296987..298276)
FT                   /locus_tag="SPO0284"
FT   CDS_pept        complement(296987..298276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0284"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by similarity to SP:P46538; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93602"
FT                   /db_xref="GOA:Q5LX78"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX78"
FT                   /protein_id="AAV93602.1"
FT                   /translation="MSNILFTNARLIDPEAGTDRIGWLRVTGGRIVATGEDSPQGLEEP
FT                   PAETLDCGGKCLAPGIVDIGVKVGEPGERHKESYKSAGQAAAAGGVTTIITRPDTNPAI
FT                   DTPEALEFVTRRAQADTPVNVLPMAALTKGRQGREMTEIGFLLDAGAVAFTDCDHVVTN
FT                   TKVFSRALTYAKSCGALVIAHPQDPGLSEGAAATSGKFAALYGLPAVSPMAERMGLDRD
FT                   IALLEMTGAKYHADQITTARALPALERAKKNGLDITAGTSIHHLTLNELDVSGYRTFFK
FT                   VKPPLRSEDDRQAVIEAVRTGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAA
FT                   LRLYHAGQLDLPTLFRAMALNPARRLGLASGRLGAGAPADLVLFDPDVPFVLDRFTLKS
FT                   KSQNTPFDGQRMQGRVLATYVAGQAVYRRD"
FT   gene            complement(298273..298659)
FT                   /locus_tag="SPO0285"
FT   CDS_pept        complement(298273..298659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93603"
FT                   /db_xref="GOA:Q5LX77"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX77"
FT                   /protein_id="AAV93603.1"
FT                   /translation="MADPVIRFVADRQAYLRNHTWMAAIAMGGAMAVLWALGNPYIWTG
FT                   APAGLAAIALRGWYLASEELAVVWEISEDTLSGPGPRVPLSQIEIVRTMGSYVQVITKG
FT                   GDKHLIKYQADPAATKAAIERAMT"
FT   gene            complement(298644..299168)
FT                   /locus_tag="SPO0286"
FT   CDS_pept        complement(298644..299168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93604"
FT                   /db_xref="GOA:Q5LX76"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX76"
FT                   /protein_id="AAV93604.1"
FT                   /translation="MTRLDVSATEHGVIRLYSLDMRPEEARFLQEPGAVAQFLGVETLD
FT                   MDHVEVFPVADLEELGLDGYLAEGLGVPEDQFDRAALRARTGWVLMLRSRAFGGRALDL
FT                   PLPAVMTLIGTYREAGTDWSGTLIKTASALPHSAPRLSPREARRKARNIGFTMFAIIMS
FT                   LIIAGLAWLIL"
FT   gene            complement(299165..300100)
FT                   /gene="pyrB"
FT                   /locus_tag="SPO0287"
FT   CDS_pept        complement(299165..300100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="SPO0287"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93605"
FT                   /db_xref="GOA:Q5LX75"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX75"
FT                   /protein_id="AAV93605.1"
FT                   /translation="MSFAHRHLLGIEQLSPADITAILDLAETYVALNRQSAKHSDVLSG
FT                   LTQINMFFENSTRTQASFELAGKRLGADVMNMSMQASSIKKGETLIDTAMTLNAMHPDL
FT                   LVVRHPHSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICG
FT                   DIAHSRVARSNLILLGKMENRIRLIGPPTLVPAQFAEFGAEVYDDMREGLKDVDVVMML
FT                   RLQRERMDGGFIPSEREYYHRYGLDREKLGLAKPDAIVMHPGPMNRGVEIDGTLADDIN
FT                   RSVIQEQVEMGVAVRMAAMELLARNLREAT"
FT   gene            300846..301631
FT                   /gene="udgA"
FT                   /locus_tag="SPO0288"
FT   CDS_pept        300846..301631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="SPO0288"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to GB:CAD29336.1; match to
FT                   protein family HMM PF03167; match to protein family HMM
FT                   TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93606"
FT                   /db_xref="GOA:Q5LX74"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX74"
FT                   /protein_id="AAV93606.1"
FT                   /translation="MESALDPHTALALLQWQVELGVTETILDAPLDRYALPETAPRPPA
FT                   QAAADPRRPAMPAPPPKAPEVDPAQEAVRAARAVGSLDALRTALAEFEHCELKRGARNL
FT                   VFADGVPGARVMIIGEAPGRDEDREGRPFVGRAGQLLDRMLAAIGLSRSESVYITNVLP
FT                   WRPPQNRDPLPVEIGMMKPFLERHVALAKPEVLVLMGNISCETVLGRRGITRLRGQWTQ
FT                   AMGLPVLPMFHPAYLLRQPQMKRQAWADLLELQAKLRES"
FT   gene            301631..302230
FT                   /locus_tag="SPO0289"
FT   CDS_pept        301631..302230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0289"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93607"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX73"
FT                   /protein_id="AAV93607.1"
FT                   /translation="MRILAFSDLHMARARAADLVAASLEADLVIGAGDYCNGRQGLDQA
FT                   MAMLAGIMVPLVLVPGNAESADELRAAAPDGAHVLHGSGVRIDGLRLFGLGYGVPPTPF
FT                   GDWSCDLTEGAAAELLDRCTGADILITHSPPKGIGDVTSTGLSVGSTEIRDAIERVQPR
FT                   LALCGHIHDSWGAEGMIGRSRVVNLGPTVNWFEVPA"
FT   gene            302227..302847
FT                   /locus_tag="SPO0290"
FT   CDS_pept        302227..302847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0290"
FT                   /product="transmembrane amino acid efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93608"
FT                   /db_xref="GOA:Q5LX72"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX72"
FT                   /protein_id="AAV93608.1"
FT                   /translation="MIDPVTLLTFVPAALALNLTPGADMMFCLGQGLRAGPRAGWAASA
FT                   GISAGGMVHVSIAGLGLGAAVQAMPWLFDVIRWVGVAYLLWLAWGALRQEFGTSEAPIR
FT                   PARRAFRDGMLVNLTNPKVILFVLAFIPQFIDPAAGPILAQFLVFGVVIAIGGFIVNGM
FT                   VGQFAGGLGRRLTGDPRLGRVLSRLTAGIFAALALRLALLERT"
FT   gene            302852..303394
FT                   /locus_tag="SPO0291"
FT   CDS_pept        302852..303394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0291"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="identified by similarity to SP:P30746; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93609"
FT                   /db_xref="GOA:Q5LX71"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX71"
FT                   /protein_id="AAV93609.1"
FT                   /translation="MSRIDESLDFIPVRIAVLTVSDTRSIEEDRSGQTLVDRIARAGHL
FT                   LADRRIVRDERAQIADQLRAWVADPEIDVIISTGGTGLTGRDVTVEAHRDVYEKEIEAF
FT                   ATVFTLISMEKIGTSAVQSRATGGVAGGTYLFALPGSPGACKDAWDGILEKQLDYRHRP
FT                   CNFVEIMPRLDEHLRRK"
FT   gene            303491..304948
FT                   /locus_tag="SPO0292"
FT   CDS_pept        303491..304948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0292"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93610"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX70"
FT                   /protein_id="AAV93610.1"
FT                   /translation="MRFLRQSLLGVFLASVALALLIWAGQLVIEAVQARMAGDRKPPAA
FT                   RERVFAVNVQRAEYGTVTPVLEAFGQIQSRRTLELRAAMGGRVIDLSDNFVEGGTVAMG
FT                   EVLVRIDPAKPQTELDRARSDLMDAEAEERDAARALILAGDELQAAADQSALRAQAMKR
FT                   QQNLVERGVGSAAAAETAELADAQARQAVLARRIAVAQAEARVDQAATRLARAQLALEQ
FT                   AERDLTETEVTARFDGTLSGVTLVEGRLVAVNEKLAELVDARALEVVFRVSTAQHTRLL
FT                   DAAGRLIGAPVEIELDVAGADLTATGTISRDSAAAGEGQSGRVIYARLDAAPGFKPGDF
FT                   VTVRVEEPPLADVVRLPASALDAAGTVLVLDSEDRLEQLPVTLIRRQGDAVLIRGEGLA
FT                   GREVVLGRTPLLGPGIRVRPLRDEAQAGSPDLSMLELSDERRARLVALVEANERMPSEV
FT                   KAKVLGQLAETRVPARLVARLEDRAGG"
FT   gene            304955..308356
FT                   /locus_tag="SPO0293"
FT   CDS_pept        304955..308356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0293"
FT                   /product="transporter, AcrB/AcrD/AcrF family"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93611"
FT                   /db_xref="GOA:Q5LX87"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX87"
FT                   /protein_id="AAV93611.1"
FT                   /translation="MVRGIPSAAGGLLSYFTRHRTVANLLLMVLLVLGAAAIPNMRAQF
FT                   FPDVIVQSVSVNVEWEGAGPEDVDSAIVQVLEPALLAVDGVESTTASSREGRADIELEF
FT                   EPGWDMSQAADDVQAAVDAVTTLPEDAEDPSVRRGAWRDRVTDVVITGPVGPQQLALFT
FT                   DELVVRLFEIGVTRTTIRGIAAPRTVVEVSSAKLIANDISMNEIATAIAAEVTGDPAGD
FT                   VSGANARIRTGVEKRSPEDIAGIVLRSNPDGSKLRIADVAQIRVEGVTRDRAYWVGDQP
FT                   AMSIRVDRSDRGDAIRVQHQVAEVVERMQASLPQGVTVQLIRTRAEAISDRLNILVDNG
FT                   LMGLALVVMLLFLFLNARTAFWVAAGIPASMFAAIALMYVGGLTINMVSLFGLIITLGI
FT                   VVDDAIVVGEHADFRARRLGEHPVVAAETAARRMAMPVFAATLTTIIAFFGLTAIGGRF
FT                   GELIRDIPFTVIAVLAASLVECFLILPNHMSHAIAHSAKEHWYDWPNRVVNRGFRWLRD
FT                   HLFRPFVGWVVHARYVVLAATVAVLASQAALFITGDVQWRFFNAPERGSVTGNFIMAEG
FT                   ATRADTLEMMRELQRATEELGRIYEERHGRNPIDYVLAEIGGNAGRGLAGAETKDADLL
FT                   GGISIELIDADLRPYSSFAFVGELQDFVTRHPKVETLSFRGWRSGPGGDALDVQFYGAS
FT                   AQVLKAASNDLQAALLRYPEVSAVEDDLAYDKEEVVLDLTAQGQALGFTVDALGRALRA
FT                   RLNGIEAATYPDGPRSAEIRVELPEGELTADFLERTLMRAPAGIYVPLADIVSVSQRTG
FT                   FSTVRRENGIRRISVTGDISEDEPARATEISAALETQILPRIASERQVEWRMAGLSEQE
FT                   DTFLSEAATGLTLCLTGIYLVLAWVFASWTRPLVVMAIIPFGLVGTIWGHYIWEVPLSM
FT                   FTVVGLLGMTGIIINDSIVLVTTIDEYAESRGLLPSIIEGTADRLRPVLLTSLTTVLGL
FT                   APLLYESSQQAQFLKPTVITLVYGLGFGVLLVLLVVPALLAVQNDVARPMSALRRALRG
FT                   GAPLARAAVTASAVLTLAWLGVTVAWVAATGALPARLLGLLPPLEGLSPMPAALALFIL
FT                   GALLVCLLAMAVSAMIMMRAGGRNAA"
FT   gene            complement(308364..308783)
FT                   /locus_tag="SPO0294"
FT   CDS_pept        complement(308364..308783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0294"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93612"
FT                   /db_xref="GOA:Q5LX86"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX86"
FT                   /protein_id="AAV93612.1"
FT                   /translation="MTAQPRIGALAVVIHEGQVLLAQRGKDPGRGLWGFPGGHVEWGET
FT                   VRDAALRELHEETAIEARAQRYLTHFDLIHRDDAGQAVVHYLLVGVLCRYQAGAPQAGD
FT                   DAMDARWFPIDHVREGTVPLIDRVSELMEIALSAS"
FT   gene            complement(308787..309605)
FT                   /locus_tag="SPO0295"
FT   CDS_pept        complement(308787..309605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC46756.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93613"
FT                   /db_xref="GOA:Q5LX85"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX85"
FT                   /protein_id="AAV93613.1"
FT                   /translation="MGMSTRFPMLALAALLSLPLAAPAPAAGLDDLVQIEILDGGLTPS
FT                   GTYLGAIRMTLSEGWKTYWRAPGEAGIPPSFDWRGSRNLGELSITWPAPEVFEQSGLRS
FT                   IGYTDQMVLPIEITPKDANRPVRLRGEMEFGVCKDICVPGNLDFDHTLDASAPRNPAIV
FT                   AALARRPYSAAEAGVTSATCRISPSQGGMRIEARIAMPSAGGSELAVFEPGDPALWAGE
FT                   AQTRRQGNTLIASSEILNDGGTAFALDRSRIRITVLGAKRAVDIRGCLPG"
FT   gene            309710..310294
FT                   /locus_tag="SPO0296"
FT   CDS_pept        309710..310294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC46757.1; match to
FT                   protein family HMM PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93614"
FT                   /db_xref="GOA:Q5LX84"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX84"
FT                   /protein_id="AAV93614.1"
FT                   /translation="MWGKGEPLPMMDLTGKLLIAMPGMGDPRFERSVIFLCSHGEDGAM
FT                   GLIVNKPADLNVSTLLEQLEIPSSSAAAARAPVRLGGPVEMARGFVLHSPDYAGKLQSL
FT                   KVSDGFVMTATLDILEDIARDNGPARAALMLGYSGWGPGQLEAEIGDNGWLTADADPDI
FT                   VFGSRDDGKWEAALKLLGIDALLLSASAGHA"
FT   gene            complement(310446..311396)
FT                   /locus_tag="SPO0297"
FT   CDS_pept        complement(310446..311396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0297"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93615"
FT                   /db_xref="GOA:Q5LX83"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX83"
FT                   /protein_id="AAV93615.1"
FT                   /translation="MPVQPTLRLAADPDGIARAAELLRDGRLVAFPTETVYGLGGDATN
FT                   GQAVAGIYAAKGRPSFNPLIAHVASAEAARRHVHWSETAERLATAFWPGPLTLVLPLRA
FT                   NHGISELVTAGLDTLAVRVPAHPTARTLLATLDRPVAAPSANPSGRISPTTADHVLAGL
FT                   DGRIAAVLDAGPCGVGVESTIVGLSGTPILLRPGGLPTEEIEALLGQPLARHQQGDNIS
FT                   APGQLLSHYAPQSTVRLNARAPSDGEVFLGFGPMDCDENLSPSGNLTEAAANLFAALHR
FT                   LDTTGKPIAIAPIPERGLGLAINDRLRRAAAPRDP"
FT   gene            311525..313228
FT                   /locus_tag="SPO0298"
FT   CDS_pept        311525..313228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0298"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93616"
FT                   /db_xref="GOA:Q5LX82"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX82"
FT                   /protein_id="AAV93616.1"
FT                   /translation="MPYRSPVTDYTFLLSHVVGYDRVSGTEKYAEAGADMVSAILTEAG
FT                   RMCDEVMAPLQRGGDLNPARLENGALRSSPGFAEGWKAIAEGGWIGMSGSPEHGGMGLP
FT                   MAVTTAVNDMMSGACLSLQLAPLMSQGQIEALEHHASDAIKALYLPKLISGEWSGTMNL
FT                   TEPQAGSDVGALSSKAEPNGDGTYAVTGQKIFISWGDNDFCDNVCHLVLARLPDGVPGT
FT                   KGISLFLVPRNLPDENGNAGVANSLKVVSLEHKMGLHGSPTCVMQYDGATGWLVGEEHG
FT                   GMAAMFTMMNNARLGVGGQGVGVAEAAWQHAMAYAMERKQGKSASGTIADHADVRRMLT
FT                   SMKADVFAARAILAACAVAIDMGNATGSAEWKARAAFLTPIAKAFGTDTGIAVSETGVQ
FT                   VHGGMGFIEETGAAQFYRDVRVTAIYEGTNGIQAMDLVARKMMDGGEAAAKLLDEIEDH
FT                   AERARGRLPELAGPVWEATETLREATEWMVAQGELNDRFAGAVPFLRAFARVLGGHFHL
FT                   IAALADPGGPREKLARYYINALLPEHAGLLEQAQGGCADLYAISLEELSA"
FT   gene            313225..314274
FT                   /locus_tag="SPO0299"
FT   CDS_pept        313225..314274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0299"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93617"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX81"
FT                   /protein_id="AAV93617.1"
FT                   /translation="MMDRTPGLAMRYPWDEPPAHGSAIEVAEGVLWMRLPLPMKLDHVN
FT                   VYALDDGDGWTVIDTGFSSKKTRAIWQALIDGPLAGKPVRRVVVTHHHPDHMGNAGWFQ
FT                   SELGAELVTTRTAWLFSRMLTLDVQESWPEETLDYYRSAGMAPEVLAKRMAERPFNFAD
FT                   MVYPMPLGFARIKQGDVFRMGGRDWDVHMGNGHAPEHATFWSRDDNLVITGDQILSSIS
FT                   PNIGVYATEPMADPLADWLETCERLAPLARPEHLALGGHKLPFTGLPIRMRQLIDNHHG
FT                   ALKRLRDHLDTPKAASDCFAPLFKRTIGEGEYGLALVEAVAHVNHLYHTGEVTRTRRAD
FT                   GAWLYQRKG"
FT   gene            314278..314733
FT                   /locus_tag="SPO0300"
FT   CDS_pept        314278..314733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0300"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93618"
FT                   /db_xref="GOA:Q5LX80"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX80"
FT                   /protein_id="AAV93618.1"
FT                   /translation="MQNKIETSAEYAEAAALPPRCHEVHADPDSPARMTDVPVPMQQPV
FT                   QNKSPAQWAYERLILYIRNFEEQLDASQEVAMGFVGGDAGVLRIEGIGFFDPDIVTFYG
FT                   ADGTGARTQLVQHVSQLNVMLRAMPVATEDRPAQRIGFRLAADLEAD"
FT   gene            314804..316648
FT                   /locus_tag="SPO0301"
FT   CDS_pept        314804..316648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0301"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93619"
FT                   /db_xref="GOA:Q5LX79"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX79"
FT                   /protein_id="AAV93619.1"
FT                   /translation="MSHFTHVRNAWSGSWSRRRVFVPLYAALRLLVLALIAPALAGLIN
FT                   LAVSLSDQSALTDQDIARFVLSPLGFAATLAVLSVLLVAEVLSFAVMAATLRSGASNVW
FT                   HAGSAGLALVLRRLRPLLIFAALFVLRVLALAAPFVALAGLIAWWVLVDYDINYYLTFR
FT                   PPSFRLAMAGIAVLVLVLAWLLMLRLSGWALSLHLVIFEGTRPAQAFAESTRRMGTRRG
FT                   ALKIELVLWLLTRLALAAALGALASAALALVPIPQEGALRRALVLVVLVMGLWSLAGLA
FT                   LAATALGALTKLLDRFYDGAAAAAPLSPSRPQGLRGRLIGAALLAALALGAGMWVSDGL
FT                   LTQLTAKDEVSVIGHRGAAGARPENTMAAIVKAIEDGADWVEIDVQETADGEVVVMHDS
FT                   DFMKLAGVPTKIWDATMQDLAEIDIGSWFSPDYAAERAPTLRAVLEAARGKSNVLIELK
FT                   YYGHDVDLENRVIALVEEFGMQDQIATMSLKYPAVQKMRALRPDWRTGVLAATAVGDLA
FT                   GLEGDFVAVSSASLRPSLLRAAHAAGKDVYVWTVNEPLLMSKMISMGVDGLITDEPAMA
FT                   REVLAVRATLNPAERLLLWLTQELGWELNAKAYRDDSP"
FT   gene            316617..317195
FT                   /locus_tag="SPO0302"
FT   CDS_pept        316617..317195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE78911.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93620"
FT                   /db_xref="GOA:Q5LX96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX96"
FT                   /protein_id="AAV93620.1"
FT                   /translation="MQRPIAMTARNLLILCLCAGSPAMAQDLTQMLEMPAHRALMAAQQ
FT                   AAPLTPFTTDGCSGGLSAGWTMVGDTFPDFAAAQGNLPPWEACCVIHDRAYHDAGGALT
FT                   PEDSYAARQQADRALQSCVRDTGESHLADLAVRYDTTPEKVRSAYGTIADAMYLAVRFG
FT                   GGPCSGLPWRWGYGYAHCTPFDSTAPARD"
FT   gene            317258..317392
FT                   /locus_tag="SPO0303"
FT   CDS_pept        317258..317392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0303"
FT                   /product="cytochrome c oxidase, subunit IV domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93621"
FT                   /db_xref="GOA:Q5LX95"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX95"
FT                   /protein_id="AAV93621.1"
FT                   /translation="MADFKPGSMDITTQTNTFDGFIKAMIRVCVVIFFVLLFMAVFTA"
FT   gene            317412..318029
FT                   /locus_tag="SPO0304"
FT   CDS_pept        317412..318029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0304"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93622"
FT                   /db_xref="GOA:Q5LX94"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX94"
FT                   /protein_id="AAV93622.1"
FT                   /translation="MKLIFLAGALALSLMACTRQSAPPADDATVAAVRYRDPGPAKLTL
FT                   YTMVNNRSGAGAHTSLMINASERVIFDPAGSFWADIVPEQNDVLYGITPAVETAYRGSH
FT                   ARETHHVVVQELEVTPEQAEAAYRLARSMGPVPGAYCANYTARLLQQVPGFGDIKVTFQ
FT                   PTKLADQFGSRPGAVTNRYYEQDDADLQKGLAANNAKLNQPG"
FT   gene            complement(318368..319084)
FT                   /locus_tag="SPO0305"
FT   CDS_pept        complement(318368..319084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0305"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93623"
FT                   /db_xref="GOA:Q5LX93"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX93"
FT                   /protein_id="AAV93623.1"
FT                   /translation="MSFTTSKSVYWKGFRDGAPFIMVAAPFGTLFGVFATEAGLNLVQV
FT                   MTFTATVFAGAAQFTALQLLLDDTPTLIVLLSALAVNLRVAMYSAALTPYLGAAPLWQR
FT                   AVAAYFTVDQSYALSVVRFETEPDLTVPQRMAYFFGTVTPLAPAWYLATYLGAVLGTRI
FT                   PDSWALDFALPITFLAMIGPMLRTLPHVIAALVAIVTALLTAAVPFNLGLLIAGTAGMM
FT                   AGARAEVILERRSKRT"
FT   gene            319140..320021
FT                   /gene="fdhD"
FT                   /locus_tag="SPO0306"
FT   CDS_pept        319140..320021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="SPO0306"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93624"
FT                   /db_xref="GOA:Q5LX92"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX92"
FT                   /protein_id="AAV93624.1"
FT                   /translation="MAISDDLSDYIIAPDPGAARLTRAVEGLDQTGAPTRLSVVEERPL
FT                   TIFLNSQEIVTAMTIGDYPEYLALGFLRNQGMLRPDEEITGVDFDEDLETVVVRTAVET
FT                   SHEEKLKKKTRTSGCAVGTVFGDMMEGLEEVRLPQVEVRTSWLYDLAARINRTPSLYLE
FT                   AGAIHGTVLCHRNRPLVYMEDVGRHNAVDKIAGWMLSTGEGADDKILYTTGRLTSEMVI
FT                   KTAMMGIPVLASRSGFTAWGVEIARQVGLTLIGRMRGQRFVCLSGAERLVWDADPDSVP
FT                   VEDRKHRRKSAQ"
FT   gene            320619..321254
FT                   /gene="mobA"
FT                   /locus_tag="SPO0307"
FT   CDS_pept        320619..321254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="SPO0307"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="identified by similarity to SP:P32173"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93625"
FT                   /db_xref="GOA:Q5LX91"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX91"
FT                   /protein_id="AAV93625.1"
FT                   /translation="MTKPLGVILAGGLATRMGGGDKGLLPLGGQPLLGHVIDRLAPQVS
FT                   GLALNANGDPARFNGFGLPVLPDTVEGFAGPLAGVLAGLDWAAGQRADSIVTAAADTPF
FT                   FPRDLVARLVAASEGQAHPLVLATTPRDGAVLKSGGRVNRHPTFGLWPVALRDDLRAAL
FT                   NDGLRKVVLWTDRHGGREALFQAEPFDPFFNVNTPEDLARAETLLERA"
FT   gene            321251..321742
FT                   /gene="mobB"
FT                   /locus_tag="SPO0308"
FT   CDS_pept        321251..321742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="SPO0308"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="identified by similarity to SP:P32125; match to
FT                   protein family HMM PF03205; match to protein family HMM
FT                   TIGR00176"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93626"
FT                   /db_xref="GOA:Q5LX90"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX90"
FT                   /protein_id="AAV93626.1"
FT                   /translation="MRIYGVTGWKNAGKTGLMERLVAEITGRGLTVSTVKHAHHSFDVD
FT                   HPGRDSWRHRQAGASEVILASRYRVAQMTELRGAAEPPLSELLGRLSPVDLVLIEGYKR
FT                   EGHPKVEAFRAEAGTALIAPGDPTIRAVASDTPLTLDRPVFDLNDTTAIADFILSEVGL
FT                   "
FT   gene            321739..322539
FT                   /locus_tag="SPO0309"
FT   CDS_pept        321739..322539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK23994.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93627"
FT                   /db_xref="GOA:Q5LX89"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX89"
FT                   /protein_id="AAV93627.1"
FT                   /translation="MRPFDTIAMVDWSGGNDTGPRPRKDAIWACVAGAEPVYLRNRGLA
FT                   ENWLCDLIETALAAGRRLMLGFDFPFGYPTGFARAVSGSDDPLHIWDWFEARIEDTPKA
FT                   NNRFDLAGAVNRGLGGKGPFWANGLKRDIGGLPRTKRDYHNPFADRRLVERRAPGAFTC
FT                   WQMAGAGAVGGQVMMGLPVLARLRRRFAGQIGVWPFERLDKPVALVEIWPSLTLGKAPE
FT                   GRIKDAWQVERVASDLSGMSLARLGSLLNVTAPEEGWILGVDQG"
FT   gene            322536..323795
FT                   /gene="moeA"
FT                   /locus_tag="SPO0310"
FT   CDS_pept        322536..323795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="SPO0310"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by similarity to SP:P12281; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   PF03453; match to protein family HMM PF03454; match to
FT                   protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93628"
FT                   /db_xref="GOA:Q5LX88"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX88"
FT                   /protein_id="AAV93628.1"
FT                   /translation="MTGIEPPPLRNDCFALPAGVEWTPVDTALDMLRDRLGPVTGVEMR
FT                   LLSQALGGVLAADAVALRSSPPQANSAVDGYGFAGAVPEGAHVMPLEEGRAAAGVPFDG
FT                   VLPAGRALRVLTGAALPEGVETVILEEDVTLGTGEIAFRGPLKRGANTRKAGEDVAEGA
FT                   VVLPAGRRLTPADLALLASVGLGVVPLRRQLRVAVLSTGDELVEPGETAGPGQIFDANR
FT                   PMLLSLIHRLGHAPVDLGRVPDDRTTLRATFDRAAAEADVILTSGGASAGDEDHVSALL
FT                   RAAGAMQQWRIALKPGRPLALGLWQGKPVFGLPGNPVAALVCSLVFARPAMAVLAGESW
FT                   SVPQGYDLPAGFEKRKKPGRREYLRARVRDGRVEVFASEGSGRVSGLSWAEGLVEIGDD
FT                   ACHIRPGDPVRFIPYGSFGL"
FT   gene            complement(323819..324826)
FT                   /locus_tag="SPO0311"
FT   CDS_pept        complement(323819..324826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93629"
FT                   /db_xref="GOA:Q5LXA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA5"
FT                   /protein_id="AAV93629.1"
FT                   /translation="MSGPSPDPDPARNTPLGLYDRPRRASVTGIEIIAIALTLLWLAVS
FT                   VYLFAFADAGAGGGIGFLVTMLAIFMPVAMIWVAATAAKASRVMREESQRLQAAIDAIR
FT                   QAYISQQQKQAAGHEPSVAKKLDEIAAAAKKTETTLATFSTSRRARALPMPAAAPESAE
FT                   DQGLLALGTPAEALSPPLSTEDLIRALHFPETAEDVEGFAALRRALKDRSAAQLIQAAQ
FT                   DVLTLLSHEGIYMDDLRPDMARPEVWRQFAHGARGRTVASLGGVRDRSSLALTAGRMKQ
FT                   DPIFRDAAHHFLRLFDRMFTTFEAQASDAEISALGETRTARAFMLLGRVAGTFD"
FT   gene            complement(324840..325310)
FT                   /gene="greA"
FT                   /locus_tag="SPO0312"
FT   CDS_pept        complement(324840..325310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SPO0312"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by similarity to SP:P21346; match to
FT                   protein family HMM PF01272; match to protein family HMM
FT                   PF03449; match to protein family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93630"
FT                   /db_xref="GOA:Q5LXA4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXA4"
FT                   /protein_id="AAV93630.1"
FT                   /translation="MEKIPMTPSGFAALEAELKQLKSVERPAIIKAIAEAREHGDLSEN
FT                   AEYHSAREKQSFIEGRIKELEGVLSLADVIDPTKLSGAIKFGARVTLVDEDTDEEKTWQ
FT                   IVGEHEANIEKGLLNIKSPIARALIGKDEGDSVEVKTPGGQKSYEILSIEYS"
FT   gene            complement(325446..325826)
FT                   /locus_tag="SPO0313"
FT   CDS_pept        complement(325446..325826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0313"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93631"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA3"
FT                   /protein_id="AAV93631.1"
FT                   /translation="MKATLEHANLTVADPKATAAWLNTVFGWETRWEGAAIAGGYTVHV
FT                   GDAGTYLALYAPPKPVPSAETSYDVIGGLNHVGVVVDDIDATEERVRAAGFTPHNHADY
FT                   EPGRRFYFDDDNGIEFEVVSYP"
FT   gene            325911..326366
FT                   /gene="soxR"
FT                   /locus_tag="SPO0314"
FT   CDS_pept        325911..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxR"
FT                   /locus_tag="SPO0314"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR01950"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93632"
FT                   /db_xref="GOA:Q5LXA2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA2"
FT                   /protein_id="AAV93632.1"
FT                   /translation="MPASEGLSIGALARRTGLAVSAIRYYETQGLIAPWRNAGGQRRYQ
FT                   RADLRRLSFVMIAQQLGLTLPEIREVLAGLPGNRTPTRGDWTRISTALRERLNQRIATL
FT                   ERLRDNLDGCIGCGCLSLPNCALYNPADRVGSKGPGPRLVLDETGDL"
FT   gene            complement(326374..326682)
FT                   /locus_tag="SPO0315"
FT   CDS_pept        complement(326374..326682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM41091.1; match to
FT                   protein family HMM TIGR02118"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93633"
FT                   /db_xref="GOA:Q5LXA1"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA1"
FT                   /protein_id="AAV93633.1"
FT                   /translation="MPVSLQVAYPTRDDTTFDYDYYLTTHMGLVAEHMGPHIQNTVVTK
FT                   GLAGGPDTPPPFHAIATIVFADQNAMNAAMKASGPVVSDIPNFYNSAPQMLIGEVVG"
FT   gene            326914..328560
FT                   /locus_tag="SPO0316"
FT   CDS_pept        326914..328560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0316"
FT                   /product="electrotransfer ubiquinone oxidoreductase family
FT                   protein"
FT                   /note="identified by similarity to SP:Q16134; match to
FT                   protein family HMM PF05187"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93634"
FT                   /db_xref="GOA:Q5LXA0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA0"
FT                   /protein_id="AAV93634.1"
FT                   /translation="MAEIEREAMEYDVVIVGAGPAGLSAAIRLKQLDADLNVVVLEKGS
FT                   EVGAHILSGAVLDPCGLDALIPDWKEKGAPLNVPVKDDNFYMLGEAGQIRIPNFPMPPL
FT                   MNNHGNYIVSMANVCRWMAEQAEELGVEIFPGMSCSELVYGDNGEVKGVVAGVFGLEAD
FT                   GSYGPNTEPGMELHGKYVFLSEGVRGSLAKEVIAKYDLQKGKEPQKFGVGMKEIWEIDP
FT                   AKHREGSVTHTMGWPLGGNAGGGSFIYHLDNNQVYVGFVVHLNYKNPHLFPYMEFQRFK
FT                   HHPMVAELLKGGKRVAYGARAITEGGYQSMPKMVAPGVALLGCSVGMVNVPRIKGNHNA
FT                   MLSGKAAAEAAHAAIKAGRQSDELSDYETEVRSGPIGKDLKKVRNVKPMWSKWGLAASL
FT                   ALGGLDMWTNTLGFSLFGTLGHGKTDAAATEDASKHKPIDYPKPDGVLSFDRLTNVSFA
FT                   ATNHEESQPCHLRLTDPDLPVKVNLPKYDEPAQRYCPAGVYEVVEDEGGPRFVVNFQNC
FT                   VHCKTCDIKDPSQNITWVTPQGGDGPNYPNM"
FT   gene            328606..330441
FT                   /locus_tag="SPO0317"
FT   CDS_pept        328606..330441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0317"
FT                   /product="TPR domain protein"
FT                   /note="identified by similarity to GB:CAE26481.1; match to
FT                   protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93635"
FT                   /db_xref="GOA:Q5LX99"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX99"
FT                   /protein_id="AAV93635.1"
FT                   /translation="MFSFVQMTGCLLPLTALTPLSHCTRPRNALALLQSSWKGGSLAIS
FT                   LVRNAVAAVLAAALSVPVSADVGAGSYLAARQAVFANDFSSAADYFARALAIDPQNPAL
FT                   MENMVLSQLALGRLEQAYPVAQLMQEAGLQSQVANIAIVVHLLSEERYQEVLDRDPEMR
FT                   GVGKLVDGLVAGWAEMGLGSVARALAQFDKVADEAGLRGFANYHKAMALASVGDFEGAE
FT                   ALFAADDGALTTISRRAALARAEILSQLDRNDQALEMLADVFSGGFDPALSDIADRLVA
FT                   GETLPFSLVRSVRDGLAEVFFTIGAALNGEASDDFTLVYIRSAVHLRPDHIDALLMTAG
FT                   LLESLGQYDLAVATYKQIPNDSPDYHAAELGRAEALRRSAKPDAAIEVLEKLAKDYPSQ
FT                   PQAFVALGDLQRQQEAYDRAATAYDKALQLTDPGAPNMWFLHYARGICHERLGNWPGAE
FT                   ADFRAALELNPDQPQVLNYLGYSLVEKQEKLDEALDLIERAVAARPDSGYIVDSLGWVL
FT                   FRLGRYDEAVGHMERAVELMPVDPVVNDHLGDVLWAVGRVREAEFQWRRALSFIKADDT
FT                   DGEADPERIRRKLEIGLDRVLAEEGVPPLKVANGD"
FT   gene            330431..331270
FT                   /gene="ispE"
FT                   /locus_tag="SPO0318"
FT   CDS_pept        330431..331270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SPO0318"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93636"
FT                   /db_xref="GOA:Q5LX98"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX98"
FT                   /protein_id="AAV93636.1"
FT                   /translation="MAIEAFAPAKINLTLHVTGQRDDGYHLLDSLVVFADIGDTIRVSA
FT                   SDRVSLDIDGPEAGGLAAEPDNLVLRAARLLAPERGAAISLTKRLPVASGIGGGSADAA
FT                   ATLRALAQLWGLAAPSAEQALTLGADVPVCLFPVPARMQGIGDRLGPIPPLPAMDIVLV
FT                   NPRVAVSTPAVFKSLIVKENAPMNPELPRWRDLPEFTCWLADQRNDLAEPAIAQQPVIA
FT                   DVLNALRDAGALFAGMSGSGATCFGLFPSDGHSAKSVAKAVLRLAHPGWWCAHGRVL"
FT   gene            complement(331351..332349)
FT                   /gene="ddsA"
FT                   /locus_tag="SPO0319"
FT   CDS_pept        complement(331351..332349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddsA"
FT                   /locus_tag="SPO0319"
FT                   /product="decaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to GB:CAD24417.1; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93637"
FT                   /db_xref="GOA:Q5LX97"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX97"
FT                   /protein_id="AAV93637.1"
FT                   /translation="MDAKVSTKPHEMLAATLSQEMAAVNALIRTRMASEHAPRIPEVTA
FT                   HLVEAGGKRLRPMLTLAAARLCGYQGEDHVKLAATVEFIHTATLLHDDVVDESGQRRGR
FT                   PTANLLWDNKSSVLVGDYLFARSFQLMVETGSLRVLDILANAAATIAEGEVLQMTAASD
FT                   LRTDESVYLQVVRGKTAALFSAATEVGGVIAGVPEAQVRALFEYGDALGIAFQIADDLL
FT                   DYQGDAKATGKNVGDDFRERKLTLPVIKAVAQATDEERAFWVRTIEKGKQAEGDLEQAL
FT                   ALMEKYGTLAATRADAHAWAEKARTALELLPNHEIRTMLSDLADYVVARLS"
FT   gene            332406..332621
FT                   /locus_tag="SPO0320"
FT   CDS_pept        332406..332621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC45419.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93638"
FT                   /db_xref="GOA:Q5LXB4"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB4"
FT                   /protein_id="AAV93638.1"
FT                   /translation="MKELLRSTDPTVMAFASALLEGEDIDCFQMDVNMSILEGGIGIFP
FT                   RRMMVRDEDYDRALRVVTDNDIPLGR"
FT   gene            332618..333391
FT                   /locus_tag="SPO0321"
FT   CDS_pept        332618..333391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0321"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD24416.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93639"
FT                   /db_xref="GOA:Q5LXB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB3"
FT                   /protein_id="AAV93639.1"
FT                   /translation="MTAFAESELSCDAFLGGHLRLFQPRDGYRAGVDPVFLAASVAAQT
FT                   GQSVLELGCGAGAAILSLGARVPDLALTGVELQPGYADLARRNAAANDIALDVVEGDIA
FT                   ALPQALRQQSFDHVIANPPYYLAGSHSPASDAGRATALGERTPLALWIDAAARRLTHRG
FT                   YLHMIAKADRLPDMLAACDDRLGSLEVLPLMPRQGRAAELVILRARKGGRAPFRLQSGL
FT                   FLHQGSRHPGDRDHYLPEIAKVLRQPAPLPWPGAG"
FT   gene            333505..333669
FT                   /locus_tag="SPO0322"
FT   CDS_pept        333505..333669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AE3289; match to
FT                   protein family HMM PF04325"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93640"
FT                   /db_xref="GOA:Q5LXB2"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB2"
FT                   /protein_id="AAV93640.1"
FT                   /translation="MSVSAHLTELKKKHANLSLEVEQAQRSPGTDDLQISQLKKQKLKL
FT                   KEEIERLSV"
FT   gene            complement(333666..334532)
FT                   /locus_tag="SPO0323"
FT   CDS_pept        complement(333666..334532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0323"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93641"
FT                   /db_xref="GOA:Q5LXB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB1"
FT                   /protein_id="AAV93641.1"
FT                   /translation="MTRSRATAIGFVAVLLWALLALLTVGSAPVPPLLLNALCFTVGGL
FT                   LGLVWVLATGGLAQLRGVRWPVYAFGTLGLFGYHALYFSALRLAPAAEAGLIAYLWPLL
FT                   IVLFSGLLPGERLRSGHLLGAALAFAGAGLIITGGGGPGFQAQYLPGYGLALLCALTWS
FT                   GYSVLSRRMGDAPTSSVAVFCLATAVASWGLHFMVEETVWPQDMLGWGATLALGLGPVG
FT                   LAFYVWDIGVKRGDIQLLGTSSYAAPLLSTLVLVISGIAAPSWVLALSALLITGGALLA
FT                   ARASLSA"
FT   gene            complement(334529..335476)
FT                   /locus_tag="SPO0324"
FT   CDS_pept        complement(334529..335476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93642"
FT                   /db_xref="GOA:Q5LXB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB0"
FT                   /protein_id="AAV93642.1"
FT                   /translation="MSDRLPPLTALRAFDAAARHMSFAKAAAELNVTPAALSFQIKSLE
FT                   EHLGRPLFRRLNRAVELTEEGRALAPGAQEGFEVLTAAWRAARRLQDNTTLTVTAGPAL
FT                   TAKWLAPRLYDFARAHPEIDLRISTSLRLVDLARDEVDVAIRFGQGSDAGLYSVSARKE
FT                   WMIPVMTPELANRFPTPESLRDAPLIFDESISFLDPPVDWPTWFRAVGIDFTPQRGAHF
FT                   SNADHAIDAAVAGVGVVLGRRPMIIKDVIEGRLVMPFKTAVETDARFRFVCLAGAETQP
FT                   KIAAFRDWFLAEIAKTAHISDGLTIVHVRDIPPK"
FT   gene            complement(335827..336549)
FT                   /gene="phbB"
FT                   /locus_tag="SPO0325"
FT   CDS_pept        complement(335827..336549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="SPO0325"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="identified by similarity to SP:P23238; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   TIGR01829"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93643"
FT                   /db_xref="GOA:Q5LXA9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA9"
FT                   /protein_id="AAV93643.1"
FT                   /translation="MARTALVTGGSRGIGAAISKALKAEGYNVAATYAGNDEAATAFTA
FT                   ETGIATYKWNVADYDESAAGIAKVEAEVGPIDIVVANAGITRDAPFHKMTPEQWHQVID
FT                   TNLTGVFNTVHPVWPGMRERKFGRVIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQ
FT                   EGARAGITANAICPGYIATEMVMAIPEKVRDSIVAGIPAGRLGEPEEIARCVTFLASED
FT                   SGFINGSTISANGAQFFV"
FT   gene            complement(336736..337911)
FT                   /gene="phbA"
FT                   /locus_tag="SPO0326"
FT   CDS_pept        complement(336736..337911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA"
FT                   /locus_tag="SPO0326"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by similarity to SP:P54810; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93644"
FT                   /db_xref="GOA:Q5LXA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA8"
FT                   /protein_id="AAV93644.1"
FT                   /translation="MTNVVIASAARTGVGSFGGSFANTPAHDLGAAVLEAVVERAGIDK
FT                   AEVSETILGQVLTAAQGQNPARQAHVNAGLPKESSAWGINQVCGSGLRAVALGAQHILL
FT                   GDAEIVAAGGQENMTLSPHAAALRAGHKMGDMKYIDTMIRDGLWDAFNGYHMGQTAENV
FT                   AEQWQISREMQDEFAVASQNKAEAAQNAGKFADEIVPFIIKTRKGDIVMDKDEYIRHGA
FT                   TIEAMQKLRPAFTKDGSVTAANASGLNDGAAATLLMTAENAEKRGIEPLARIASYATAG
FT                   LDPSIMGVGPIHASRKALAKAGWKVEDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNG
FT                   GAIAIGHPIGASGCRVLNTLLFEMKRRNAKKGLATLCIGGGMGVALCVERD"
FT   gene            complement(338082..338921)
FT                   /locus_tag="SPO0327"
FT   CDS_pept        complement(338082..338921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0327"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93645"
FT                   /db_xref="GOA:Q5LXA7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA7"
FT                   /protein_id="AAV93645.1"
FT                   /translation="MRTRIKKLADLPEGAENPLSAAISSRHRSTVAMATEAVRHGDCLL
FT                   AYQPVLQTAPPHGIAFYEGFIRVLDETGRVIPARDFMPAVENTEIGRELDCVALETGLR
FT                   ALVRNPTLRLSVNMSARSIGYRKWMQTLERFLKRDEALGDRLILEINQTSAMAVPELVI
FT                   DFMDRLQPRGIAFALDDFGDGPIDFNSFRDFFFDAVKIDGRFIRQVSTDAANRATVRAL
FT                   IALAREFEMLIIAESVETEEDAAFLAENGVDCLQGYLYGAPTVTPVWEKPETAKASG"
FT   gene            complement(339136..340068)
FT                   /locus_tag="SPO0328"
FT   CDS_pept        complement(339136..340068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48523.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93646"
FT                   /db_xref="GOA:Q5LXA6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA6"
FT                   /protein_id="AAV93646.1"
FT                   /translation="MIETLSFPDPTQLAVPFFIAAILIEFLWIAMKKRGGRYETRDAVT
FT                   SLIMGAGSVAEGILLGFIAWAFFMLLWRVTPLDMGTSIWAVLICFVLDDLRYYWVHRFG
FT                   HRVRWVWASHVNHHSSQHYNLTTALRQTWTGTFTFMMVVKAPMVLLGFHPALVLFCGGL
FT                   NLIYQFWIHTEAIDKLPRWFEAVMNTPSHHRVHHGRNPRYLDCNYAGVFIIWDKMFGTF
FT                   VPEQEDEKVDYGLVHNLGTFNPLRVAFHEWLGIWRDVTQPGLSLRQRLAYAFAPPGYSH
FT                   DGSRETSEGIKARYLATHPEQRGTPGFEG"
FT   gene            complement(340065..340484)
FT                   /locus_tag="SPO0329"
FT   CDS_pept        complement(340065..340484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93647"
FT                   /db_xref="GOA:Q5LXC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC3"
FT                   /protein_id="AAV93647.1"
FT                   /translation="MSFTLRCREGPMPLEILLILVIGGISTIAVILHLSGRSKRADLTL
FT                   ETARAAWLRHFPQDTVHDILLARDGHAALVETETGPGLLWALGADTVGRRLQDYALSET
FT                   ADGLAIRFHDFTAPRVTLTLAPDETPIWQQRLARA"
FT   gene            340918..341967
FT                   /gene="ccpA"
FT                   /locus_tag="SPO0330"
FT   CDS_pept        340918..341967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SPO0330"
FT                   /product="cytochrome c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="identified by similarity to SP:P14532; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93648"
FT                   /db_xref="GOA:Q5LXC2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC2"
FT                   /protein_id="AAV93648.1"
FT                   /translation="MSPKSLFSFSLTALSCTAGLAAANPLREQALELFQPLPSTVPAVK
FT                   DNPITPEKIDLGKALFFDPRMSASGVFSCNSCHNLATGGDDNLETSIGHGWQKGPRNAP
FT                   TVLNAVFNAAQFWDGRAPDLAEQAKGPVQAGVEMANTPGQVVATLNSMPEYVAWFQAAF
FT                   PDQPDPVSFDSFAKAIEAYEATLITPAPFDAWLNGDDAALSGEQKQGLSLFIDAGCASC
FT                   HGGVNLGGQDYYPFGLVETPDAEVLPSGDKGRFAVTATEDDEYVFRAAPLRNIAVTAPY
FT                   FHSGKVWELEAAVSIMASSQLGADLSEEETAAITAFLHSLTGEVPQVVYPVLPAETSGT
FT                   PRPDGAVQR"
FT   gene            complement(342014..342577)
FT                   /locus_tag="SPO0331"
FT   CDS_pept        complement(342014..342577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0331"
FT                   /product="thiol:disulfide interchange protein, putative"
FT                   /note="identified by similarity to SP:P43221"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93649"
FT                   /db_xref="GOA:Q5LXC1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC1"
FT                   /protein_id="AAV93649.1"
FT                   /translation="MKKLLLALVYTAAALGANPSLGLAADRAQIEALRDGDMKKLIVLP
FT                   ETRAVSQVPFQLADGAGEATLGDYKGKVVLLNFWATWCAPCRKEMPQLSALQSELGGES
FT                   FEVLTIATGRNSPAGIEKFFGEIGVDNLPRHQDPRQALAREMAVIGLPITVLIGADGME
FT                   VARLIGDADWNSDSAKAIIQAVIE"
FT   gene            342602..343993
FT                   /gene="argH"
FT                   /locus_tag="SPO0332"
FT   CDS_pept        342602..343993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SPO0332"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by similarity to SP:P59615; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93650"
FT                   /db_xref="GOA:Q5LXC0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXC0"
FT                   /protein_id="AAV93650.1"
FT                   /translation="MTDKTSNQMWGGRFAAGPDAIMEAINASIGFDKRLAAQDIAGSRA
FT                   HAAMLAATGVITDSDAEAIREGLLTVLSEIEAGEFTFSTALEDIHMNVEARLKEIIGEP
FT                   AGRLHTARSRNDQVATDFKLWVRDQFDAAEAGLLALLRALLGQAEAGADWVMPGFTHLQ
FT                   TAQPVTWGHHMMAYVEMFGRDLSRVRDARARMNESPLGSAALAGTSFPIDRHMTAAALG
FT                   FDRPTANSLDAVSDRDFALEFLSVASICAMHLSRFAEELVIWSSAQFRFVTLSDRFSTG
FT                   SSIMPQKKNPDAAELIRAKVGRIFGANTALMMVMKGLPLAYSKDMQEDKEQVFDAADNW
FT                   MLALAAMEGMVRDMTANRDSLAAAAGSGFSTATDLADWLVRVLGLPFRDAHHVTGALVA
FT                   LAESKGCDLPDLSLDEMQSAHAAITEDVYGVLGVENSVNSRQSYGGTAPAQVRAQVARW
FT                   KEMLA"
FT   gene            343990..344172
FT                   /locus_tag="SPO0333"
FT   CDS_pept        343990..344172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0333"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93651"
FT                   /db_xref="GOA:Q5LXB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB9"
FT                   /protein_id="AAV93651.1"
FT                   /translation="MTPIRLTLALALTALISGCGADGEPVQPTVAANVGVSGSGTHVSG
FT                   GVGLGKGPFNLWLGF"
FT   gene            344379..345644
FT                   /gene="lysA"
FT                   /locus_tag="SPO0334"
FT   CDS_pept        344379..345644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="SPO0334"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93652"
FT                   /db_xref="GOA:Q5LXB8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB8"
FT                   /protein_id="AAV93652.1"
FT                   /translation="MDHFLYRDGALCAEDVPLAEIAATVGSPFYVYSTATLLRHFQLFD
FT                   EALDGTDHLICYAMKAASNQAILRTLAQAGAGMDVVSVGEYLRARAAGVPGVRIVFSGV
FT                   GKTAEEIRVALVGGIRQFNVESEPEMEVINAIALELGKVAPITIRVNPDVDAKTHAKIA
FT                   TGKSENKFGIPIARASAVYAQAAALPGLEVVGIDVHIGSQLTDLAPFETAYRKVAELTE
FT                   RLRAEGHDIRRLDLGGGLGIPYTRSNEAPPLPMEYGALIKRTLGHLGCEIEIEPGRLIA
FT                   GNAGLMVSKVIYVKSGEGRDFLILDAAMNDLIRPAMYDAHHDIVPVVEPEPGVEPQPYD
FT                   IVGPVCESGDTFAKARMMPPLAAGDLVAFRSAGAYGAVMSSEYNSRPLIPEVLVHGDQF
FT                   AVIRPRPSFDEMINRDTIPPWL"
FT   gene            345684..348242
FT                   /locus_tag="SPO0335"
FT   CDS_pept        345684..348242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93653"
FT                   /db_xref="GOA:Q5LXB7"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB7"
FT                   /protein_id="AAV93653.1"
FT                   /translation="MTRNRPPNLPLPRFALGLTHAGLWAERLWRGFWPFLSVLMLALAP
FT                   ILLGLHELVPVEWVWAFAAGFALVLVVTLVLGLRRFRRPVRAEALARLDAALPGRPIQT
FT                   LMDEQAIGAQDPASAALWRAHQARMAARVANAEPVAPDLVLTRRDPYGLRFMAALCFVA
FT                   ALLFGSVWRVGSVVDLAPGAAQAATGPSWEGWIEPPRYTGLPTLYLNDQTGEVLQLPQG
FT                   SRITLRLYGEVGQLRLTEEVSGKPLERPDHPEQTVEVTRSGPFEIEGRGGRGWQVVMLS
FT                   DTAPQVEIAGAAETRAGGQMVLPFAAMDDYGITGGRAVIALDLEAVDRRYGLRTDPDPR
FT                   DPVVADLPLPITGDRREFTENLIEDFSQHPWAHLPVTITLIAQDAAGQEAETLPFGTAL
FT                   PARRFFDPLAAAVIEQRRDLLWSRDNATRVAQILRAVSHRPDDVFRSQTAYLRLRVILR
FT                   RMEALQRFGLKPAQQEEIAQALWDLAIMLEDGTLSDALERMRRAQERLSEAMKNGASDQ
FT                   EIAELMQELREATQDYLRQLAQNQQNEQDGERQAQEGESLQMTQDDLQKMMDRIQELME
FT                   QGRMAEAQQALEEFQQMMENMRVTQGQGDNGQSEGQRAMEGLAETLRNQQGLSDQAFRD
FT                   LQEQFNPGAQAGESQQNEGRNGGEGRGQSHEGQGQGSRQSGTGQDGAQQGEPGETGEGS
FT                   LAERQQALRNELGRQEQNLPGQGTPEGDAAREALDRAGRAMEGAEEALRENDLAEAIDR
FT                   QAEAMEAMREGMRSLGEALAQQSQPGQGSQEGDQRARNQDPLGRTPGSQGGVDTDESLV
FT                   PGDDVYRRARDLLDEIRRRSGESDRPKVERDYLKRLLDRF"
FT   gene            complement(348262..349101)
FT                   /locus_tag="SPO0336"
FT   CDS_pept        complement(348262..349101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0336"
FT                   /product="MJ0042 family finger-like domain protein"
FT                   /note="identified by match to protein family HMM TIGR02098"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93654"
FT                   /db_xref="GOA:Q5LXB6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB6"
FT                   /protein_id="AAV93654.1"
FT                   /translation="MRLTCPNCDAQYEVPDEVIPPEGRDVQCSNCGHTWFQPPAGEALD
FT                   ADEGDAEDGFAPDAAPAPEEDTSESPDQSDEQDDWDEDGELPDDKDEDSFDNDPAPTDP
FT                   VQGRGVGPDVSDILREEAAREAELRAREAEALESQPDLGLDAYPGDEPGRRAREAQDRM
FT                   ARMRGQEPVAQETDSTSRRGLLPDIEEINSTLRNSDAAAAAPAIHAGPARRRRSGGFMR
FT                   GFVVMLIFGAVLFLLYTNAPLVARTLPQADPMLSAYVALVDQARLWLDAQIGALIPR"
FT   gene            349240..349971
FT                   /gene="ftsE"
FT                   /locus_tag="SPO0337"
FT   CDS_pept        349240..349971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPO0337"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to SP:P10115; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93655"
FT                   /db_xref="GOA:Q5LXB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB5"
FT                   /protein_id="AAV93655.1"
FT                   /translation="MKPRAPSGKKSRKRQGADVIELENVGYSYGGGELLGEISVELSPG
FT                   SFHFLTGPSGSGKTTLLKLCYGALLATSGQVRAFGEDMRRLDRDQMALFRRRIGVVHQD
FT                   CRFLDHLPLTENIALPLTVSGHDLAGEHENLRELMAWVGLSKRAEALPPELSGGERQRA
FT                   ALARAVIMSPDVVVADEPTGNVDWEMSQRLLQLLVELNRMGKTVLIATHDLSLIRAAKS
FT                   QVQARVLRISNKRLQLAGADL"
FT   gene            349968..350867
FT                   /locus_tag="SPO0338"
FT   CDS_pept        349968..350867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0338"
FT                   /product="cell division permease protein FtsX, putative"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93656"
FT                   /db_xref="GOA:Q5LXD3"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD3"
FT                   /protein_id="AAV93656.1"
FT                   /translation="MSKGTIRALLMADKQADRVVPPSGFTAQLTLFVSGAMAFLAVFAL
FT                   ALSLASGRLADRWASELAQAATLRINAPADQVAAQTQAALAILIQTPGVAEARALSREE
FT                   QAALLTPWFGPDLPLDTLPVPQLIEIVGGTPAYDAQGLRLRLAAEVPGAVLDDHRRWRE
FT                   PLVDAANSLRRLALVSILLIGGATAAMITLAANAALAANSQVIEVLRLVGARDRYIAGA
FT                   FVRRFTLRALIGAAVGVLLGMGGVMLLPEASDEGGFLTGLGFRGIGWLLPLLIPVLGAV
FT                   VAFAATWHAARRRLKELA"
FT   gene            350864..351595
FT                   /locus_tag="SPO0339"
FT   CDS_pept        350864..351595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0339"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93657"
FT                   /db_xref="GOA:Q5LXD2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD2"
FT                   /protein_id="AAV93657.1"
FT                   /translation="MMMQWVRSIVFTIVIYIWMAILGLLFTPYALVSKKGALRACKLYA
FT                   RSTIWMARWMVGIHGEIRGPVPTGEVLIAAKHQSFFDILLIFHAVPHGKFIMKRELLWT
FT                   PVIGVYAKRLGCIPVNRGKRGAAVARMVKDVAKEFAEPGQLVIYPQGTRVAPGVSKPYK
FT                   VGSAVLYEGLQYSCIPVATNVGLFWPRDGLLRKPGRAVVEFLEPIPPGVPRDAFMRRLE
FT                   TEIEGASDRLMREAGYETAQG"
FT   gene            complement(351721..353109)
FT                   /gene="lpdA"
FT                   /locus_tag="SPO0340"
FT   CDS_pept        complement(351721..353109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SPO0340"
FT                   /product="2-oxoglutarate dehydrogenase, E3 component,
FT                   dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93660"
FT                   /db_xref="GOA:Q5LXD1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD1"
FT                   /protein_id="AAV93660.1"
FT                   /translation="MATYDVIIIGAGPGGYVCAIRCAQLGLKTAVVEGRETLGGTCLNV
FT                   GCIPSKALLHASHSLHEAQHNFAKMGLKGKSPSVDWKQMLAYKDEVIEGNTKGIEFLFK
FT                   KNKIDWIKGWASIPAAGKVQVGDDTHEAKNIIIASGSEPASLPGVEVDEKTVVTSTGAL
FT                   ELGKIPKSLVVIGAGVIGLELGSVYARLGAEVTVVEFLDVITPGMDGEVQKTFQRILKK
FT                   QGLTFVMGAAVQKTEIARGKAKVTYKLLKKDTEHEIEADTVLVATGRKPYTAGLGLDKL
FT                   GIEMTQRGQIKVGKDWQTNVPGIYAIGDVIEGPMLAHKAEDEGMAAAEQVAGKHGHVNY
FT                   GVIPGVIYTTPEVANVGATEESLKAEGRAYKVGKFMFMGNGRAKANFASDGFVKILADK
FT                   ETDRILGAHIIGPAAGELIHEVCVAMEFGASAEDLALTCHAHPTYSEAVREAALACGDG
FT                   PIHS"
FT   gene            complement(353181..353450)
FT                   /locus_tag="SPO0342"
FT   CDS_pept        complement(353181..353450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93658"
FT                   /db_xref="GOA:Q5LXC9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC9"
FT                   /protein_id="AAV93658.1"
FT                   /translation="MATHALWQADVADFDAWLKVFREDRAMRKAAGIRDLHIWRDPDRA
FT                   DHAVALFEITNLASAQAFFDSEELAMHHERGGIAHITVKLLTPV"
FT   gene            complement(353635..355143)
FT                   /gene="sucB"
FT                   /locus_tag="SPO0343"
FT   CDS_pept        complement(353635..355143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="SPO0343"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93661"
FT                   /db_xref="GOA:Q5LXC8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC8"
FT                   /protein_id="AAV93661.2"
FT                   /translation="MTIEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVT
FT                   VEVPAPAAGVMGDIVAKEGETVGVNALLATITAGEGAAAAPAAPAAAAPAASSGGSVDV
FT                   MVPTLGESVTEATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEIVAAEG
FT                   ATVNASAKLAVISGSASGASPAPAAPAAAVTPAVATGKDIANAPSAEKAMAEAGITPAQ
FT                   VTGTGRDGRIMKEDVTAAVAAAAAAPAPAAAAPAPAAAPRAPALAEDAAREERVRMTRL
FT                   RQTIARRLKDAQNTAAILTTYNEVDMTEVMALRNTYKDAFEKKHGVRMGFMSFFTKACC
FT                   HALKEVPEVNAEIDGQDIVYKNYVHMGVAAGTPQGLVVPVIRDADQMSFAEIEKAIAEK
FT                   GKRARDGKLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMVINGE
FT                   IKIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL"
FT   gene            complement(355147..358104)
FT                   /gene="sucA"
FT                   /locus_tag="SPO0344"
FT   CDS_pept        complement(355147..358104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="SPO0344"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM TIGR00239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93662"
FT                   /db_xref="GOA:Q5LXC7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC7"
FT                   /protein_id="AAV93662.1"
FT                   /translation="MTEQSPNSQFHASSFMQGHNAEYLEQLYARYANDPGAVDAAWAEF
FT                   FRAMGDAETDVKKEANGPSWARADWPPMPADDLTGALTGQWAEIDAKAAGGKIKEQAAK
FT                   AGVPVSDDQIKRAVLDSIRALMIIRAYRIRGHLVADLDPLGMRANTLHPELDPKTYGFA
FT                   DSDMDRPIFIDNVLGLTHASMRQILDIVKRTYCGTFALQYMHISNPEEAAWLKERIEGY
FT                   GKEISFTREGRKAILNKMVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKRGGA
FT                   LGVREIVIGMPHRGRLNILANVMGKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSD
FT                   REFDGNTVHLSLTANPSHLEAVNPVVLGKARAKQDQFGDKDRTSVMPVLLHGDAAFAGQ
FT                   GVVAECFQLSGIRGHRTGGTMHIVVNNQIGFTTAPHFSRSSPYPTDIALMVEAPIFHVN
FT                   GDDPEAVVHAAKVATEFRQKFRKDVVLDIFCYRRFGHNEGDEPMFTNPIMYKKIKSHKT
FT                   TLALYTERLVRDGLIPEGEIEDMKAAFQAHLNEEFEAGKDYKPNKADWLDGRWSHLDKN
FT                   KEEYVRGETAITPETLAAVGNALTRAPEGFSLHRTVERLLETKKAMFDSGTGIDWATGE
FT                   ALAYGSLLTEGYPVRLAGQDATRGTFSQRHSGLISQDSEERYYPLNNIRKGQAQYEVID
FT                   SMLSEYAVLGFEYGYSLAEPNALTLWEAQFGDFANGAQIMFDQFISSGESKWLRMSGLV
FT                   CLLPHGFEGQGPEHSSARLERFLQMCGQDNWIVANCTTPANYFHILRRQLHRTFRKPLI
FT                   LVTPKSLLRHKLAVSRTEEFTTGSSFHRVLWDDAQYGNSDTKLVADDKIKRVVLCSGKV
FT                   YFDLLEERDARGIDDVYLLRIEQYYPFPAHSLINELERFKGAEMVWCQEEPKNQGAWSF
FT                   IEPNIEWVLTRIGAKHTRPTYVGRATSASPATGLASQHKAQQEALVNEALSIEGK"
FT   gene            complement(358122..358784)
FT                   /locus_tag="SPO0344a"
FT   CDS_pept        complement(358122..358784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0344a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG005;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0344a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86005"
FT                   /db_xref="GOA:V5UZC2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:V5UZC2"
FT                   /protein_id="AHB86005.1"
FT                   /translation="MFGPISGQVHGTGAKALVIVLHGDSGPDYITSFAADLARRNPQST
FT                   VIQMARPGYSIAGRRSKGSNSGSRDHYTKQNNNLLAQGISAASQAYPHNRLVVVAHSGG
FT                   AAQTGTLLGTVPGLIDIAVMVSGPFDIPRWRASRGTPWPKSQSPIRYLDQIPRQTKIIA
FT                   VTGQQDSNTQPGLARDYVAKAQARGLNATFTAIPNAGHSFRSLKEPVLAIATREIQS"
FT   gene            complement(358880..359431)
FT                   /locus_tag="SPO0345"
FT   CDS_pept        complement(358880..359431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN82305.1; match to
FT                   protein family HMM PF05656"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93663"
FT                   /db_xref="GOA:Q5LXC6"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC6"
FT                   /protein_id="AAV93663.1"
FT                   /translation="MTFGQSIGTCFAKYITFSGRASRPEYWYFFLFLLLGSIAATMLDA
FT                   LLFDAVTTTVETSDTSTSARIENTGPIAPIFSLAVFLPHLAVAFRRMHDTGRSGIYAIL
FT                   PFLLMLCAVLVLVFGVGIASSFAAGGSLDLLFTRATLLLLIPTLAVLFISPLLVLWWLT
FT                   RPSQPGTNQYGPNPVRAVAS"
FT   gene            complement(359481..360365)
FT                   /gene="sucD"
FT                   /locus_tag="SPO0346"
FT   CDS_pept        complement(359481..360365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="SPO0346"
FT                   /product="succinyl-CoA synthase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P07459; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02629; match to protein family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93664"
FT                   /db_xref="GOA:Q5LXC5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC5"
FT                   /protein_id="AAV93664.1"
FT                   /translation="MAVLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   MEHLGLPVFNSVHEAKHVTEANATVIYVPPPFAADSILEAIDAQMEVIVCITEGIPVLD
FT                   MMKVKRALEGSSSRLIGPNCPGVITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVK
FT                   QTSDIGLGQSTAVGIGGDPIKGTEHIDVLEWFLADDETESIIMIGEIGGSAEEEAAQFL
FT                   KDEAKKGRKKPVAGFIAGRTAPPGRRMGHAGAIVAGGKGGAEDKIEAMRSAGIVVADSP
FT                   ATLGEAVLEAIGK"
FT   gene            complement(360402..360911)
FT                   /locus_tag="SPO0346a"
FT   CDS_pept        complement(360402..360911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0346a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG006;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0346a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86006"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYD5"
FT                   /protein_id="AHB86006.1"
FT                   /translation="MQRAILGIIASAFLVGCTDTSLSTSGGGSTRSQTQVVSYEDAVNA
FT                   FIEACVKTAASPNSAPQAFEALGFGKKENRNGGYDFQSPYATAQVSLRAGVGKTTELGQ
FT                   CQVIPNGGNFQTSAALLSQQISKPSFRAKRVPGNTSWFLGNTGTIAIVSFNKGMMVRTQ
FT                   RLASSQ"
FT   gene            complement(360913..362106)
FT                   /locus_tag="SPO0347"
FT   CDS_pept        complement(360913..362106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0347"
FT                   /product="succinyl-CoA synthase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P07460; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02222; match to protein family HMM TIGR01016"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93665"
FT                   /db_xref="GOA:Q5LXC4"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC4"
FT                   /protein_id="AAV93665.1"
FT                   /translation="MNIHEYQAKALLRSYGAPVSDGRVVLRAEDAKTAAGELDGPLWVV
FT                   KAQIHAGGRGKGKFKEADAGEKGGVRLTKSVEEAAEEAKKMLGRTLVTHQTGPVGKQVN
FT                   RIYIEAGSGIERELYLALLVDRQTSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPVT
FT                   GYQPYHGRRIAFSLGLEGPQVKQCVALMGLLYKAFVEKDMEMLEINPLIVAEGGSLKVL
FT                   DAKVGFDGNAIYRHSDIAELRDTTEEDPKELEASKYDLNYIALDGEIGCMVNGAGLAMA
FT                   TMDIIKLYGAEPANFLDVGGGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDVIAE
FT                   GVVAAVKEVGLQVPLVVRLEGTNVEKGKEIINTSGLNVIAADNLSDGAEKIVKAVKG"
FT   gene            362383..363507
FT                   /locus_tag="SPO0348"
FT   CDS_pept        362383..363507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93666"
FT                   /db_xref="GOA:Q5LXE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE2"
FT                   /protein_id="AAV93666.1"
FT                   /translation="MVPAPSERVARAVMYFREGGSGQASWAVVTTCREPTVLVLAFVAH
FT                   HLALGADYVELYLDAPDPELQEALADLPGCRVTLCDDAYWQQELGGPRPATNEKRQIRN
FT                   ASRAYLQAEADWLLHLDADEFLETDLVMARILGGLPEAVDFLHLPNLERVFDAAEPQEQ
FT                   LFDGYMRAPLLRGWPDQADLLDPAIQPFLHRGVVAHSQGKSAVRVGRKLWPGIHSPRAP
FT                   SGHDRPLLWPAVNARVLHYDGLTGFHWIMKLLRGWTDRGGGAAAHAGLAPARQAQIAYV
FT                   DENRGDMFALLQLHQRLKALPLVDLERLEAIGLLWRPRIDPGAALRALGLTADLSRVGF
FT                   DEGLELDIPDFDRHRIRWRRLYRLHFAEAGRKQG"
FT   gene            complement(363558..364520)
FT                   /gene="mdh"
FT                   /locus_tag="SPO0349"
FT   CDS_pept        complement(363558..364520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="SPO0349"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by similarity to SP:Q59202; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01763"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93667"
FT                   /db_xref="GOA:Q5LXE1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXE1"
FT                   /protein_id="AAV93667.1"
FT                   /translation="MARPKIALIGAGQIGGTLAHLVALKELGDVVLFDIAEGTPEGKAL
FT                   DIAESGPSEGFDAKLKGTQSYADIAGADVCIVTAGVPRKPGMSRDDLLGINLKVMKSVG
FT                   EGIRDNAPDAFVICITNPLDAMVWALQQFSGLPANKVCGMAGVLDSARFRHFLAEEFNV
FT                   SMKDVTAFVLGGHGDTMVPSVRYSTVAGIPLPDLIKMGWTSQEKLDAIVQRTRDGGAEI
FT                   VGLLKTGSAYYAPATSAIEMAEAYLKDQKRVLPCAAYCNGELGVKGMYVGVPTVIGAGG
FT                   IERIIDVSLTKEEQDMFDNSVNAVKGLVEACKGIDGSLA"
FT   gene            364683..365438
FT                   /locus_tag="SPO0350"
FT   CDS_pept        364683..365438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0350"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93668"
FT                   /db_xref="GOA:Q5LXE0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE0"
FT                   /protein_id="AAV93668.1"
FT                   /translation="MLEPDIGFFAVTIPAVIFAGISKGGFGSGVAFASASILAIYLDPG
FT                   QALALMLPLLMLIDLATLKPYWRRWSWPDARLLILGGLPGVALGALLYRATDADLLRLL
FT                   IGGISLAFVAWQMLRGRGWMREFASRLPPAAGLLAGAVAGFTSFVSHAGGPPAAVYLLS
FT                   QRLGKTEFQATTVLTFWALNIAKFVPYAWLGMFTLDTARAGLLLAPFALLGAWLGVRAH
FT                   HMVPERAFFALAHAMLTLTGLKLIWDALV"
FT   gene            complement(365521..365835)
FT                   /locus_tag="SPO0351"
FT   CDS_pept        complement(365521..365835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC45660.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93669"
FT                   /db_xref="GOA:Q5LXD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD9"
FT                   /protein_id="AAV93669.1"
FT                   /translation="MKTMMIKMTMGLGLMALAAGQLQAQGNNCAPRQMVLDQLAQKYGE
FT                   ARRGIGLVQQGSVMEVFASDETGTWTITVTLPNGMTCMVASGQSYEALAEALPTSGNDA
FT                   "
FT   gene            366147..367004
FT                   /gene="citE"
FT                   /locus_tag="SPO0352"
FT   CDS_pept        366147..367004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SPO0352"
FT                   /product="citrate lyase, beta subunit"
FT                   /EC_number="4.1.3.34"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by similarity to SP:P77770"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93670"
FT                   /db_xref="GOA:Q5LXD8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD8"
FT                   /protein_id="AAV93670.1"
FT                   /translation="MDPRQRPYRSVLYIPGSKERALDKARSLPVDAIIFDLEDAVAADE
FT                   KDNARETLKAALAQGGYGARVKIVRINGLDTPWGHADAEAVRDMDADVVLLPKVGGAAD
FT                   VDALAAITGDLPIWAMMETPRGMLNAAQIAAHPLLTGFVMGTNDLAKELQTRFRADRLP
FT                   MMSSLGLCLLAAKAEGLIAIDGVYNAFKDGEGLAAECAQGRDMGFDGKTLIHPAQVEIA
FT                   NTAFAPSEAEIDLARRQIAAFAEVEASGQGVAVVDGKIVENLHVATAREVLAKAEAILA
FT                   LQAG"
FT   gene            367011..367565
FT                   /locus_tag="SPO0353"
FT   CDS_pept        367011..367565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0353"
FT                   /product="NnrU family protein"
FT                   /note="identified by match to protein family HMM PF07298"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93671"
FT                   /db_xref="GOA:Q5LXD7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD7"
FT                   /protein_id="AAV93671.1"
FT                   /translation="MGFVLLILGIAVWWAAHLFKRAMPARRAAMGDRGKGMVALALLGS
FT                   VVLMVIGYRMTDYIHVWAPPSYLTHANNLLVLVAIWMMSPAGTKGKLLHKMRHPMLAGF
FT                   RAWAAAHLLVNGDLASIILFGGLFLWGIVEVAAINAAEPEWTPGEPGTLGKDAMFLVAS
FT                   VVLMAVIGYIHGLVGPWPFPA"
FT   gene            367576..367782
FT                   /locus_tag="SPO0354"
FT   CDS_pept        367576..367782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AE3561"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93672"
FT                   /db_xref="GOA:Q5LXD6"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD6"
FT                   /protein_id="AAV93672.1"
FT                   /translation="MAKLYRLLTEEDTAAFCHKVSDALAKGWELYGSPAYAYDAANGIM
FT                   RCAQAVTKEVEADYSPDMKLGQH"
FT   gene            367782..368810
FT                   /locus_tag="SPO0355"
FT   CDS_pept        367782..368810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25618.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93673"
FT                   /db_xref="GOA:Q5LXD5"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD5"
FT                   /protein_id="AAV93673.1"
FT                   /translation="MAKTNPGRFFEDYTVGQTLHHAVPRTVTNGERALYHALYPARHAL
FT                   YSSDAFAQSCGLPGSPIDDLAAFHVVFGKTVPDVSLNAVANLGYAEGRWLKPVYAGDTL
FT                   RSVSEVIGLKQNSNGKTGVVYVRTRGLNQRDETVMEYVRWVMVRKRDLDAPAPEIVVPE
FT                   LKKALAPNDLVVPEGLDFTAYDFALAGEPHRWGDYAVGETIDHVDGVTVEEAEHMLATR
FT                   LWQNTAKVHFDLTFRPDGRLIYGGHVISMARALSFNGLANAQIIVGLNGGAHANPCFAG
FT                   DTIKAWTEVLDKAETAAPGVGALRLRLVATKGGAPFALHGEDGKYLPEVLLDLDYWVLM
FT                   PK"
FT   gene            368789..369547
FT                   /locus_tag="SPO0356"
FT   CDS_pept        368789..369547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC61369.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93674"
FT                   /db_xref="GOA:Q5LXD4"
FT                   /db_xref="InterPro:IPR025644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD4"
FT                   /protein_id="AAV93674.1"
FT                   /translation="MGADAEIISAFHLGDFGMRFVLSALLCLATPVAADDADFVRSNLT
FT                   AILYHEFGHALIDILGLPVFGQEEDAADVASILLIDALYEEAGATDIAIDAAFGFLAEA
FT                   EAVGDEIAWWDVHGPDLQRYYNLVCLFAGADLESRSDIALELDLPQERLDSCGEEFDIA
FT                   YDSWGPVLDEISGAGQSMTYVGPKAGLSAEVVSEEVAVFNDLFHLPEPLEFRVEPCGEA
FT                   NAYYDPEAVSITLCTEFEDWLFEQAPLTRM"
FT   gene            369582..370244
FT                   /locus_tag="SPO0357"
FT   CDS_pept        369582..370244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0357"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93675"
FT                   /db_xref="GOA:Q5LXF1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF1"
FT                   /protein_id="AAV93675.1"
FT                   /translation="MSFWRVFLFGLFLTPPAAACDLALALAVDVSGSVDEGEYRTQMDG
FT                   LAHALRDPVVSEALVRAEAQLMLVQWTGSDRQRVTIPWTQASSFDALDRFADRVAADPR
FT                   IWRNYSTAIGEALEVTMAAFAQVPDCARHLIDVSGDGPSNEGIEPLAVHRDLRALGITV
FT                   NAIAIEQSEPDLTAYFYENVIVGEGAFVETANGFADYPARIRKKLLREVTQQTAALD"
FT   gene            370463..370849
FT                   /gene="sdhC"
FT                   /locus_tag="SPO0358"
FT   CDS_pept        370463..370849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="SPO0358"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="identified by match to protein family HMM PF01127"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93676"
FT                   /db_xref="GOA:Q5LXF0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF0"
FT                   /protein_id="AAV93676.1"
FT                   /translation="MADVNRGNRPLSPHLSIYRPQLTSITSILTRITGNALLFAALLIV
FT                   WWFLAAATSPEYFAVADGVITSLIGDLVMALSLWGLWYHTLAGIRHLIWDNALGLDLPT
FT                   AEKLGWAVVIGSVLLTILTLVVIA"
FT   gene            370862..371233
FT                   /gene="sdhD"
FT                   /locus_tag="SPO0359"
FT   CDS_pept        370862..371233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="SPO0359"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="identified by similarity to GB:AAC17941.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93677"
FT                   /db_xref="GOA:Q5LXE9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE9"
FT                   /protein_id="AAV93677.1"
FT                   /translation="MRYLTDRKRAVGMGSAKTGTAHFWAMKVSSVALLILIPLFVFTFG
FT                   PMLGEPHQAVLDYFSRPFPAIVAALTLVVGFKHFADGAQVLIEDYVHGLMQKILIILVI
FT                   CLSYAAAATGLFAIARIAL"
FT   gene            371250..373055
FT                   /gene="sdhA"
FT                   /locus_tag="SPO0360"
FT   CDS_pept        371250..373055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SPO0360"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by similarity to SP:P31038; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF02910; match to protein family HMM TIGR01812; match to
FT                   protein family HMM TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93678"
FT                   /db_xref="GOA:Q5LXE8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE8"
FT                   /protein_id="AAV93678.1"
FT                   /translation="MAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPT
FT                   RSHTVAAQGGIAASLSNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEH
FT                   YGVPFSRTEEGKIYQRPFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAE
FT                   FYIEYFAIDLIMSEDGQCQGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMVARAGLALQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYA
FT                   PQYKDLAPRDYVSRSMTMEIREGRGVGKDGDHIHLNLSHLPAEALAERLPGISESAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYWGEVLNPTADNPTAIVPGLMAVGEAGCASVHG
FT                   ANRLGSNSLIDLVVFGRASAIRAGKVVDPEAANPVLNLASVEKAFDRFDGLRNAKGSVA
FT                   TADLRLEMQKTMQADAAVFRTAKTMAEGVEKMTAIAAKMDDLSVTDRSLVWNSDLMETL
FT                   ELTNLMPSALATIVGAEARKESRGAHAHEDFPTRDDENWRVHTISRVEGNKVELSYRPV
FT                   ITEPLTTEEQGGIALKKIAPKERTF"
FT   gene            373055..373336
FT                   /locus_tag="SPO0360a"
FT   CDS_pept        373055..373336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0360a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG016;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0360a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86007"
FT                   /db_xref="UniProtKB/TrEMBL:V5UZ01"
FT                   /protein_id="AHB86007.1"
FT                   /translation="MKIKSLVLDAKRLSLLGALLAAGMVSACGSSPENEAKAAAFRACV
FT                   ADAGISGPFTTSLVRNSAGALSAKVEASGNVTQARADKANACIRAKGL"
FT   gene            373340..374119
FT                   /gene="sdhB"
FT                   /locus_tag="SPO0361"
FT   CDS_pept        373340..374119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SPO0361"
FT                   /product="succinate dehydrogenase, iron-sulfur protein"
FT                   /note="identified by match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93679"
FT                   /db_xref="GOA:Q5LXE7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE7"
FT                   /protein_id="AAV93679.1"
FT                   /translation="MVQLTLPKNSRLTTGKTWPKPEGATNLRKFQIYRWNPDDGQNPRV
FT                   DTYFVDMDDCGPMVLDALIYIKNKVDATLTFRRSCREGICGSCAMNIDGINTLACIYGM
FT                   DEIKGDVKIYPLPHMPVVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRRK
FT                   LDGLYECVMCASCSTSCPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDNLEDPF
FT                   KLYRCHTIMNCAKTCPKGLNPAKAIAEIKKMMVERTV"
FT   gene            374164..376323
FT                   /locus_tag="SPO0362"
FT   CDS_pept        374164..376323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0362"
FT                   /product="type I secretion target repeat protein"
FT                   /note="identified by match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93680"
FT                   /db_xref="GOA:Q5LXE6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE6"
FT                   /protein_id="AAV93680.1"
FT                   /translation="MPTLTELNSEYSVVSSGLAQSGPQNAALSDGRQVVTWQTRTGLLY
FT                   FKIVDSEGKSTGSSTLVSTIVGPNSPSDVKTLSDGSFIVVYTEQISSNNSEIRATRYSD
FT                   TGQKIGTEMNLMTDAREILFAPTVTSLSDGGFAVLSGGYSSSDSDHSTFVRAFDIDGTP
FT                   RGPMAQLDLTTAGKQVFPEAVGVENGGLVAVWTSGTGDGSGTSVKMRLVDGNGVPQGRE
FT                   IQVNQYTPSDQQEPAIARLDDGSVIVVWHSKGQDGSEGSIIARHFSAQGVPQGNEFIVN
FT                   VTRAGEQTLPTVVALNEGGFVVAWTNLTSRPDTMARQYDYNLRPVTGEIKLSQGSLSRD
FT                   IGPELSALSNGGVGFVWMDISVVASLPTLGVEVRTTHPSDFNPTEGNDLLSGDAGNNRI
FT                   FARDGDDWVSPGIGSDTVDGGAGNDMVSFIDHRQAVRVDLSEGRVTSGRDINHLSNVEN
FT                   VTGSSFADYIVGDDGDNRLRGAGSYDWFIGSDGADFYDGGSGRDMVSYVSSSGAVQVDL
FT                   TRGRGQGGMAEGDRYQSIERVTGSSFEDHLTGDAGDNDLRGLGSYDWFVGTAGRDRYDG
FT                   GSGLDMISYASSSAAVSVDLSQGRGTRGDAAKDSYVSVERVTGSSHDDVLIGDDGRNVL
FT                   RGLYGEDTLLGNAGVDRLHGGASDDFLDGGAGWDFAIFDGNRDDYNVTRQGERTLVERV
FT                   SPGNEGIDTLVNIEVIQFQDDFLYL"
FT   gene            376576..376791
FT                   /locus_tag="SPO0363"
FT   CDS_pept        376576..376791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93681"
FT                   /db_xref="GOA:Q5LXE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE5"
FT                   /protein_id="AAV93681.1"
FT                   /translation="MCPEFKLRRREGPNLTQRMTPMKAANKPASPQIPAHQALALLEQA
FT                   WAYYTPEPVPAAQEEQPDLFQYANAA"
FT   gene            377206..378387
FT                   /locus_tag="SPO0364"
FT   CDS_pept        377206..378387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0364"
FT                   /product="decarboxylase, pyridoxal-dependent"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93682"
FT                   /db_xref="GOA:Q5LXE4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE4"
FT                   /protein_id="AAV93682.1"
FT                   /translation="MEMTLNAVVTGPLACESATLSRAETFILANRFDRPTLVIDTQAVA
FT                   RQFAALAQGLGRAGIHYAVKANPLPEILSTLARLGSNFDAASRVEIELCLAAGASADRI
FT                   SFGNTVKKPADIAWAHAAGIALFAADAEDELDKIAAHAPGAKVYIRMIVEACQADWPLS
FT                   RKFGCAPDKAIAVLDYARSVGLDPVGLSFHVGSQTRRAEMWVPVLDQVAAVWHAARAAG
FT                   HDLSLLNIGGGFPAFYGQEVDAPELYAAEVIRLVGERFGDVGQIMAEPGRGMVAEAGAI
FT                   AAEVLLVSRKSGHDLHRWVYLDIGKFSGLAETMDEAIRYQFLTEREHEPTGPCILAGPS
FT                   CDSADVLYEKKPVQLPLGLRDGDRIVIRNCGAYTSTYASVGFNGFPPLDVVAI"
FT   gene            378468..379325
FT                   /locus_tag="SPO0365"
FT   CDS_pept        378468..379325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G97525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93683"
FT                   /db_xref="GOA:Q5LXE3"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="PDB:3DI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE3"
FT                   /protein_id="AAV93683.1"
FT                   /translation="MTDAPADAPLDADARRAVKPVICYPNDSLPRPDLALYRAARASAR
FT                   KTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHGT
FT                   HVTTGERLWSNLPYLRPMATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHY
FT                   HHCCHSNLTRALADHTGLPLHEAEMLVHDVLNVFMCTGFTRDTGQYFMKASPVRPGDYL
FT                   EFFAEIDLLGNLSACPGGDCSSEHSSDTASCHPLLVEIFAPAEGMLGDWPSPSVNGYDR
FT                   SHGR"
FT   gene            complement(379410..380120)
FT                   /gene="deoD"
FT                   /locus_tag="SPO0366"
FT   CDS_pept        complement(379410..380120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="SPO0366"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by similarity to SP:O34925; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93684"
FT                   /db_xref="GOA:Q5LXG0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG0"
FT                   /protein_id="AAV93684.1"
FT                   /translation="MTIHIGANPGEIAETVLLPGDPYRAKWAAETFLDNPVLVNEVRGM
FT                   LGFTGMWRGNRVTIHGSGMGMPSLSIYANELIRDYGAKTLIRIGSCGGMQDSVEVRDVI
FT                   LAMTASTLGTPSRGIFRELSFAPCADWSLLHAAARAAEDKGVRTHVGGIYSSDVFYDER
FT                   PDLNEQMVRHGVLGVEMEAAELYILAARHKCRALAVLTVSDHLLTGAALPSAERETSFG
FT                   DMVEIALHAAFPGA"
FT   gene            complement(380136..380453)
FT                   /locus_tag="SPO0367"
FT   CDS_pept        complement(380136..380453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0367"
FT                   /product="DNA-binding protein, H-NS family"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93685"
FT                   /db_xref="GOA:Q5LXF9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF9"
FT                   /protein_id="AAV93685.1"
FT                   /translation="MGIDLSGMSRKELISLRDQVDGAIKAAEQRERQEALKAAEKAAAE
FT                   FGFSLSELSGEARRSTKGTKAQAKYRNPANPEQTWSGRGRKPQWVHDAIQGGADISELE
FT                   I"
FT   gene            complement(380565..382565)
FT                   /locus_tag="SPO0368"
FT   CDS_pept        complement(380565..382565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0368"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="identified by similarity to SP:Q49115; match to
FT                   protein family HMM PF01642; match to protein family HMM
FT                   PF02310; match to protein family HMM TIGR00640; match to
FT                   protein family HMM TIGR00641"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93686"
FT                   /db_xref="GOA:Q5LXF8"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF8"
FT                   /protein_id="AAV93686.1"
FT                   /translation="MSQMQKDRQTANPDRKADRPWLIRTYAGHSTAKASNTLYRNNLSK
FT                   GQTGLSVAFDLPTQTGYDSDHVLARGEVGKVGVPICHLGDMRVLFDQIPLEQMNTSMTI
FT                   NATAPWLLALYIAVAEEQGADVSKLQGTVQNDLIKEYLSRGTYVCPPKPSLKMIADVAE
FT                   YCYTNVPKWNPMNVCSYHLQEAGATPEQELAYALATAIAVLDELKPRVPAEDFPALCGR
FT                   ISFFVNAGIRFVTEMCKMRAFVDLWDEILESRYGVSDPKFRRFRYGVQVNSLGLTEQQP
FT                   ENNVYRILIEMLAVTLSKKARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAYETDLL
FT                   EFGDLFDGNPVVDAKVEELKAGARAELANLDSMGGAVASIEYMKSRLVDSNAERLNRIE
FT                   RNETVVVGVNRWTEGEPSPLQTEDGGIMVVDPAVEQEQIARLESWRADRDDAAVAAALE
FT                   ALRAAARTGANVMEPSIAAARAGVTTGEWAEEMRKAYGTYRGPTGVSGSVSNKTEGLED
FT                   LRAAVDAASDKLGRRLKFLVGKPGLDGHSNGAEQIAFRARDCGMDISYDGIRLTPEELV
FT                   ASALDQQAHVVGLSILSGSHLPLVEEVMERMKKAGLAHIPVIVGGIIPDEDSQKLRAMG
FT                   VAKVYTPKDFELNGIMGDIVTLVSDTEIAAE"
FT   gene            382532..384115
FT                   /locus_tag="SPO0369"
FT   CDS_pept        382532..384115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0369"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by similarity to SP:P00482; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93687"
FT                   /db_xref="GOA:Q5LXF7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF7"
FT                   /protein_id="AAV93687.1"
FT                   /translation="MQSDGLFASATWTALRFWFGNKVSLEGSKSQFSGHVNSLHRGNHR
FT                   AHQTIVRPRIWWQGAGMTQTVELPLWLFVLIVLFAAVTFASHFLFPSVRWFFRRRLERA
FT                   VARLNTRLARPIQPFKLARRHDMIQRLIYDPEVARAVRDQAQAEGIPEAVAFEQAQRYA
FT                   REIVPGFSAFAYFSFAIRLARFLSNALYRVRLRHVDAEALRAIDPEATVVFVMNHRSNM
FT                   DYVLVTYLAAEQSALSYAVGEWARVWPLSRLIRAMGAYFIRRKSRSDLYRKVLAAYVRH
FT                   ATDAGVTQAMFPEGGLSLSGGLGRPKLGLLKYIVDGAIPEGRDVVFVPVSINYDRVLED
FT                   TILTAAASRGERRFRARIGVITMWFLKQMWWRMTGRFHRFGYAAVSFGRPLSLSEFRVR
FT                   TKGDPTVPLARELMSRIGVVVPVLPVPLVAWLILRNGPMTRSALAAGFDKVLAALPHAH
FT                   IHMPRDDRHYAIEVGLRQLIERRIIVETDGRFGPGTERQDLLTYYAASIAHLMDGGAAY
FT                   AEELSAIAGS"
FT   gene            384226..385512
FT                   /gene="ccrA"
FT                   /locus_tag="SPO0370"
FT   CDS_pept        384226..385512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrA"
FT                   /locus_tag="SPO0370"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR01751"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93688"
FT                   /db_xref="GOA:Q5LXF6"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF6"
FT                   /protein_id="AAV93688.1"
FT                   /translation="MALDTDSGIASYAAPEKDLYEMGEIPPMGFVPKKMYAWAIRKERH
FT                   GDPDTAMQVEVVDVPTLDSHEVLVLVMAAGVNYNGVWASKGVPISPFDGHGQPYHIAGS
FT                   DASGIVWAVGDKVKRWKVGDEVVIHCNQDDGDDEHCNGGDPMYSPSQRIWGYETPDGSF
FT                   AQFTNVQAQQLMPRPKHLTWEEAACYTLTLATAYRMLFGHEPHDLKPGQNVLVWGASGG
FT                   LGSYAIQLINTAGANAIGVISDESKRQFVMDLGAKGVINRKDFNCWGQLPTVNTPEYAE
FT                   WFKEARKFGKAIWDITGKGVNVDMVFEHPGESTFPVSTFVVKKGGMVVICAGTSGYNLT
FT                   FDVRYMWMHQKRLQGSHFAHLKQAMAANQLMVERRLDPCMSEVFTWADLPEAHMKMMRN
FT                   EHKPGNMSVLVQSPRTGLRTLEEVLDARG"
FT   gene            385883..386602
FT                   /gene="luxR-1"
FT                   /locus_tag="SPO0371"
FT   CDS_pept        385883..386602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR-1"
FT                   /locus_tag="SPO0371"
FT                   /product="autoinducer-binding transcriptional regulator
FT                   LuxR"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93689"
FT                   /db_xref="GOA:Q5LXF5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF5"
FT                   /protein_id="AAV93689.1"
FT                   /translation="MGRKVNLNPILEDLDATSALEDLERVTIKLRDTLEIDHIVYHWVD
FT                   SAGDQYGCATYPKAWQERYLERNYHRIDPVILGCFQRFHPVDWKRLDWSGKVAKAFLQD
FT                   ALKHGVGNQGYSIPIRGPNGQFALFTVNHVCDDQAWSEFTEIYGRDLILIAHFFNRKAL
FT                   EFERSRQPDQPRNLSPREVDAMTLLALGYSRAQVAHSLSISEHTLRVYIESARFKLGAL
FT                   NTTHAIATAMSRGLIVV"
FT   gene            386685..387323
FT                   /locus_tag="SPO0372"
FT   CDS_pept        386685..387323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0372"
FT                   /product="autoinducer synthesis protein"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93690"
FT                   /db_xref="GOA:Q5LXF4"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF4"
FT                   /protein_id="AAV93690.1"
FT                   /translation="MLRYLYADELHQYPKLARSMFLDRADQFKTRLGWDVHVNEDGEER
FT                   DQYDALNPLYVIWEEPDGSHGGSMRFLPTTGPVMINDVFGHLTGGSPICSPLIWEVTRF
FT                   CMSRRASSRVAGAIMLSGGEVMEGFGLTHIAGVFDERMIRIYRLIGSSPEVLGSEGEGR
FT                   DRISVGLWPFSPADCARVSERAGISRELSRLWFNRAFGKVNRRRFAQTG"
FT   gene            387521..388918
FT                   /locus_tag="SPO0373"
FT   CDS_pept        387521..388918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0373"
FT                   /product="helicase, ATP-dependent, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93691"
FT                   /db_xref="GOA:Q5LXF3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF3"
FT                   /protein_id="AAV93691.1"
FT                   /translation="MAVIGKAGSGKTLLLAELCKALTTAGVQVVSGDYEGRKSKDRRTL
FT                   AVLAPTNKAASVLRLRGVPATTIHRILYTPVYDPDYERIAEWLAGNGERPEIEGLSDEA
FT                   LDRAAAFYARNSSIPGALAAAGLRGSDFITGWKRREEPLDIGFIDEASMLDDRQFEDLK
FT                   EIFPTLILFGDPAQLAPVNQSGSMVFDALPEPRKLTLSRIHRQEADNPILDLAHALADP
FT                   AVDFEAFERMVEDKARQDDRVVWGGRVEVDLMARSPVLVWRNATRIRLINAFRSVHGAP
FT                   ETELLEGEPLICDGIELPLKHRKKRLDLEARGLIKGAQVIYLGPGRKPGFSRLHVMGAE
FT                   DPQVSAASIVKIEKPDEEEPFIPFAARMGATFLHGAAVTIHKAQGSQWETVQVFAPDIY
FT                   AAARAGRVEAGQPLWKRLAYVAITRAQERLIWVVRNRLSKPTYPLRVDDLRQAAAPVLT
FT                   LEEEQEA"
FT   gene            complement(389073..389870)
FT                   /locus_tag="SPO0374"
FT   CDS_pept        complement(389073..389870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE26256.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93692"
FT                   /db_xref="GOA:Q5LXF2"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF2"
FT                   /protein_id="AAV93692.1"
FT                   /translation="MAPQGGIEMHRILLAALLLLAAPLTATATEEQVVLGLSRDRVAIT
FT                   ADFDGSDILIFGAIKRETPIPDGDPLQVIVAVSGPSAPVLVRRKEKKLGIWVNTDSVLV
FT                   DSAPSFYAAATSAPFSQALSDTEDLRHRVSIRRAIRSVGADMNIADAQEFTRAVMRIRQ
FT                   NEGLYSIRENTVAVDEQTLFRTEIDMPANLTEGEYIARIFLTRGGRVVSSFQTTIDVRK
FT                   VGLERFLFNLAHQQPVLYGLMSLAIAIAAGWGASAAFRALRGN"
FT   gene            complement(389848..390798)
FT                   /locus_tag="SPO0375"
FT   CDS_pept        complement(389848..390798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0375"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93693"
FT                   /db_xref="GOA:Q5LXG6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG6"
FT                   /protein_id="AAV93693.1"
FT                   /translation="MAGHAGLTKNMQIYLPIAEVSVNAFLLLGLGGMVGILSGMFGVGG
FT                   GFLMTPLLFFIGIPPAVAVATEANQIVASSFSGVLAHFRRRTVDFRMGTILLIGGLSGA
FT                   ALGVVLFNYLKSLGQVDLLVKLCYVVFLGIIGGLMFIESLNAIRKSRKAGGAVPKRRQR
FT                   GWIHAMPFKMRFRTSGLYISVIPPIVVGLLVGVLSAIMGVGGGFIMVPAMIYLLGMPTK
FT                   VVVGTSLFQIIFVTAFTTMLHATTNYTVDVVLAVLLLVGGVIGAQIGTVIGARMKAEQL
FT                   RILLAGLVLAVCAKLALDLLLMPSELYSLGASGGH"
FT   gene            complement(390860..391828)
FT                   /locus_tag="SPO0376"
FT   CDS_pept        complement(390860..391828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0376"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93694"
FT                   /db_xref="GOA:Q5LXG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG5"
FT                   /protein_id="AAV93694.1"
FT                   /translation="MMDFLTIIQVLDSTIRLSTPLLLACLAGLYSERAGIFDIGLEGKM
FT                   LMAAFFSAAVAAVSGSVWLGLLAGIASSLVLAGLHGLASITFRGNQLISGVAINFLAAG
FT                   MTVLVAQDWFKQGGRTPSLFGGARFEPIDWPLAETLSGIPVLGPIYAELLSGHSVLVYL
FT                   AFLAVPGTWWLLYRTRFGLRLRAVGENPAAVDTAGVSVVGLRYAAVMICGVLCGIAGAY
FT                   LATALQAGFVKDMTAGRGFIALAALIFAKWRPLHAMWACLLFGLLQAVALRFQNIDLGG
FT                   VVIPVQVMDALPYILTVVILAGFVGKAIPPRAGGEPYVKER"
FT   gene            complement(391825..392919)
FT                   /locus_tag="SPO0377"
FT   CDS_pept        complement(391825..392919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0377"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93695"
FT                   /db_xref="GOA:Q5LXG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG4"
FT                   /protein_id="AAV93695.1"
FT                   /translation="MDKMPKWADVVLIPLISLILAAILSALVILGIGEDPVAAVNMMVS
FT                   GALGSTYGWGYTLYYATNFMFTGLAVAVAFHARLFNIGGEGQAMLGGLGVAMICLYIPW
FT                   PHWTMALLAACAASMLFGAVWAAIPAYLQARRGSHIVITTIMFNFIAAALLNYMLVNVM
FT                   RPDGSMDPASERFPAAVHLPTLHELLAPIGISFSKAAPANVSLLVAVLACVVVWALIWR
FT                   TRLGYEIRAYGHSESGALYAGISPFKITMVAMLISGALAGLMATNNVMGEAERLVLNST
FT                   EGAGFIGIAVALMGRSHPFGVFLAAILFGFLYQGGAELALWTNIPRELIVVIQALVILF
FT                   TGALDNMVRMPLEKVFLALRKGNA"
FT   gene            complement(392919..394448)
FT                   /locus_tag="SPO0378"
FT   CDS_pept        complement(392919..394448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0378"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93696"
FT                   /db_xref="GOA:Q5LXG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG3"
FT                   /protein_id="AAV93696.1"
FT                   /translation="MTVPAIELKGISKSFGPVQANKDISISVAPGTIHGIIGENGAGKS
FT                   TLMSILYGFYKADKGEIWINGKKTEIPDSQAAIAAGIGMVFQHFKLVENFTVLENIILG
FT                   AEDGGLLKPSLAKARRTLAELAAEYELNVDPDAVIEEIGVGMQQRVEILKALYRQAEIL
FT                   ILDEPTGVLTPAEADQLFRILHRLKDEGKTIILITHKLREIMEATDTVSVMRRGEMTAT
FT                   VKTAETSPEHLAELMVGRKVLLRVDKVPAKPGKPILEIENLRVTDEKGVERVKGIDLTV
FT                   RAGEILGIAGVAGNGQSELLEVLGGMRPGSGAIRLNGAPLPLSGPGSDARARRTAHVAH
FT                   VPEDRQREGLIMDFHAWENVAFGYHHDPAYQSGIFMNNAALRADTERKIEKFDVRPADG
FT                   WLAAKNFSGGNQQKIVVAREIERNPDLLLVGQPTRGVDIGAIEFIHKQIVALRDQGKAV
FT                   LLVSVELEEIFGLADRIAVMFDGHIMGERLPDETDEKELGLLMAGVNGEAA"
FT   gene            complement(394572..395570)
FT                   /locus_tag="SPO0379"
FT   CDS_pept        complement(394572..395570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0379"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93697"
FT                   /db_xref="GOA:Q5LXG2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG2"
FT                   /protein_id="AAV93697.1"
FT                   /translation="MTLMKSLMGAAAAMALTAGAALAEPALIFDLGGKFDKSFNEAAFN
FT                   GAQRWAEETGGSFREIELQSEAQREQALRRFAEAGANPVITMGFAMADPLSAVAADYPD
FT                   TKFVAVDVTWLDAPNIRQIGFAEHEGSYLVGMMAAMASKSGTVGFVGGMDIPLIRHFGC
FT                   GYAQGVKAVNPDVKIVANMTGTTPAAWNDPVKGSELTKAQISQGADVVYAAAGGTGVGV
FT                   LQTAADEGILSIGVDSNQNHLHPGKVLTSMLKRVDVAVYDAMKAGENLETGVFNMGLAE
FT                   EGVGYALDDNNAALISGEMKAAVDQARQDIIDGKLNVVSYYENDSCPALKF"
FT   gene            complement(395729..396142)
FT                   /locus_tag="SPO0380"
FT   CDS_pept        complement(395729..396142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0380"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /note="identified by similarity to SP:P09453; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93698"
FT                   /db_xref="GOA:Q5LXG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG1"
FT                   /protein_id="AAV93698.1"
FT                   /translation="MTPTELARLHARAFTQSRPWSESEFAALLGNPHTHLVGDLRCFAL
FT                   FQVIAGEAELLTIATDPDQRRQGLARACMDAWQAQAARAGATRALLDVAADNDPAIALY
FT                   TACGYAPCGLRRGYYRRPSGETADAIVMERPLP"
FT   gene            complement(396139..396729)
FT                   /locus_tag="SPO0381"
FT   CDS_pept        complement(396139..396729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0381"
FT                   /product="protease, putative"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93699"
FT                   /db_xref="GOA:Q5LXH1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH1"
FT                   /protein_id="AAV93699.1"
FT                   /translation="MPSDPVILAFDTSAAHCAAALLVGDRIVAATAEEMTRGQAERLMP
FT                   LLEEVLAGAGLGWHDLDAIGVGIGPGNFTGIRISVSAARGLALGLGIPAVGVDGFEARA
FT                   LLTPLGVHPAIPAPRDHVYLAPDGGTPQLLPRDQAEALGPLQAEYSPQGLAEAIARAAA
FT                   PRWRDATIPPAPLYVRPADAAPSRDRPPVLLDP"
FT   gene            complement(396719..397282)
FT                   /locus_tag="SPO0382"
FT   CDS_pept        complement(396719..397282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0382"
FT                   /product="nifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93700"
FT                   /db_xref="GOA:Q5LXH0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH0"
FT                   /protein_id="AAV93700.1"
FT                   /translation="MFIQTESTPNPATLKFLPGQTVLEVGTADFPSAEAAEKSPLAARI
FT                   FAVSGVTGVFFGNDFVTVTKAEGVEWDHIKPAILGAVMEHYQSGQPVMGADAQTGSGHA
FT                   EHSGEDAEVVTQIKALLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLT
FT                   LKMGIENLLRHYIPEVTEVRPVAV"
FT   gene            complement(397406..398020)
FT                   /locus_tag="SPO0383"
FT   CDS_pept        complement(397406..398020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0383"
FT                   /product="acyl carrier protein phosphodiesterase, putative"
FT                   /note="identified by similarity to SP:P41407; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93701"
FT                   /db_xref="GOA:Q5LXG9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXG9"
FT                   /protein_id="AAV93701.1"
FT                   /translation="MTKLLQIIASPRGGDSKSNALADAFVAAQRAKDSTLQVDHLDLWA
FT                   EDLPAFDGDPAAAKMTFFGVGQMDPSKEQAWSAVARITERFMSADHVVMGVPMWNGGIP
FT                   YRLKHYIDIITQPGMLFGFDPDNGYSGLLRNRKATVVTTSGVWSEGADARFGSDFHSTY
FT                   LKWWFETIGITDVTFVRYQPSLLTDDPQAGYDRALAALTAA"
FT   gene            398149..398739
FT                   /locus_tag="SPO0384"
FT   CDS_pept        398149..398739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89223.1; match to
FT                   protein family HMM PF07336"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93702"
FT                   /db_xref="GOA:Q5LXG8"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG8"
FT                   /protein_id="AAV93702.1"
FT                   /translation="MQTALPPPYLIADDPGLELLNSTGAPYGTEIDWLQNGTEMLAWMQ
FT                   AVGLLGATEAELVRSTLGARELDAAASDLRDLRAMFRENVPVASAGFVDRLNACLAETS
FT                   GHARIVMTEAGTQELQHVQRFRTGRDLVGLCALAIAELLSQGESGRTRQCGGPTCTYWF
FT                   RDVSKNNRRRWCSMAVCGNRAKVATHRARARSE"
FT   gene            complement(398793..399386)
FT                   /locus_tag="SPO0385"
FT   CDS_pept        complement(398793..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0385"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93703"
FT                   /db_xref="GOA:Q5LXG7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG7"
FT                   /protein_id="AAV93703.1"
FT                   /translation="MGKRIAFWFEFASTYSYLSAMRIERAAADLGVTIAWEPFLLGPIF
FT                   AAQGWTSSPFNLFPAKGRYMWRDMERLCARQGLPLTRPDPFPQNGLPAARLAMVAREMG
FT                   HIAPFVRAVYAAQFGRGLVISDPQVLAECWAEAGLPPEAMEQAKSPEIKAALFAQGERA
FT                   AALDLFGAPSFVVGEEVFWGDDRLDQALALAAQS"
FT   gene            complement(399394..399864)
FT                   /locus_tag="SPO0386"
FT   CDS_pept        complement(399394..399864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0386"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93704"
FT                   /db_xref="GOA:Q5LXH7"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH7"
FT                   /protein_id="AAV93704.1"
FT                   /translation="MWRTEMRKFLVVLDDSRECLNAMRFAAMRAAHTGGGVAILSIIPP
FT                   DEFNHWIGVGEVMREEARERIHAHFEVFAKWMRDKQGVEPELVIREGEAVPEIIAHVQE
FT                   DPEIGVLVLGAGTDKKGPGPLVSQLSRSSGSLPIPITIVPGDLSKEKLEAIT"
FT   gene            complement(399889..400953)
FT                   /locus_tag="SPO0387"
FT   CDS_pept        complement(399889..400953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0387"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93705"
FT                   /db_xref="GOA:Q5LXH6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH6"
FT                   /protein_id="AAV93705.1"
FT                   /translation="MIAQIGDPRRDLLTLAVGALGALIATLVHMPMALLAGPAVAVSLA
FT                   GLCGLSLHISPRLRDAGFLVIGLSIGSLVGPESIEAMMRWPVAFGLLAGLTLATPWAGR
FT                   WLIPRLLPIDRDEAFLAAAPGHLSLVIALADSLQLSLTRPVVLASIRLMALTLLVPLAA
FT                   SLAGIEIGPGLPQLAAVTPWAWILGQIVAALLLAPVLKALKLPAHVLIAGIVVAATTHL
FT                   AGWTAGGLPGWAAQASLILMGAMIGSRFGGMGWRELRQSLTAGLAIVVLTTGLATLAAL
FT                   PAAYLSGLPLLDVLLGFSPGGLETMIILSAALGADPSFVAAAHLFRLSVLAVVLTLYAT
FT                   DVARRGQGKSDGQR"
FT   gene            complement(400950..401813)
FT                   /locus_tag="SPO0388"
FT   CDS_pept        complement(400950..401813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0388"
FT                   /product="aminotransferase, class IV"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93706"
FT                   /db_xref="GOA:Q5LXH5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH5"
FT                   /protein_id="AAV93706.1"
FT                   /translation="MATGSNIRTYFQGSWHEGDAPIIRAADHGAWLGSGVFDGARYFDG
FT                   MAPDLEAHCARVNRSAEALMLTPTVSTQDMVEIVREGLKAYGPDQAVYIRPMYWGIDGD
FT                   PTAIIPQADSTGFAVCLEEIPMAPATASATLTTTRFRRPVLEDAVVNAKAGCLYPNNAR
FT                   MLREARSKGFTNALVADALGNVAETATANIFMVKDGEVFTPIANGTFLAGITRARHIKN
FT                   LRADGVPVHETVLSFADFHAADEVFMSGNMSKVTPVTALDDTQYQIGPIARRARALYWD
FT                   WAKSTA"
FT   gene            complement(401873..402334)
FT                   /locus_tag="SPO0389"
FT   CDS_pept        complement(401873..402334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0389"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93707"
FT                   /db_xref="GOA:Q5LXH4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH4"
FT                   /protein_id="AAV93707.1"
FT                   /translation="MDQIDHRIVRALQRDGRMTISDLADKVGLSPTPCARRLERLQRDG
FT                   VITGYSARVDPAKLGLGVSVFVSVELERQERAAVDAFERAIRTCDEVMECYLMTGSRDI
FT                   LLRVLVADLAAFDAFLENRLMQIPGIRNLRSNFALRTMVQRDSLPAIRR"
FT   gene            402464..403513
FT                   /locus_tag="SPO0390"
FT   CDS_pept        402464..403513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0390"
FT                   /product="glutamate/leucine/phenylalanine/valine
FT                   dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00208;
FT                   match to protein family HMM PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93708"
FT                   /db_xref="GOA:Q5LXH3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH3"
FT                   /protein_id="AAV93708.1"
FT                   /translation="MQITPVAAPEHEQVVRIADPESGLLGFIAIHSTRRGPAAGGVRMR
FT                   PYAQEADALNDALRLSRGMTYKNAAAGLDLGGGKAVIMADPATQKTPDLLAAFGSAVET
FT                   LAGRYWTAEDMGMTPADMARIGTRTTCVAGLADGDFASGDPSPITARGIFYAIRTAAKH
FT                   RLGSVDLTGRTVAVQGLGHVGHYLCGYLHQAGANLIVTDIDRAQVARVAERYGATAVAP
FT                   DAIYGVEADIFAPCAIGAILNAETIPQLKVRVVAGGANNQLATPEDATRLHDLGILYAP
FT                   DYVANGGGIINVATEILKISGREAWVASRLAALDDTMDRILTRARILSVSPAEVADATV
FT                   DEILQAKAA"
FT   gene            complement(403532..404017)
FT                   /gene="bphC3"
FT                   /locus_tag="SPO0391"
FT   CDS_pept        complement(403532..404017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bphC3"
FT                   /locus_tag="SPO0391"
FT                   /product="biphenyl-2,3-diol 1,2-dioxygenase III"
FT                   /EC_number="1.13.11.39"
FT                   /note="identified by similarity to SP:P47233; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93709"
FT                   /db_xref="GOA:Q5LXH2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH2"
FT                   /protein_id="AAV93709.1"
FT                   /translation="MTYSAPAGTCVGHVHLKVSDLDRAIAFYRDVLGFEVQQRYGDAAA
FT                   FLGAGGYHHHIGLNTWHSRGGPQPPARATGLYHSAFLYPDRKALGTVLRQVIEAGIPID
FT                   GSADHGVSEAVYLRDPDGNGVELYRDRAPEDWPRDGEGNLAMTNAPLDIPALLAEAG"
FT   gene            complement(404139..405155)
FT                   /gene="trpS"
FT                   /locus_tag="SPO0392"
FT   CDS_pept        complement(404139..405155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="SPO0392"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by similarity to SP:P00953; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93710"
FT                   /db_xref="GOA:Q5LWF0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF0"
FT                   /protein_id="AAV93710.1"
FT                   /translation="MTETQFTPRVFSGIQPSGNLHLGNYLGALKRFVDMQGPEMETVYC
FT                   MVDLHAITVWQDPKELAHSTRELCAGFIAAGIDPEQSILFNQSQVPEHAQLAWIFNCVA
FT                   RMGWMQRMTQWKDKAGKNQQNASLGLFAYPSLMAADILIYHATHVPVGEDQKQHLELTR
FT                   DIAIKFNNDFGVDFFPVTEPVIEGAATRVMSLRDGTKKMSKSDPSDMSRINMTDDADAI
FT                   AQKIRKAKTDPDALPSEIDGLEGRPDARNLINIYAALADRSVEQVLADVGGKQFGEFKP
FT                   MLAELAVAKLSPISSEMARLMNDQAEIDRILARGAERARAITAPILKRTYEIVGMVS"
FT   gene            405115..405927
FT                   /locus_tag="SPO0393"
FT   CDS_pept        405115..405927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0393"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93711"
FT                   /db_xref="GOA:Q5LWE9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE9"
FT                   /protein_id="AAV93711.1"
FT                   /translation="MPENTRGVNWVSVMMGNSRLENSVPVAYPWGKGTSTAAKGPPMSS
FT                   DNDTSPVNPLPPVVVALVLFIMGIEITFSLGARGIVGGPQAVGWRLAAMQSYAFSPDIL
FT                   TWMWETGRWPVEHVIRLVSYPFVSVSFTQSLFVCVFVLAMGKMVAESFGSLAMLVVFLV
FT                   SGIGGALGYALLTGSPVALIGGFPPVYGLIGAFTWLLWRKLSLVGQHQARAFSLIAFLM
FT                   GAQLLFGLLFGGGLDWVADLAGFATGFALSFLLSPGGWARMRGRIRHD"
FT   gene            complement(405948..406139)
FT                   /locus_tag="SPO0394"
FT   CDS_pept        complement(405948..406139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE09894.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93712"
FT                   /db_xref="GOA:Q5LWE8"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE8"
FT                   /protein_id="AAV93712.1"
FT                   /translation="MTRNEGTLDRAARIILGLVLLSLTVIGPKTMWGLVGLIPLLTGLV
FT                   GSCPLYTILGLNTCPLKK"
FT   gene            complement(406211..406795)
FT                   /locus_tag="SPO0395"
FT   CDS_pept        complement(406211..406795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0395"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93713"
FT                   /db_xref="GOA:Q5LWE7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE7"
FT                   /protein_id="AAV93713.1"
FT                   /translation="MSALDCPAGTVLFRAGQDCPGFLRLDEGSIRVTLTAANGREVVLY
FT                   RVRPGDVCLQTFACLTEGRSYSAEGVAETRVRGHLMSHADFRTALARDEAFRTEVMQAV
FT                   ARRFADFEHLVEDVALTGFDTRLARVLLRLAKGDTVAATHEALAAETASGRAFVSRRLA
FT                   EFARQGLVELARGRVTLCDRSGLERIAAEER"
FT   gene            complement(406792..408333)
FT                   /gene="mviN"
FT                   /locus_tag="SPO0396"
FT   CDS_pept        complement(406792..408333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="SPO0396"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by similarity to SP:O05467; match to
FT                   protein family HMM PF03023; match to protein family HMM
FT                   TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93714"
FT                   /db_xref="GOA:Q5LWE6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE6"
FT                   /protein_id="AAV93714.1"
FT                   /translation="MKPIRLMAGFFTVGFWTLASRILGFAREILLAAYIGPGPVMDAFV
FT                   AAFRLPNLFRRFFAEGAFNAAFVPMFSKRLEGGEDAEGFAQQAFNLLGAAVLTLVALAM
FT                   IFMPALIWATASGFVGDERFDLAVGYGKIAFPYILFMSLAALFSGVLNATGRFAAAAAA
FT                   PVLLNVFACAAMLAGSALGGEVIDWLIWVIPVAGVAQLALVWVAAERAGIRLRPGLPRL
FT                   SPAMRRLVRVAFPAALAMGVTQINLVVGQLVASRTESAVSWLFTADRLYQLPLGVVGIA
FT                   VGIVLLPDLSRRLRAGDDTGAREAYSRAGEFSLILTLPSAMALMAIPLPLVAVLFQRGA
FT                   FTPEDSAATAIAVAIYGLGLPAFMLQKVFQPLFFAREDTKSPFRYAVVAMVINAVLAFA
FT                   LYPLLGWIAPAIATTVAGWTMVAQLALGARRMGEVARFDTRFHGRAWRILMASLIMGAA
FT                   LYAVLIPLGWVFDLPSWRYLGLLALILFAAVVYFGVGHLIGAFRLSEFRRALRRS"
FT   gene            complement(408330..411056)
FT                   /gene="glnD"
FT                   /locus_tag="SPO0397"
FT   CDS_pept        complement(408330..411056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SPO0397"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93715"
FT                   /db_xref="GOA:Q5LWE5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWE5"
FT                   /protein_id="AAV93715.1"
FT                   /translation="MFDTPAVFARITEAAAEAADNAALRGAVVAILRDVQNAGRAAIAE
FT                   GFAEDPFAARPLTRAYTYLTDGMVKTAMYVASEILHPLATPTQGERIAVLAVGGFGRGE
FT                   MAPFSDVDLLFLTPYKITAWAESVIESMLYILWDLRLKVGHSSRTVKDCIRLGRDDFTI
FT                   RTAMLEHRFLAGHAPLARSLDQRLKSELYKDTQREFIEAKLEERDARHRKQGERYMVEP
FT                   NVKEGKGGLRDLQSLYWIAKYIYEVKETAELVPLGLFTPSEYRTFVQAEEFLWAVRAHL
FT                   HLVTGRATEQLTFDLQVEVAARMGYQDRAGRRGVEVFMQKYFREATRVGELTRIFLTKL
FT                   EAAHMKGAPLLERIFRRRRRIKQGYKVVRGRLDVVDPEAFLADKLNLLRIFEEALRTGM
FT                   LIHPDAMRLVTANLDLIDDGMRNDKEARRIFLDLLLKHGNPERALRRMNELGVLSAFVP
FT                   EFEPIVAMMQFNMYHSYTVDEHTIQTIVNLAQIEKGELVESLPLASSILKAGVNRKVLY
FT                   VALLLHDIGKGRPEDHSILGARIARKVAPRLGLSKADCETVEWLVRYHLLMSDMAQKRD
FT                   ISDPRTVRDFAKAVQTTKRLDLLTVLTVCDIRGVGPNTWNNWKATLLRALHAETKRALE
FT                   MGMEALNREGRGNEAKKALRTALSDWPAGEVKTEIARHYPPYWQGFNVETHVTFAEMLR
FT                   QLEHSGDPGGIEIRLDPDEDRDATRACFAMADHPGIFSRMAGALALVGANVVDARSYTT
FT                   KDGYVTDAFWIQDAEGHPYEAARLPRLSQMILKTLKGEVVARDALKSRDKIKKREKAFN
FT                   VPTHITFDNEGSDIYTIIEVDTRDRPGLLYDLARALAAANVYIANAVIATYGEQVVDSF
FT                   YVKDMFGLKYHSEAKQRTLETKLRKAITEGAERAAAS"
FT   gene            complement(411124..412299)
FT                   /locus_tag="SPO0398"
FT   CDS_pept        complement(411124..412299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC45936.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93716"
FT                   /db_xref="GOA:Q5LWE4"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE4"
FT                   /protein_id="AAV93716.1"
FT                   /translation="MFAVFNPARKIALSAMALAAAALLSACEPVAIGGGGPSINTSKPV
FT                   PVALLVPRGSAQSGDAVLAQSLENAARMAIADLQNVQIDLRVYDTAGDAGTAAAVAKQA
FT                   VGEGAKIILGPVYAQAANAAGLAVLNQNVNVLSFSNNVNIAGGNVFVLGPTFNNSADRL
FT                   VSFAARQGKGNIVVVHSTDEAGQLGRAAISDAISRSSAKLAGTVAYERSQQGVINSVPQ
FT                   VKATVDGTGADSVFFTSTTAGALPLYTQLLPEAGVSPAQTQFIGLTRWDIPAQTLELPG
FT                   VQGGWFALPDPSKAAAFRARYQSTYGGAPHPIGGLAYDGIAAIGALVGAGKSDALTGAA
FT                   LTQSAGFQGVGGIFRLRPDGTNERGLAIATIQNKQVVVIDPAPQSFSGAGF"
FT   gene            412384..413241
FT                   /locus_tag="SPO0399"
FT   CDS_pept        412384..413241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0399"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93717"
FT                   /db_xref="GOA:Q5LWE3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE3"
FT                   /protein_id="AAV93717.1"
FT                   /translation="MNYQKLRLPAGLYFVGTPIGSARDITLRALDVLASAEVIAAEDTR
FT                   SLRHLLDIHGVPLDGRRVLAYHDHSGAGAQARLLEALAEGKSVAYASEAGMPLIADPGF
FT                   ELSRAAAEAGHMVTCAPGPSAVLTALTLAGLPTDAFFFAGFLPNAAAARKTRLETLRGV
FT                   PGTLVFYESPKRLAASLRDMAEVLGGERPAALCRELTKKFEETRRDTLAGLAEALAEAP
FT                   VKGEVVLLVDRARSGPVKDSDIEQDLLAALETHSVRDAADLVARMHDVPRRPVYQLALK
FT                   LGKG"
FT   gene            413243..413614
FT                   /locus_tag="SPO0400"
FT   CDS_pept        413243..413614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN66948.1; match to
FT                   protein family HMM PF02021"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93718"
FT                   /db_xref="GOA:Q5LWE2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWE2"
FT                   /protein_id="AAV93718.1"
FT                   /translation="MKALASRGTRNHLAGEAAENSVLRDYERRGYHLVRRRWRGRCGEI
FT                   DLIARSGDEVVFVEVKQSRDFARAAESLGARQMKRLHAAAAEFLAEEPDGQLTPMRFDV
FT                   ALVDGTGRLEIVENAFGHG"
FT   gene            413677..414609
FT                   /gene="gshB"
FT                   /locus_tag="SPO0401"
FT   CDS_pept        413677..414609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="SPO0401"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by similarity to SP:P04425; match to
FT                   protein family HMM PF02951; match to protein family HMM
FT                   PF02955; match to protein family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93719"
FT                   /db_xref="GOA:Q5LWE1"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE1"
FT                   /protein_id="AAV93719.1"
FT                   /translation="MKIAFQMDPIGAVNINADSSFRLAEEAQARGHELFYYGPDQLAYQ
FT                   EGRITARGHDMTVQRVAGDPAVLGPLREVDLAEFDVVWLRQDPPFDMHYITSTHLLDRL
FT                   KGQTLVVNDPFWVRNYPEKLLVLNFPELTPPTTIARDLDTIRAFKARHGDIILKPLYGN
FT                   GGAGVFRLDENDRNLSSLHELFVGFSREPLIVQKYLPDVRKGDKRVILVDGEAVGAINR
FT                   VPAEGEVRSNMHVGGRPEKIGLTDRDREICTAIGPLLREKGQIFVGIDVIGDYLTEINV
FT                   TSPTGIQELERFDGGNIAGRIWEAIEAKL"
FT   gene            complement(414677..416191)
FT                   /gene="comM"
FT                   /locus_tag="SPO0402"
FT   CDS_pept        complement(414677..416191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="SPO0402"
FT                   /product="competence protein ComM"
FT                   /note="identified by similarity to SP:P45049; match to
FT                   protein family HMM PF01078; match to protein family HMM
FT                   TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93720"
FT                   /db_xref="GOA:Q5LWE0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE0"
FT                   /protein_id="AAV93720.1"
FT                   /translation="MVARAHTVAFQGVEARPVEVQCAVTPGLPAFSIVGLPDKAVSEAR
FT                   DRVRSALSGMAIALPSKRITINLSPADLPKEGSHFDLPIALALLAALEIVPADAAEATL
FT                   ALGELSLDGSLVPVVGALPAAMTAAAEDWLLLCPEASSAEAAWVDAAKVIGATSLSAVV
FT                   RHFTGQAPIDAARPGEVSAAAFERDLREVKGQERAKRALEIAAAGRHHMIMIGTPGSGK
FT                   SMLAARIPGILPPLTPVEALETSMIHSLCGLLDQGGISRTRPFREPHHTASMAAIVGGG
FT                   KGAKPGEISLAHNGVLFMDEFPEFPRTVLETLRQPIETGEVMVARANAHVKYPCRFMLV
FT                   AAANPCRCGYLSDPARACARVPVCGEDYLGRISGPLMDRFDLRIEVPPVAFTDLDLPPS
FT                   AEGSAEVAARVAAARAVQTARFGGHPTLRQNADAEGKALEEIATPDAEGRDLLLTAADR
FT                   FGLSARAYHRILRVARTIADLAGEPDIRRPHIAEALSFRVSAKALN"
FT   gene            complement(416250..417125)
FT                   /locus_tag="SPO0403"
FT   CDS_pept        complement(416250..417125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD13614.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93721"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD9"
FT                   /protein_id="AAV93721.2"
FT                   /translation="MTYDLYIGDRSFSSWSLRGWLMLEKFGIPYRSHLVGLYSGTMAAD
FT                   LAPVAPARQVPALRTPDGIALGQSLAMAETLAERHPEAGLWPADPAARATARWLCAEMV
FT                   SSFTALRGECPMQLLHCYEGFQPGAGTLADLARIETLWSHARAVSGAATGPLFGTYSLA
FT                   DVFYVPVAARIIGYGLPVSAAARDYCLFLLGDTAVRQWRAMGLTVRYDPMPYGLDLPVR
FT                   DWPVGTPGAARAVEAGPSVNTACPYSGDPVSDFLELDGRVWGFCNAFCRDKTVADPGAW
FT                   PKFTAMVAKG"
FT   gene            complement(417186..417764)
FT                   /locus_tag="SPO0404"
FT   CDS_pept        complement(417186..417764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0404"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93722"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD8"
FT                   /protein_id="AAV93722.1"
FT                   /translation="MTRLHLVRHGPTHAKSMVGWSDLPADLSDTGFLTRLAAHLPPQAL
FT                   VVSSDLRRAADTASAIQGDRTRLPHRAALREIHFGAWELRRFAEIEAEDPEHIRAYWET
FT                   PGDVRPPGGESWNEVCARVDAEIDALIAAHPGADLIVVGHFGMILTQVQRALRLEADQA
FT                   FAHRIDNLSVTEITRLPQGWEVGRINHLV"
FT   gene            complement(417761..418285)
FT                   /locus_tag="SPO0405"
FT   CDS_pept        complement(417761..418285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0405"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /note="identified by match to protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93723"
FT                   /db_xref="GOA:Q5LWD7"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD7"
FT                   /protein_id="AAV93723.1"
FT                   /translation="MLYPKFTLVLGGAASGKSSFAEQMVVSTGKSRVYFASSQVFDAEM
FT                   QAKIDRHLVQRGPGWTTIEEPLEPGPALSALSARDICLFDCATMWLSNHLLAEGDLDAA
FT                   QERLMAAIRHCPAQLVMVSNEVGHGIVPENALARRFREAQGRLNIALAAEADLVVLVVA
FT                   GLPLALKGQLP"
FT   gene            418384..419262
FT                   /gene="rpoH-1"
FT                   /locus_tag="SPO0406"
FT   CDS_pept        418384..419262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH-1"
FT                   /locus_tag="SPO0406"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P48194; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93724"
FT                   /db_xref="GOA:Q5LWD6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD6"
FT                   /protein_id="AAV93724.1"
FT                   /translation="MALNDPQDKRMSRQAMKAELLDAETELALAYAWRDHRDEAALHRL
FT                   ITAYMRLAISMAAKFKRYGAPMNDLIQEAGLGLMKAADKFDPDRGVRFSTYAVWWIKAS
FT                   IQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQARLEREAATDGLALDRHQLHQMIASEIG
FT                   VPLRDVEMMEGRLSGSDFSLNATQASDEEGREWIEALEDESEQAAELVAHRHDTEQLRD
FT                   WLIEAMQALNERERFIVRERKLRDEPRTLESLGDELGLSKERVRQLEAAAFAKMRKSLE
FT                   ARSREVQHFLV"
FT   gene            419259..420083
FT                   /locus_tag="SPO0407"
FT   CDS_pept        419259..420083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E83058"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93725"
FT                   /db_xref="GOA:Q5LWD5"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD5"
FT                   /protein_id="AAV93725.1"
FT                   /translation="MKQFFAAGLALALCLIAPLRAASAGELIPEDILAAMRQADVVILG
FT                   ETHDNPRHHLVQAEAIAALQPGAVVWEMLTEEGAQRLRRKAVNDPAELERILQWAELGW
FT                   PPLAMYLPVFEAADAPVYGALVPRAAARAAMETGAAAAMGADAARFGLTVPLAEADQAA
FT                   READQQAAHCNAMPPEMLPQLVAIQRLRDAVLARAILRAQDETGGPVAVITGNGHARAD
FT                   RGIPVFLSRISPGLRVYVLGQSEGGLIEGRFDAVIDSPAAPREDPCAAFDKS"
FT   gene            420163..421359
FT                   /gene="coaBC"
FT                   /locus_tag="SPO0408"
FT   CDS_pept        420163..421359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="SPO0408"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93726"
FT                   /db_xref="GOA:Q5LWD4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD4"
FT                   /protein_id="AAV93726.1"
FT                   /translation="MLASKRILLIIGGGIAAYKTLDLIRRLRERGAAVTPVLTGAAEEF
FT                   VTPLSVSALAGEKVYRALFDLTDEAEMGHIQLSRSADLVVVAPATADLMGKMAAGLAND
FT                   LASTLLMATDTPVLIAPAMNVRMWQHPATRRNHAQLAADGIRFIGPNEGDMACGEYGPG
FT                   RMSEPLEIVAAIEAALGDGPLKGKRVLVTSGPTHEPIDPVRYIANRSSGAQGTAVARAL
FT                   AALGAEVVFVTGPADVPPPDGVEVVRVQSAREMDAAVDAALPVDAGVFAAAVADWRVAS
FT                   ASDRKLKKSRDGLPVLEFAENPDILKRVSRMEAGRPPLVVGFAAETNDVIENATAKRLR
FT                   KGCDWIVANDVSPATGIMGGSENAVILITGEGAEEWPRMSKEAVADRLARRIAETLVG"
FT   gene            421423..421878
FT                   /gene="dut"
FT                   /locus_tag="SPO0409"
FT   CDS_pept        421423..421878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SPO0409"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93727"
FT                   /db_xref="GOA:Q5LWD3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWD3"
FT                   /protein_id="AAV93727.1"
FT                   /translation="MVAIRVIRDAGADTQVPLPSYETTGAAGADIRANLPDRGSLTLAP
FT                   GGRALIPTGLRVEIPAGYEIQIRPRSGLALKHGITLPNTPGTIDSDYRGPLGVILLNAG
FT                   AEPFEVVHGERIAQLVVAPVVQARFELTEALGETERGAGGFGSTGRG"
FT   gene            421878..422918
FT                   /locus_tag="SPO0410"
FT   CDS_pept        421878..422918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0410"
FT                   /product="molybdopterin biosynthesis protein MoeB,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93728"
FT                   /db_xref="GOA:Q5LWD2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD2"
FT                   /protein_id="AAV93728.1"
FT                   /translation="MLLVLALAAGLWTMGHVMGVSRRARLVMLCALFAVVLMLQFALPV
FT                   SHPLRAATGGSPALWLLIGGFALLAFGYGSGVAWLKARAQGRPAETTAKPGSFTETELD
FT                   RYARHIVLRELGGPGQKRLKQARVLVIGAGGLGAPALQYLAAAGVGTIGVIDDDVVENA
FT                   NLQRQVIHRDADIGKPKVFSAEAAMLAQNPAIAVRPYHRRLTEEIAADLFADYDLILDG
FT                   TDNFTTRYLANQVAVAQGKPLISGALSQWEGQLSVFHPAGDTPCYQCIFPEAPAPGLAP
FT                   SCAEAGVIGPLPGVVGAMMAVEAIKLITDAGAPLKGEMLIYDALYGESRKIRLSRRADC
FT                   PICGQG"
FT   gene            422854..423549
FT                   /locus_tag="SPO0411"
FT   CDS_pept        422854..423549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93729"
FT                   /db_xref="GOA:Q5LWD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD1"
FT                   /protein_id="AAV93729.1"
FT                   /translation="MAKAARFGSAAGPIARFAARGDPARGRRREMSTETFHAELANYLG
FT                   VGDLRSDYPDGGWSWNRHRLTLGRYRVELTQDRQIVAQRPRGGGLIPSTQLAISGVRSF
FT                   AEGERVSDDLCRLLSLAAQSQVVPLSYRFGGRGRQPLHPMGQAIYLRPLLPIRDGAAMR
FT                   TYLETVWPPCYPAQRDRAFRPVPSPYESLRDHHDRRKEILHEYLLRLLDYRGRMLLYRH
FT                   AARVGKDIG"
FT   gene            complement(423669..424136)
FT                   /locus_tag="SPO0412"
FT   CDS_pept        complement(423669..424136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93730"
FT                   /db_xref="GOA:Q5LWD0"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD0"
FT                   /protein_id="AAV93730.1"
FT                   /translation="MTGREEMAKTETTKITPASFTEVLKSMQGPVSMTSLVKPQLEQFW
FT                   DAQEKLLAESERFTRHWFERRHEAIRTALDAARSATAADPANPAQAMETVMDWQRHSVE
FT                   RLVEDAREWFDTVSRCADYVSKTEAEAVGETLNEAQDLARKATKSAKSEPV"
FT   gene            complement(424229..425440)
FT                   /locus_tag="SPO0413"
FT   CDS_pept        complement(424229..425440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0413"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93731"
FT                   /db_xref="GOA:Q5LWC9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC9"
FT                   /protein_id="AAV93731.1"
FT                   /translation="MTKTNRPAGPMTTAIHAGEAPDPATLASAPPIHMSSTYVSEDVLG
FT                   FSAHDLTPQSPYAYSRWANPTVAMLEAKIAAMQGTEACLCTASGMAAAAAIFFTFLSAG
FT                   DHVIVSDVSYAGVAELARDTLPRMGIAVSTVDMSDLAAVAAAIRPETRLIHTETPVNPI
FT                   GRLTDLAAISALARQAGALLSCDATFASPLGMDTVALGVDLTMHSVTKYICGHGDAVAG
FT                   AVCGRADLVSRMRVEAAIHHGGVLSPFNAWLIARGAATLPLRMKAHAAGAHAVAEWLEA
FT                   DPRVGRVIYPGLPSHPQAELAARQMSNMSAMISFQVGDAATGERLARQMIERLEVIHYA
FT                   VSLGHHRSLIFWMGTEGLMETSFRLEGAQLEAYRAYAGDGIFRLSVGLEDPEDLIADLD
FT                   RAIA"
FT   gene            425562..427577
FT                   /locus_tag="SPO0414"
FT   CDS_pept        425562..427577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0414"
FT                   /product="peptidyl-dipeptidase, putative"
FT                   /note="identified by similarity to SP:P27236; match to
FT                   protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93732"
FT                   /db_xref="GOA:Q5LWC8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR034005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC8"
FT                   /protein_id="AAV93732.1"
FT                   /translation="MTNPILADWQTPFDIAPFDRIADSDFAPALEVALAEHRAEIAAIA
FT                   DSPEAPTFANVIEALEAAGGALDRVLGVFFTVAGADSNPAREELQRAFSPQLAAHFSEI
FT                   SANKALFARVAAVWEARADLELSDEQQRVLMLTHRGFVRAGAALSGEAEARMKEIKARL
FT                   AVLGTEFTQNLLADERDWFMDLSEDDLEGLPDFVTAAARAAGQEKEAAGPVVTLSRSLI
FT                   VPFLQFSPRRDLRERAYRAWVARGANGGKTDNRAIATETLTLRQERAALLGYDSFAAYK
FT                   LETEMARSPDRVRDLLMQVWAPARARAEADAEVLTAMMQEDGINGPLEPWDWHYYAARR
FT                   RKAEHDLDEAALKPYLQLDRMIEASFACANRLFGLEFRPLDIALYHPDCRAWEVTRDGR
FT                   HVAVFIGDYFARGSKRSGAWCSAMRAQAKFPRTQAPVVINVCNFAKGDPALLSYDDART
FT                   LFHEFGHALHQMLSDVTYESVSGTSVARDFVELPSQLYEHWLEVPEVLAEFATHAETGA
FT                   PMPAEMLEKVLGAANFDQGFQTVEYVASALVDLAFHDGPAPSDPMAKQAEVLAELGMPH
FT                   AIGMRHATPHFAHVFAGDGYSSGYYSYMWSEVMDADAFAAFEEAGGAFDPDRAEALERH
FT                   ILSTGGSRDAEDLYLAFRGRLPGVEALLKGRGLIAA"
FT   gene            complement(427642..428574)
FT                   /locus_tag="SPO0415"
FT   CDS_pept        complement(427642..428574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0415"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93733"
FT                   /db_xref="GOA:Q5LWC7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC7"
FT                   /protein_id="AAV93733.2"
FT                   /translation="MPANVLFSARSELWPVYQPLISTYLREMGIDFDLRRDFPPEEVDY
FT                   VVYAPNGGLRDFTPFTRLKAVLSLWAGVESIADNPTLTVPLARMVDHGLTQGMTEWVVG
FT                   HVLRYHLGMDAHIHGLNGDWRQDVPPLASQRQVTILGLGALGEAAARALSALGFQVTGW
FT                   SRSPKELPGIACLHGPDGLDQALARAEILVLLLPSTAATENTLNTQTLARLPRGARIIN
FT                   PGRGPLIDDDALLAALDSGQVGHATLDVFRIEPLPRDHPYWGHPNVTVTPHIASETRPE
FT                   TAAQVICENIRRGESGEMFLHLVDRSLGY"
FT   gene            complement(428594..429733)
FT                   /gene="mreD"
FT                   /locus_tag="SPO0416"
FT   CDS_pept        complement(428594..429733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="SPO0416"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by similarity to SP:P15035; match to
FT                   protein family HMM PF01098; match to protein family HMM
FT                   TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93734"
FT                   /db_xref="GOA:Q5LWC6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC6"
FT                   /protein_id="AAV93734.1"
FT                   /translation="MSYLEYTVKSTPSGLRKILYMNWPLTLLLISVASAGFLMLYSVAG
FT                   GSFSPWAEPQIKRFMAGLVVMTAVAMVPIWFWRNMAAVAYGGSLVLLVMVELFGAVGMG
FT                   AQRWIDLGFMRLQPSELTKITLVMVLAAYYDWLPGKKTSRPLWVLVPVLIILVPTALVL
FT                   KQPDLGTAILLLSAGGALMFLAGVHWAYFAAVIAAGVGLITAVFKSRGTDWQLLKDYQF
FT                   RRIDTFLDPSSDPLGAGYHITQSKIALGSGGWSGRGFMQGTQSRLNFLPEKHTDFIFTT
FT                   LAEEFGFIGGISLLSLYALIIAFCVATALATRDRFSSLVTLGIAVNFFLFFAVNMSMVM
FT                   GLAPVVGVPLPMVSYGGSAMLVLLVAFGLVHSAHIHRPR"
FT   gene            complement(429730..431676)
FT                   /gene="pbpA"
FT                   /locus_tag="SPO0417"
FT   CDS_pept        complement(429730..431676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="SPO0417"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by similarity to SP:P08150; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93735"
FT                   /db_xref="GOA:Q5LWC5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC5"
FT                   /protein_id="AAV93735.1"
FT                   /translation="MRRSARDMDKVQRVLTRRTLLLGGIQAAFIGGLAMRMRYMQVDQA
FT                   DQFRLLAEENRINIRLIPPSRGELFDRNGAIIAQNTPSYRIVMVREDAGDVDAVVANLQ
FT                   RLIPLDPEELDRALAEMRRSPPFLPVTLADQISWEHISKVAVNAPALPGITPEVGLTRV
FT                   YPQASDFAHVVGYVGPVSDYDLSQIQDPEPVLRIPRFQIGKVGLEAKQEDLLRGKAGAK
FT                   RVEVNANGRVMRELDRREGKPGADLQLTVDSALQSYVQARLGQESAAAVVIDCETGDLR
FT                   AIASAPSFDPNLFVRGISVADYRGLTEDPYRPLANKSVQGAYPPGSTFKMITAMAALEA
FT                   GITNPEETVYCPGFLEVSNRRFHCWKRGGHGHMNLEESLEQSCDVYYYDVALKVGIDRI
FT                   SAMAEEFGLGVRHDIPMSAVARGLAPNRDWKARVHGQDWLVGDTANASIGQGFMLASPL
FT                   QLAVMTARIATGRKVAPRLVKSIDGVEQPSGAGEPLAVNQANLRRLRKGMYAVSNNRRG
FT                   TAYRSRILADDNRMAGKTGTSQVRNITAAERAAGVIRNEDLPWERRDHALFVCFAPFDN
FT                   PRFAVSVVVEHGGGGSTAAAPIARDILLQALYDGFPPLESYPAKDRSRIEAQQERLRRE
FT                   LRPVTRPEDKDRA"
FT   gene            complement(431678..432214)
FT                   /locus_tag="SPO0418"
FT   CDS_pept        complement(431678..432214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0418"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GB:CAE53834.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93736"
FT                   /db_xref="GOA:Q5LWC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC4"
FT                   /protein_id="AAV93736.1"
FT                   /translation="MDSLAPSRIWVMRLSYAGLAMVILFFHLLPLDTLPKRWASPDLLL
FT                   ALTLAWSLRRPDFVPPLLIAIVILLADLLLQRPPGLLAALTVAGTVFLHSRFGNHGETG
FT                   FVAEWLAVAVVLMAIALLYRIVLAITSVDQAPLFLVASQLVLTILIYPLVAGASQAVFG
FT                   VRHLTPADAETLGAR"
FT   gene            complement(432207..433142)
FT                   /gene="mreC"
FT                   /locus_tag="SPO0419"
FT   CDS_pept        complement(432207..433142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="SPO0419"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by similarity to SP:P16926; match to
FT                   protein family HMM PF04085; match to protein family HMM
FT                   TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93737"
FT                   /db_xref="GOA:Q5LWC3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC3"
FT                   /protein_id="AAV93737.1"
FT                   /translation="MAERTSLARDRSQREDYAGPLRRLLLGVLLLCLLGIFLVWRIDSP
FT                   RVERFRAQVVDTVIPSMDWAMVPVTGTINLIRDFQSYQRLSEQNRELRSELRQMRAWKE
FT                   AALQLEQENARLLDLNNVRLDPRLTYITGVVMADSGSPFRQSVLLNVGARDGIVDGWAA
FT                   MDGIGLVGRISGVGQSSARVILLTDAASSIPATIQPSGQTALITGDNTAAPVVDFLENR
FT                   ELVRPGDRVVTSGDGGVFPAGLLIGQVAEDRTGRLRVRLSADYERLEFLRVLRHHGTEK
FT                   IEDHGDVVGPPAPAAPDTSALTTPAEATDG"
FT   gene            complement(433204..434250)
FT                   /gene="mreB"
FT                   /locus_tag="SPO0420"
FT   CDS_pept        complement(433204..434250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="SPO0420"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by similarity to SP:P13519; match to
FT                   protein family HMM PF06723; match to protein family HMM
FT                   TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93738"
FT                   /db_xref="GOA:Q5LWC2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC2"
FT                   /protein_id="AAV93738.1"
FT                   /translation="MGFFDNLSGLFAADMAIDLGTANTLVYVKGRGIILSEPSVVAYHV
FT                   KDGVKKVLAVGEDAKLMLGRTPGSIEAIRPMREGVIADFDTAEEMIKHFIRKVHKRSTF
FT                   SKPKIIVCVPHGATPVEKRAIRQSVLSAGARRAGLIAEPIAAAIGAGMPITDPTGNMVV
FT                   DIGGGTTEVAVLSLGDIVYARSVRVGGDRMDEAIISYLRRQQNLLVGESTAERIKTSIG
FT                   TARMPDDGRGQSMLIRGRDLLNGVPKEIEISQAQVAEALAEPVQQICEAVMTALETTPP
FT                   DLAADIVDRGVMLTGGGALLGDLDLALREQTGLAVSIADESLNCVALGTGKALEYEKQL
FT                   RHAIDYDS"
FT   gene            434416..435201
FT                   /locus_tag="SPO0421"
FT   CDS_pept        434416..435201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93739"
FT                   /db_xref="GOA:Q5LWC1"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC1"
FT                   /protein_id="AAV93739.1"
FT                   /translation="MLSYQHIYHAGNLADVQKHALLALALDYLTRKDKPLSYLETHAGR
FT                   GLYHLDAAEAVRTGEAGAGIGRAEGAAWFDPAHPMTRVLAAVRTDHGAMAYPGSPLVAA
FT                   HLLRPGDMMHLAELHPQEHAALEQAMAGYPARVYRRDGVEMAQSLLPPEPRRGMMLIDP
FT                   SYEVKSDYDRIPAVIAQLHRKWNVGVIALWYPILTDERHKVMLAALERLDLPRVLRHEV
FT                   RFAPAREGHRMVGSGMFVINAPFGLADEAARLSGLFAQL"
FT   gene            complement(435291..436865)
FT                   /gene="leuA"
FT                   /locus_tag="SPO0422"
FT   CDS_pept        complement(435291..436865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SPO0422"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93740"
FT                   /db_xref="GOA:Q5LWC0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC0"
FT                   /protein_id="AAV93740.1"
FT                   /translation="MTHVTDQDRVLIFDTTLRDGEQSPGATMTHTEKLEIAEMLDEMGV
FT                   DIIEAGFPIASEGDFKAVSEIAKRAQNSRICGLARANFADIDRCWEAVKHAEKNRIHTF
FT                   IGTSPLHRAIPNLTQDEMAEKIHETVSHARNLCDNVQWSPMDATRTEWDYLCRVIEIAI
FT                   KAGATTINIPDTVGYTAPAESADLIRRLIETVPGADDVIFATHCHNDLGMATANSLAAV
FT                   AGGARQIECTINGLGERAGNTALEEVVMAMKTRHDIMPWRTGIDTTKIMAISRRVATVS
FT                   GFNVQFNKAIVGKNAFAHESGIHQDGMLKNRENFEIMRPEDIGLSGTSLPLGKHSGRAA
FT                   LRDKLEHLGYEVGDNQLKDIFVRFKELADRKKEVFDDDVIALMRSGENAEQDHLQLVSM
FT                   KVICGTGGPAEATVEMEIDGKDVSATAHGDGPVDASFKAIRALHPNEAHLQLYQVHAVT
FT                   EGTDAQATVSVRLEEDGMIATGESANTDTVVASAKAYINALNRLIVRREKAGPGADARE
FT                   ISYKDLT"
FT   gene            complement(437092..437673)
FT                   /locus_tag="SPO0423"
FT   CDS_pept        complement(437092..437673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0423"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93741"
FT                   /db_xref="GOA:Q5LWB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB9"
FT                   /protein_id="AAV93741.1"
FT                   /translation="MSETAPRQTTPIIGTRMRELRKARGLTLKQLAAATGLSIGYLSQL
FT                   ERQAADPSVRALNVISTALGVGINWFFPDPDTVSDPEADLVVRADRRRTLRFSSGVRDE
FT                   LISPNLSGQLELIVTTFDPGAGSGAELYAHRGEEAGFIVEGQLEVTVGARLVTLGVGDT
FT                   VQFASTIPHRYHNPGPGRTVMIWAVTPPYY"
FT   gene            437751..438938
FT                   /locus_tag="SPO0424"
FT   CDS_pept        437751..438938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0424"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93742"
FT                   /db_xref="GOA:Q5LWB8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB8"
FT                   /protein_id="AAV93742.1"
FT                   /translation="MRNSSFLRAYGFWHWGEGLQTVLFTWYMAFHVGLPASQIGFYQAL
FT                   VLSPFLLFTIAGGILTDRIGARRSFRAATVLFGLLLIGYGVLDHVFGFVPVLFFAYCLA
FT                   AGVVSAVSNPAIDTFIPDATPRRAQENALLAANAHNMAKLAGNLTGLTLPLLHAVGGFG
FT                   VNGLLMLASAASLRPVQPATRQGAPEPELSERPSLRRLWAHFRECPENFDILLSSAMLG
FT                   LLVVPVGYILLPLALRANFPGYGDLLAVMTVSSWLGAIAATWAIGRLSRRIGHPGRIAL
FT                   LVWGGYACALVTLPLVPGFAWLCVLVAVLGMVKLGKAMVYGKYIRNCPDTLRGSVIAVE
FT                   QTAFWGLATLGTFLLGWLVDLIGLVPTIHLVALSVGLAALALALRGRLSGLTPAL"
FT   gene            complement(438976..440388)
FT                   /locus_tag="SPO0425"
FT   CDS_pept        complement(438976..440388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0425"
FT                   /product="MORN repeat protein"
FT                   /note="identified by match to protein family HMM PF02493"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93743"
FT                   /db_xref="GOA:Q5LWB7"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB7"
FT                   /protein_id="AAV93743.1"
FT                   /translation="MTRNRRRIAFAAILAMATTAHAQQGQVLTTQDEIGGVYEGTFRGG
FT                   LQHGTGTYRLPNGYEYSGEWVDGEIRGRGVARFPNGSVYEGSFAQGKPEGMGKITFSDG
FT                   GTYEGEWSNGVINGQGVAVYANGVRYEGGFRDARHHGKGVMQSPGGYVYEGDWADGQKE
FT                   GLGKITYPDGAVYEGGIVAGQRHGEGTLTLPDGLVYVGFWADGQINGKGTLTQANGDVY
FT                   EGDLIAGRREGKGKVTYANGDVYQGDFTDDRREGQGIFTGTDGYSYAGSWVAGQIEGQG
FT                   RVTYPDGSVYEGNFRADLADGQGKITYPDGSSYEGEWVAGVIEGTGTAIYANGIVYKGT
FT                   FKNAKNHGQGVMTYADGYRYEGEWQDGVRHGQGKATYPDGSVYTGQYVNGQREGDGEIV
FT                   MADGFRYKGQWQSGKISGIGVATYANGDIYEGHFRNGKRQGEGTMKYASGQEEKGNWDN
FT                   GALTKGAAASDG"
FT   gene            440542..442200
FT                   /gene="nadE"
FT                   /locus_tag="SPO0426"
FT   CDS_pept        440542..442200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SPO0426"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="identified by similarity to SP:Q03638; match to
FT                   protein family HMM PF00795; match to protein family HMM
FT                   PF02540; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93744"
FT                   /db_xref="GOA:Q5LWB6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB6"
FT                   /protein_id="AAV93744.1"
FT                   /translation="MADRFRITLAQLNPTVGDLAGNAAKARMAWEHGREAGADLVALPE
FT                   MFVTGYNTQDLVLKPVFHDAAIAMIEALAEECADGPALAIGGPLVEEGKLYNAYLILKG
FT                   GKIVSRSLKTHLPNETVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDAWHEDVAETLAE
FT                   TGAEFLLVPNGSPYYRDKYDMRINQMVARVVETGLPLIYLNMVGGQDDQVFDGGTFGLN
FT                   PGGALAFRMPVFDEAITHVDLERGSEGWQIVQGEVAPLPDAWEQDYRVMVESLRDYMRK
FT                   TGFAKVLLGLSGGVDSALVAAIATDALGPENVRCVMLPSEYTSRSSLDDAEAVAQALGV
FT                   RYDYVPISESRAAVTNTLAPLFAGTEPGLTEENIQSRLRGLLLMALSNKFGEMLLTTGN
FT                   KSEVAVGYATIYGDMAGGYNPIKDLYKTRVFETCRWRNANHRLWMMGPAGEVIRPSVID
FT                   KPPSAELREDQKDSDSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVARRVEHLIYI
FT                   SEYKRYQAAPGARLTPRAFWLDRRYPIVNRWRDPS"
FT   gene            442341..443000
FT                   /locus_tag="SPO0427"
FT   CDS_pept        442341..443000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93745"
FT                   /db_xref="GOA:Q5LWB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB5"
FT                   /protein_id="AAV93745.1"
FT                   /translation="MPRSTGASRGRKLLVSGMCAMFNPLNAPPQGVEMLKSPPREIDEA
FT                   EIDQFVQAVMRQEAAAPKPRKTLPEIAPAVPEAAASEESEERKPRYQPKWRHSAAILAL
FT                   ALLIGWPGLLVALLGLAVVVPVIAYLTLGHDRASECVAAAFARFRRLDPVRAEILRGWA
FT                   MRRVAGVERVLSWLPERWTSGLYLPDLRDTPVSHDKMRLDPFSRFQAEQAETPDAG"
FT   gene            443116..444447
FT                   /locus_tag="SPO0428"
FT   CDS_pept        443116..444447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0428"
FT                   /product="amino acid deaminase, putative"
FT                   /note="identified by similarity to GB:AAA86752.1; match to
FT                   protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93746"
FT                   /db_xref="GOA:Q5LWB4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB4"
FT                   /protein_id="AAV93746.1"
FT                   /translation="MPGPRPTDFYSDLALPKQVEVVVVGGGIIGVSAALELAERGVSVL
FT                   LCEKGQIGAEQSSRNWGWVRLGMRDPREIPLMQAALEIWDGLDDRLGRSTGFVRSGILF
FT                   AASGRRSVGNLERWARHVDGLETRARMIEGAELAAHLPGHSKLPRAALFMPQDGRAEPQ
FT                   WAAPAVAEGARDRGAQILTACAVRSVDVEAGQVTGVYTERGRVACSRVILAGGAWSRLF
FT                   AGNAGVSLPQLKVLNTVLRSSPTVEGPNAAYWSDGFAMRRRADGGFTIAAGTQNTVDLV
FT                   PDSLRLAHRFLPAFRQEWRSLRFRLSRRWLEEAQQARQWQPGDVTPFELTRILDPEPSQ
FT                   KHLRRAWNAARRAFPMLDGSEIMQSWAGMIDVTPDAIPVISDVPALPGLFIATGFSGHG
FT                   FGIGPGAGRLVADLATGETPVVDPWAFRLSRFSDGSRVAPDPGY"
FT   gene            complement(444464..445396)
FT                   /locus_tag="SPO0429"
FT   CDS_pept        complement(444464..445396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0429"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93747"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB3"
FT                   /protein_id="AAV93747.1"
FT                   /translation="MTLKLSRRAALTGAASLPLAAAAAPVLAGGHGGKAAAPIARSFKL
FT                   GSMGVTTLLDGSLPRDGAKDIFGGGASDEDFARVSAENFIPADMAQFFFTPTLIDTGAE
FT                   LVLFDTGLGQGGITRALDAAGVAPEAIDVVVITHMHPDHIGGMVTDGAPTFANARYVTG
FT                   AAEYDFWSKAEAGNRVGDLVKSHVTPLAEKMTFVEPGASVAAGVTAVDASGHTPGHMGY
FT                   MLESDGQQLMLTADLANHYVWSFAHPEWEVRFDMDKAKATASRRAILGMLAADRVPMIG
FT                   YHMPFPAAGYVETRGEGFRFVPVGYQLMG"
FT   gene            445622..446953
FT                   /gene="gltX-1"
FT                   /locus_tag="SPO0430"
FT   CDS_pept        445622..446953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-1"
FT                   /locus_tag="SPO0430"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P22249; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93748"
FT                   /db_xref="GOA:Q5LWB2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWB2"
FT                   /protein_id="AAV93748.1"
FT                   /translation="MSMTTTRFAPSPTGYIHVGNLRTALMNYLIARKAGGTFILRIDDT
FT                   DPERSKEEYVDAIKQDLDWLGLHWDRVERQSERLDRYAEAADKLRAMGRFYEAFETPTE
FT                   LDLKRKKQLNMGKPPVYDRAALALSEGEKEALRAERGNGVWRFKLDQERIEWTDGILGD
FT                   ISIDAASVSDPVLIRGDGQVLYTLASVVDDTDMGVTDVVRGSDHVTNTATQIQIMAALG
FT                   FEHPRFAHHSLLTGPQGEALSKRLGTLALRDLREQGVQPMALLSLMARLGSSDPVELRS
FT                   DMAELIEGFDVTRFGAAPTKFDVQDLFPLTGRYLQALPLEAVAKDVAAAGVPEDLAAPF
FT                   WSMARENITTLNDLAGWWALCRDGAEPLIADEDRAFVTEAMALLPEGPLDADSWGAWTQ
FT                   AVKEATGRKGKGLFMPLRKAVTGMERGPEMATLLPLMQVIRARG"
FT   gene            complement(447047..447616)
FT                   /locus_tag="SPO0431"
FT   CDS_pept        complement(447047..447616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E82090"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93749"
FT                   /db_xref="GOA:Q5LWB1"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB1"
FT                   /protein_id="AAV93749.1"
FT                   /translation="MADPYFFGYGSLVNLATHDFPDPRPARLFGWRRLWRHTDLRQVAF
FT                   LTAIPDPECSIDGMIAHVPDDDWEALDAREWAYDRVAVSAHVRHDLKRPAEVAVYAVAP
FT                   EKQSPPSTRHPILLSYIDVVVQGYLHAFGLEGVRDFFATTSGWDAPILNDRKEPRYPRH
FT                   QQLKAAETDLVDRSLNDIGADIITAG"
FT   gene            447721..448167
FT                   /locus_tag="SPO0432"
FT   CDS_pept        447721..448167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0432"
FT                   /product="rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93750"
FT                   /db_xref="GOA:Q5LWB0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB0"
FT                   /protein_id="AAV93750.1"
FT                   /translation="MRITKRTNIAVRLLMFCAAHPGRLVTKSEIAEVCNVSENHLAQVI
FT                   NQLSQLGFLTTQRGRNGGMCLGMAADAIRIGEVFRHVEGNLPMVECFADADNSCPLTDA
FT                   CRLRLALRDAAQAFYASLDEITLDALVCDNTDLLKILNPVVCAR"
FT   gene            complement(448191..450707)
FT                   /locus_tag="SPO0433"
FT   CDS_pept        complement(448191..450707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0433"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93751"
FT                   /db_xref="GOA:Q5LWA9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA9"
FT                   /protein_id="AAV93751.1"
FT                   /translation="MSLRLAARLARRELRGGLRGFRIFLACLALGVAAIAAVGSVRSAI
FT                   EAGLSREGAALLGGDAQMGFTYRFATPEERDWMQARASRVSELVDFRSMAVVGAERALT
FT                   QVKAVDGAYPLLGSVTLDPDLPLDQALAGAKGLPGGVMEPVLSDRLGLQPGDRFRLGTQ
FT                   EFVLMARLMQVPDGVADGFALGPRTLVRTADLAQSGLLAPGTLFDTKYRLDLPPDSDLA
FT                   SIAQDARGRFTDSGLRWTDARNGAPGIADFTRRLGAFLILVGLSGLAVGGIGVSAAVRA
FT                   YLADKTTTIATLRTLGADRRIVFQTYFLQIGALSGLGILLGLVLGGLAPLLLAPLIEAQ
FT                   LPVPAVFAIYPEPLAEAAIYGLLTALVFTLWPLARTEEVRAATLLRDALSRAPLLPRLR
FT                   YVLATGAGLALLCGLAAWFSGALALTLWTLGGIAGALLLLAIAASAVQALSRAAAPLAR
FT                   GRPALRWALASISSPRQGAAPVMLSLGLGLSVLAAVGQIDGTLRNAISGNLPDVAPSYF
FT                   FVDIQRDQMPGFTARLESDPGVSRVESAPMLRGIITRINDRPAREVAGNHWVVRGDRGV
FT                   TYSAELPDTTRLTEGAWWPQDYDGPPLISFAAEEGAEMGLQLGDTLTVNILGRDITARI
FT                   ASFREVDFSTAGMGFVMAMNPAALSGAPHSNIATVYAEPDAEAAILRDLASAYPNITAI
FT                   RVRDAIDRAAGLLAGLASATSYGAGVSLLTGFLVLIGAAAAGQGARIYEAAVLRTLGAS
FT                   RRRILLSLALRSALLGAAAGTIALAAGILGGWAVSRFVFETSFTVIWPSAILIVLGGVL
FT                   AVLGASLVFALPPLAARPARVLRARE"
FT   gene            complement(450704..451399)
FT                   /locus_tag="SPO0434"
FT   CDS_pept        complement(450704..451399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0434"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93753"
FT                   /db_xref="GOA:Q5LWA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA8"
FT                   /protein_id="AAV93753.1"
FT                   /translation="MTDPALVLEDARLSLEGNAGKVDILRGISLNVPAGQTLGLVGPSG
FT                   SGKSSLLMLMGGLERATGGRVQALGHDLGAMDEDALARFRRDRMGVVFQSFHLIPTMTA
FT                   LENVATPLELAGHRDAFARAAAELEAVGLSHRAGHYPAQLSGGEQQRVALARAAAPRPA
FT                   ILLADEPTGNLDEANGAAIMDLLFGLRDQYGATLVLVTHSARLASRCDRVVRLRDGRIE
FT                   DTESREAAQ"
FT   gene            451448..452083
FT                   /locus_tag="SPO0435"
FT   CDS_pept        451448..452083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0435"
FT                   /product="acyl-CoA thioesterase, putative"
FT                   /note="identified by similarity to SP:P29679"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93752"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA7"
FT                   /protein_id="AAV93752.1"
FT                   /translation="MRKALIGLLLAGWGMAATAEPVVIAALGDSLTQGYGLVPEQGFVP
FT                   QLQRWLMAEGAEVTLINAGVSGDTTAGGAARVAWTLTPEVDAMIVALGGNDLLRGIAPE
FT                   VARGNLATILTEAQRAGVAVLLVGMQAPGNYGADYKVAFDAIYPELAAEHSALLAPSFF
FT                   AGLMAEGDPAAAAGLMQGDGIHPNAEGVARIVAALGPFVLDLVQAAEK"
FT   gene            452085..452702
FT                   /locus_tag="SPO0436"
FT   CDS_pept        452085..452702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AC2205"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93754"
FT                   /db_xref="GOA:Q5LWA6"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA6"
FT                   /protein_id="AAV93754.1"
FT                   /translation="MPGRFFLTRPLTELADWLGCALPDLGTQPPRRNIQPGQEVLVLTG
FT                   QGLCPMRWGIVPVGRVNARGRPVMETIINARSETVFDKSAFAGTGRAVIPVDGWYEWTG
FT                   EKRRKTAWRISDAAGAPLLFAAITDVWTAPGGQQLHQVAAVTCPPNADVAPIHHRMGVL
FT                   LSREDVPVWLNGDQTQVQALMRPWPEGRLRIERATDVDWSAP"
FT   gene            complement(452742..452948)
FT                   /locus_tag="SPO0437"
FT   CDS_pept        complement(452742..452948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0437"
FT                   /product="cold shock family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93755"
FT                   /db_xref="GOA:Q5LWA5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA5"
FT                   /protein_id="AAV93755.1"
FT                   /translation="MATGTVKWFNTTKGFGFIAPEEGGKDVFVHISAVERSGLTGLADN
FT                   QKVSYELKPGRDGRESAVDLKLL"
FT   gene            complement(453151..453708)
FT                   /locus_tag="SPO0438"
FT   CDS_pept        complement(453151..453708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0438"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein/Tat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93756"
FT                   /db_xref="GOA:Q5LWA4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA4"
FT                   /protein_id="AAV93756.1"
FT                   /translation="MITRRTFIAASAAAGTLPWAIQAKASDAFDPTPQVVRIKKQFEPG
FT                   RLLILPRSFYLYYVTEEREAIRYGCGVGKAGLEFTGTATIDVKKEWPTWRPTPEMIERD
FT                   PRTYAKFVDNNYIQPGGPENPLGARALYLFQNGVDTYFRIHGTTQPQTIGHAASNGCIR
FT                   MLNEHVIDLYNRVPLGTVVTVL"
FT   gene            complement(453771..454187)
FT                   /locus_tag="SPO0439"
FT   CDS_pept        complement(453771..454187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0439"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93757"
FT                   /db_xref="GOA:Q5LWA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA3"
FT                   /protein_id="AAV93757.1"
FT                   /translation="MPTHNQTQIPSMTRVNHILIPGIVLLVSALLVQISGLTLLLGAHP
FT                   WWAHKVIWMGLPIGIGLALIAGALRVPRRLRQIGFTLLTLVAFLIATEGKTQFTASFAE
FT                   NTAAGRAWYFGWIATCALITATAASLFRYSHQTD"
FT   gene            454284..454676
FT                   /locus_tag="SPO0440"
FT   CDS_pept        454284..454676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0440"
FT                   /product="thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93758"
FT                   /db_xref="GOA:Q5LWA2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA2"
FT                   /protein_id="AAV93758.2"
FT                   /translation="MTDPQPSGELTLRTLAMPRDVNVNGDIFGGWVLSQMDIAAGLTAG
FT                   ARAGGRVTTVAVDAMKFIRPVGVGDVLCIYCQVVRVGRSSMAIEIEAWALRDRQGLREK
FT                   VTEAVFTFVAIDEEGRPRPVDAAAAG"
FT   gene            454811..455152
FT                   /locus_tag="SPO0441"
FT   CDS_pept        454811..455152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93759"
FT                   /db_xref="GOA:Q5LWA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA1"
FT                   /protein_id="AAV93759.1"
FT                   /translation="MEIIMQILVGIAGLSLAVLIYAWAYGRAHDPAAPAWARGQLFASV
FT                   ASLVATSLAPIGAGYLTAGLLWPDGLSLVWGLPVAIGAVPVVWVFSLRLLRRGRDRAQS
FT                   PTGLARAMA"
FT   gene            455224..455649
FT                   /locus_tag="SPO0442"
FT   CDS_pept        455224..455649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0442"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93760"
FT                   /db_xref="GOA:Q5LWA0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA0"
FT                   /protein_id="AAV93760.1"
FT                   /translation="MGDKTLTCLACGQLNRVPEARLTAGAKCGKCGDGLLTGQARDVDP
FT                   AILEKAKKNDDLPLVVDFWAPWCGPCRMMGPEYAKAAGVLAGQARLVKLDTQKHQSTGG
FT                   RYGIRGIPTMVAFERGKEKKRQSGAMQSGQIVGWVRG"
FT   gene            455724..455942
FT                   /locus_tag="SPO0443"
FT   CDS_pept        455724..455942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC62291.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93761"
FT                   /db_xref="GOA:Q5LW99"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW99"
FT                   /protein_id="AAV93761.1"
FT                   /translation="MTGVEWMTLDRAVMMFAGFMVLLSVLLTALVSPLWMWFTVFIGVN
FT                   LIQSSVTGFCPAAMVLKKLGFKTGTAF"
FT   gene            complement(455955..456170)
FT                   /locus_tag="SPO0444"
FT   CDS_pept        complement(455955..456170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93762"
FT                   /db_xref="GOA:Q5LW98"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW98"
FT                   /protein_id="AAV93762.1"
FT                   /translation="MAWIGVFLGTFAGLASSILACVLWELPLWAALLLYPLAGSAIAVA
FT                   VILLFMLREIRVPAAEPVTGGRTVNG"
FT   gene            456283..456858
FT                   /locus_tag="SPO0445"
FT   CDS_pept        456283..456858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ60337.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93763"
FT                   /db_xref="GOA:Q5LW97"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW97"
FT                   /protein_id="AAV93763.1"
FT                   /translation="MSIYVRPRVPGATIFFTVTLANKGSGLLTDQIGLLRTTVWQTRRE
FT                   RPFHIDAWVVLPDHLHAVWTLPRGDTDFSTRWGAIKARFTMGVRKAGFSPPPDLPVVRS
FT                   GRYAGLKPGLRSEKREAGVWQRRFWEHHIRGPDEYLAAVSFCHNDPVKHGLVTDAKAWP
FT                   FSTVHRKMQTSGEMCRAGFSPPSVVGPG"
FT   gene            complement(456890..458545)
FT                   /locus_tag="SPO0446"
FT   CDS_pept        complement(456890..458545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P37797"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93764"
FT                   /db_xref="GOA:Q5LW96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW96"
FT                   /protein_id="AAV93764.2"
FT                   /translation="MAAYQYVYHMQGVSKSYPGGKKCFENIHLSFLPGVKIGVVGVNGA
FT                   GKSTLMKIMAGLDKDFTGEAWAAEGAKVGYLPQEPHLDPNLTVRENVMLGVKAKKDILD
FT                   RYNELAMNYSDETADEMASLQDQIDAENLWDLDSQIDVSMEALRCPPDDANVESLSGGE
FT                   RRRVALCKLLLEAPDMLLLDEPTNHLDAETIAWLQQHLIDYKGTILIVTHDRYFLDSIT
FT                   GWILELDRGRGIPYEGNYSAWLEQKAKRLEQEAREDKAKQKTLERELEWMRQGQKARQA
FT                   KSKARIQAYNEMANQSEREKVGRAQIVIPNGPRLGSKVIEVEGLSKHMGDKQLIEGLDF
FT                   SLPPGGIVGVIGPNGAGKSTLFKMITGQEQPDAGSIEIGDTVKLSYVDQSRDDLKDGDT
FT                   VWEAITGGAEIIQLGDAQVNSRAYCSSFNFKGGDQQKKVSLLSGGERNRVHMARLLKEG
FT                   GNVLLLDEPTNDLDVETLRALEDALVDFAGCAVVISHDRFFLDRICTHILAFEGDAHVE
FT                   WFEGNFEDYEEDKKRRLGPDALEPKRLKHKKFVR"
FT   gene            458806..459792
FT                   /locus_tag="SPO0447"
FT   CDS_pept        458806..459792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93765"
FT                   /db_xref="GOA:Q5LW95"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW95"
FT                   /protein_id="AAV93765.1"
FT                   /translation="MIYVILKIYKNVNISAVRALVPPDLGAKGHIKWGKTNMTCDSVKW
FT                   TLTSGDVTVEVIATDDGFGNITFTYELVSGIADLNGFFIDIGNDGGDISKLSGGNNMKG
FT                   SDSDGDRLDGFDIAEEIGTVGGNDEDTTSGTLTFTMAELGISSLAELADAEIGIRATSV
FT                   GEDREDSLKLADTGTYCPVEPPSDDDFPEWGQDISHVVFVFNQTVGDTSGDGYYTIKVD
FT                   YTDALVAAQGNDLDDYIDDFLFALINDDTNVPFLEPDADLMGVVIKGGLQTTEYYAYGD
FT                   YNTNGTDPDPLPAGIGFALPGDKGTVDPVNEIDLALSVDDSGDFIFA"
FT   gene            459926..460420
FT                   /locus_tag="SPO0448"
FT   CDS_pept        459926..460420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0448"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93766"
FT                   /db_xref="GOA:Q5LW94"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW94"
FT                   /protein_id="AAV93766.1"
FT                   /translation="MPPQRRRVMTDLQTLIAGWAQPGRVGWIGLRPERRAALIAVDEGL
FT                   VGLDGLAGDHGRPGKRAVTLVQGEHLGAIGAYLGRGAVSPLDLRRNIVVEGINLSALKG
FT                   RAVRVGGAVLRLSVICAPCSRMEETFGTGGYSAVRGHGGWCAEVLEPGLIKLGDPVRPA
FT                   D"
FT   gene            460454..461095
FT                   /gene="nadD"
FT                   /locus_tag="SPO0449"
FT   CDS_pept        460454..461095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="SPO0449"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93767"
FT                   /db_xref="GOA:Q5LW93"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW93"
FT                   /protein_id="AAV93767.1"
FT                   /translation="MRQGFPYARPGQVIGLFGGSFDPPHAGHVHVTREALKMFGLDRVW
FT                   WLVTPGNPLKAHGPAPLDRRMEAARAMMRHPRVDVTDIEAHLGTRVTADTIAALRRIYP
FT                   RVRFVWLMGADNLAQLHRWKDWRQIIETVPVGVLARPGDRISARMSPAARAYAPYRIDG
FT                   QARHLLGRAEAPAWCFVNVPMVDVSSTRIRAAGGWSAAQQGRGQTGTQDQ"
FT   gene            complement(461048..461875)
FT                   /locus_tag="SPO0450"
FT   CDS_pept        complement(461048..461875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0450"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93768"
FT                   /db_xref="GOA:Q5LW92"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW92"
FT                   /protein_id="AAV93768.1"
FT                   /translation="MGRAIGIMFIAMSLIPAGDMAGKLLTGTYGAAPIYVAWSRFALGL
FT                   LMLMPFVPAAAWRLLANWRIWFRALLLAGGILSIQSALRTEPLANVFAAFFVGPILSYA
FT                   LSALLLREPVTMLRSALMLLGFGGVLLVVRPGFGGSPGLLLALLAGCFYGGFLTASRWL
FT                   SPLGSPLALSLTQLAIAGLVLMPFGLSALPSFSPQVAALTLASALGSMLGNLLLLVAYA
FT                   RAPATRLAPLVYFQLAAATGLGWAVFGDLPDLWTWAGLSLVLGAGLASALLRR"
FT   gene            461960..463450
FT                   /gene="dacB"
FT                   /locus_tag="SPO0451"
FT   CDS_pept        461960..463450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="SPO0451"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93769"
FT                   /db_xref="GOA:Q5LW91"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW91"
FT                   /protein_id="AAV93769.1"
FT                   /translation="MVEAISRRVFLAGLGAALSHSAAYAEAPALSLRPPLRLKDARALA
FT                   GPEAVLSGSGLSGRVAFAVADAETGLELETVEPGLALPPASVAKALTALYALETLGPSH
FT                   RFRTRVLADGPVENGVLKGDLILAGGGDPTLDTDALAALVRALKESGLREVRGAFKVYD
FT                   GSLPEVFSIDPEQPEHVGYSPAVSGIALNFNRVHFEWKRAGKGWSVSMDARSAKIRPAV
FT                   AIAEMKVVSRALPIYTYEQRQRIDSWTVASQALGQDGSRWLPVRKPALYAGDVLQTLAR
FT                   SNGIVLGRVEVVKSLPGGARTLVHHDSAPLEDILRDMLKYSTNLTAEMVGLAATVARGK
FT                   RPATLRASAEEMSVWAAERYGLRGSRLVDHSGLGDASRMTARDLVAILVQAGKTGRLPR
FT                   MLKDIPMRDQKGRVVKGHPIKVAAKTGTLNFVSGLGGFMTAADGTVLAFAILTADPDRR
FT                   AAIPPEDRERPEGARGWNARSKKLQQALIERWGAIYGS"
FT   gene            complement(463501..463923)
FT                   /locus_tag="SPO0452"
FT   CDS_pept        complement(463501..463923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AD3572"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93770"
FT                   /db_xref="GOA:Q5LW90"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW90"
FT                   /protein_id="AAV93770.1"
FT                   /translation="MTEQPTHPMTPQDCLVAIMMAVSASDENIRTAELVKIQSAVNMLP
FT                   VFADYDIDRMKRVSQVVFDLFEQEDGLDALFGLVRDNLPERLFETAYALACDVAAADGT
FT                   LAETELRLLEEIRYELNIDRLHAAAIERGARARHVV"
FT   gene            complement(464016..464474)
FT                   /gene="dddW"
FT                   /locus_tag="SPO0453"
FT   CDS_pept        complement(464016..464474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dddW"
FT                   /locus_tag="SPO0453"
FT                   /product="DMSP lyase"
FT                   /note="identified by similarity to GB:AAM06297.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93771"
FT                   /db_xref="GOA:Q5LW89"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW89"
FT                   /protein_id="AAV93771.1"
FT                   /translation="MTAMLDSFATDLTAATSLHQPGNLPHPPHAIDAENVPLSGGTDPT
FT                   YGEVRWRTLINGTEAAPRDMVLGIAEFGPGHQLRPHRHTPPEFYLGLEGSGIVTIDGVP
FT                   HEIRAGVALYIPGDAEHGTVAGPEGLRFAYGFASASFEAIEYRFTASA"
FT   gene            464569..465450
FT                   /locus_tag="SPO0454"
FT   CDS_pept        464569..465450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0454"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93772"
FT                   /db_xref="GOA:Q5LW88"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW88"
FT                   /protein_id="AAV93772.1"
FT                   /translation="MERLPSFSGLTAFYAAARRGTLTAAAAELNVSQPAVSRRIAMLEA
FT                   DLGSPLFDRSHKPVRMTQSGRDLLRALQGGFGQIEAAVAQIRQAAQGKVVTVTAPSGFV
FT                   AFWLIPQLGELEAAFEDVTIRIISQEYGEATRPGDIAIRFGLPEDGTERRLLGDGVFPA
FT                   ASPLYLDRREMSGSDYDFARMTLLTMESARSQWHDWPSWFRSVGMSMPQKARVLDFSSY
FT                   AMLVNAALAGQGVCLCWDGVLDRFLEAGALVRLEGPEAVSSRGYFMAAREGLAAAPHVR
FT                   GILGWILEKSHK"
FT   gene            465480..467126
FT                   /gene="lysS"
FT                   /locus_tag="SPO0455"
FT   CDS_pept        465480..467126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SPO0455"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93773"
FT                   /db_xref="GOA:Q5LW87"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW87"
FT                   /protein_id="AAV93773.1"
FT                   /translation="MLHWHNRTAGPGAWGALPSPMETDMSNSRELALASKAWPFEEARR
FT                   VLKRYEKAPPEKGYVLFETGYGPSGLPHIGTFGEVARTTMIRRAFHEISDIPTRLICFS
FT                   DDLDGMRKVPGNVPNQDMLREHLQKPLTSVPDPFGTHESFGHHNNAMLRRFLDTFGFEY
FT                   EFYSATEFYRSGQFDEILLRAAERYDDIMKIMLKSLREERQQTYSIFLPIHPETGRVLY
FT                   VPMKEVNAKDGTITFDDEDGREWTLPVTGGNVKLQWKPDFGARWAALGVDFEMYGKDHS
FT                   TNTPIYDGICRVLGVPAPEHFTYELFLDENGQKISKSSGNGVSIDEWLTYASSESLAYF
FT                   MYQKPKTAKRMYFDVIPKAVDEYHQQLRAYPTQDLAAQLNNPVWHIHGGDVPASTLIVP
FT                   FGMLLNLASVSGAEDKEALWGFIRRYAPEASAESHPDLDQAAGFAVRYFNDFVKPTRVY
FT                   RAPIEVEREALEELRAQLAAYDGPVEDEALQSIVYAVGRDRFDPLRAWFGALYEVLLGA
FT                   SQGPRFGGFIALYGIPETIALIDKALAGELV"
FT   gene            467237..467545
FT                   /locus_tag="SPO0456"
FT   CDS_pept        467237..467545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93774"
FT                   /db_xref="GOA:Q5LW86"
FT                   /db_xref="InterPro:IPR025498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW86"
FT                   /protein_id="AAV93774.2"
FT                   /translation="MTIPDEDKFQGRIHGERPEPKDPENLWWRLLHMILIAIMINLAQT
FT                   ILAVVTVVQFIIMAVSKSQPNERLADFGTDLGIWIAKAARFQTAASNVKPWPWTDLD"
FT   gene            467598..467999
FT                   /locus_tag="SPO0457"
FT   CDS_pept        467598..467999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC47480.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93775"
FT                   /db_xref="GOA:Q5LW85"
FT                   /db_xref="InterPro:IPR032347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW85"
FT                   /protein_id="AAV93775.1"
FT                   /translation="MRQLLFILACCVGLVGPAQAQSDEIKAVIGNQIEAFLADDFATAF
FT                   TFASPMIREIFRTPENFGSMVRNGYPMVWRPAEIRYLGLEEREGTLWQLVRVTDRQGLA
FT                   HVLAYQMVNLESGWKINAVQVLETPPPSV"
FT   gene            complement(467966..470359)
FT                   /locus_tag="SPO0458"
FT   CDS_pept        complement(467966..470359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93777"
FT                   /db_xref="GOA:Q5LW84"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW84"
FT                   /protein_id="AAV93777.1"
FT                   /translation="MILIGPLLHLGIRRQIGNRTPRFPQRPLWHHSIDSARLGPERQGC
FT                   IGIDQPVVRCAGLVHLQPQGVGAARADPMIGVPLIDQIPGPIEIQPRETGVDPLGPVDV
FT                   SIDRAELVAGDCHAIDEMANPMRLDHDIAEPGRHLARQKDIVGDAQRAERESAIEVRVR
FT                   VLFVSPFQAAIVDIVLGKSRARVSPDQYDTRCARPVVNGIALKEVVAQDHMVLPRHDGK
FT                   MTEPGRPAMAQLDVVGIGVEPDAAAVRHVQRLFRREKLAPVDQHALTATTDRGDSTILW
FT                   PTDKTIVKRECSAVRSQPDRAAMGVTLELDVLHVELRQRAEAAEIQHVFEAAEGEDLGA
FT                   CRIIERRVQCDLTGPHVFRAHIDFAPDTRSRHQGTHRNIGDIRHVVQLTRVIGVICRLR
FT                   DKGIGIPSGTRHRHQLPVADHPSGRETGPVWNSRLHVDRRGDRHIAPAHVQRFVIRPVQ
FT                   QRLKRLAKGGFLVTKGRDIGRKIKILGQQQHLVDRHRHRALEIDLRCQADRLPQEISSA
FT                   RHENAAPSGCAIGGLECGRVVGDPIAHRTVITDIDLAQHVTQERAGDIGDLDIVDPHDA
FT                   AIRPFEIEAEMTIERRRPPDHVDTAAIAGSHDARHLDHIAIAGQRGRGPLFRHAADMRT
FT                   ACRTGPPGDPNAGQVATDRLDPDLDLQVTARLQGRLPHIAQLLNRCGLLQFQAAAKIGI
FT                   RRNKGRIRRPIIGIRPRRAVAARPHIQPQLKGGRHEVDAVGDCLVHTNPFPNRATDDLP
FT                   ARFHVTGPGRTRTRQMGRTKGLIPAHSTVTVTLPQTEGGGVSRT"
FT   gene            468056..470425
FT                   /locus_tag="SPO0459"
FT   CDS_pept        468056..470425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93776"
FT                   /db_xref="GOA:Q5LW83"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW83"
FT                   /protein_id="AAV93776.1"
FT                   /translation="MARSGAARTRHMKARWQVVSGAIGKGICMNKAITDGINFMPPAFQ
FT                   LGLNVWSSGDGTPGSDTYDGAPNAAFVPADADFGGCLELQKTASVQKLRYMGQTPLQPG
FT                   CYLQIKVRIKAISGNLPSVRVAGWAGAAGGAHVGGVTEQGPSTTLTSYGDVVEVTGIVG
FT                   SGNRGGVDMVWGASALYGHFGLDLEGSNGGIVRIDDIEITDITGAFLRDMLSQVDVRDY
FT                   GAVGDGVTDDSAAFEAADSAAGGRRVFVPGGTYFLGQTVSLASEIDFEGTVTMPVDKML
FT                   LLTKNFDLPTYIAAFGDEETAFRKAFQALLNGSDHESLDMGGRNVSVTAPIDMQAAVPN
FT                   RTSFSTRRVIRNGQLVAVAGPAWDTDTFISQATYDPNDARKLNNVTNIANIPVGSLVTG
FT                   AGVGREIYVRSKNVGAGEITLNAPLYDAAGTQVFTFRSFKYMLDFSGFSSLSKFNMQNI
FT                   EFQCNTHCSAIRLAPYGATFALYDCFISRPKDRGITSIGGGCQGMLIDGCQFLSSEEAL
FT                   NVPDRSSIGFNTNANDVKLRHCRATRFRHFAVMAGQNHMILGNHFFQGDAVDNGPRTAG
FT                   IVLIGTYSSATFAENYVDNCSLEWTNEQDPNPDFNGGFSFSALSITDNIFLSGEVAPWF
FT                   SYIVIKPHGVGHFINGMTVTGNKFRSINGYIDRAERVDTSFSGLNFDRTRDLIYQGNTY
FT                   HGVSTRSANPLRLEVDQTSASDNWLINTDATLPFGAETRGVDAVVPQGPLRESGGAVAY
FT                   LAPYAQVQQGTNQDQLRLRWSEPVSGTVFVTVRADK"
FT   gene            complement(470475..471332)
FT                   /locus_tag="SPO0460"
FT   CDS_pept        complement(470475..471332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93778"
FT                   /db_xref="GOA:Q5LW82"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW82"
FT                   /protein_id="AAV93778.1"
FT                   /translation="MVLPDPPFCCATVMTCPMRRLSHAASQHSARPPVHNGKTTATLRH
FT                   NRTNQSLTKLREACDGGCGMGRLLIALWICMTAACPAAAGAWLREKGHGFTSASVTLYR
FT                   FQGAYDYKTTAYAEWGMAERLTLGIDINEQPGLAGHALIFARYPLWDLGTKGRFAAELG
FT                   LGAHHWLGDWAPMGKLTLSYGKGLETRWGNGWLAVDTGWERRSGTKTNIFKLDMTAGLS
FT                   TARRIDPMLQVETAYVPGHPLFWTITPSLLIEGSKGRTWVLGLERKSDLPGSLNIKFSL
FT                   WREF"
FT   gene            471280..471909
FT                   /locus_tag="SPO0461"
FT   CDS_pept        471280..471909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0461"
FT                   /product="ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93779"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW81"
FT                   /protein_id="AAV93779.1"
FT                   /translation="MGHVITVAQQKGGSGKTTLAVNLAVAFMRAGRRVALMDTDPQGSA
FT                   GRWFMARLEAGGDPGLEFSTASAWGVSYEVRKLAKDHDIVIIDTPPKADSDLRPALREA
FT                   DLVLIPVATSHLDLWAVEMVLYLAEREDKPALMVMTRNRPGTRLAQDVAAKAQELNAEL
FT                   AQAALANRVTYAETLGHGRAALEAPKGPAHAEVTGLMREIEIALGL"
FT   gene            471959..472285
FT                   /locus_tag="SPO0462"
FT   CDS_pept        471959..472285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0462"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93780"
FT                   /db_xref="GOA:Q5LW80"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW80"
FT                   /protein_id="AAV93780.1"
FT                   /translation="MPKIAKAAPVQTVITTFEMTPGTCQDLLEALTEAYADFISKQPGF
FT                   VAAGLHVNDAQTRIANYSQWQRREDFLAMLRTPEMRERNRRINEMCKSFEPVMYEVAET
FT                   FDGN"
FT   gene            472365..472772
FT                   /locus_tag="SPO0463"
FT   CDS_pept        472365..472772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0463"
FT                   /product="universal stress family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93781"
FT                   /db_xref="GOA:Q5LW79"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW79"
FT                   /protein_id="AAV93781.1"
FT                   /translation="MYHNILVPISFDAERDVSGPLKLAQLLATPEARVTLLHVVEHIPA
FT                   YAISYMPTDYLAEARKALKKELDALAAQLPNATGVLIEGHSGRSILDWAETNNPDLIII
FT                   SSHRPGMQDLLLGSTATQVVRHAQCAVHVVR"
FT   gene            472839..473417
FT                   /locus_tag="SPO0464"
FT   CDS_pept        472839..473417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93782"
FT                   /db_xref="GOA:Q5LW78"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW78"
FT                   /protein_id="AAV93782.1"
FT                   /translation="MVVSLVLLAGSLLLLGWSLLTFGSILTPALLVAALGVVVGVVLVL
FT                   RFRLRAAPVWIVIDGSNVLYWRDETPNLHTVRQCVEGLVRNGWTPLLWFDANVGYLVGS
FT                   QYMGPHELSRALRYPASHINVAPKGTPADPLLIEQAGDLGARIVTNDRFRDWVETYPQV
FT                   ADAGLFLRGSASDQGVSLRFAEEPARKRA"
FT   gene            complement(473414..473896)
FT                   /locus_tag="SPO0465"
FT   CDS_pept        complement(473414..473896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0465"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93783"
FT                   /db_xref="GOA:Q5LW77"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW77"
FT                   /protein_id="AAV93783.1"
FT                   /translation="MTDPYLPADAKTRAQARALIDSARHGALAVLQPGGLAPSVSRISL
FT                   ATDAQGMPVSLVSSLAAHTAALEATPACALLIGEPGAKGDPLTHPRLTLHCSAQLIPRG
FT                   TPEHDALRARYLMLRPKAGLYADFGDFRFVRFAVADGLLNAGFGKAVRLSAEDLST"
FT   gene            complement(473906..474685)
FT                   /locus_tag="SPO0466"
FT   CDS_pept        complement(473906..474685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0466"
FT                   /product="transporter, formate/nitrate family"
FT                   /note="identified by similarity to SP:P21501"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93784"
FT                   /db_xref="GOA:Q5LW76"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW76"
FT                   /protein_id="AAV93784.1"
FT                   /translation="MSDANPTGLDAYKPAEIARLVETAGVAKAGLGAAQTLTLAVLAGA
FT                   FIGFGGAAYTMVMTGADTGFGPARFLGGVVFSLGLILVIVGGAELFTGNALMVMAAVDR
FT                   RITLAALLRNWGLVYLGNLLGAVGLALAFALTGLLDGLMGDTAQAIARGKAALDPGAAF
FT                   MRGVLCNAMVCLAVWLTFAARTAAGKILAILWPISAFVLLGLEHSVANMYLIPQGMLAG
FT                   AEVTPGAALANLFWVTLGNILGGAGGVALAYRFAYLR"
FT   gene            complement(474743..475453)
FT                   /locus_tag="SPO0467"
FT   CDS_pept        complement(474743..475453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0467"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93785"
FT                   /db_xref="GOA:Q5LW75"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW75"
FT                   /protein_id="AAV93785.1"
FT                   /translation="MSRIPVWKTIALSLTEDIAEGRYGEGDRLPTEAQLAATHGVNRHT
FT                   VRRALADLADQGLVHARRGAGVFVAARPTDYAIGKRVRFHKNIAAGGRIPGKRILALTT
FT                   RAADSTESEALALPAGAQVHVYDGLSLADGQPIAVFQSVFPAARFPGLPEVLTETRSVT
FT                   AALQRLGVADFTRVSTRLTARPANATQALHLRLNEGAPLMFSTGVNVDPDGRPVEYGRT
FT                   WFAGDRVTLTLGED"
FT   gene            475557..476012
FT                   /gene="phnG"
FT                   /locus_tag="SPO0468"
FT   CDS_pept        475557..476012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="SPO0468"
FT                   /product="alkylphosphonate utilization protein PhnG"
FT                   /note="identified by similarity to SP:P16685"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93786"
FT                   /db_xref="GOA:Q5LW74"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW74"
FT                   /protein_id="AAV93786.1"
FT                   /translation="MAEQEKETAARQGWMGLLARAPEAMLMALWNRVEERPAFDWLRAP
FT                   ETGGVMVRGRAGGTGAPFNLGEMTVTRCALALADGTVGHAYVQGRSRAKAEAAALIDAL
FT                   MQTAAADTIRALVLDPLAAQMAERSEGRAARAAATKVEFFTLVRGED"
FT   gene            476009..476587
FT                   /gene="phnH"
FT                   /locus_tag="SPO0469"
FT   CDS_pept        476009..476587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="SPO0469"
FT                   /product="alkylphosphonate utilization protein PhnH"
FT                   /note="identified by similarity to SP:P16686"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93787"
FT                   /db_xref="GOA:Q5LW73"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW73"
FT                   /protein_id="AAV93787.1"
FT                   /translation="MMDGSSLYAGGFRDAPVDAAHAFRAAMSAMARPGDIRRIAGAEPP
FT                   APLSVAAGTLLLTLCDPETRVHLAGAVDTDAVRQWLSFHTGAPLVDAAEADFALGSWAD
FT                   LMPLSRYRIGTPEYPDRSAALIVECDALENTGAVLSGPGIRDTARLSLPDVDTLKGNAI
FT                   LYPLGCDFFFTCGDRVAALPRSTTIVAEG"
FT   gene            476591..477682
FT                   /gene="phnI"
FT                   /locus_tag="SPO0470"
FT   CDS_pept        476591..477682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="SPO0470"
FT                   /product="alkylphosphonate utilization protein PhnI"
FT                   /note="identified by similarity to SP:P16687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93788"
FT                   /db_xref="GOA:Q5LW72"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW72"
FT                   /protein_id="AAV93788.1"
FT                   /translation="MYVAVKGGERAIENAHAWLAEERRGDTSVAELSLAQIREQLSLAV
FT                   NRVMAEGSLYDPDLAALAIKQARGDLIEAIFLIRAYRTTLPRFGASRAVDTGAMACDRR
FT                   ISATFKDAPGGQVLGPTFDYTHRLLDFKLAAEGDVPPAPSAPPRREPTPHITEFLGQEG
FT                   LIQPEPVSDAVPGDLTREPLEFPADRALRLQSLARGDEGFVLGMAYSTQRGYARNHAFV
FT                   GELRIGRVTVEMEVPELGFAIEIGELELTECETVNQFKGSKTEPPQFTRGYGLVFGQSE
FT                   RKAISMALVDRALRWKELGEDNLGAPAQDEEFVLSHSDNIQATGFLEHIKLPHYVDFQS
FT                   ELELVRKLRREAEERIVHREAAE"
FT   gene            477762..478598
FT                   /gene="phnJ"
FT                   /locus_tag="SPO0471"
FT   CDS_pept        477762..478598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="SPO0471"
FT                   /product="alkylphosphonate utilization protein PhnJ"
FT                   /note="identified by similarity to SP:P16688"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93789"
FT                   /db_xref="GOA:Q5LW71"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW71"
FT                   /protein_id="AAV93789.1"
FT                   /translation="MTEQAYNFAYLDEQTKRMIRRAILKGLAVPGYQVPFASREMPMPY
FT                   GWGTGGVQVSAATLTPDDRLKVIDQGADDTTNAVSIRKFFERTAGVATTEATQEATVIQ
FT                   TRHRIPEAELTEDQILVYQVPIPEPLRFLEPRETETRKMHSLQEYGLMHVKLYEDISQH
FT                   GAISTAYAYPVRVAERYVMDPSPIPKFDNPKMEMAAIQLFGAGREQRIYAVPPYTRVVS
FT                   LDFEDYPFEATKAEHPCDLCGAEDSYLDEVIMDDAGGRMFVCSDTDYCRSRREAAA"
FT   gene            478684..479454
FT                   /gene="phnK"
FT                   /locus_tag="SPO0472"
FT   CDS_pept        478684..479454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="SPO0472"
FT                   /product="alkylphosphonate utilization protein PhnK"
FT                   /note="identified by similarity to SP:P16678"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93790"
FT                   /db_xref="GOA:Q5LW70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW70"
FT                   /protein_id="AAV93790.1"
FT                   /translation="MSPLLEVRGIEKRYGARIGCTNVSFDLYPGEVMGIVGESGSGKST
FT                   LLNCLAGHLVPDAGQVIFDTRHTGPVDTVTMSEPERRMLSRTDWAFVHQHARDGLRMSV
FT                   SAGGNIGERLMAVGDRHYGRIRASALDWLDRVEIDGARIDDRPTAFSGGMQQRLQIARN
FT                   LVTGPRLVFMDEPTGGLDVSVQARLLDLLRGLVRRMGLSAIIVTHDLAVVRLLADRLMV
FT                   MKDGRVVESGLTDQVLDDPQHGYTQLLVSSVLQV"
FT   gene            479522..480205
FT                   /gene="phnL"
FT                   /locus_tag="SPO0473"
FT   CDS_pept        479522..480205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="SPO0473"
FT                   /product="alkylphosphonate utilization protein PhnL"
FT                   /note="identified by similarity to SP:P16679"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93791"
FT                   /db_xref="GOA:Q5LW69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW69"
FT                   /protein_id="AAV93791.1"
FT                   /translation="MIDIRDVSKSFTLHNQGSAVIRVMEGASLHVAPGECVALTGASGA
FT                   GKSTLMRVIYGNYLAASGSVLVGGLDVVQAEPREILQLRREVLGYVSQFLRVVPRVPTV
FT                   EVVAEPLLALGADPDAARARAEALLSRLNIPERLWKLSPTTFSGGEQQRVNIARGFAHA
FT                   YPALLLDEPTASLDAANRAVVLELIEEAKARGAAIVGIFHDVEARARVCDRVVDVSAFT
FT                   PGAAA"
FT   gene            480202..480750
FT                   /gene="phnN"
FT                   /locus_tag="SPO0474"
FT   CDS_pept        480202..480750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="SPO0474"
FT                   /product="alkylphosphonate utilization protein PhnN"
FT                   /note="identified by similarity to SP:P16690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93792"
FT                   /db_xref="GOA:Q5LW68"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW68"
FT                   /protein_id="AAV93792.1"
FT                   /translation="MTQVPVIAVVGPSGVGKDSVMTALATRDPRVHLIRRVITRPEDAG
FT                   GEAFTGVSRQEFEAMRAAGAFALSWEAHGLCYGVPMPSEVKQADARALLVNLSRGVLLR
FT                   AQEVFHPFAVLSLTARPEVLAARLAARGREDAAEQARRLGRAGMALPEGVRRVITVDNS
FT                   GPLERTVDAVLAHLQRESA"
FT   gene            complement(480732..481415)
FT                   /locus_tag="SPO0475"
FT   CDS_pept        complement(480732..481415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN29788.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93793"
FT                   /db_xref="GOA:Q5LW67"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW67"
FT                   /protein_id="AAV93793.1"
FT                   /translation="MTFLRYAIYFLPPASEAWAGFGASWLGWDVETGQELAHPAETGLD
FT                   VAALTATPRKYGLHATMKPPFRLAEGQDVDALRRACATLAASRPAVTLDGLEIARLGRF
FT                   LALRPVGELGALNALAAACVTELDPFRAPATPQELVRRRAARLSPEQDAHLLSWGYPYV
FT                   LDQFRFHITLTGRLDDDMLMQAQTLLQRRLGPLLPVPFTLADLALVGEAGDGRFHLIHR
FT                   YALSR"
FT   gene            481469..482611
FT                   /gene="phnM"
FT                   /locus_tag="SPO0476"
FT   CDS_pept        481469..482611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="SPO0476"
FT                   /product="alkylphosphonate utilization protein PhnM"
FT                   /note="identified by similarity to SP:P16689"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93794"
FT                   /db_xref="GOA:Q5LW66"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW66"
FT                   /protein_id="AAV93794.1"
FT                   /translation="MTDEVILANATLVLRGETVTGSLHIKGETIAGIDQGAHVPAGAVD
FT                   CEGDFVSPGLVELHTDNLERHIQPRPKVDWPHAAAILAHDAELAGTGITTVFDAMRVGS
FT                   IPSGAGRYLQYARNLSRELWQLREASALKISHFLHLRAEVCSETLVEELDEFAPEDRVG
FT                   LVSLMDHTPGQRQFRDMTKLEAYMKGKHAMSDDTFLQHVSQLKGLRDRYGDRHEIETVK
FT                   AARRLGSVLASHDDTTAEQVAVSAGHGIRLAEFPTTIEAAEACHAHGIKVIMGAPNLIR
FT                   GGSHSGNVAAADLAERGLLDILSSDYVPSALLLSAVRLGALWGDMARGMATVTRTPAQA
FT                   VGLDDRGEIAPGLRADLIRFRMSQDVPALQSVWSRGRRVA"
FT   gene            complement(482616..483182)
FT                   /locus_tag="SPO0477"
FT   CDS_pept        complement(482616..483182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93795"
FT                   /db_xref="GOA:Q5LW65"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW65"
FT                   /protein_id="AAV93795.1"
FT                   /translation="MRPHGKWGTPNRAQDPEKQIFNATLSVSYPKSPVLPTARHGAAIF
FT                   AGQLCPMTELQAIREALYPEAPRKQTRRLRRADRTRAKALSPLRVLLLLASLPVIAGST
FT                   AIGVYMRTSPYPPELALRHLAALAGCETAALAGLPQARRGEPGYHQRNDADLDGVACGT
FT                   TLADAGMEARTPTQRAPGQAKFVRP"
FT   gene            483205..483456
FT                   /locus_tag="SPO0478"
FT   CDS_pept        483205..483456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93796"
FT                   /db_xref="GOA:Q5LW64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW64"
FT                   /protein_id="AAV93796.1"
FT                   /translation="MRSLLFAATLFAAATPVLADEVTGIILAYDRVDGRIVLEDKTVWS
FT                   LEFVEEIPEGLAVGDEVRIVFEAAGEDGITKINAIHQE"
FT   gene            483607..484674
FT                   /locus_tag="SPO0479"
FT   CDS_pept        483607..484674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0479"
FT                   /product="ISSpo8, transposase"
FT                   /note="identified by similarity to GB:AAF61102.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93797"
FT                   /db_xref="GOA:Q5LW63"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW63"
FT                   /protein_id="AAV93797.1"
FT                   /translation="METSMITELKSVRDIWKKMPSERHARIFLEEMIWPSGRHCPHCGS
FT                   LSSTPIRGRTARPGLYQCAERECCLQFTVTTKTPMHATKLDLRIWIAAIFLMLTSSKGI
FT                   SSVVMARILGVNQKTAWKLGHAIRELMDEREAVSARLAGVVEVDEAYVGGAPKFKKGVK
FT                   NKRGRGTGKPMVLVAADRTGQAKATLIPNAKGATLGPIMKEWIDPSSALMTDSNTAYRK
FT                   IGRSFASHHTVNHGKRQHSRPSKGAHINTVEAVNSQVQRALIGVYHRLGRQHLQRYLDE
FT                   ILWQWNHRQQEVKIRNRKTSSGTKTIATRVWKPIPVVDQMRGLLCCAVGRQLRRTPQWG
FT                   LCWPIHLFEHKGTFA"
FT   gene            complement(485387..485463)
FT                   /locus_tag="SPO_tRNA-Arg-2"
FT   tRNA            complement(485387..485463)
FT                   /locus_tag="SPO_tRNA-Arg-2"
FT                   /product="tRNA-Arg"
FT   gene            complement(485499..485975)
FT                   /locus_tag="SPO0481"
FT   CDS_pept        complement(485499..485975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0481"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93798"
FT                   /db_xref="GOA:Q5LW62"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW62"
FT                   /protein_id="AAV93798.1"
FT                   /translation="MSGFVIERANPSAPEAAALIARHVALMASQSPEESCHVLDGSGLD
FT                   SPDVAFFLLRQAGVAIGMGALKTLSDGALELKSMHTVSEARGSGAGRAMLEFLLDRARS
FT                   QGAGGIYLETGSTDDFLPARRLYETYGFTECAPFEGYAEDPWSTFMTLDLRAAA"
FT   gene            complement(485983..486294)
FT                   /locus_tag="SPO0482"
FT   CDS_pept        complement(485983..486294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0482"
FT                   /product="NADH-ubiquinone oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93799"
FT                   /db_xref="GOA:Q5LW61"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW61"
FT                   /protein_id="AAV93799.1"
FT                   /translation="MRARIYQPARNAMTSGMAKTRKWVLEYAPGSAREVDPLMGWTSSS
FT                   DTQSQVRLRFDSKEEALDYARAHGIDAVVTEPHKRKPNLRARGYGENFATDRRGPWTH"
FT   gene            complement(486480..487127)
FT                   /locus_tag="SPO0483"
FT   CDS_pept        complement(486480..487127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0483"
FT                   /product="microcystin dependent protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93800"
FT                   /db_xref="GOA:Q5LW60"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW60"
FT                   /protein_id="AAV93800.1"
FT                   /translation="MSKNAFTTFATAAALSLSLIAPASQARAGTDPFVGELMLAGFNFC
FT                   PRGWAEANGALLAISSNTTLFSLLGTMYGGDGRTTFALPDLRGRVAIGVGTGPGLQPIT
FT                   QGERLGQPTTTQTIATMAPHTHLATSNASTSIHVSSDDANIQDPGNAFLGTTSTPTYTT
FT                   TQPDEALANGSATTGVTTTILSTGQGLPQENHQPSLGLKYCIALFGVYPSRN"
FT   gene            487568..488410
FT                   /gene="rplB"
FT                   /locus_tag="SPO0484"
FT   CDS_pept        487568..488410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPO0484"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:P02387"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93801"
FT                   /db_xref="GOA:Q5LW59"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW59"
FT                   /protein_id="AAV93801.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNN
FT                   TGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALIKYEDGEQAYI
FT                   LAPQRLAVGDKVVASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGIRPSVRG
FT                   VAMNPIDHPHGGGEGRTSGGRTPVTPWGKDTKGTRTRNKNKASQKLIIRSRHAKKKGR"
FT   gene            488414..488692
FT                   /gene="rpsS"
FT                   /locus_tag="SPO0485"
FT   CDS_pept        488414..488692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPO0485"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by similarity to SP:P02375"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93802"
FT                   /db_xref="GOA:Q5LW58"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW58"
FT                   /protein_id="AAV93802.1"
FT                   /translation="MSRSVWKGPFVDAYVLKKAAAVRESGRNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGQKHIPVNVTEDMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            488696..489076
FT                   /gene="rplV"
FT                   /locus_tag="SPO0486"
FT   CDS_pept        488696..489076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPO0486"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by similarity to SP:P02423"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93803"
FT                   /db_xref="GOA:Q5LW57"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW57"
FT                   /protein_id="AAV93803.1"
FT                   /translation="MGKEKNPRRVAENEAMAKLRMLRTSPQKLNLVAAMIRGKKVGQAL
FT                   TDLTFSNKRIAQDVKKCLQSAIANAENNHNLDVDELIVAEAWVGKNLVMKRGRPRARGR
FT                   FGKIMKPFSELTITVRQVEEQA"
FT   gene            489076..489783
FT                   /gene="rpsC"
FT                   /locus_tag="SPO0487"
FT   CDS_pept        489076..489783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPO0487"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by similarity to SP:P02352"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93804"
FT                   /db_xref="GOA:Q5LW56"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW56"
FT                   /protein_id="AAV93804.1"
FT                   /translation="MGHKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLAIREFIKE
FT                   ECKQAGVARVIIERPHKKCRVTIHTARPGVIIGKKGADIETLRKKLANMTDSELHLNIV
FT                   EVRKPEMDAQLVAESIAQQLERRVSFRRAMKRAVQNSMRMGALGIRVNVAGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYALAEASTPYGIIGIKVWIFKGEILEHDPQARDRKAQEL
FT                   QDGPAPRGAGGRR"
FT   gene            489796..490209
FT                   /gene="rplP"
FT                   /locus_tag="SPO0488"
FT   CDS_pept        489796..490209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPO0488"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by similarity to SP:P02414"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93805"
FT                   /db_xref="GOA:Q5LW55"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW55"
FT                   /protein_id="AAV93805.1"
FT                   /translation="MLQPKRTKFRKMFKGRIHGLAKGGSDLNFGTYGLKALEPERVTAR
FT                   QIEAARRAMTRHMKRQGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMF
FT                   EIDGVNDEIAREALRLAAMKLPIKTRVVVREDW"
FT   gene            complement(491490..492839)
FT                   /locus_tag="SPO0489"
FT   CDS_pept        complement(491490..492839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0489"
FT                   /product="ISSpo2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93806"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW54"
FT                   /protein_id="AAV93806.1"
FT                   /translation="MDHLEDAGETGAVRLGFDRRVRLEFHGSKISSDGGLLLFRELDEV
FT                   LGLHDIARGVLRDTRTGHNRLHSIVGLLRQSVFGRLAGYEDVNDADRLALDPVMQQVVG
FT                   GRAVDTNAASASQMGRFETKVRATAEKRAALAELSGQWIDRVHASAPPKWITLDIDSSV
FT                   CPTHGAQEGTAWNGHFGCICYHPLFVFNQFGHLECCALRPGNVHSADGWEEVLKPVIAR
FT                   YADRHLMRFFWADAAFAIPGLYEALEAENCFYAIRMRANRILQGRIAHLLKRPVGRPPN
FT                   HVRRIYGDFEYQSASWDKPRRVVAKVERHPGELFPRIGFVVTNLPMVPDWIVHFHNQRG
FT                   TAEQRIKEGKQAINWTRLSCKGLAQNEVRLQLHALAYNLGVFLQGADLPEEVAEWSLTS
FT                   LQTRLIKIGARVVRHARAIKFQLAEVAASGDRFRLILTAIQRLRAPPVPS"
FT   gene            493432..494433
FT                   /locus_tag="SPO0490"
FT   CDS_pept        493432..494433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0490"
FT                   /product="calcium-binding domain protein"
FT                   /note="identified by similarity to GB:AAO08434.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93807"
FT                   /db_xref="GOA:Q5LW53"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW53"
FT                   /protein_id="AAV93807.1"
FT                   /translation="MELLFLLGFGLLGAGLAMTGDDDEESAPAEGFTFDDDQAVGTEND
FT                   DILTVGDFPEGVTTIPEILGQGGDDLIDLNVPPDLYDDFGDDVINANGVSGRVDGGAGD
FT                   DTITGFFSGGTIAGGAGDDSIDVASLSSDSLIVDGGEGDDFIDATDAAGGQALGGAGND
FT                   TIVAQGVGEAEGGSALFPDGGEGDDLIRFTAYSDFFPGYFVADQVVRGGEGADTFEILV
FT                   NEGQHDSSLDDDVYSDTSLWSVPNVEIADFEPGVDKLVIEASRHDDAYELADVRMEEVD
FT                   DGNGGLSTNVILAYEHDTLNTREIVVSLNATGVSCSDIEVEYLGETYPVPTT"
FT   gene            494499..495119
FT                   /locus_tag="SPO0491"
FT   CDS_pept        494499..495119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE79871.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93808"
FT                   /db_xref="GOA:Q5LW52"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW52"
FT                   /protein_id="AAV93808.2"
FT                   /translation="MSQIESLFVTRLYRARLSEHGPAIDPEEMEASCYSIAEDDEAGQE
FT                   WCEENGYPGYTSYASLTDLPWRFPIFADLVTSLDAHVAAFAADLEFDLDGRKLVLEDLW
FT                   INILPQGGMHSSHLHPHSVISGTTYVAMPEGASALKLEDPRSGRMMAAPTRTKTARREL
FT                   QPFIYMKPDVGDVLLWESWLRHEVPMNMSEEERISVSFNYRWD"
FT   gene            495167..495532
FT                   /locus_tag="SPO0491a"
FT   CDS_pept        495167..495532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0491a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG018;
FT                   similar gene identified in less than 5 other Roseobacter
FT                   strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0491a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86008"
FT                   /db_xref="GOA:V5UYV7"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYV7"
FT                   /protein_id="AHB86008.1"
FT                   /translation="MYDHTAILLSEAEQVVFTTHARIAPTLTELVIIVVFAPIALVIWL
FT                   FIHRSFRSTVYMITTKRVLVIEKQGIVDQIPIQDIQRVTGRRRSMMIYGSDTRLWLARL
FT                   QDGWQFETILERVRKLI"
FT   gene            495649..496491
FT                   /locus_tag="SPO0492"
FT   CDS_pept        495649..496491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0492"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by similarity to GB:BAC74954.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93809"
FT                   /db_xref="GOA:Q5LW51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW51"
FT                   /protein_id="AAV93809.1"
FT                   /translation="MVDVPRRVTAARIRSLSPGCASPLPETCRRAIAGGGRPVCPPGPE
FT                   HAGMELDFIIEGWAGHLSYLLLVLSMLMRHMLWLRLFVIASAMAGIAFDHFWLQNPVGV
FT                   FWQSLLVLVNVAELALLWRNDRRARFTVEEDRFRETLLSGLSPGRCRRLLDLGRWETLS
FT                   TGTVLTREGQRPEFLTYMASGAVRIERQGRLLRLVGEGHFIGEMSMMGDGLAVATAVMQ
FT                   DSGRVWRIERVKLDRLRESSPAAMAAIETGVARDMRAKLAYQNTGPDTAAQPADGPAD"
FT   gene            496675..496875
FT                   /gene="rpmC"
FT                   /locus_tag="SPO0493"
FT   CDS_pept        496675..496875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPO0493"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by similarity to SP:P04457"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93810"
FT                   /db_xref="GOA:Q5LW50"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW50"
FT                   /protein_id="AAV93810.1"
FT                   /translation="MNAQELRNKTPDQLREDLVTLKKEAFNLRFQQATGQLENNARIRT
FT                   VRRDVARVMTVLNEKAAEAAN"
FT   gene            496888..497118
FT                   /gene="rpsQ"
FT                   /locus_tag="SPO0494"
FT   CDS_pept        496888..497118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPO0494"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93811"
FT                   /db_xref="GOA:Q5LW49"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW49"
FT                   /protein_id="AAV93811.1"
FT                   /translation="MPKRILQGTVTSDANAQTVTVLVERRFTHPVLKKTIRKSKKYRAH
FT                   DEKNAFKVGDTVRIIECAPKSKTKRWEVLEA"
FT   gene            497221..497589
FT                   /gene="rplN"
FT                   /locus_tag="SPO0495"
FT   CDS_pept        497221..497589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SPO0495"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by similarity to SP:P02411"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93812"
FT                   /db_xref="GOA:Q5LW48"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW48"
FT                   /protein_id="AAV93812.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTAIRFDRNAAVILNNNNEPVGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            497592..497903
FT                   /gene="rplX"
FT                   /locus_tag="SPO0496"
FT   CDS_pept        497592..497903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPO0496"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by similarity to SP:P12876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93813"
FT                   /db_xref="GOA:Q5LW47"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW47"
FT                   /protein_id="AAV93813.1"
FT                   /translation="MAAKLRKGDKVVVLAGKDKGKEGTITSVDPKAGKAVVDGVNIAIR
FT                   HTRQTQTSQGGRLPKALPIDLSNLALLDKNGKATRVGFRMEGDKKVRFAKTTGDVIDA"
FT   gene            497896..498456
FT                   /gene="rplE"
FT                   /locus_tag="SPO0497"
FT   CDS_pept        497896..498456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SPO0497"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by similarity to SP:P12877"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93814"
FT                   /db_xref="GOA:Q5LW46"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW46"
FT                   /protein_id="AAV93814.1"
FT                   /translation="MLDAANYTPRLKAQYAETIRAALKEEFGYKNDMMIPKLEKIVLNI
FT                   GCGAEAVKDSKKAKSAQEDLSKIAGQKAITTTAKKSIAGFRVREDMPMGAKVTLRGERM
FT                   YEFLDRLITIAMPRIRDFRGVKPSFDGRGNFAMGIKEHIVFPEIDFDKVDEVWGMDIVI
FT                   ATTAKTDAEAKSLLKHFNMPFNA"
FT   gene            498474..498779
FT                   /gene="rpsN"
FT                   /locus_tag="SPO0498"
FT   CDS_pept        498474..498779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SPO0498"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by similarity to SP:P02370"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93815"
FT                   /db_xref="GOA:Q5LW45"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW45"
FT                   /protein_id="AAV93815.1"
FT                   /translation="MAKKSMIEREKKRERLVAQYAAKRAELKEIANDESRPMEERFKAR
FT                   LKLAKLPRNSSATRLHNRCQLTGRPHAYYRKLKVSRIMLRELGSAGQIPGMVKSSW"
FT   gene            498792..499184
FT                   /gene="rpsH"
FT                   /locus_tag="SPO0499"
FT   CDS_pept        498792..499184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPO0499"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by similarity to SP:P02361"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93816"
FT                   /db_xref="GOA:Q5LW44"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW44"
FT                   /protein_id="AAV93816.1"
FT                   /translation="MNDPIGDMLTRIRNAQLRGKSTVSTPGSKLRAWVLDVLADEGYIR
FT                   GYEKSTDVNGHPTLNIELKYYEGEPVIRELKRVSKPGRRVYMGVKDIPSVRQGLGVSIV
FT                   STPKGVMSDANARSNNVGGEVLCTVF"
FT   gene            499197..499730
FT                   /gene="rplF"
FT                   /locus_tag="SPO0500"
FT   CDS_pept        499197..499730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SPO0500"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by similarity to SP:P02391"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93817"
FT                   /db_xref="GOA:Q5LW43"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW43"
FT                   /protein_id="AAV93817.1"
FT                   /translation="MSRIGKKPVELPSGVSAAVSGQTIEVKGPKGARSFTATDDVTITV
FT                   DGNVVSITPRGMSKRARQQWGMSRTMVANLVAGVTEGFKKELEITGVGYRANAQGNTLK
FT                   LNLGYSHDVDFTVPAGVTVSTPKQTEIVVEGIDQQQVGEVAAKIREWRSPEPYKGKGIR
FT                   YKGEFIFRKDGKKK"
FT   gene            499742..500101
FT                   /gene="rplR"
FT                   /locus_tag="SPO0501"
FT   CDS_pept        499742..500101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPO0501"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by similarity to SP:P46899"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93818"
FT                   /db_xref="GOA:Q5LW42"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW42"
FT                   /protein_id="AAV93818.1"
FT                   /translation="MANSKRTLFLKRRLRVRNKLRKVNAGRLRLSVHRSNKNISAQLID
FT                   DVRGVTLAAASTMEKDLGVVGKNNVEAAKKVGAAIAERAKKAGVEEAYFDRGGFLFHGK
FT                   VKALADAAREGGLKI"
FT   gene            500214..500786
FT                   /gene="rpsE"
FT                   /locus_tag="SPO0502"
FT   CDS_pept        500214..500786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPO0502"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by similarity to SP:P02356"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93819"
FT                   /db_xref="GOA:Q5LW41"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW41"
FT                   /protein_id="AAV93819.1"
FT                   /translation="MAERENRRGNRRDREEAAPEFADRLVAINRVSKTVKGGKRFGFAA
FT                   LVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDIEGRHGAGK
FT                   VVMRAAPEGTGIIAGGPMRAVFEMLGVKDVVSKSLGSANPYNMIRATIDGLKKEQSPRS
FT                   VAQRRGKKVADILPKRDEAPAAEAAEA"
FT   gene            500799..500987
FT                   /gene="rpmD"
FT                   /locus_tag="SPO0503"
FT   CDS_pept        500799..500987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPO0503"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by similarity to SP:Q9Z9J6"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93820"
FT                   /db_xref="GOA:Q5LW40"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW40"
FT                   /protein_id="AAV93820.1"
FT                   /translation="MAKTIVVKQIGSPIRRPADQRATLVGLGLNKMHKTRELEDTPSVR
FT                   GMIRKIPHLVEIIEERG"
FT   gene            501090..501713
FT                   /locus_tag="SPO0504"
FT   CDS_pept        501090..501713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0504"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG027;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93821"
FT                   /db_xref="GOA:Q5LW39"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW39"
FT                   /protein_id="AAV93821.2"
FT                   /translation="MRFPFSMLASLVVLSSCGPSPAEREAEIASFRAGPTEAQRSDYRK
FT                   YGIIAADPDSRIYQGLAVSVSRSSSLPVSYFDVELRPISTTSGTTNPSNRIPDEILADI
FT                   PVELVRAAKAQIETGAGTGQILKLAKEIAKRTYCVGRQVGVYDLKGTKISDPASIARIM
FT                   AANGGNILGANIGDLNVKKERIPVVELKEWANTGTIMADVHLKC"
FT   gene            501740..502174
FT                   /locus_tag="SPO0504a"
FT   CDS_pept        501740..502174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0504a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG009;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0504a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86009"
FT                   /db_xref="UniProtKB/TrEMBL:V5V0I8"
FT                   /protein_id="AHB86009.1"
FT                   /translation="MALMGCKTTVDRETNAASETSPGSTVMYFDPFHGYQIVFFETPET
FT                   SWLWYPGNRTSLPALVRYKGSDVCFKYGSHTFNPVIGKQGGSWDCTPRFILDGLAVASG
FT                   EGDIFGLSDGTVPYRRRKCDGTDGFARINVDPGLYKQGCG"
FT   gene            502959..503432
FT                   /gene="rplO"
FT                   /locus_tag="SPO0505"
FT   CDS_pept        502959..503432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPO0505"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by similarity to SP:P19946"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93822"
FT                   /db_xref="GOA:Q5LW38"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW38"
FT                   /protein_id="AAV93822.2"
FT                   /translation="MKLHELSDNPGATKKRMRIGRGPGSGKGKMGGRGIKGQKSRSGVA
FT                   INGYEGGQMPLYQRLPKRGFNKPNRKAFAVVNLGLIQKFVEAGKLDGAAAITEDALVAS
FT                   GLVRRKLDGIRVLAKGDFNAKLNIEVTGASKSAVEAVEKAGGSLKVTNAAAAE"
FT   gene            503545..504912
FT                   /gene="secY"
FT                   /locus_tag="SPO0506"
FT   CDS_pept        503545..504912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SPO0506"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93823"
FT                   /db_xref="GOA:Q5LW37"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW37"
FT                   /protein_id="AAV93823.1"
FT                   /translation="MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPV
FT                   PGIDGVALREFMEQAGQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTAMVP
FT                   SLEQLKKEGEQGRKKINQYTRLGTVALATVQAYGLAVSLESGDLATEPGMYFRFATMIT
FT                   LVGGTMFLMWLGEQITARGIGNGVSLIIFVGIIAEVPAALAQFFASGRSGAISPAVIIA
FT                   IILMVIAVITFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFAS
FT                   SLLLLPVTISTFSSGAANGPVMSWLLANFGPGQPLYLLFFVSMIVFFAYFYTFNVSFKP
FT                   DDVAQNLKNQNGFVPGIRPGKKTAEYLEYVVNRVLVLGSAYLAAVCLLPEIMRGQFNVP
FT                   FYFGGTSVLIIVSVTMDTIQQVQSHLLAHQYEGLIEKSQLRGKNRKRTNRKGPARR"
FT   gene            504909..505550
FT                   /gene="adk-1"
FT                   /locus_tag="SPO0507"
FT   CDS_pept        504909..505550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk-1"
FT                   /locus_tag="SPO0507"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to SP:P10772"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93824"
FT                   /db_xref="GOA:Q5LW36"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW36"
FT                   /protein_id="AAV93824.1"
FT                   /translation="MNIILLGPPGAGKGTQARHLVETRGMIQLSTGDMLRAARSSGTEM
FT                   GKKVAAIMDAGKLVTDEIVIGLIEEQLTTQTGAGFIFDGFPRTLAQADALAALLAKLGQ
FT                   SLHTVIEIRVDDEALVDRISGRFTCGGCGEVYHDKTKPTKVDGVCDNCGSTEMVRRADD
FT                   NADSLRTRLMEYYKKTSPLIGYYYAKGDLRPVNGLADIKEVTASIEAILG"
FT   gene            505599..506672
FT                   /locus_tag="SPO0508"
FT   CDS_pept        505599..506672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93825"
FT                   /db_xref="GOA:Q5LW35"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW35"
FT                   /protein_id="AAV93825.1"
FT                   /translation="MKRILIGLAILAGLLAGLALAATLLATGKRPVPDQLAGYHETTLS
FT                   VGHRDVPVSLHIWYPAAQDGTAELVGQNALFYGQYVLRDAKPAPGAHPVVVFSHGSGGN
FT                   ANNHGWLATELARQGMIVVAPNHPGTMSRDSDPHRTPHIWERARDLHAILDSLETNPPL
FT                   GMQPDMDRVASAGFSLGGFSALSIAGVRVSKAAFIDYCDRHAGEFDCGWMQAASVDFAA
FT                   IDPAAYEADYRDPRIKATVSIDPALPQAMTGDSLTAATLPILLVSLGQGEEVPPATRVD
FT                   AMARQMPQARLVETPGAWHFSFLSECSTLGWIIIGLMGEENICSDIGMRDRGVLHEELK
FT                   AVISTFLSENLALSPSG"
FT   gene            506867..507235
FT                   /gene="rpsM"
FT                   /locus_tag="SPO0509"
FT   CDS_pept        506867..507235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SPO0509"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by similarity to SP:P80377"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93826"
FT                   /db_xref="GOA:Q5LW34"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW34"
FT                   /protein_id="AAV93826.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYITGIGNTSAKAICEAVGIDATRRV
FT                   NELSDAEILAIREHIDANYSVEGDLRREVQMNIKRLMDLGCYRGLRHRRNLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
FT   gene            507251..507643
FT                   /gene="rpsK"
FT                   /locus_tag="SPO0510"
FT   CDS_pept        507251..507643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPO0510"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by similarity to SP:P04969"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93827"
FT                   /db_xref="GOA:Q5LW33"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW33"
FT                   /protein_id="AAV93827.1"
FT                   /translation="MARDKTRTTKKKERKNIASGVAHVNSTFNNTKILISDVQGNAISW
FT                   SSAGTMGFKGSRKSTPYAAQLAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAV
FT                   GFNITSIRDVTPIAHNGCRPPKRRRV"
FT   gene            507760..508776
FT                   /gene="rpoA"
FT                   /locus_tag="SPO0511"
FT   CDS_pept        507760..508776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SPO0511"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P00574"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93828"
FT                   /db_xref="GOA:Q5LW32"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW32"
FT                   /protein_id="AAV93828.1"
FT                   /translation="MIHKNWAELIKPTQLEVKPGNDPARQATVIAEPLERGFGLTLGNA
FT                   LRRILMSSLQGAAISSVQIDNVLHEFSSVAGVREDVTDIILNLKQVSLRMDVEGPKRLS
FT                   VNAKGPAVVTAGDISESAGIEVLNRDHVICHLDDGADLFMELTVNTGKGYVSADKNRPE
FT                   DAPIGLIPIDAIYSPVKKVAYDVQPTREGQVLDYDKLTMKIETDGSITPDDAVAFAARI
FT                   LQDQLSIFVNFDEPESAGRQDDDDGLEFNPLLLKKVDELELSVRSANCLKNDNIVYIGD
FT                   LIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDVEDWPPDNIEDLAKKFEDAF"
FT   gene            508954..509376
FT                   /gene="rplQ"
FT                   /locus_tag="SPO0512"
FT   CDS_pept        508954..509376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPO0512"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by similarity to SP:P02416"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93829"
FT                   /db_xref="GOA:Q5LW31"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW31"
FT                   /protein_id="AAV93829.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIVEKLITLGKRGDLHARRQAAAQLKEDKDVAKLFDVLAERYKDRQGGYVRILKAGFRY
FT                   GDMAPMAIIEFVDRDVDAKGAADKARLAEEEAAAEE"
FT   gene            509484..509891
FT                   /locus_tag="SPO0513"
FT   CDS_pept        509484..509891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC52410.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93830"
FT                   /db_xref="GOA:Q5LW30"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW30"
FT                   /protein_id="AAV93830.1"
FT                   /translation="MRTSSPAGYSGRPLVAKLGFKPGWSVRAINPPPHYADLMAEAVDI
FT                   RFDPDARDADAAHLFLHGPEPLAEVAATEIAHLRPGGMLWLSWAKKSSPRHAGITEDLL
FT                   RAEVLPLGWVDVKVCAVDADWSGLKFLRRRG"
FT   gene            509955..511337
FT                   /locus_tag="SPO0514"
FT   CDS_pept        509955..511337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0514"
FT                   /product="periplasmic serine protease, DO/DeqQ family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93831"
FT                   /db_xref="GOA:Q5LW29"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW29"
FT                   /protein_id="AAV93831.1"
FT                   /translation="MIRAILLCLPLVLAAPVQAETRVPTSRAEIGLGFAPVVKKAAPAV
FT                   VNIYARIITAGRQSPIFDDPFFRDFFRGFGAPQPRVQNSLGSGVILSDDGYVVSNYHVV
FT                   GMASEIRVVTTDRREFTAQVVLGDEESDIAILRLDAARDLPFLALRDSDHVEVGELALA
FT                   IGNPFGVGQTVSSGIVSGLARSGAATGNGRGYFIQTDAPINPGNSGGALIDVNGDLIGI
FT                   NTSILSRSGGSNGIGFAIPANLVAEFLRQARQGNSSFAQPWAGIAGQPMTADIADSLGL
FT                   VLPEGVVISDLHPESPLAQAGFAVGDVVTEVDGQTVNSPAEMKFRMSVAGIGGEARMTR
FT                   LRQGQRETLSVALIEAPDAPPAQETTLGERTILPGLTVARLNPAVIARLGLPLSARGVV
FT                   VLDPGPYGARAGLQPGDVLGAINGDQVDSPRDVERALSEAGRRVQIDLQRRGQRVSLRF
FT                   RL"
FT   gene            511341..512657
FT                   /locus_tag="SPO0515"
FT   CDS_pept        511341..512657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0515"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93832"
FT                   /db_xref="GOA:Q5LW28"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW28"
FT                   /protein_id="AAV93832.1"
FT                   /translation="MADLFDTGAKPSPEREPPRPLADRLRPQSLGEVIGQQQVLGPEAP
FT                   LGVMLASGSLSSLVFWGPPGVGKTTIARLLAQETDLHFVQISAIFTGVPDLKKVFEAAR
FT                   IRRGNGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAALLSRAQ
FT                   VLVLERLSAEDLEHLTARAERELDRELPLTPEARLALQEMADGDGRALLNLIEQVAAWK
FT                   VAAPLEREALAARLMRRATKYDKSGDEHYNLISALHKSVRGSDPDAALYWLARMLTGGE
FT                   DPRYLARRITRMAVEDIGLADPQAQSVCLHAWEIYERLGSPEGELALAQAIVYLALAPK
FT                   SNGAYVGYKAAMRLAKQSGSAPPPKHILNAPTGLMKDQGYGAGYAYDHDAEDGFSGQNY
FT                   FPDGMERPQLYQPVERGFERELKKRLDYFARLRAQREQG"
FT   gene            512820..513863
FT                   /gene="rluC"
FT                   /locus_tag="SPO0516"
FT   CDS_pept        512820..513863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="SPO0516"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by similarity to SP:P23851"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93833"
FT                   /db_xref="GOA:Q5LW27"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW27"
FT                   /protein_id="AAV93833.1"
FT                   /translation="MSGVQMITVGEGDGDQRLDRWFRRMFPHVGQGRIEKMCRKGELRV
FT                   DGARAKPATRLEVGQQVRIPPLPAPGERPEPVKSRVSDSDAKLIRACVLHRDDDIIVLN
FT                   KPAGLAVQGGSGQTRHVDGLSEALRFGNDENPRLVHRLDKDTSGVLVLARTREAAARLT
FT                   AAFRHRNTRKIYWALVAGVPTPYLGEIKTGLVKAGGHGARGEGEKMNVVHLSELDATPG
FT                   AKRAHTYYATLYRVAGRASWVAMEPVTGRTHQLRAHMAGIGHPIIGDGKYGGSGQENLG
FT                   DGWGAQLGGIISKKLHLHARSLSFEHPSTRKKVTFTAPLPEHMRESWDTFGWTEDLAAE
FT                   DPFEELM"
FT   gene            513860..514531
FT                   /locus_tag="SPO0517"
FT   CDS_pept        513860..514531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0517"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93834"
FT                   /db_xref="GOA:Q5LW26"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW26"
FT                   /protein_id="AAV93834.1"
FT                   /translation="MSQPLHLILFDVDGTLVDSQAAIVGAMTAAFDALSLPVPARADIL
FT                   SIVGLSLPQAMARLAPGQSETTQARLVEAYKQSYHATRLALGAGHSPLYPGAREMLEQL
FT                   HAVPHYLLGVATGKSKRGLDALIEAHGLERVFVTRQVADHHPSKPHPSMIETALAETGT
FT                   APGHAAMIGDTSFDMEMAAAAGIAGIGVSWGYHPPRALSRARCIVDTFPQLPPALTQIW
FT                   T"
FT   gene            514528..515244
FT                   /locus_tag="SPO0518"
FT   CDS_pept        514528..515244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC50629.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93835"
FT                   /db_xref="GOA:Q5LW25"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW25"
FT                   /protein_id="AAV93835.1"
FT                   /translation="MNDMSDWKPKRFWKQAAVAETAEGYAVELDGRPVRTPAKAPLLLP
FT                   TRALAEAIAAEWDAQESEVDPINMPFTRTANAAIDKVRIQQAEVADMLAAYGDSDLLCY
FT                   RADSPAELVELQAQTWDPALDWAAETLGVRLRPVQGVMHQPQPASAIETLTRKVHALNP
FT                   FQLAAFHDLVSLSGSLVLGFAAALNWRKADEIWQISRLDETWQEEQWGPDDEARALAAV
FT                   KRAAFLHAKAAYDIST"
FT   gene            515315..516457
FT                   /locus_tag="SPO0519"
FT   CDS_pept        515315..516457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0519"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93836"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW24"
FT                   /protein_id="AAV93836.1"
FT                   /translation="MSDIAPKLGPIEGDSSFEIRSGANVCRSNRSGTGVENQEEVKMKK
FT                   SVFLGALTVAGMAAGVAAAGTMDDVKARGKLNCGVTTGLVGFAAPDSNGEWKGFDVALC
FT                   RAVAAAVLGDGNAVEFVPTTGKTRFTALASGEVDMLARNTTWTFSRDVDLKFEFVGVNY
FT                   YDGQGFMVPKSLGVSSAKELDGATVCIQTGTTTELNLADFFRANNISYEPVPIETNAEA
FT                   QQQYLAGACDVYTTDASGLAATRATFENPGDHVLLPEIISKEPLGPLVRHGDHEWGDVV
FT                   RWTLNALVSAEEMGITSANIDEMSAGTNNPEINRILGSEGTLGEMLGLDAEWAKRAIKV
FT                   GGNYGEVFAQNIGESTPIGLARGLNAQWTDGGLLYSPPFR"
FT   gene            516592..517860
FT                   /locus_tag="SPO0520"
FT   CDS_pept        516592..517860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0520"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93837"
FT                   /db_xref="GOA:Q5LW23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW23"
FT                   /protein_id="AAV93837.1"
FT                   /translation="MTTLTDPPKEQFRLSMLLYDTRYRSATIQVIAMIGFMLLAAWLIS
FT                   NTAQNLAALGKPIDFGFFSEPASYDINQRLLDYSSRDTHLRAAFIGLLNTLVVAVLGCI
FT                   TATVLGVIIGVLRLSNNWIVARLMTIYVEGFRNVPVLLWIVFIMAILIETLPAPRAFRG
FT                   DDATASMMLNDSVAVTNRGVYIPDALFSNSLGNVHLFGESSLRFDISLDLMLILIVLGG
FT                   SLWVSNFLRKRADRIQEQTGDRPVTWWQRLAVVVLPTGLVLVLLGFHLGYPELKGFNFQ
FT                   GGTHLRNSLIALWLALSLYTAAFIAEIVRAGILAISKGQTEAASALGLRSNKIMSLVIL
FT                   PQALRVIIPPLISNYLNLTKNSSLAIAVGYMDITGTLGGITMNQTGRELETILLLMLVY
FT                   LTISLSISAVMNWYNESVKLKER"
FT   gene            517862..519175
FT                   /locus_tag="SPO0521"
FT   CDS_pept        517862..519175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0521"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52665"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93838"
FT                   /db_xref="GOA:Q5LW22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW22"
FT                   /protein_id="AAV93838.1"
FT                   /translation="MSDIGFVRTEMLPEREPPASTVGALGWARANLFSNWFNSVLTLAS
FT                   LYAVFAILAAVLPWIFSPTWNGTSLSNCREILTAAGSVGDHGTSGACWGVIRERWIQLL
FT                   FGFYPSELYWRPILAFILLGVALAPVLFSDKMPSKMLIFSGLYPFIFPWLLWGGTIWGP
FT                   IAALLGFVLGWVIYSAVSKTMSSLIGILLGAAAALVWWLVLAGFFVGVFDSVLAIGIEA
FT                   VESRKFGGFMLSITIGVVAIACSLPLGIVLALGRQSDLLIVKYICVGFIEFIRGVPLIT
FT                   LLFVASTLLNIFMPPGTNFDIILRVLIMVTLFAAAYMAEVIRGGLAALPKGQYEGADSL
FT                   GLNYWQAQRLIIMPQALKISIPGIVSTFIGVFKDTVLVSIIGLLDPLGLSNAIRADANW
FT                   NGIVWEIYGFIALIFFVFCFGMSRYSMYLERKLHTGHR"
FT   gene            519186..519977
FT                   /locus_tag="SPO0522"
FT   CDS_pept        519186..519977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0522"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q52666"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93839"
FT                   /db_xref="GOA:Q5LW21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW21"
FT                   /protein_id="AAV93839.1"
FT                   /translation="MSELAIDREIDRSKMQVSDEVAIEITNMNKWYGAFHVLRDINLTV
FT                   YQGERIVIAGPSGSGKSTLIRCLNALEEHQQGKIVVDGTELSNDLKNIDKIRSEVGMVF
FT                   QHFNLFPHLTILENCTLAPIWVRKTPRKEAEETAMHFLEKVKIPEQALKYPGQLSGGQQ
FT                   QRVAIARSLCMRPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQ
FT                   VANRVIFMDAGQIVEQNEPEEFFNNPQSERTKLFLSQILGH"
FT   gene            complement(520026..520535)
FT                   /locus_tag="SPO0523"
FT   CDS_pept        complement(520026..520535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0523"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93840"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW20"
FT                   /protein_id="AAV93840.1"
FT                   /translation="MTRILILTRHAKSAWDDISLGDHERPLNKRGRRSAQAIGAWLRKR
FT                   GYLPDQVISSDAVRTRETWTQMSAEMGQAGGDPTFTRSLYLAPAQHILANLRQASGRVV
FT                   LLLGHNPGIAEFAGQIVDEAPAHARFFDYPTGATTVIEFARDTWGDIGWHQGEVLDFIV
FT                   PRELTD"
FT   gene            complement(520532..521167)
FT                   /locus_tag="SPO0524"
FT   CDS_pept        complement(520532..521167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48651.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93841"
FT                   /db_xref="GOA:Q5LW19"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW19"
FT                   /protein_id="AAV93841.1"
FT                   /translation="MTLERISAEAAASALIVMGALHPADAAGTVVLLGTGPGFWPVFSA
FT                   AQEYGDGQRDPVDRWSKRVIGAIAANLGAETAFPSDGPPYPPFIAWALASGRFHTSPVG
FT                   MMVHDQVGLMISLRGALLLPDRIDLPVADAPSPCDSCDAPCTRACPVGALAAGRAYDVD
FT                   ACRGYLDTAAGSACMEAGCAARLACPLSAGAARDPAQSALHMRAFLRR"
FT   gene            complement(521164..521958)
FT                   /locus_tag="SPO0525"
FT   CDS_pept        complement(521164..521958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0525"
FT                   /product="sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93842"
FT                   /db_xref="GOA:Q5LW18"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW18"
FT                   /protein_id="AAV93842.1"
FT                   /translation="MENESLVRLAMFVGLFVLFAIAERLAPRRMVHPRRPRRWLTNLTI
FT                   SVLNTVTLRALAVGLPLLAVGAALDASALGWGLFNHLGWPGWVEVLLAVLILDFAIWGQ
FT                   HLITHKIPLLWRLHRVHHADTDIDVTTAIRFHPVEIALSMLLKIGLVYLLGPSALAVIL
FT                   FEILLNGTALFNHSNLRLPLALDAVLRKVLVTPDMHRVHHSVLREEHDSNYGFALSIWD
FT                   RMMGTYVAQPAKGHDEMTIGLAWQDDRPTRLGWSLLLPFRRR"
FT   gene            complement(522016..522879)
FT                   /gene="argB"
FT                   /locus_tag="SPO0526"
FT   CDS_pept        complement(522016..522879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SPO0526"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93843"
FT                   /db_xref="GOA:Q5LW17"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW17"
FT                   /protein_id="AAV93843.1"
FT                   /translation="MKTRDMNRDWIATAATLNAALPYLQRYDDAIVVIKLGGHAMGSDE
FT                   AMESFARDVVLLRQVGVNPVVVHGGGPMINAMLKKLDIQSEFVNGKRVTDVATVEVVEM
FT                   VLSGVVNKRIVQEINRQGGKAVGLSGKDANLMICDQTNPDLGFVGTPTEMNPDLLRNLF
FT                   AHDIIPVIAPLGAGREGETFNVNGDTAAGAIAAALKADRLLLLTDVSGVKNGEGEVLTE
FT                   LKAGQIREMIADGTIAGGMIPKTETALDALDNGVRAVVILDGRVDNAVLLELYTEHGAG
FT                   SLIRRD"
FT   gene            522955..523722
FT                   /locus_tag="SPO0527"
FT   CDS_pept        522955..523722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0527"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93844"
FT                   /db_xref="GOA:Q5LW16"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW16"
FT                   /protein_id="AAV93844.1"
FT                   /translation="MIGSARNQSRGRIMTRKTLVLTGASRGIGHATVRRFVAEGWRVIT
FT                   CSREPVPPGCPWSSGENNHVQIDLSDPQATIAGAEIIRAKLDGRLDALVNNAGISPKGS
FT                   DGERLSTLSTDLSDWGHVFHVNFFAPVVLARSLKDELAAAKGSVVNVTSIAGSRVHPFA
FT                   GAAYATSKAALAALTREMAHDFGPLGVRVNAIAPGEVETSILSPGTDKIVEKLPMQRLG
FT                   QPSEVAAAIYFLCSPESSYISGTEIEVNGAQHV"
FT   gene            complement(523761..525158)
FT                   /locus_tag="SPO0528"
FT   CDS_pept        complement(523761..525158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0528"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93845"
FT                   /db_xref="GOA:Q5LW15"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW15"
FT                   /protein_id="AAV93845.1"
FT                   /translation="MADSQTNARGTMHPLAQKFYFAAWRWHFYAALYVIPFLLILAVTG
FT                   LMMMFITQFDGRDGEKIAVQPQSTELSFDAQSAAVLQAQPGTIVEWIGPKAPDLAAVFR
FT                   VKTPEGQRLVALDQYSGEVLSIWDRRAGWYDLADNIHSTLLIGDLGDRLIEIAAGLGIV
FT                   LILTGLYIWWPRDNAMSALVPNLRARGRALWKSLHAVTGFWISALLLVFLVSGLSWAGI
FT                   WGGKLVQAWSTFPAEKWDNVPLSDDVHASMNHGHTNDVPWALEQTPLPASGSEAGVTGL
FT                   PEGQPVSAENLIALGRAMGMEGRFRLAYPAGGTGVWTINRDSMSGDSDDPFIDRTIHVD
FT                   QYTGKVLADVRYDDYSWAGKAMAVGVPFHMGLMGGWNFALNIVFCLSVIFLCVSGVVMW
FT                   VKRRPARSLRLAAPPEPADMPMWKGAALVAVLVSLMFPLAGLALIAALAFDVLILSNIP
FT                   ALRRALA"
FT   gene            complement(525224..525592)
FT                   /locus_tag="SPO0529"
FT   CDS_pept        complement(525224..525592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93846"
FT                   /db_xref="GOA:Q5LW14"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW14"
FT                   /protein_id="AAV93846.1"
FT                   /translation="MTFLTHFSAVLSLLAVVLTSAIPQGWMPMRKDDRILLVICTEEGE
FT                   ARQWVDLAPDSPAHEDESDARPSCHFGGLNQVAILAQPPLLMTLNHAQRTRWDNLDFTH
FT                   RSAGFFPLYDARGPPHLS"
FT   gene            complement(525589..526242)
FT                   /locus_tag="SPO0530"
FT   CDS_pept        complement(525589..526242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0530"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93847"
FT                   /db_xref="GOA:Q5LW13"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW13"
FT                   /protein_id="AAV93847.1"
FT                   /translation="MTALPFPVAEEPDAFTAETGRKLFAGPSEFVKGVVAMSGLPPADR
FT                   VEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYA
FT                   NAPLKVVEKWQKLLKQYLSGRQTLRRAFVLIDARHGVKAVDDEIMKLLDTSAVTFQCVL
FT                   TKADKVKAAERDKVLAQVRAALAKHPAAYPEIVLTSSEKGDGIATLRSIIAHLE"
FT   gene            complement(526239..526976)
FT                   /locus_tag="SPO0531"
FT   CDS_pept        complement(526239..526976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0531"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93848"
FT                   /db_xref="GOA:Q5LW12"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW12"
FT                   /protein_id="AAV93848.1"
FT                   /translation="MTGTVTGLWRHPIKSHGREALDSVTLSPGQTMPGDRVWAVAHEMS
FT                   QADGSEWVHCGHFSRVSKVPELMAISATLNGDRVTLRHPRRPDLDFAPDAEANRFLDWV
FT                   KPLMPQDRAQSARIIRVPGRGMTDSDFPSVTLCNMASHRAVEQRIGHALSPLRWRGNIW
FT                   FDGLPLWEEFDWLDREVQIGEVVFAVRERTDRCAATTTNPETGKRDADTLGALDHWGHR
FT                   DFSVRAEVIRGGTIRLGDEVRPL"
FT   gene            complement(526973..528802)
FT                   /locus_tag="SPO0532"
FT   CDS_pept        complement(526973..528802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0532"
FT                   /product="inner membrane protein YidC, putative"
FT                   /note="identified by similarity to SP:P25714"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93849"
FT                   /db_xref="GOA:Q5LW11"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW11"
FT                   /protein_id="AAV93849.1"
FT                   /translation="MDDQNKNLILATALSFLVILVWFILFPPPEQTEAPATEIATTNGT
FT                   AVQTPTAAATEGGAGEVPALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDY
FT                   RVSLDEDAEIVEMLTPAGSTSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGT
FT                   PVTLSWSNGSGVTFRRTLAVDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADL
FT                   PGLKNFFILHEGVVAMNDGTLSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHY
FT                   WMATLIPGSGTAFKSAAKYDARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESI
FT                   RAYQQDGVQKFLDSIDWGWFFFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPL
FT                   ALKSYVSMAKMKELQPQMEALKEAAGDDRQKMQQGMMELYKKEKVNPAAGCLPILLQIP
FT                   IFFSLYKVIFVTIELRQAPWFGPFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIG
FT                   ILPLLLGISMWLQQKLNPAPTDPTQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITF
FT                   TQQYIIMRSHGYKPDVFGNIKSGFARRAKADKK"
FT   gene            complement(528927..530468)
FT                   /locus_tag="SPO0533"
FT   CDS_pept        complement(528927..530468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0533"
FT                   /product="diguanylate cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93850"
FT                   /db_xref="GOA:Q5LW10"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW10"
FT                   /protein_id="AAV93850.1"
FT                   /translation="MRIKPSLTRIRNAVVPVLTGPPILAFLPAVTLGAFWLGGEIALLL
FT                   ISLGLPLMFAFAGAFGKWPVNHQLPRDSVTGLMLKDGFEGALTHIHAMAAETDRKSACF
FT                   IIELDDYADLVDHHGQEAGDLVALRSGERILSAVRNNDVVARLGDRRFAVCLAPVPQLD
FT                   LELCIQLAGRMQSAVEDPISLDGVAIYVSCSIGFCQNRRAPGSSASDWLDAANVALAAA
FT                   QGAGPSAIRAYAPDMERRPSGAPDLRDEIQAALENGQIQPWYQPQISTDTGKVTGFEAL
FT                   ARWNHPTRGLLAPNLFLPVIEEAGLMERLGQVMLYHALTAVKAWDSAGVDVPRVGVNFA
FT                   SDELRNPGLVERVQWELDRFDLTPDRLSVEILETVFSNTPDDVITRNIAGLGKLGCRID
FT                   LDDFGTGHASIASIRRFDISRIKIDRSFVMKADRDPEQQRMIAAILTMAERLELETLAE
FT                   GVETVGEHALLAQLGCDHVQGFGIGKPMPFDQTLDWIAHHDAKLQDAPRIGRETG"
FT   gene            complement(530541..531425)
FT                   /locus_tag="SPO0534"
FT   CDS_pept        complement(530541..531425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AF3393"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93851"
FT                   /db_xref="GOA:Q5LW09"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW09"
FT                   /protein_id="AAV93851.1"
FT                   /translation="MLDENEDIHPLFAGAPATTEFKKLRKRIVRYTREAIEQYGMVERR
FT                   ADGSTPKWLVCLSGGKDSYTLLAVLYELKWRGLLPVDLLACNLDQGQPGFPSTVLPEFL
FT                   DRMGVPNRIEYQDTYSVVVDKVPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHRD
FT                   DILETFFMNLFHGGRLATMPPKLVNEEGDLFVFRPLAHVAEADCEKFARAMNYPIIPCD
FT                   LCGSQDGLQRQQVKQILDGWEKNRPGRRQVMFRALMNARPSHLLDPKLFDFQGLELGSR
FT                   EKGENFGEIPLLR"
FT   gene            complement(531470..532399)
FT                   /locus_tag="SPO0535"
FT   CDS_pept        complement(531470..532399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0535"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93852"
FT                   /db_xref="GOA:Q5LW08"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW08"
FT                   /protein_id="AAV93852.1"
FT                   /translation="MEYLSIAAGLIGLFLGGEALVRGSVGLAQRLGLPPLLIGLTVVGF
FT                   GTSTPELLVSVDAALRGVPDIALGNILGSNIANILLIGGITSLIWPIRGKPVGLWRDLT
FT                   VMILATLALTPILLGGQVIRVVGLVLLLSLVAYLVWSYRQAGGPCAEDTETDLPDVPAR
FT                   PFVAPALIGAGLLGLMIGARLLVDGAVSVAQGLGVSDAFIGLTIVAVGTSLPELATSVI
FT                   AAYRRQSEIAVGNIVGSNIFNVLGILGATAVIAPIPVASRFALFDLPVALAAAVTFSVL
FT                   LLWRAGVSRGAGVLLLLAYAAYVWAAQG"
FT   gene            complement(532528..532785)
FT                   /locus_tag="SPO0536"
FT   CDS_pept        complement(532528..532785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0536"
FT                   /product="putative protein TIGR00278"
FT                   /note="identified by similarity to GB:CAE35356.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93853"
FT                   /db_xref="GOA:Q5LW07"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW07"
FT                   /protein_id="AAV93853.1"
FT                   /translation="MTPLAHILALPVRAYRLIFSPWVGFNCRYQPTCSAYALEALEKHG
FT                   ALRGSWLAARRIGRCHPLGSDGYDPVPEPKDRKPPHSPAG"
FT   gene            complement(532846..533271)
FT                   /locus_tag="SPO0537"
FT   CDS_pept        complement(532846..533271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0537"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93854"
FT                   /db_xref="GOA:Q5LW06"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW06"
FT                   /protein_id="AAV93854.1"
FT                   /translation="MTPPEAPTDGTASPGEMPPAVSVCASSGISVLRKRSDFLKAARAR
FT                   RQGAGSMMVQARKRDAGEAEGIRVGFTCSKKVGNAVARNRAKRRLREAARLVLPDMGRP
FT                   GWDYVLIGRPSDTASRPFDGLLDDLRRALRKLHAPKP"
FT   gene            complement(533296..533445)
FT                   /gene="rpmH"
FT                   /locus_tag="SPO0538"
FT   CDS_pept        complement(533296..533445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SPO0538"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93855"
FT                   /db_xref="GOA:Q5LW05"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW05"
FT                   /protein_id="AAV93855.1"
FT                   /translation="MEYGAMKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRK
FT                   ELSA"
FT   gene            533672..534469
FT                   /locus_tag="SPO0539"
FT   CDS_pept        533672..534469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0539"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93856"
FT                   /db_xref="GOA:Q5LW04"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW04"
FT                   /protein_id="AAV93856.1"
FT                   /translation="MAAWVCILGQMKPDPETKPDPMRQTAQPAPQRLLRHLPLIVIVLI
FT                   AVIGAITLRDYLSFDTLAANRQALLAYREAHYAALAAIFVATYVLIVAFSLPGAAVASM
FT                   TGGFLFGLAVGTVLNVVAATIGAVAIFLAARAGLGAMLTARLEASEGTVKRLKEGLRRN
FT                   EIEVLFLLRLVPAVPFFAANLIPALVGVKLRNYVLTTALGIVPGAIVFTWIGVGLGGVF
FT                   DRGESPDLSLFREPFVIGPILGLCLLAALPIAIKALRGKPEGE"
FT   gene            534469..535887
FT                   /locus_tag="SPO0540"
FT   CDS_pept        534469..535887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0540"
FT                   /product="mercuric reductase, putative"
FT                   /note="identified by similarity to SP:P17239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93857"
FT                   /db_xref="GOA:Q5LW03"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW03"
FT                   /protein_id="AAV93857.1"
FT                   /translation="MERIETDLLVIGAGSGGLSVAAGASQMGARVVLLEGHEMGGDCLN
FT                   YGCVPSKALIASAKAAHARMTDAGLGVAGQEPQVDFAAVKDHVAAVIAQIAPVDSQDRF
FT                   EGLGVRVIREYGQFVSRTEVQAGAHLIAARRIVIATGSTPLIPPIPGLDSVPYLTNEIL
FT                   FDLRQRPDHLLIIGGGPIGLEMAQAHVRLGCKVTVIEAARALNREDPEAAALVLTRLRA
FT                   EGVEIAEDTAAAQIRGRAGAIEVVSAEGRIFAGSHLLVAVGRKASTDRLNLDAAGVETT
FT                   RTGIRVDASLRTSNRRVYAIGDVAGGLQFTHVAGYQAGVILRSALFGLPSKARTDHIPR
FT                   ATYTDPELAQIGLTEAEARDRHGDRVEVARFDYLHNDRAIAEGRTEGFIKVMVVRGRPV
FT                   GVTIVGHQAGEHANLWSLALANNLKMSQVAAMVSPYPTIGEISKRAAGAYFSPRLFENQ
FT                   SVKRVVGLVQRWLP"
FT   gene            535901..537286
FT                   /locus_tag="SPO0541"
FT   CDS_pept        535901..537286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0541"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93858"
FT                   /db_xref="GOA:Q5LW02"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW02"
FT                   /protein_id="AAV93858.1"
FT                   /translation="MLNSLSGRFLILTVAFVMLAEVLIFVPSIARFRQDFLQNRLERAQ
FT                   IASLALLADDMLATDLETELLENAGVYNVVLRRDEVRQLMLSSPIPGQIGQSYDLRQAS
FT                   PWILMRDALLRFFMSENEVIRVIGEPVKEAGLLIEVTMDSQPLRMAMIDYGARILLLSL
FT                   VISIITAFFLFLAVRAILVRPIRGVVDYMQRYARAPEDVRGIITPNSGVTELREAEEAL
FT                   QMLQRQLTQALRQRERLAQLGGAVAKVSHDLRNILTSAQLFTDRIETSEDPLVRRMAPK
FT                   LVNSITRAVSLCESTLAFGRAEEPSPMLTMVRLHMVAEDVVASERLALGEGAIEIVNEV
FT                   PETLSARADPEQLFRVVMNLVRNARQALEATGQAGLVAVSGHETEADWVIEVRDTGPGL
FT                   PLKARENLFTPFQGGVRKGGSGLGLAISAELVRGHGGALVLKDSGPSGTAFEIRLPKGG
FT                   ETF"
FT   gene            537350..537426
FT                   /locus_tag="SPO_tRNA-Arg-3"
FT   tRNA            537350..537426
FT                   /locus_tag="SPO_tRNA-Arg-3"
FT                   /product="tRNA-Arg"
FT   gene            complement(537802..539055)
FT                   /locus_tag="SPO0543"
FT   CDS_pept        complement(537802..539055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD14035.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93859"
FT                   /db_xref="GOA:Q5LW01"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW01"
FT                   /protein_id="AAV93859.1"
FT                   /translation="MNTAQPDFDLIVAGAGMVGMSAALYAQMDGLKVALCDPNPPGSGT
FT                   TYGSACTIATYACIPVNSPAIFAALPYLLTSKDSPLSFNLLHGLKNPCWMLSFLANCRA
FT                   ARVRRITEALGRFLADADAGLDPLIMAAGAEDLIVSNDCLYVWSTRAGYEGARASNALR
FT                   RAQGVRFEELGPDEVRAMEPNLKQPIHRGLHFKGARHVTSPQALVGRMQHRFETLGGTY
FT                   LPARVERCDPDEGGVTVRLNDGGTLRAGHFALTAGARSRQIAGTGAEGLPLGTERGYHI
FT                   LYRDHASLVSRPVGWAEAGFYATPMAQGLRIAGTVEINAIDAPFNTKRTDYLQRKSHEM
FT                   FGQLGAPDETWLGHRPTMPDSLPVIGPSPSSDRVIFAFGHQHIGLTLGGLTGKVVADLA
FT                   QQRSPTCNLGDFAPQRFT"
FT   gene            complement(539068..541503)
FT                   /locus_tag="SPO0544"
FT   CDS_pept        complement(539068..541503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0544"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93860"
FT                   /db_xref="GOA:Q5LW00"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW00"
FT                   /protein_id="AAV93860.1"
FT                   /translation="MKQVRVAVIGGGVVGVSVLYHLARLGWTDCCLLERTQLTAGSTWH
FT                   AAGLLPLYYPNQTMSLINKHSMQLYARLQAETGQPSGFHQCGQLRLATDHDRLDEYRAY
FT                   LSFARYLGIDCALITREEAQKLWPLADLGDVIAALYHPGDGHIAPADLTQAMATGARGM
FT                   GAKIHLNTEATAISRTASGEWLISTPNGDFLAEHVVTATGNYARQTGAMVGLNVPSIPV
FT                   MHQYVVTETIKEFADHNRAGRPEMPVLRDDKSRFYLRQENDGLILGPYEPNPKSWAING
FT                   VPPGFGAELMTPDYDSLEPFIEGTLRRVSSFAAAGIRTVVNGPIAHTPDAFPLVGPAPG
FT                   LQNYWLAEGMVAGICYGGGVGRYLAEWITEGAPTIDMWPVDPRRFNGHAGKNHTRLKNE
FT                   ETYGHIFDIHYPNLEMPAARPGKTSPCYDRLTRAGAVWGVAGGWERARWFDAEGNRTPE
FT                   TLTFRRSNAFEAIGAECRAIRNAVGLIDFTSFAKWEVSGAGAMAFLDRALANAMPKRDG
FT                   RVTLAHALDENGRFCAEFTVARLAEDRFYICGPAFSEVHDDHVLRSRLRPADAATLTNV
FT                   SMGWGCFTVAGPKSRELLSRIVDAPLENDSFKWFDLHEGEVGWATDVRLMRVNYCGELG
FT                   WELHHPIAFQHHILDQLEQAGADLGLRHVGMRALDSLRIEKSYRAVAQELTTQNTLHEL
FT                   GLGRFIATGKTGFIGAQAVAERVGKESVKLVTLEVDCEAGGVEPAMNQAVRCGDKVIAL
FT                   TTSGAYGHFLGKHLAMAILPLDHAAEGTRLSVEILDERYDAVVIADSPHDPGNLRPRA"
FT   gene            541827..544025
FT                   /gene="uvrB"
FT                   /locus_tag="SPO0545"
FT   CDS_pept        541827..544025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="SPO0545"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93861"
FT                   /db_xref="GOA:Q5LVZ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ9"
FT                   /protein_id="AAV93861.1"
FT                   /translation="MPDAHSDKSAALMHAPAPDVKARPKLEGGRRFVMQTEFQPAGDQP
FT                   TAIAELTQGVNEGERNQVLLGATGTGKTFTMAKVIEETQRPAIILAPNKTLAAQLYGEF
FT                   KGFFPDNAVEYFVSFYDYYQPEAYVARSDTYIEKESQINEQIDRMRHSATRALLERDDV
FT                   IIIASVSCIYGIGSVETYGAMTQDLKVGGEYDQRQIMADLVAQQYKRNDQAFQRGSFRV
FT                   RGDSLEVWPAHLEDRAWKLSFFGEELEAITEFDPLTGQKTDTFDQIRVYANSHYVTPKP
FT                   TMQQAIIGIKQELRQRLDQLVGEGKLLEAQRLEQRTNFDLEMLEATGVCNGIENYSRYL
FT                   TGRAPGEPPPTLFEFIPDHAIVFADESHVSVPQIGGMYRGDYRRKFTLAEHGFRLPSCM
FT                   DNRPLKFEEWDAMRPQSVFVSATPAAWEMEQSGGVFTEQVIRPTGLLDPQVEIRPVEMQ
FT                   VDDLLDEVRKMADQGFRTLVTTLTKRMAEDLTEYLHEQGIKVRYMHSDIDTLERIEILR
FT                   DLRLGAFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLIQTIGRAARNAEGR
FT                   VIMYADRITGSMERALGETDRRRAKQIAYNEEHGITPATVKKNVEDVLAGLYKGDTDMS
FT                   RVTAKIDKPLHGGNLEAVLDGLRADMRKAAENLEFEEAARLRDEVKRLEAVDLAVSDDP
FT                   MARQWAVESASEQAVKSRGRSTAGRPGQRGGNVKRRGR"
FT   gene            544149..544619
FT                   /locus_tag="SPO0546"
FT   CDS_pept        544149..544619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93862"
FT                   /db_xref="GOA:Q5LVZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ8"
FT                   /protein_id="AAV93862.1"
FT                   /translation="MFSHLRFFAHAGAVSRACRRGCNKELLRMKYTLSLHSRSSPFRIV
FT                   LEINGDPDSDSFHWTEIEPDHEKPFFMAASRSLGYFDNSAKHGEIKRAIFKGSGVATDK
FT                   RPPVLELQICRLPEFKIRDFEHCWQGNILRWADSPNYQKQSLQRFTWRAEAV"
FT   gene            complement(544720..545253)
FT                   /locus_tag="SPO0547"
FT   CDS_pept        complement(544720..545253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:H83501"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93863"
FT                   /db_xref="GOA:Q5LVZ7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ7"
FT                   /protein_id="AAV93863.1"
FT                   /translation="MPNYRRARIAGASYFFTLALADRSSTLLTERINDLRHAYALTIRE
FT                   APIVCEAFVVLPDHLHAVWTLPPGDSAFSERWRKIKHRFSRAVGRTAHPTHRSESKRAK
FT                   RECGIWQRRFWEHLIRDEDDFRRHVEYCWGNPVKHGLVDRAVDWPFSTIHRDIRLGRVD
FT                   AQWAGRPTEGAFGE"
FT   gene            545461..545724
FT                   /locus_tag="SPO0548"
FT   CDS_pept        545461..545724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93864"
FT                   /db_xref="GOA:Q5LVZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ6"
FT                   /protein_id="AAV93864.1"
FT                   /translation="MRIAVFAISLAYVLLYGWAWVGTVNASMDAAGRGMALGFLTVGIG
FT                   ATAIFVIPALVLAIANRAPKWALGLSLAPAALLFLVVMTGVI"
FT   gene            complement(545732..546238)
FT                   /locus_tag="SPO0549"
FT   CDS_pept        complement(545732..546238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G97668"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93865"
FT                   /db_xref="GOA:Q5LVZ5"
FT                   /db_xref="InterPro:IPR025690"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ5"
FT                   /protein_id="AAV93865.1"
FT                   /translation="MDHARRGDRPMSRLDSMLRRLTAQRDGLNWAALQISGIPGEVLDM
FT                   GLGNGRTYDHLREILPGRRIRVMDRVLQCHPSCTPPEADFLMGEAEPMLERLAAEGAPI
FT                   VLAHYDFGMGIKADDVAEAARLSPLIARVMVPGGLIISGQPLVGFTPVAAPDSIPPERY
FT                   LFYRA"
FT   gene            complement(546205..546969)
FT                   /locus_tag="SPO0550"
FT   CDS_pept        complement(546205..546969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E95936"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93866"
FT                   /db_xref="GOA:Q5LVZ4"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ4"
FT                   /protein_id="AAV93866.1"
FT                   /translation="MTPDWTPLDAELARWAAEGLTLPLWWRDDDAVSTTPQLDRLTALA
FT                   EDLDLPVHLAVIPAGADTALADHVTAHPHLVPVVHGWAHQNHVPATEKKAEFRAHRPLS
FT                   EILTEAGQGKARLQALFGDALRPMFVPPWNRIAPEVTAGLPPLGYRALSTATPRRSPMA
FT                   APGLAQVNTHLDPIDWRGSRGLVAPQTLIAQTATLLADRREGRADATEPFGILTHHLVH
FT                   DDEIWQFSGALLARLLAGPCQPWTMPAEETDR"
FT   gene            complement(546966..548105)
FT                   /locus_tag="SPO0551"
FT   CDS_pept        complement(546966..548105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B97670"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93867"
FT                   /db_xref="GOA:Q5LVZ3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ3"
FT                   /protein_id="AAV93867.1"
FT                   /translation="MKVMIVVTHLLGTGHLSRALTLGRAFAATGHQVRLVSGGMPAPQL
FT                   DPAGLELVQLPPLRSDGVDFARLLTETGAEADAGFHTTRQAALLEALTAFAPDVLITEL
FT                   YPFGRRSLKTEFRALLAAARALPRPPLVLSSIRDILAPPSKPAKAEEADQVIAEAYDAV
FT                   LVHSDPKVTRLEASWPVSAALADKLRYTGYVAPPPAEPHPERAGAGEILVSAGGGAVGG
FT                   PLFRVALEAARRMPSHRWRLLVGGTQAGAEVAALQEQASNAPVTVEPARPDFRAMLTHA
FT                   AASVSMCGYNTALDLLQARTPAVLIPFDAGKEVEQGLRARALTALPGFATVTSAELTPE
FT                   TLMRALQQVMRDPRRDTTTLRFDGAAETVRMVEMMEAAR"
FT   gene            complement(548102..548686)
FT                   /locus_tag="SPO0552"
FT   CDS_pept        complement(548102..548686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0552"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93868"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ2"
FT                   /protein_id="AAV93868.1"
FT                   /translation="MRRLALLRHGHTDWNRAGRIQGRSDIPLDDAARHDLGALALPAPW
FT                   DRATLWSSPLSRAVETAKLVAGHTPRNAPALTEMNWGDWEGQRGRDLLDTPGSGYRHIE
FT                   DWGWDFRPPAGESPAEVWTRIDPWLAGLTGDSVAVCHIGIMRVILARAHGWNFDGIPPF
FT                   KVKRNRLFVVSLDPLAPSGEPVRLIPREARP"
FT   gene            complement(548683..549762)
FT                   /locus_tag="SPO0553"
FT   CDS_pept        complement(548683..549762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0553"
FT                   /product="glycosyltransferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93869"
FT                   /db_xref="GOA:Q5LVZ1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ1"
FT                   /protein_id="AAV93869.1"
FT                   /translation="MARIAFYAPMKSPDSPVPSGDRELARSLRTMIAGRGVPVDLVSEF
FT                   KSLDKQGDAGAQARLRAGAAVEVRRLIRDLPGDCALWVTYHNYYKAPDLIGPAVCAARA
FT                   IPYVQIESTRATSRLTGPWAGFAQAAHDACDAARVIFYLTANDLITLERERFGTQALVE
FT                   LPPFLPENTLPSRTTADGPMLSAGMMRPGDKLASYRLIAETLAHLDGAWQLDIAGDGPA
FT                   RPEVAALMAPFGARVRFLGQLDRAGLQAAYGRSSLFFWPGVNEAFGMVYLEAQAAGLPV
FT                   VAQDRPGVRDVLLPGPAYPAPEAGPEALAEMIDRLRADPGMRQRIGSEARDRIATRHLP
FT                   TAAAAVFWGAVTPLMETAS"
FT   gene            complement(549765..551009)
FT                   /locus_tag="SPO0554"
FT   CDS_pept        complement(549765..551009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0554"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93870"
FT                   /db_xref="GOA:Q5LVZ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ0"
FT                   /protein_id="AAV93870.1"
FT                   /translation="MTSDSPKLAVVVKGWPRLSETFIAQELVALEEAGHDFDIWSLRHP
FT                   TDVKRHPLHERLRARVRYLPEYLWQEPERVWRARAVAQALPGYAEAYRAWRADLARDRT
FT                   KNRIRRFGQACVMAAELPASTRGLYAHFLHTPASVARYAAIMRGLPWSFSAHAKDIWTS
FT                   PDWEKAEKLSAASHGAAFGATCTAVGATHLRGLTDDPGRVDLVYHGLDLARFPDPPARS
FT                   PRAASAPLAMLSVGRLVEKKGFDRLIAGFGLLPPGLRWHWTHIGGGGDRAALTAQAEAL
FT                   GIAQQITWRGACDQPEVIAAMRAADLFVLPSRVAADGDRDGLPNVLMEAASQLLPILST
FT                   PVSAIPEFITDGAHGTLSDDAPEALARAIATLAADPERAAGMAAAARVRLLSEFTMAPG
FT                   IAHLSNRLTALCAGG"
FT   gene            complement(551006..552220)
FT                   /locus_tag="SPO0555"
FT   CDS_pept        complement(551006..552220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50184.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93871"
FT                   /db_xref="GOA:Q5LVY9"
FT                   /db_xref="InterPro:IPR016683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY9"
FT                   /protein_id="AAV93871.1"
FT                   /translation="MQGESRTVDTGRAARVMLYSHDTFGLGHLRRSRALAAAITQADPS
FT                   ASALILTGSPVAGRFTFPRRVDHVRLPGVTKRADGSYASQTMGMGIDEVTDLRSGLIRG
FT                   AAERYDPDILIVDKEPTGFRGELLPTLDCLQRRGRARLVLGLRDVLDEPEVLAAEWARK
FT                   GAVAATERFYDEIWVYGLRSVYDPTAGLPLSPEAQARMHWTGYLRRDLGPVGTPPHQPY
FT                   VLITPGGGGDGEAMVNLVLSAYEQDPTLSPRAVLVYGPFLSGDTRAEFERRVAALNGRV
FT                   TAVGFESEIETLFAGAAGVVCMGGYNTFCEVLSFDQRAVIVPRTVPRLEQWIRASRAEE
FT                   LGLVRMLEESRDGLTPETMIQAIRNLPNQPLPSQAIGEGLLDGLDHVTRRVRALLSKTS
FT                   HQAAE"
FT   gene            complement(552230..553540)
FT                   /locus_tag="SPO0556"
FT   CDS_pept        complement(552230..553540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0556"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93872"
FT                   /db_xref="GOA:Q5LVY8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY8"
FT                   /protein_id="AAV93872.1"
FT                   /translation="MKHARSGTQAMSRQTDQDRIAVLGLGYVGLPLALGLARAGFQTLG
FT                   FDTDAAHITALGRGHDRNGEVSERSLAETRARFSCDPADLAGCTVYIIGVPTPITDAKT
FT                   PDLEPLKGACRMIAPHLVPGDMVIVESTVYPGVTEEICGPVLAEGSGLELYSQIKLAYS
FT                   PERVNPGDAEHSMENVVKIVSAQDAETLDRVAAIYAPVVKAGVHRASSIRTAEAAKVIE
FT                   NTQRDLNIALVNEFSLIFSRLGLDTLEVLEAAGTKWNFLPFKPGLVGGHCIGVDPYYLT
FT                   YRAEQSGYHPEVILAGRRINDNMGRHVARQLIKALIARRIDPGRARVLVMGFTFKENCA
FT                   DIRNTRVADILSELAEYSVATEVCDPWVDPEAMEQEYGVTPVSEPTTGAYDAIVVAVAH
FT                   RQFVELGAAAIRAFGLPGAVLYDIKGIFSKSDTDLRL"
FT   gene            553643..556090
FT                   /locus_tag="SPO0557"
FT   CDS_pept        553643..556090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0557"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93873"
FT                   /db_xref="GOA:Q5LVY7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY7"
FT                   /protein_id="AAV93873.1"
FT                   /translation="MPSGQALRISRTCRLNAHPRFDRLWRSPTPIQVSAMIVAFRLFLA
FT                   CLGLFLCLSSPLAAQVSLYSGIAGTSDESAGGDLAEAIRAASEAGASVIVIDSAGRVAA
FT                   AGTEAGAVETARVDPMGEASQLMKAQEKVSDFIGALRSRLEALPYSIFEVQYILRQTSP
FT                   DGRIATYAEVLAINLVLLLIGRWMSIEIYGKRIARKHVVSRIREAPRGYREKMPFLVFR
FT                   FVMGVGATLFAMVFAFIIGFLIFGPMQDLSIQFTVTAIFTAYFLARTASDLWRMVLSPY
FT                   LSQYRLPPFSDRDAKRLYLWASLLATYDISSELFSTWVADFGLNYNVYAMVYGVLTGVG
FT                   ALGNVLMVLFNGRAISNAIRGGRTKDEVSWILRLVSVAWAPVVLFYMVFGWLQLAFDLV
FT                   LERPVHIPLMAGTYGIFMSVVVAYGAMNYLLERYFDRTRQVKELNAALAEAEAAEDLSM
FT                   TGVSAQRHHIATFEDLARRVAGILAFVVGTYALVLIWNPEMDWTGDLPIDRALDVMVII
FT                   FLGYIVFHFFRIWIDSKIAEETVDVPEGELGDEGGGTSASRLATLLPLFRGAILAVVVV
FT                   SIVLIALMEVGINVSPLFAGAGVVGLAVGFGSQTLVRDIFSGAFFLVDDAFRKGEYIDI
FT                   GDVKGTVEKISVRSFQLRHHLGALHTIPFGEIKVLTNFSRDWVIMKLPLRVTYDTDVEK
FT                   VRKLIKNLGQELLSDPVIGDNFIQPLKSQGVIEMQDSAMIIRVKFMTKPGDQWLVRKRV
FT                   YQDIRELFAREGIKFAHREVTVRLADGQEAAKMTPQQREAVTGAVQAAIDEDVLDDMMD
FT                   DDR"
FT   gene            complement(556181..557332)
FT                   /locus_tag="SPO0558"
FT   CDS_pept        complement(556181..557332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0558"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42063"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93874"
FT                   /db_xref="GOA:Q5LVY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY6"
FT                   /protein_id="AAV93874.1"
FT                   /translation="MTQLPDGRYVDDAPYDPQQSIQQLERRDLDAPNWLLVWRKFRTHK
FT                   LGLISGIFLLLSYLLLPFMGFIAPYSPNYRNADHLYAPPQAVRWVHEGDFLGPFIYPIT
FT                   AEADLETFQWTFVPDTENPQRIRFFCEGDSYKLAGLIESDTHLFCAPEGATLFLWGSDR
FT                   LGRDVFSRILYGAQLSLTVGLIGISVSFVLGIFFGSLAGYLGGKTDWVINRVIEILRSL
FT                   PELPLWLALSAAVPSNWSPVAVFFIISVILGILDWPGLARSVRAKFLSLREEEYVRAAE
FT                   MMGAGKGRVIRKHLLPNFMSHLIASATLSIPAMILGETALSFLGLGLRAPAVSWGVMLN
FT                   DAQNLASIELYPWTAIPMLPIVVVVLAFNFLGDGLRDSLDPYS"
FT   gene            complement(557329..558357)
FT                   /locus_tag="SPO0559"
FT   CDS_pept        complement(557329..558357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0559"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42062"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93875"
FT                   /db_xref="GOA:Q5LVY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY5"
FT                   /protein_id="AAV93875.1"
FT                   /translation="MAILRYAFYRFGTMLMTLLVVSVLVFAIINLPPGDYLSNQIAELK
FT                   ASGQSAGVAKAEFLRKEYALDRPVWQQYMIWMGFMPGPHGFSGLIQGNFGWSFEFDRPV
FT                   SEIVGDSLWLTVLVNMAAIVFVYATALPLGVIAAAKARTWADYTSAFVGYLGLATPNFL
FT                   LALILYYYGRKYLDIPIGGLMDPAFEGQPMSWAKIQSVLVHLIVPTIVIGTAGASAMMQ
FT                   RLRANMLDELGKPYVETAIAKGMAPSRMLAKYPLRVAFNPFVADIGNLLPSMVSGSVLV
FT                   SVVMGLQTIGPTLLTALKSQDMFLSGFVLMFVALLTLIGTMISDILLVMLDPRIRYEGR
FT                   DA"
FT   gene            complement(558370..560286)
FT                   /locus_tag="SPO0560"
FT   CDS_pept        complement(558370..560286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0560"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to GB:BAB50197.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93876"
FT                   /db_xref="GOA:Q5LVY4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY4"
FT                   /protein_id="AAV93876.1"
FT                   /translation="MLELPRRAFALALTMVLAGVLPLRADTVPTLQESVFWGAEVKSGD
FT                   LPPIDQRIPEEPLIVDLAAKGREFGTPGGVMRTMITRSKDIRQMVVYGYARLVGYDENY
FT                   NLVPDLLKSYEVEEDRRFTLHLRKGHKWSDGAPFTSADFEYWWKDVANNPLLSPAGPPD
FT                   FLLIEGQPPRVSFPDATTVMFEWDKPNPNFLQSLAQARPPFIYRPAHFLKQFHQDYADT
FT                   AQLAAAVEENRVKSWAALHNKLDNMYQFDNAQLPTLQPWINASEGKKIRHNFVRNPYYH
FT                   RIDTRGVQLPYIDIIEMEIVAPGLVAAKSNAGEVDLQGRGLDFRDASILKKGEADGGYK
FT                   TYLWQTGVASQIAIYPNLNHNDDVWRALLRDARLRRALSLAIDRDAINRALYFKLAKPG
FT                   AMAVLPASPFFKQEHRDAWAAYDPARASALLDEVGLDKRDGAGIRLLPDGRPMELVIET
FT                   AGERQEVENALQIITDTWREIGVKLVMRPLDRDILRNRVFAGTTMASVWFGWDNGLPQA
FT                   YTSPAYLAPTDQVFLAWPKWGQHYQTAGQVGEAPDLPEAQRLMELLHDWERANNDQDRA
FT                   AAWSEMLAIHADQIYGIGILAEAPQPIVVSARMRNVPKKGMWAWDPGAHFGVHRMDEFF
FT                   IQD"
FT   gene            complement(560279..562051)
FT                   /locus_tag="SPO0561"
FT   CDS_pept        complement(560279..562051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0561"
FT                   /product="ABC transporter"
FT                   /note="'initially identified as a pseudogene, expression
FT                   verified by proteomics'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0561"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86010"
FT                   /db_xref="GOA:V5UZC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:V5UZC4"
FT                   /protein_id="AHB86010.1"
FT                   /translation="MTPLLSVENLSIGFGRGDAVVRDVSFEVMPGQTLALVGESGSGKT
FT                   VTCRAVLRILPKAAQIRTGRITLNGQDGPLTLNQLGERQLRAIRGNRISMIFQEPMRSL
FT                   SPLHRIGNQVSEVLWLHRGASEREARKTVLEQFERVGFPDPERAYNSYPFEMSGGMRQR
FT                   AMIAMAMVAKPDLLIADEPTTALDVTTQAQVLGLIKELQRETGMALILVTHDLGVVANM
FT                   AEQVVVMHKGRVMESGSAVAMLKDPAHPYTRQLFDAAPEIPDTQAVGLPMPQDDLILEM
FT                   KDVSKTYTMRSGRGWQPHKQIYACRGVDFRLARGKTLAIVGESGSGKTTAARIALGAEP
FT                   PDPGGQVLFRAAPGDAPLTVHDMTRAQRTAFQRQAQMVFQDPYSSLSPRMRIQDAMTEP
FT                   LEIHRIGTRAEQRDKATEALERVGLNADMLKRYPHAFSGGQRQRLSVARALMLDPAMIV
FT                   CDEPTSALDVSVQDQILTLLEELQEGLKLSYLFISHDLAVVARIADEVAVMRQGLVVEQ
FT                   APPETLFHNPQHPYTKALIAAQPEPDIDRPINLKLVALGAGAPDTWAEAFRFTDSVIPS
FT                   LVEMEPGHKVRCHA"
FT   gene            562275..562796
FT                   /locus_tag="SPO0562"
FT   CDS_pept        562275..562796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50200.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93877"
FT                   /db_xref="GOA:Q5LVY3"
FT                   /db_xref="InterPro:IPR025690"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3IHT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY3"
FT                   /protein_id="AAV93877.1"
FT                   /translation="MREMQIMSQPEQSRLDLFIDRMVSQRACLEHAIAQTAGLSGPVYE
FT                   LGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGDIRETLPATLERFGA
FT                   TASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLMVSSDRMYFEGLEELPLPPGAV
FT                   VGRCFIYRRG"
FT   gene            562897..563526
FT                   /locus_tag="SPO0563"
FT   CDS_pept        562897..563526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0563"
FT                   /product="glutathione S-transferase, putative"
FT                   /note="identified by similarity to SP:Q12390"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93878"
FT                   /db_xref="GOA:Q5LVY2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR034346"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY2"
FT                   /protein_id="AAV93878.1"
FT                   /translation="MLFYDCSTAPNPRRARMFIAEKGVEVESRDISIAKGEQLQPAFRA
FT                   VNSRATIPVLVTDEGTVLTENLGIAAYLEARFPEPPLMGRSADEKGLVLMWNAIAEQQG
FT                   GAPVADALRNGHPAFKDRAIPGPANHAQIPELAQRGVARVAQFFDLLEERLNESPFIAC
FT                   DHFTLADISTFVFVDFARVIKMRVPEGNTATRAWYEAIKARPSAQI"
FT   gene            563718..566126
FT                   /locus_tag="SPO0564"
FT   CDS_pept        563718..566126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0564"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93879"
FT                   /db_xref="GOA:Q5LVY1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY1"
FT                   /protein_id="AAV93879.1"
FT                   /translation="MKSHYRVVVIGGGVVGASVLYHLAKFGWTDVVMLERRRLASGSSW
FT                   HAAGGIHALNADPNMAALQAYTIDLLSEIEKESGQNIGLHMTGGLTLAGTPERWEWLQA
FT                   NYRIFQSIGIDDCELLTPQEAQRRCPIMSTDGVLGAMWADREGYIDTTGTVQAYATAAR
FT                   KRGAEYYEDTKVEQLIQTADGWQVVTDKGTITCEHVVNAAGLWAKQVGRMAGVELPVSP
FT                   LKHHYLITDTVPEVAAAEFEMPMTVDLEGFTYMRQDQKGILVGIYEINHEHWAMDGAPW
FT                   NYGEELFQEQLDRIENELMLGFARYPSIQDVGIKTWVNGAFTFSPDGNPLVGPVPGKRG
FT                   YWSACAVMAGFLQGGGVGKTLAEWMIHGEPEADAWSMDVARYGDYAQNKRYIRETTGQF
FT                   YSRRFVMSYPNEQLPAGRPLKMAPAHDAMTAAGCRWGVSWDLEVPLYFAPSEDFVENLT
FT                   LKRSNAHPIVAEECRVIREGVGLLDITGFSRFEVSGPNAEAWLDKLFATKLPAPGRARL
FT                   AVMLSETGRLKGDLTLLNWGDGTWWIMGSYYLRAWHMRWFNDHLDDGVSVRDLGEEICG
FT                   FGLVGPKSRTVIEKLAEQDISELKFMGCGSFDIGLVRARVARMSVTGEMGYEINCRYGD
FT                   HIALRRMLLEAGAGEDICEVGFNALLSTRIEKSFGIWSAEFTQDRTPGMTAMDRWIAWD
FT                   KGDFIGRDAAIAERDGNGPARVQVTLEVDAADADASGYEPVWADGVQIGFVTSGAYGHY
FT                   TGKSLAMALVDRDRAHPGTSVSVHVVGVERPATIIAPSPYDPDGKAMRG"
FT   gene            566123..567646
FT                   /locus_tag="SPO0565"
FT   CDS_pept        566123..567646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0565"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93880"
FT                   /db_xref="GOA:Q5LVY0"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY0"
FT                   /protein_id="AAV93880.1"
FT                   /translation="MSAGRRGRRARTEAPASARKVDYRNLRNPFPPMAAFSEDRIEALH
FT                   EASLSVLEELGIKVLHPGARDLYRQGGARIDGEMVHIGREMVEAALASAPKSIRMRGAV
FT                   PDRDVVLELGRMAFQPGAGCPHATDLARGRRPGTIADFRELVQITQSFDVLHMVPPLVE
FT                   AQDVPMHLRHMAMTEVELTQSDKVPFLYSRGTPQVMDGFEMIRDFRGLSDAEFRAQSWC
FT                   YTIINTNSPRTIDMPMAQGLIDFARHGQMAIITPFTLMGAMAPVTVAGAMTLSHAEALA
FT                   AITLSQLAQPGAPVCYGTFTSNVDMKSGAPAFGTPEHFTASLVAGQLARRIGLPWRCAG
FT                   GSAANINDAQAANETQFGLWGCLLAGATVTIHAAGWLEGGLTVSYEKIITDLEVLQMVA
FT                   ELCAGTPATDADIALDALREVPPMGHFFGAAHTMARYQTQFYEPLVGDWSNFGQWSERG
FT                   AVDANHRATGIWRGIVDNFEPPPMDPDRVAALQDFIARRTAEGGAPPES"
FT   gene            567709..568332
FT                   /locus_tag="SPO0566"
FT   CDS_pept        567709..568332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0566"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93881"
FT                   /db_xref="GOA:Q5LVX9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX9"
FT                   /protein_id="AAV93881.1"
FT                   /translation="MGNIKVTRDDWLNVAMDVLVSDGVEQVKVMNLAERMAVSRSSFYW
FT                   YFKSRQDLLDALLAKWQATNTAGLIAQTELPAQTITGAVCNLFHCVVDPALFDTALDFA
FT                   VRDWARRSGKVRRLLDLSDSRRLEALTAMFLRYDYSQIEAETRARVLYYMQIGYDLAQM
FT                   NEPIDQRLSFVRHYLFVFTGVQARDEEVAAFSAFARGFWEGRRP"
FT   gene            568329..569633
FT                   /locus_tag="SPO0567"
FT   CDS_pept        568329..569633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0567"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93882"
FT                   /db_xref="GOA:Q5LVX8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX8"
FT                   /protein_id="AAV93882.1"
FT                   /translation="MNSPDAIIIGTGVIGAAIAFEMAKAGWKTLSLDRNAQVGHGSTAG
FT                   SCAIIRMHYSTFEGTALAWEGYHYWRDWADYLGLPEGADLARFRQTGCLVMKTVANDQM
FT                   VKHIRCSAELGIPFEEWSAEEVLARLPIYALDSYAPARRLEDPEFGKPNGGRMGGAVFW
FT                   PNGGYVTDPALSAQNLMDAARLHGAALRNRAEVVEILQAGGRVAGVRLASGEEIHAPVV
FT                   INVAGPGSAIVNRMAGVTGDMTIQTRPLRQEVVHVPAPEGFDFETQGTIVSDSDIACYC
FT                   RPEQGNHILIGSEDPACDPHQWCKDDLDFDRNFTDQWTTQAMRYAQRVPSLGIPSRMRG
FT                   VVDLYDASTDWIPIYDRSSLPGFYMACGTSGNQYKNAPIAGKMMAALVRYCEEGGDHDT
FT                   APLEFELPYIGRRIDVGFYSRKRPVNQESSFSVLG"
FT   gene            complement(569855..573268)
FT                   /locus_tag="SPO0568"
FT   CDS_pept        complement(569855..573268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0568"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93883"
FT                   /db_xref="GOA:Q5LVX7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX7"
FT                   /protein_id="AAV93883.1"
FT                   /translation="MTHPAPALRSYALEDRYNQTTGRVFLTGTQALVRIMMDQARRDRA
FT                   AGLNTAGFVSGYRGSPLGGLDLEMWRAKTRLEQDRITFMPAVNEDLGATAVLGAQQAVL
FT                   DPDCQHEGIFSMWYGKGPGVDRSGDALKHGNAYGSAPKGGVLVVAGDDHGCVSSSMPHQ
FT                   SDVAFMAWFMPTLNPASVEEYLEYGEYGLALSRFSGTWVGFKAISETVESGRSVELRPD
FT                   RQFTLPQIDLPAGGLHVRRADLPSPEIETRIQAKLRAVRAFAEENPIDRRIYDLPNARF
FT                   GFVTTGKGHLDLMEALRLLGLDEAKCRALGIDIYKVGIVWPLARRNALRFVRGKQEVLV
FT                   VEEKRGIIESQFKEYFYDWPGDKPHRMVGKYDEQGEPLIPWTGELSPLMLAPVVAARLD
FT                   AFFPDENLPARARALTETPPPVIAVPGATRTPYFCSGCPHNTSTKVPEGSRANSGIGCH
FT                   VMASWMNRDTDGYAQMGGEGVPHVVASKFNGGKHIFQNLGEGTWYHSGSLAIRQAVAAG
FT                   TNITYKILYNDAVAMTGGQPVDGPVSVSGIAQTCRAEGVQRIALISDDIEKFARADFPA
FT                   GTTFHDRAELMVVQKELREIKGVTVLIYEQTCATEKRRRRKRGKIEDPKRFAWINDLVC
FT                   EGCGDCSVASNCLSVEPRETPLGRKRKINLSSCNKDFSCLNGFCPSFVTVEGATRRKRT
FT                   ITLELDQLESGLPEPTLPALSDPFDLLVTGVGGTGVVTVGALITMAAHLEGLGASVLDF
FT                   TGFAQKFGTVLSYIRLGAKPDTLHQVRIDTGGADAVIGCDMVVSSAPKASAHYRNGTKV
FT                   VLNRAEMPTGDLVLHRDAQLKIDTREAAIRAVVGTENVSGFDANQTAEQLLGDAVFANV
FT                   MMLGYAWQQGLVPVSRSALAQAILLNGVAVEKNRLAFAAGRALAADPARLDVESASPEA
FT                   EETLDQMLARRAAFLTDYQNAAYATRFTNRIAALRQALPEASEALIAEAARNLFRFMAS
FT                   KDEYEVARLMTADHFQQDLQAQFEGDVKLTYHLAPPLLAHRKDARGRPVKRGFGPWLRP
FT                   VLSLLARAKPLRGTALNPFGYHSEARLHRETLAWYLALLDRMQQDCTATNEADWQSVLT
FT                   LTGEIRGYGPVRAEAAGRIRAEIASRLDRG"
FT   gene            573419..573877
FT                   /locus_tag="SPO0569"
FT   CDS_pept        573419..573877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0569"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93884"
FT                   /db_xref="GOA:Q5LVX6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX6"
FT                   /protein_id="AAV93884.1"
FT                   /translation="MQLDDRDRRILTLLQQDSRISNADLAEAVGMSASALWRRVRAFEE
FT                   AGVITRYGAVVDPGAMGLDFEAIVHVHLTRHDPDGIVAFIRAIETAPEVQECYATTGQA
FT                   DYHLRVLCPDLAAYNIFLERFLFRLPAVASAQTNVVLRTIKRNRPVTI"
FT   gene            574059..576395
FT                   /locus_tag="SPO0570"
FT   CDS_pept        574059..576395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD14776.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93885"
FT                   /db_xref="GOA:Q5LVX5"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX5"
FT                   /protein_id="AAV93885.1"
FT                   /translation="MVKARLFLCVRSVCTAALLMTTSLAAPALAETDPLDAPMQEITLG
FT                   PDDTIRGIVGQYLRDPDLWPAILALNNIASPAALQPGTVLRLPVQQVFAADAALVSSLS
FT                   AIQKANAEGARIFAPTQIGEAIRNRDEAVQKREVGDWRQVVGFAGVATDIAHEALELSL
FT                   TQRDRSAEAVVSDVQGDVEGRAPVEPSWSDRQLNDILVEFERVRTLSASTTQITFRDLS
FT                   RLRLNPNSNATIQRMRSDPLTGGEVTKVSLAEGDFYALLNQLSEKTTFEIEVPGIETTT
FT                   NSADFWIKNDTTGARFVNYDQPGLEIEENGRKIDVGQGEGVVITGAGAQRVTVLNSPRL
FT                   SAPALGEILYTRTADLAWDMFEGAEAYWLEVAADPGFNQMQVSEWGIRDTGLQVELPPA
FT                   RYHWRVAALDRLGLPGAWSTAQEFTIRLDDTPPFLTVLSPAPDTIVTTPEIEVLGATEL
FT                   DAALILNGVALEQGADGSFVTRVALVPGRNMISVLATDPAGNNSRRDQAVIYRPAAAIE
FT                   ISLSQGMPRVDEALATRSAQLSVTANSTAEPGAPVVVRNAAGAIALRAEVAPGGAISFT
FT                   VPVDAAPRSYRIEVLAPDGSVEGALEFQALRDELAPELTLDLPPPRATAETALALSGLA
FT                   EDAVRLELNGSDLPLVEGRFDLSVTLSPGVNTFDLVATDAVGNVTAKRLETLLDIDPPE
FT                   IASVVLNRPQGDGGPIEIEALASDASGLRQAAPFLIRIGAEEVEGFLRCDSTNGICRVS
FT                   LPPQDGALELVELMIEDYAGNAAFE"
FT   gene            576429..581300
FT                   /locus_tag="SPO0571"
FT   CDS_pept        576429..581300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0571"
FT                   /product="PKD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93886"
FT                   /db_xref="GOA:Q5LVX4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX4"
FT                   /protein_id="AAV93886.1"
FT                   /translation="MEERNMALARNWTAATLAVALLAIGSGTGAQTVADEGLLVVYGPQ
FT                   APSREGDTDRREQVFFSVPASLAERVYVRVFDPETGGEGDFTYGGSADSETTFRLFGGD
FT                   GAYSDADRPEPVADGAREPRLIPYDPVTQPGKMIREQVWGHDLATDGRWVSLAAVRARQ
FT                   GEIVGDRAYFRIDVQGSRGNDGNGYSLGVSLARDRDRAPEGLEMFSYQPTVRWSAGKPA
FT                   TRVDFTRTAPGPLTVQSFDGANGELALITDYRDLGLRISGQDFWTSDEVATDETNLAIS
FT                   LLGGFETPNDVTLAVFDAEGNPVPLSMPPYRAVVPPRPVARGTGQPLADCRSVAFDASG
FT                   STGRTPLSYLWEFDDGARSTDPVVAHRYSEPGRYTARLSLLEPGSRPGRGDRIEVPVHV
FT                   RNAPAAVAGSDIVVAPGQVVDFDGSASQPSDSPITGYRWTFGDGGAAQGPRAQHVYDQP
FT                   GQYRAVLRVQDDAVHPCNFGTAVRRVVVNFAPVAEAGTDQSAIVGQAVTLSGAASYDVD
FT                   GAILDYRWSMGDGTVLSGETVTHRYEQSGSYQVLLTVTDDSGVVNKIATDGARIEVNAP
FT                   PEPRFTIPDRPVSVSEVAVLDASASTDADGQILSYIWDFGDGAMGEGPVASYAWTRAGE
FT                   FSVTLTVEDDSATASALQSITRIVRVDAAPVADAGPDQYVTATEVRFDGGGSVDPDGRV
FT                   TDWQWDFGDGATASGQSVTHAYLRPGRYEVALIVRDDSGAPLNTHRDTMWLTINTAPIA
FT                   DAGPPQVVAPGEEFLLSGGASVDPDGAISDYLWTFPDGQVKQGQRVSHVLDEPGLHRIR
FT                   LTVADNFAGGAAEDEAEVLITVNAAPVAVAGRDLLIAPGDTVVFDAGQSFDPDGRLTSY
FT                   RWEFEDLGAPLEAQRVERAFDAPGVWSAQLVVADDSGVLNATAADDVTIRVNHPPVAEA
FT                   GAPVITDQLHVTFDGSGSKDGDGDPLIHRWDFGDGSPPVYGETVTHVFPRAGIFPVTLR
FT                   VDDGTGLSNARAIDATAVTIQARPMADAGGNRDVCSGEPILFDASASADPDGGLLAYEW
FT                   DFGDGSGSDLINPTKTYELPGVYPVTLKVRNGTGTEHGTAVDRIAALVREGPIADAGPD
FT                   MTVCSNAQVRFDGSGSSDADGAVNAFTWTFGDGGSGSGATPQHIFRTPGTYSVTLTITG
FT                   DARGACSPLDTDVSQVTVIAAPELKVLGQGRAAAGIPASFSAGLDQLGGASPEGFSWSI
FT                   SDGTTYEGRDIEHVFAEPGDYLVTLRSRLSGGTEACSELEVQRRIIVNAAPEPVIDAPL
FT                   RVSVGQSVRFDAGGSSDSDGAIARFAWAFGDGAGAEGVQAVHRYETPGSYEVSLTVTDD
FT                   AGVANSQITRRQQIEVAPSPVAGLTARGAVCPGVSLPWAVSPGGETAVGWAFGDGTVAE
FT                   GAETRHGFDRPGLMPVRVELDDGRDLPGSRRAEEIYVRVNAQPTALAGPDRVVCPGEVV
FT                   VFDAGGSGDVDGDLTSWRWTFSDGVTLEGARVERVFDAAADLTVQLSVQDDSGAEGCDI
FT                   GTDSARILVNGTPQVDAGPDLTVPVGGAHDVVRFDAGAASDPDGHGLRLSWSFGDGTEA
FT                   TGAVVRHRFANPGSYTVTLRAQDSTGLVCGIGRDTATVTAVARD"
FT   gene            581383..583098
FT                   /locus_tag="SPO0572"
FT   CDS_pept        581383..583098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0572"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93887"
FT                   /db_xref="GOA:Q5LVX3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX3"
FT                   /protein_id="AAV93887.1"
FT                   /translation="MRFPLRLKFFVFAVLLAMGPLALVGQNLTQLTRDELKSAANEDLT
FT                   TVAAELRATFDNTFQGRWLTPLTVIRNGVDSADLGVPQKISLLTLGLQELSQVVALQLS
FT                   IEGSDLPIIVTNEGFATRLSEAGLNPVEALATSSELIKAIAGTGQYGRPVITRLEETGD
FT                   WLATLALPLETRIAGRQVTMAARIDLGLLGETVRRHPFAQRGEITVVDQAGRRVLTGTP
FT                   ELLDKRRIVASTLPLIVAGARADALEPYVRPDGTAMLGAYAFPDWFPWAVITELSEDNA
FT                   YAVVNAITRQILTVGLVGFAVAAAAALLFARQLTRPILMIGQVAQRVGEGDFSARVEDV
FT                   RARDEIGDLAARFNRMIAHLGERVELMKFVSHSTMSAIQSAERTGMARGGQRRRVSVIF
FT                   TDIRGYTEFSERVPPETVIEVLNSYFDAQTDIVEHYKGDVDKFVGDALVAVFEGDGMEA
FT                   RAVACAVGITEAMARLLEENPEHGLHVGIGVASGEVVMGAMGARDRMDFTVLGSTVNLS
FT                   ARLCSKAAADQVLIDRETRDAAVLEDIVYEPLEPIALKGYAAPVPAFAALRKAG"
FT   gene            complement(583201..583596)
FT                   /locus_tag="SPO0573"
FT   CDS_pept        complement(583201..583596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ87470.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93888"
FT                   /db_xref="GOA:Q5LVX2"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX2"
FT                   /protein_id="AAV93888.1"
FT                   /translation="MFLPVTIGSLLLVLGLFQIKHMFADFFLQTPRMLSGRCQYWHLGR
FT                   AQHAGVHAVGSVLLFLVVGAPVVFALVIAVVEWVVHFNIDYGKASYSDRKALQPNQAKY
FT                   WHAMGFDQFLHQLTYLAMAWAWVEFAH"
FT   gene            583706..586804
FT                   /locus_tag="SPO0574"
FT   CDS_pept        583706..586804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0574"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93889"
FT                   /db_xref="GOA:Q5LVX1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX1"
FT                   /protein_id="AAV93889.1"
FT                   /translation="MSGRDSLGEGRRLRVWRPSCLRPILGVGAIERTLFRFIWKYSRRD
FT                   QLILLMVTATLFPLLYLTLELPKRIINDAIGAASSTIEVWGFTFDQVTYLGILCAAFLI
FT                   SVLAHGLMKMRINTMKGVMSERMLRRFRYLLITRVLRFPQPYFERVSQGELVSMITAES
FT                   EPMGGLMGDAISQPVLQAGQMITILSFLFLQSLWFGLAAVALIPLQAWLIPRMQRQINL
FT                   LNKKRIQEVRVLAAQIGENAAGAATLRSNAGWPWRMSMISYQLGRLFTIRFDIYQKKFF
FT                   MKFVNNFIGQLTPFLFYSIGGYLVLQGSVSLGALVAALAAYKDLSSPWKELLTYYNQTQ
FT                   DMSLRWEVILDRFAPPGMIDEDKFTGFPDERPRLIGDIVLDKVSVRDADGNLVLDDLDL
FT                   TLPGGKVIGIAASSEEDRRALSELLTREVLPASGQVRIGEIALSDLHQMVVASRIGHAT
FT                   SRPVLFQGTFGDNVTMPVRVRPQGDSGEPGFHAETLRAGNSADPYHSDWLEPGLAGFDD
FT                   ARALRDWWLKLVEGLGSGAALYRRGAEQVFAEADHPDLAARLVALRPVIQEAAERAGLA
FT                   GQAHFFDPDHYNPALPVAENLLFASPRAPFTPEVLAGQTDFLEQIRQIGLDEPLVRLTQ
FT                   DVIDMLRQIFGLDGTDHPLFRKMNLDVRTYETALELVEKTRDAGARALEDDQLASLLAV
FT                   PFRISADQIGPAFSDQIKARILELRKSHSSELMRSLDDVFAPLDPGAFAPGLNVLENAL
FT                   FGKVSEVGGARSDELRKLITDLLDEHGLRPQVIQLIYDLPVTLGGQNVPAIFAEPLAFT
FT                   RATIKRPDILLLDRALASYDMQTQIAVYRNLRALLPETTLIYLNDAFENPDVFDLYVEV
FT                   QQGRIVTEEVPRQQEEEDSVASADLSRKVRTLEQTPLFSGLDRRQLRLLAFGARWYSAK
FT                   AGEVVFLKDDEPTDGAYMMIEGEAGLYLPREGQEDQLIVTVGPGRLVGELGLIRKEPRA
FT                   LSMVAATDITCLRIGEEEFLAVVENDAATAFKLLQVVAGYVSN"
FT   gene            complement(586900..588057)
FT                   /gene="acdA-1"
FT                   /locus_tag="SPO0575"
FT   CDS_pept        complement(586900..588057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA-1"
FT                   /locus_tag="SPO0575"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93891"
FT                   /db_xref="GOA:Q5LVX0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX0"
FT                   /protein_id="AAV93891.1"
FT                   /translation="MTCSSPFMTPERQAFRDTLAAFFATEVTPHVEEWEAAQAVPWELH
FT                   QKLGALGVFGFGIPEEYGGLGFDDAFMRCDYAELAFGCGASGVAAAVGGRMISLGPMVQ
FT                   FAPEPFRQDILPRIVRGEMNSALAITEPGGGSDVANLSTRAARVAGGWVLNGAKAYITG
FT                   GMDAQWFVVGARTGGPGLAGISLFLIEADTPGFSRTPLGGKMGWHCSTQAMLHFDDCHV
FT                   PEAALIGPENKGFLAIMNNFNHERLAMVAGSLGMMRVCYRSALDWARERRTFGQRLIEH
FT                   QVIAHKFAEMSARIDMTEAYLERICWAMNQGLMPAAEIAKAKVQATKALEFVASEGMQI
FT                   FGGAGYLTGNPVERVWREVKVMAIGGGSEEILRDLAVRQMGLAGQ"
FT   gene            complement(588054..588683)
FT                   /locus_tag="SPO0576"
FT   CDS_pept        complement(588054..588683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0576"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GB:AAS05297.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93890"
FT                   /db_xref="GOA:Q5LVW9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW9"
FT                   /protein_id="AAV93890.1"
FT                   /translation="MPETLKPTQQDRRSRSTQAKVIRATITCLDRLGYAETTFARIQER
FT                   AGVSRGAITHHFPTRQALVAATAMELLSRALDPVERRAAQAASPEPVRDLITRAWGQVV
FT                   NAAGGRAMVEILVACRTDAELYRLLETRLHDWDHQSRASVARAYVGADQAADDAELLWS
FT                   MTRNFLRGLVLHERFVTDPAYLARMVDRFAGMMESQLTPLTAKDAL"
FT   gene            588797..590560
FT                   /locus_tag="SPO0577"
FT   CDS_pept        588797..590560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0577"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D83286"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93892"
FT                   /db_xref="GOA:Q5LVW8"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW8"
FT                   /protein_id="AAV93892.1"
FT                   /translation="MTAALRIGGACGFWGEAPHATAQLLAAGVDVLVYDYLAEITMSIM
FT                   ARARLKDPDQGYATDFVTEAMVPNLTAIAKQGVRVLSNAGGVNPEACAEALRERIAAAG
FT                   LSLRVAVVTGDDLLARASEFVKCTEMFTGAAMPPLERIASMNAYLGAAPVVAALRAGAD
FT                   IVLTGRCADSALTLAACVHHFGWDLSDHDRLAAGSLAGHLLECGPQATGGNFTDWEVAG
FT                   DLARIGYPIAEVAADGGFVLTKPEGSSGLVTPATVGEQMLYEIGDPRAYLLPDVVCDFS
FT                   GVTLEQAGPDRVRVSGARGRAPTGRLKVSVTWADGYRGGMVFQMTGRAARAKAQAFAQA
FT                   GLDRAQARLAALGAPGYREVSFEAFGGRPAPDAPEEIAFKAAVRHDDARAVGLFLKELV
FT                   GAALATPPGLHFFTGAGRPRPSPVVALFSCLIPADAVRASVVLDGADLSFDAPAPPLRD
FT                   IEEGLAPCPPEPDMELELEMRPLEALAWARSGDKGDSANIGVLARRPDYMPYIWAALSP
FT                   EAVMRFFDEKSPAQIQRFYLPGCHAMNILLTGALGGGGVASLRNDAQGKAFAQELLSLP
FT                   VPVPVGLITTD"
FT   gene            590573..592192
FT                   /locus_tag="SPO0578"
FT   CDS_pept        590573..592192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0578"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase"
FT                   /note="identified by similarity to GB:BAB16296.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93893"
FT                   /db_xref="GOA:Q5LVW7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW7"
FT                   /protein_id="AAV93893.1"
FT                   /translation="MRFISQLDKDSDCYRRNRADMLALVDQLRALEARPMALSEERRAR
FT                   MEARGQITPRDRLARLLDPGLPFVQLHSLAGYMVDSADPETSVPGASVIIGIGFVSGVR
FT                   TVVVVDDSGIKAGAMTEMTAAAFLSAQEVALKQRLPFLHLVESAGANLMEYRVELWAHG
FT                   GKLFRNLARLSAAGIPNIAVLHGPSTAGGAYMPGLADYVVGVRKNGMAALAGAALVHAA
FT                   TGERANDRDLGGSEMHAQTSGLVEYLAEDDAHGIEIARQVVAALDWNKSLPERPAPADI
FT                   APPLDPEDLAGLVPVDYRVPYDMRELAARVVDGGVFQDFKPRYGVSTVCLQAAIQGIAV
FT                   GIIGNNGPIDPDGATKAAQFIQLCGQSDTPLIFLNNTTGYMVGTAYEQAGMIKHGAKMI
FT                   QAVTSVDVPRITLYVGASFGAGNYGMSGYAYEPDFLFAWPNATTGVMGGEQAAGTMAMV
FT                   ARAGAARKGQDLDEARLAKQSAMIAAHFDQQSDAFYTSGRCLDHGVIDPRDTRRVLAFC
FT                   LHTCREARARRVKPGSYGVARF"
FT   gene            592192..594174
FT                   /locus_tag="SPO0579"
FT   CDS_pept        592192..594174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0579"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase,
FT                   putative"
FT                   /note="identified by similarity to GB:BAB16297.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93894"
FT                   /db_xref="GOA:Q5LVW6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW6"
FT                   /protein_id="AAV93894.1"
FT                   /translation="MMRFDTLLIANRGEIAVRIIRTAREMGLRTVAVYTTADAGAPHVA
FT                   LADHAVWIGEGPVGDSYLNADRILDAARQSGAGAIHPGYGFLSENAGFARAVAAAGLVF
FT                   VGPDAAAIEAMGNKAEAKRLMLAAGVPCVPGYQGADQSDAALTREAEQIGYPLMVKAAA
FT                   GGGGRGMRLVEGPGALSEALARARAEALGAFGSDELILERAVVEPRHVEFQVFGDAHGA
FT                   VIHLGERDCSVQRRHQKVIEEAPCPVMTPELRDAMGAAAVAAARAVDYRGAGTVEFLLD
FT                   ASGGFYFLEMNTRLQVEHPVTEMVTGLDLVALQLQVAQGDPLPLTQDDLRIDGHAIEVR
FT                   LYAEDPAAGFLPAIGPVLRWRPAAGAGLRVDAGIAQGQQIAPHYDPMLAKIIAHGPSRT
FT                   VALARLARAVADTVLLGTATNSAFLADLLALPEFAEGQATTGLLARSYPEGYGAGAPDP
FT                   RAVALMVAVLMQHDRDTALAAAGPIPPELLGWSSAPVLPRSLRVETGGQVFDCTAGAVP
FT                   GGWRIGVADAQFEIALVHREDGLRARLGGETHDLLAHVSGDTVHMASGAQRLSLRRQRP
FT                   GAPDAEALGGGRVTAPMPGLVQAVSVSEGAEVAKGQTLAVLEAMKMQHQITAPVAGRVA
FT                   RQHVAPGAQLAAGDVMFEIEEEESA"
FT   gene            594171..595301
FT                   /locus_tag="SPO0580"
FT   CDS_pept        594171..595301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0580"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93895"
FT                   /db_xref="GOA:Q5LVW5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW5"
FT                   /protein_id="AAV93895.1"
FT                   /translation="MNSDLCRKLGIEFPLFAFSHCRDVVAAVSRAGGMGVFGAVLYTPE
FT                   QLRTELEWIDANCGGKPYGVDLIVPTSIQRQGGSGPSDDQLLAGLPAEHLAFAEQVLER
FT                   AGVGADDLEERRCALLHISRNLDSAGAEAMLDVAFSFPIRLIANALGTPPQIMLDRARA
FT                   AGVPVAALVGSKQHAQRQVAAGVDILVAAGGEAGGHCGEVSTMVLVPEVVSVAGDTPVL
FT                   AAGGIVTGRQMAAAMAMGAAGAWCGSVWLTTAEGEPSQVVKDKMLAASSSDTVRSRSRT
FT                   GKTSRQLKSAWTDAWEADGPAPLPMPLQSLVAEPALARIEALAQRGHAGAADLATYWVG
FT                   QGVGLMTQTTSAAEVVQDFKRDYLAATERLMATLED"
FT   gene            595304..596095
FT                   /locus_tag="SPO0581"
FT   CDS_pept        595304..596095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAB95889.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93896"
FT                   /db_xref="GOA:Q5LVW4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW4"
FT                   /protein_id="AAV93896.1"
FT                   /translation="MEQAGDFLAECQALDAVLDGVSGADWDRPTQFKGWTLNDVLVHLH
FT                   FWNRMADLSLTDPAAFQARAAETLAGIGRDGFRATENAMITERGADLRAAWAAQYTDMA
FT                   ERWAGLDPKQRLQWVGPEMSARSSITARQMETWAHGQEVFDCLGATRTETDRIRNIVVL
FT                   GVNTFGWSFKVHGRPQPEMMPRLELTAPSGALWQFGEPGANRIAGPAVEFAQVVAQTRN
FT                   IADTSLVVEGPLAAEWMAIAQCFAGGPETPPAKGARHRVAG"
FT   gene            596200..597357
FT                   /gene="acdA-2"
FT                   /locus_tag="SPO0582"
FT   CDS_pept        596200..597357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA-2"
FT                   /locus_tag="SPO0582"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93897"
FT                   /db_xref="GOA:Q5LVW3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW3"
FT                   /protein_id="AAV93897.1"
FT                   /translation="MSLFSSTAAWVTDEHRMFAEAAGRFLDDELVPNIETWVDNGVVDR
FT                   DFWRKAGETGLMAGAIPEEFGGVGGGMGFDAVTIYEQTSRGDAGWGYGIQSIVTHYITA
FT                   YGSEEQKAKWLPGLASGEMVGAIAMTEPGTGSDLQAVRTTAEKDGNSYRINGSKIFITN
FT                   GQTADLIIVVAKTDKTLGSKGVSLIALETEGAEGFRRGRNLKKLGMKANDTAELFFEDV
FT                   KVPMTNLIGPEEGHGFYQLMKQLPWERLTIGIMALGAIDFALAETVKYVQERKAFGQRV
FT                   MDFQNTRFKLAECKTKAEVLRSFVNDCIGRLEAGQLDAATASMVKYYGSEVQNEIMHEC
FT                   LQLFGGYGFMMEYPIARLYADARVQMIYGGTNEVMKELIARSMDV"
FT   gene            complement(597540..598421)
FT                   /locus_tag="SPO0583"
FT   CDS_pept        complement(597540..598421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0583"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93898"
FT                   /db_xref="GOA:Q5LVW2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW2"
FT                   /protein_id="AAV93898.1"
FT                   /translation="MIAPRRFLPSISSLLALEAVDRLGSASAAAEELALTQSAISRQLK
FT                   TMEEQLGVELVQRDRVRLHLTPAAREYVQTARAALTQLAQASLKLKANPTGGTLSLSIL
FT                   PAFGMHWLAPRLQDFARRHPEVSVNLSTRLKPFDFASEPFDAAIHFGRRDWAGVDYLKI
FT                   MREEVLPVCAPELRQKTSDPTWLLSAPLLHLDTRPDAWERWFAVHDLAAPGLRGMLFDQ
FT                   FSTMIPAVANGLGVALLPSYLVTDDLARGRLVTACDGPAVSLGSYYLVWPKERMIAPPL
FT                   ASFRVWLQEAFA"
FT   gene            598519..599682
FT                   /gene="aspC-1"
FT                   /locus_tag="SPO0584"
FT   CDS_pept        598519..599682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC-1"
FT                   /locus_tag="SPO0584"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="identified by similarity to SP:Q06191"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93899"
FT                   /db_xref="GOA:Q5LVW1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW1"
FT                   /protein_id="AAV93899.1"
FT                   /translation="MNISSDTGFRRAGRLDGIELSEIVQISERVAQLRADGADIVALST
FT                   GEPDFPTPTHVIEAAHRAALAGQTRYPATAGTPALRAAIAAEAGVEPANVIVSTGAKQV
FT                   LAGAFLATLDPGDEVITTAPFWTSYADMVRLAGGVPVVLDCPGAQGFKLTPAQLEAAIT
FT                   SRTRWLLLNTPSNPTGAIYSEAELQALGAVLDRHPHVWVISDEIYQHLAYVPFTPFVQA
FT                   VPTLADRTLIVNGVSKAYSMTGWRIGWGIGPAPLIKAMVAVQGQITSGACSIAQAAALA
FT                   ALSGPQDLLVERRAEMLARRDLVVAGLNAAGLECASPDGAFYVFPKTPARMPVDHDFCH
FT                   HLLDTAGVALVPGRAFGMSGHLRLSFAYARQSLEEGLARIARAVAAL"
FT   gene            599692..601914
FT                   /locus_tag="SPO0585"
FT   CDS_pept        599692..601914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0585"
FT                   /product="dehydrogenase/transketolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93900"
FT                   /db_xref="GOA:Q5LVW0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW0"
FT                   /protein_id="AAV93900.1"
FT                   /translation="MTPSIKEGPAMDRAQIVHENFLSRVAARDLPKGAPPRPGLTQAQA
FT                   VSLYRAQVLSRALDRTSRAMQKAGQGFYTIGSSGHEGMAAVAQALRPTDIAFLHYRDAA
FT                   FQIARAEQVPGQQIAWDMLLSFACSKEDPASGGRHKVLGSKALMIPPQTSTIASHLPKA
FT                   VGAAYSLGAARRHPPEHRQLPEDGIAMCSFGDASANHSTAQGAINTAGWTSVQSIPLPL
FT                   LFVCEDNGIGISTKTPRGWIQASMEHRPGIRYFQANGLDIYETYAVAQEAADYVRNRRK
FT                   PAFLHLKTVRLYGHAGADVPTTYLTRAEVEAEEAMDPLLHSVRLLAEDGALASEEALAI
FT                   YEQTCARIDRIAVEAATRPHLASAAEVAASLIPPKRECKPTNGPGAEMRAATFGGDMRA
FT                   MDEPQPMSRLINWALTDLMLEHGEIVCMGEDVGRKGGVYGVTQKLQQRFGPDRMIDTLL
FT                   DEQSILGLAIGMGHNGFLPIPEIQFLAYLHNAEDQIRGEAATLPFFSNGQFTNPMVLRI
FT                   AGLGYQKGFGGHFHNDNSLAVLRDIPGVIIACPSTGEDAAQMLRECVRLAREEQRVVVF
FT                   LEPIALYPMRDLHGVQDGGWMTPYPSPDRRIALGEVGVHGNGTDLAIVTYGNGHYLSQQ
FT                   AVPEIEAAGIRARIIDLRWLAPLPIEALRAATKDCKHVLIVDECRRTGSQSEALMTFFC
FT                   EESRATSTARVVAEDCFIATGPAYAAPLPSRDGIVAAALSLTGVAK"
FT   gene            601911..602948
FT                   /locus_tag="SPO0586"
FT   CDS_pept        601911..602948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0586"
FT                   /product="acyl-carrier domain protein"
FT                   /note="identified by similarity to PIR:T00580"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93901"
FT                   /db_xref="GOA:Q5LVV9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV9"
FT                   /protein_id="AAV93901.1"
FT                   /translation="MTRTAVVICPGRGTYNKPELGYLHRHHGARMDMFRAFDAIRGEAG
FT                   QEAVTALDGAERYTVGKYSRGDVASPLIYAASLGDAQALAEDIEVVAVTGNSMGWYIAL
FT                   AAAGALSAENGFRVVNTMGTLMQERLIGGQLVYPFTGEDWADDAARKAALLADVARIDA
FT                   LPGHDLALSIDLGGMLVLAGNEAGLSAFEAAQPVVQERFPMRLANHAAFHTRLQAPVAA
FT                   EGRQRLGADLFTQPIRPMIDGRGKIWCPGATDTGALWDYTLGHQVTEPYDFTRAVQTAA
FT                   REFAPDLFIVTGPGATLGGAVAQSLVLANWRGMGDKAMFQARQAEAPLLVAMGREDQRG
FT                   LVTAA"
FT   gene            602992..604269
FT                   /locus_tag="SPO0587"
FT   CDS_pept        602992..604269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC46788.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93902"
FT                   /db_xref="GOA:Q5LVV8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV8"
FT                   /protein_id="AAV93902.1"
FT                   /translation="MSDNTRTLWHLTSAEQVTAPPLAGDVTADLVVIGGGFTGLSAALH
FT                   AAEQGADVRLVEAEAPGHGGSGRNVGLANAGLWLPPDDIRAHLGDAVGNRLIALLAGAP
FT                   ALVFELIARHGIACEPVRSGTLHCAHSPSGLADLCRRHAQLTASGAPVELLSAEETTRR
FT                   TGSGAFHGALFDPRAGTIQPLAYACGLARAAQAAGARLHGQSPALEIEHKDGAWQVRTS
FT                   GGSIRARKLIQATNAYHRGLADRRPAHVPVHYFQYATDPLPEKTRAAILPGGEGCWDTG
FT                   LIMTSFRLDRAGRMIIGGMGALDHPASGIHRAWVRRKLAQLYPALSRQPLVTGWHGRIA
FT                   MTGDHIPKITRPGPGALAAHGYSGRGIGPGTLFGKAMAEALLSGIETNLPIPAIDRHAE
FT                   RWTALQQAYVETGATLMHLIRARVGY"
FT   gene            complement(604263..605174)
FT                   /locus_tag="SPO0588"
FT   CDS_pept        complement(604263..605174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0588"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93903"
FT                   /db_xref="GOA:Q5LVV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV7"
FT                   /protein_id="AAV93903.1"
FT                   /translation="MSKFDFTDLDGKVLRCFLVILEESSVSRAADRLGVTQSAVSHTLA
FT                   KLRAVLGDPLFVRSGQGLTPTERALSLREPVQRVLDGIKSLTDARPFDPLGEEMHFDIA
FT                   ANDLQRELIFPELLCRARAEGVRLSLGFVPSGVPDPALLRSDRCQLVLTPLPPDGPDIY
FT                   QRRLFTSPLQIYYDASHRSPPDSWQSYCAAEHVEVRFIDGRSANVVMRGVDQSQIRPPT
FT                   VVLPHFGAIPAFVKGSDLISTDTALMKLGPLATLDCAPLPFACDPVSIYMVWHERSTAD
FT                   PAHRWLRARVEAIAARLQRSAQ"
FT   gene            605196..608468
FT                   /locus_tag="SPO0589"
FT   CDS_pept        605196..608468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0589"
FT                   /product="oxidoreductase, NAD-binding/iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93904"
FT                   /db_xref="GOA:Q5LVV6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV6"
FT                   /protein_id="AAV93904.1"
FT                   /translation="MVLLSIPRYAKRAVRRRRMGIRFFSDRDRPVHMGPYPLERLARRE
FT                   AVADLSTVPQIPVLSFHRPERPESIVNAMGEFQAMLDAIRDGLVNPARAEISADPLERA
FT                   NHLKAFGYFNDASMMGCGPLPAEALLPAPRRNPDIDRLAEALRTRQTKTLASGIDVIMA
FT                   DLKESMEAPPRPIDSHRHAIVFLYEHHRDPEADEPGAEWIHDAQDHRACLLASENAVVI
FT                   ANYIRLLGYDARAHTAMSSDVDLGRLALAAGLVTLEGGQLAAPWLGRRFGLAAVTTEME
FT                   LAHDRPLAPLAAQSWAATRGPAWWLGKGFAKSALNRDPYARRRYVDGAHPFERLNRVET
FT                   PTTYIDEANVARVPKRADMFARAQFGDMGKALQEGAKGGHYVRKAAPSFAQRRALGAFV
FT                   LLQDGDRADVPRPIDPRRNAANLKAASYFLGIDAVGLSRCPTWAWYSHDATGEAITPPH
FT                   DQAISMIVDQGYETMEGSSGDDWIAVAQSMRAYLRFSLLGGVIAQQIRNLGYKAKAHTV
FT                   MDGEVLQPPLLLLSGLGEVSRIGEVILNPFLGPRLKSGAVTTDMPMSHDKPIDFGLQRF
FT                   CEACNKCARECPSGAITAGPKRMFNGYEIWKSDSQKCATYRITTQGGAMCGRCMKTCPW
FT                   NLEGLFAERPFRWAAMTVPAAAPALARLDDALGHGGLNEVKKWWWDIELQPDGAYRPTT
FT                   GPVNRRGLQRDLDLKYEDQTLAVYPAPLAPHPWPYPFPMDREAGIAAYQAMIGADEYRA
FT                   RLAAGDLSVVHRYTVPDADTAPVIRVEVTRAEKMTGEITKYEFAAPDGAPLPEWTAGAH
FT                   LDVLVAPEFLRQYSMSGDPTDRTTYQIGVLREEEGRGGSKLMHRIFAPGRRVFISKPIN
FT                   HFELDEGATRSFLMGGGIGITPMIAFAHRLHALGADFELHYSVPSRTSAGYLEDLDAMP
FT                   WADRVHLHVSDEGSRADLDAVLAGFQPGWHVYTCGPERFMDGVMQAAERQGFPEEARHL
FT                   EYFSVPEQPAYENHPFTLKLARTGREIAVPADKDAAQVLNENGIHIDVKCSDGICGVCK
FT                   CGLIAGAVEHRDFVLSGKQREGAIILCQSRAAEPGGVVEIDL"
FT   gene            complement(608478..609506)
FT                   /gene="hpsR"
FT                   /locus_tag="SPO0590"
FT   CDS_pept        complement(608478..609506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsR"
FT                   /locus_tag="SPO0590"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93905"
FT                   /db_xref="GOA:Q5LVV5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV5"
FT                   /protein_id="AAV93905.1"
FT                   /translation="MTAPSTQPTPTLADVARRAGVSTATVSRCLNTPDRVIEETRNRVL
FT                   EAVRELGYSPNFGARALAAKRTNTIGAVIPTMENAIFARGLQAFQEELRLKGITLLVAS
FT                   SSYRADLEEEQIRTLVARGADGLFLIGAHRDPALYDFLNRRGIPTLAAWVHDPDAPVPT
FT                   IGFDNHAAMLDLAREVIARGHRRIGVISAEQASNDRARARVAAIRAAMAEAGLGADTLS
FT                   LVETAYGIDEGAAAFDTLMQRTPRPSVVMCGNDVLAVGAMGRAKETGYDVPGDVSITGF
FT                   DDIELAKVCSPGLTTVHVPHRQMGTQAAQALVAMVAEGAPGQGQRLDTYVVLRGSLAPP
FT                   RA"
FT   gene            609872..611017
FT                   /gene="hpsK"
FT                   /locus_tag="SPO0591"
FT   CDS_pept        609872..611017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsK"
FT                   /locus_tag="SPO0591"
FT                   /product="Dihydroxypropanesulfonate (DHPS) TRAP
FT                   transporter"
FT                   /note="identified by similarity to SP:P37735; PMID:
FT                   20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93906"
FT                   /db_xref="GOA:Q5LVV4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV4"
FT                   /protein_id="AAV93906.1"
FT                   /translation="MKDDRTGLASATRRNFLKLAGSGSFTAALVAGAAGTLWSTEAAAQ
FT                   TAKEEKEREAAASHVMTVATAYVLGASRSYPIMQLDLKENIQNATNGKVYVKLAPGGQL
FT                   GAGGALVQKVQGGTIQAAQHSLSNFAPFASAVDLINMPYFCGSNQRFTNLVSSDAWKTE
FT                   VHPKVEAAGFKALFYIVIDPRVVAVRKGGNAVITPGDLAGVKFRVPGSKMLQQYYRMVG
FT                   ANPTPVAWGETPSAIKQGVADALDPSVGALYVFGFKDILSHVTFTQAVPDSQVFSMNLE
FT                   WFNGLPADVQEGIMFAGEVTSQQNLAKVPAARAYAMSELTKSGVEFHSLSADQLAEWQA
FT                   TGGYQRSEWDSFKTELAGSMDAFNRLEEAAGTMGRYYVHDA"
FT   gene            611097..611639
FT                   /gene="hpsL"
FT                   /locus_tag="SPO0592"
FT   CDS_pept        611097..611639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsL"
FT                   /locus_tag="SPO0592"
FT                   /product="Dihydroxypropanesulfonate (DHPS) TRAP
FT                   transporter"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93907"
FT                   /db_xref="GOA:Q5LVV3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV3"
FT                   /protein_id="AAV93907.1"
FT                   /translation="MPLARREGHVTPILNALNRNAERWALLVFYVMLVVTMAVEVLRRE
FT                   IFAYSSIWGEEIVRYSFIYLAWIGAASAVKERGHIRIDVLMHYLGRRAKALLYIFGDLV
FT                   MFVVAVIALYWSFETVLVSAKFGSVSHGLRISMVWFLMAVPVGFSLMVLRLVQSFLRDL
FT                   RSLRDGTPVYEGDKLFD"
FT   gene            611650..612978
FT                   /gene="hpsM"
FT                   /locus_tag="SPO0593"
FT   CDS_pept        611650..612978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsM"
FT                   /locus_tag="SPO0593"
FT                   /product="Dihydroxypropanesulfonate (DHPS) TRAP
FT                   transporter"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93908"
FT                   /db_xref="GOA:Q5LVV2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV2"
FT                   /protein_id="AAV93908.1"
FT                   /translation="MLWNTLNQTVELGWDFYLPVIMFVGLIALAVPVWAAIGAAAITML
FT                   IMSGDMPLSAVGESLFTGIDAFALTAVPLFILTGDVLVRTGLSRKFLDVAEALTQFAKG
FT                   GFGSATVLVCGMFAAISGSDAAGAAAVGRMTIDRLVESGYPRPYACALVAAGACTGILI
FT                   PPSIAYIIIGLVLGISASTLFLAALIPGLCILISILVTNVVMNRINGWEGGGNISAGEY
FT                   FGNLGRSLKSGWYAFIVPGIIFYGIFSGRLTPTEAGATAVVVTVLMGFILRTLSLSDFP
FT                   AMLVSSAKVNGVILPIIAFSAPLAEALAIMGVPQGFVAAVTGMTDEPWLLILLMIGILI
FT                   AAGCVMETTPNIVILAPILKPLADNIGMNEIQFCIMMITALGVGFITPPLGLNLFVVSG
FT                   ITGESILKIAARAVPFVLFMLLVVLLIAYLPAISTTLLPDIYK"
FT   gene            612991..614298
FT                   /gene="hpsN"
FT                   /locus_tag="SPO0594"
FT   CDS_pept        612991..614298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsN"
FT                   /locus_tag="SPO0594"
FT                   /product="dihydroxypropanesulfonate-3-dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by similarity to SP:P10370; PMID:
FT                   20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93909"
FT                   /db_xref="GOA:Q5LVV1"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LVV1"
FT                   /protein_id="AAV93909.1"
FT                   /translation="MTIEYLKKASLTSKSDASDVQETVRAILADIEAGGDQVALDYAAK
FT                   FDRYEGSIILSPEEIEAACAKVPEKLKADIRFAHDNVRRFAETQKATLTDVELEVVPGV
FT                   ITGQKAIPVDAAGCYVPGGRYSHIASAIMTVTTAKVAGCKHIMACSPPRPGVGVAPAIV
FT                   YAAHICGADTIMAIGGVQGVASMAFGLFGLPKAKILVGPGNQFVAEAKRMLFGRVGIDM
FT                   IAGPTDSLILADRTADPHIVTTDLVSQAEHGYNSPVWLVTDDRALAEKVIEMIPSYIAD
FT                   LPEVNRDNAAAAWRDYAEVILCADREEMAATSDRYAPEHLTVMAEDLDWWLDRLSCYGS
FT                   LFLGEESTVSYGDKAAGTNHVLPTSGAASYTGGLSVHKYMKIVTWQRGTREGYKPVAEA
FT                   TARIARLEGMEGHARAADVRLAKYFPDETFDLTANG"
FT   gene            614291..615052
FT                   /gene="hpsO"
FT                   /locus_tag="SPO0595"
FT   CDS_pept        614291..615052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsO"
FT                   /locus_tag="SPO0595"
FT                   /product="R or S-dihydroxypropanesulfonate-2-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="identified by similarity to SP:P50199; PMID:
FT                   20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93910"
FT                   /db_xref="GOA:Q5LVV0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV0"
FT                   /protein_id="AAV93910.1"
FT                   /translation="MADSGYLFSVRGRVACVTGASSGLGRRAATVLAQAGAQVVGVARR
FT                   ADALAEWQAEAGGETHAIPYDLSDRDGLEGLARQVVDPFGAPDILVHAAGINTRQPADE
FT                   VTPEGWDITLTLNLSVPFFLSQYLVPGMKARGWGRIVNFASLQTTRAFPGGIAYGASKG
FT                   GVAQMTRAMAEAWSPHGITANALGPGFFRTELTAPVFADPERAARNAAQTCIGRNGEPE
FT                   DLDGPLLFLCSQASAYVTGQVLMVDGGYTAK"
FT   gene            615049..616047
FT                   /gene="hpsP"
FT                   /locus_tag="SPO0596"
FT   CDS_pept        615049..616047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsP"
FT                   /locus_tag="SPO0596"
FT                   /product="S or R-dihydroxypropanesulfonate-2-dehydrogenase"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93911"
FT                   /db_xref="GOA:Q5LVU9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU9"
FT                   /protein_id="AAV93911.1"
FT                   /translation="MKALVYTGPETLALREMPNPVAGPGEQLIRIARVGICGSDMHAYL
FT                   GHDARRPAPLILGHEVAGVIVGGPRDGERVTVNPLVTCGACPACREGRDNLCPTRQIIS
FT                   MPPREGGFAEYVAMPEGNLVTVPDSVPLAQAALAEPLACGWHTVRLSLAALSGARDTAL
FT                   VLGGGAIGLGAALCLTAQGVPQVTVVEPNPARRAYLSDRCGQHALDTPPAGSQYDLVID
FT                   GVGYAATRATASAHVRPGGVIGHIGLGEDTGGLDIRRMTLQEITFIGTYTYTSEDFRQT
FT                   AQAIFDGRLGPLDWTEARPLDQGAAAFADIRAGRVAAPKVLLVPDTAPERS"
FT   gene            616051..616455
FT                   /gene="hpsQ"
FT                   /locus_tag="SPO0597"
FT   CDS_pept        616051..616455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsQ"
FT                   /locus_tag="SPO0597"
FT                   /product="UspA stress protein"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93912"
FT                   /db_xref="GOA:Q5LVU8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU8"
FT                   /protein_id="AAV93912.1"
FT                   /translation="MYHRILVALSLEHGISERALETARALAAEGASIRAVHVIEPPNPA
FT                   VRAYLDADLVAKARADAEARLRARVADAPGVEPVLLSGHSSRALTEYATDMGIDLIIVG
FT                   SHRPGLSDYFLGTTAARVVRHAPCTVMVLR"
FT   gene            616496..617611
FT                   /gene="slcD"
FT                   /locus_tag="SPO0598"
FT   CDS_pept        616496..617611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slcD"
FT                   /locus_tag="SPO0598"
FT                   /product="Membrane-bound sulfolactate dehydrogenase"
FT                   /note="PMID: 19581363"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93913"
FT                   /db_xref="GOA:Q5LVU7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU7"
FT                   /protein_id="AAV93913.1"
FT                   /translation="MLRQTGIHSSEDARRLARKRLPWMVFDYVDGAAGEEHGAMLARRA
FT                   IQDIRLTPRVLRNVSRRELRVQLFDKLAVRPFGISPMGMCNLSAPDADLMLARLAARDR
FT                   VPHGVSTVASTDMETLLKASGGMAWFQLYFSGDGSGTMKLVERARAAGYGTLVLTVDVP
FT                   EVGRRPRELRHGFKMPFRIGPRQFVDFALHPRWSLSTLIRGRPQMANFDGRNYVFDRTE
FT                   SRAAADWTTFETLRATWPGKLVVKGVLHPGDALRLKALGADAIQVSSHGCRQLDAAPPA
FT                   IEALAAIRQAVGPSYPLFYDSGIRSGEDVVKAYAMGADFVFLGRPLLYAMAAGGEAGLH
FT                   QLWEVLAQEVSLTLAQLGLTEMAALREGAAR"
FT   gene            complement(617618..618466)
FT                   /gene="speB-1"
FT                   /locus_tag="SPO0599"
FT   CDS_pept        complement(617618..618466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB-1"
FT                   /locus_tag="SPO0599"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93914"
FT                   /db_xref="GOA:Q5LVU6"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU6"
FT                   /protein_id="AAV93914.1"
FT                   /translation="MSIFLDSELTTAERGEDARFRIIPVPLERTVSYGSGTAGGPAAII
FT                   EASNELERITNGAEPCAQGIYTEPPLDCDGPLPEVMERLAQRTEAAIRAGRVPVMLGGE
FT                   HSLSFGAVMGVARALGQPLGLVQIDAHADLRIAYQGEKHSHASVMHLLAEEGIRLAQFG
FT                   VRALCQQEMDERARHGVFYKDAEELVTTNIHAIDLPEDFPQLVYVSFDVDGLDPAQMPA
FT                   TGTPVPGGLGYYQALHLVEHALKGRKCVGLDVVELAPDGNAAWDFTAAQIVYRLMAACT
FT                   A"
FT   gene            complement(618463..619632)
FT                   /gene="nspC"
FT                   /locus_tag="SPO0600"
FT   CDS_pept        complement(618463..619632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="SPO0600"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93915"
FT                   /db_xref="GOA:Q5LVU5"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU5"
FT                   /protein_id="AAV93915.2"
FT                   /translation="MADVMQTQAGDAGAFRHFDLSRVPTPCFVVDEVAIERNLKILRDI
FT                   SDRSGAHVLSALKAFSMFTLAPLVRQYLGGTCASGIYEARLGREEYGGEVATFCAGYKE
FT                   QDIDEILSLSNHIIFNSPAQKDRFLSRAQAAGVQVGLRINPEHSEGEIAKYDPCAPCSR
FT                   LGTPVSLLTPETLKGVDGLHMHTLCEQGFEPLLRTWAAVEPKLAPYLPGLKWLNFGGGH
FT                   HITRADYDRDALIDFLKSLRARHGLDVYLEPGEAVALDAGILVGEILDLPSNGMDLAIT
FT                   DISATCHMPDVIEAPYRPALMDEADSGHTYRLGGPSCLAGDVIGDYTWDQPLTIGQRFA
FT                   FLDQAHYSMVKTNTFNGVPLPTIALWNSKTDALRIVRQFDYSDFKDRLS"
FT   gene            complement(619737..620948)
FT                   /locus_tag="SPO0601"
FT   CDS_pept        complement(619737..620948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0601"
FT                   /product="saccharopine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93916"
FT                   /db_xref="GOA:Q5LVU4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU4"
FT                   /protein_id="AAV93916.1"
FT                   /translation="MGKTLVVGAGGVSHAAVHKMAMNSDIFTEITLASRTKAKCDAIAA
FT                   SVKERTGVTIQTAALDAMDVAATVALIKETGAEILVNLALPYQDLKLMDACLEAGCHYL
FT                   DTANYEPEDVAKFEYHWQWAYQDKFKEAGLTAILGSGFDPGVTSVFATWLKKHKLATIR
FT                   QIDVLDANGGSNDQAFATNFNPEINLREVLAEARHWENGAWQVTPAMTHKVEFDFPGIG
FT                   PKNMYLMYHEELESLSAHFPEIERARFWMTFGDAYIMHAKVLENVGMTRIDPVMHDGKE
FT                   IIPIQFLKTLLPDPGTLAEETKGKACIGDIATGQAKDGSGEKTYYIYNICDHEECFREV
FT                   GSQAVSYTTGVPAMIGAAQVLKGNWVEPGVWNMEQLDPDDFMDMLNNHGLPWQVHELDG
FT                   PVSF"
FT   gene            complement(620974..622959)
FT                   /gene="speA"
FT                   /locus_tag="SPO0602"
FT   CDS_pept        complement(620974..622959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="SPO0602"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="identified by similarity to SP:P21170"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93917"
FT                   /db_xref="GOA:Q5LVU3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU3"
FT                   /protein_id="AAV93917.1"
FT                   /translation="MSAPQVWPWTNQTPPLKGDPTPEPKPQERPTRLKHPLDAPHSVYG
FT                   VDKWGKGLIVVTEEGEIGLKNPLRPEADAVSLPGILHDLEQRGIRAPMILRISSYLENE
FT                   ICHINDSFADAIARSGYKGAYRGVFPIKVNQQAQVIDRIVEFGHRYSYGLEAGSKPELV
FT                   IALAHKLATDALIVCNGVKDAEFVRLAILSRKLGFNTVIVLESPKEADTVIAVYEELGI
FT                   EPLLGVRVKLTNQISGKWEESSGDRSSFGMNTDQLVRVVDKLRDAGLIHCLKLQHSHLG
FT                   SQVPDVNDVRRAVGEACRYFTELSAEGVPLTHLDLGGGMGVDYTGEKRATENSINYTVE
FT                   EYCANVVETVAYAMDEAGIDHPTIVTESGRAVVATSSLLVFNVLESTLYDAPTAPGTEP
FT                   DDHHLVSDLAAVNGYLTPARLQECWNDATFYRNELRALFRRGYVDLRQMARAERIYLSL
FT                   MARIKTMVAEVEAETDLDAQMEKIADIYHCNFSLFQSLPDVWAIDQLHPIVPLQMLNEA
FT                   PDRRAVLSDITCDSDGKVDRFILADGVSPSLPVHSLPEDQDYYLGVFFVGAYQETLGDL
FT                   HNLFGDTNVVTIDLRADGGFDLLHEQEGDTISEVLSYVEYDPADCVAAFRKLVDGAISN
FT                   GCLKASERKLIIGAYRDSINGYTYYE"
FT   gene            complement(623032..623346)
FT                   /locus_tag="SPO0603"
FT   CDS_pept        complement(623032..623346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AH0077"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93918"
FT                   /db_xref="GOA:Q5LVU2"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU2"
FT                   /protein_id="AAV93918.1"
FT                   /translation="MSTQKIWDLHLTYDGPLSQEFLTGTRQLAESIAQEPGIVWKIWTV
FT                   EDGTNHFGSTYLFRTLDHLETYKKMHLKRLADFGIRVVSDHVFDIMEELSAIDNAPLQG
FT                   "
FT   gene            complement(623375..623752)
FT                   /locus_tag="SPO0604"
FT   CDS_pept        complement(623375..623752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC62948.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93919"
FT                   /db_xref="GOA:Q5LVU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU1"
FT                   /protein_id="AAV93919.1"
FT                   /translation="MTNKTFLTAHGVIYMFFALALFFAPALLWPNYGLQLNDRYAVFLS
FT                   QHNSIFLGGIGVTSFLFRHVAQGSEAARTFLTGLIWTNALGVVITLYACLTGIFSGFGW
FT                   SDPIFFALLAVLSFMQLGKNR"
FT   gene            complement(623755..624207)
FT                   /locus_tag="SPO0605"
FT   CDS_pept        complement(623755..624207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0605"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93920"
FT                   /db_xref="GOA:Q5LVU0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU0"
FT                   /protein_id="AAV93920.1"
FT                   /translation="MKHKTQDRENQALVLALLRSQQLFMRAMGPVFRAHGLTAPQWDAL
FT                   ETLANKGPVSMNDLMRFTLSTSGNLDVVIKNLIQAGLIEKSVDPEDKRGRILQLSPEGR
FT                   RKVDDFIPIHNQALDQLFSGLGTAGKRQTITALNQLRKTLTQAPRG"
FT   gene            624480..626168
FT                   /locus_tag="SPO0606"
FT   CDS_pept        624480..626168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0606"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:C95874"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93921"
FT                   /db_xref="GOA:Q5LVT9"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT9"
FT                   /protein_id="AAV93921.1"
FT                   /translation="MAQCIVAAAASGPVLVCDEGLSFWGGVDPETGRVIDAHHPQHGAA
FT                   LAGAVVMMPTSRGSCSGSGVLLALALNGHAPAALVFREGEDVLTLGALVAAWMYDRPVA
FT                   VLRLSAAEYAALAMEPSAEVTPERLTAGALSLTLEPLSGETLDLSDADRAMLSEEAAPP
FT                   VRLAMRIICAMAAAQGAERLTDVSRAHIDGCIYHSEANLRFAEDMAAMGGRVCIPTTMN
FT                   AISVDHANWRAQGVPPAFGGPASRLADAYLRMGARPSFTCAPYLLDDIPQAGEAIAWAE
FT                   SNAVVYANSVLAARSVKHPDYLDLCMALTGRAPLAGVYLDANRKAQVEIRVERPEGADD
FT                   AFWPLLGYLAGRLAPDRIPLLTGLEGSAPSGDDLKALCAAFGTTSAAAMLHVAGVTPEA
FT                   DGALTDGAAHMAIAPGDFARAWDQFNPGPQRVELVAIGSPHASAHECRVLTDLLDGHRI
FT                   ADGTATIVTIGRGERDKLAGDGVLARLQALGVQVIPDLCWCSVTEPVLPPATRTIMTNS
FT                   GKYAHYGPGLSGRAMRFGSLAHCAEAALTGYAPGRPGWINGQDRV"
FT   gene            626168..627193
FT                   /locus_tag="SPO0607"
FT   CDS_pept        626168..627193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0607"
FT                   /product="proline racemase, putative"
FT                   /note="identified by similarity to GB:CAB71312.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93922"
FT                   /db_xref="GOA:Q5LVT8"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT8"
FT                   /protein_id="AAV93922.1"
FT                   /translation="MRSSKTIHVISAHAEGEVGDVIVGGVAPPPGETLWEQRNWIARDG
FT                   RLRNFMLNEPRGGVFRHVNLLVPPKDPRADAAFIIMEPEDTPPMSGSNSICVATVLLDS
FT                   GLVEMVEPVTELVLEAPGGLVHVRAECRDGKAERIFVRNLPSFAAQLDVSLDVPGLGRV
FT                   RVDTAFGGDSFVVVRPQDVGVEITRDRARDLAEMGIAITNAANAQLGFHHPENPDWRHI
FT                   SFCLFAGGIERRDGILRAASAVAIQPGKIDRSPTGTAVSARMAILHVRGDMAQGEQFIA
FT                   TSIIGSEFSGRIAGLTSVGERPAILPEISGRGWITGMHQHMLDPADPWPDGYRLRDTWG
FT                   V"
FT   gene            627307..629085
FT                   /locus_tag="SPO0608"
FT   CDS_pept        627307..629085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0608"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transporter operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93923"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT7"
FT                   /protein_id="AAV93923.1"
FT                   /translation="MPQSISGIADNREEKMRRYLLSAAAVCAVVAGQAAYADEAAAKKW
FT                   IDEEFQPSVLSKDEQMAEMQWFIKAAEPYAGMEINVLSEGIPTHSYESEVLTKAFEEIT
FT                   GIKVNHQILGEGEVVQAVQTQMQTKRNLYDAYVNDSDLIGTHSRLQLAYNLTDMMAGDF
FT                   KDVTNPGLDLGDFMGTQFTTGPDGDLYQLPDQQFANLYWFRKDWFDREDLKAAFKAKYG
FT                   YELGVPVNWSAYEDIAEFFSEDVKEIDGTAIYGHMDYGKRAPDLGWRMTDAWLSMAGAG
FT                   SKGEPNGIPIDEWGIRMEAGSCNPAGASVTRGGAANGPAAVYAIRKWDEWLRKYAPPGA
FT                   ASYDFYQSLPALAQGNVAQQIFWYTAFTADMVKPQSEGNNTVDGDGNPLWRMAPSPHGP
FT                   YWEDGQKVGYQDVGSWTILNSTPLDRAQAAWLYAQFVVSKTVDVKKSHVGLTFIRDSSV
FT                   NHESFSERAAKLGGLVEFYRSPDRVRWSPTGINVPDYPKLAQIWWQQIGDVNSGAFTPQ
FT                   EAMDRLAFEMDTVMARMQAADEAANVYGGCGPRLNEEKDAEWWFANGGAKPKLDNEKPQ
FT                   GETVNYDELVARWAKN"
FT   gene            629200..630264
FT                   /locus_tag="SPO0609"
FT   CDS_pept        629200..630264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0609"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93924"
FT                   /db_xref="GOA:Q5LVT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT6"
FT                   /protein_id="AAV93924.1"
FT                   /translation="MALELRNVTKRVGADLHIKETSLVLETGHFNVLLGATGAGKTSLI
FT                   KMMAGLDPVASGQILMDGQDVTGQSTQKRNISLVHQFFINYPHMTVFDNIASPLKVAGL
FT                   AKSEIQGRVEHAADILKLRPMLHRRPHELSGGQQQRTALARAIAKESRAVFLDEPLANL
FT                   DYKLREELRDQLPDLFAGRGAVVVYATSEPEEALLLGGHTALMEDGRVTQFGRTAEIYR
FT                   DPSNVLAAQVFSDPPINTAQIAKQGDTARMGPDVSWTLSGAAAGLADGPYVIAIRPHHV
FT                   SPVASSEATVTLSGRVQVTELSGSESSAHFDMGSGSWVSLAPGVHPYRVGEMHDFHMDP
FT                   SAAYVFAPDGSRVA"
FT   gene            630272..631357
FT                   /locus_tag="SPO0610"
FT   CDS_pept        630272..631357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0610"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93925"
FT                   /db_xref="GOA:Q5LVT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT5"
FT                   /protein_id="AAV93925.1"
FT                   /translation="MAKITLSKLRHSYYPNPKTPDDYALKEIDLDWTDGGAYALLGPSG
FT                   CGKSTLLNIISGLLVPSEGRILFDGQDVTELPPDKRNIAQVFQFPVIYDTMTVYDNLAF
FT                   PLRNRGRDEATVRERVTAIAEMLELSDLLNRKAAHLSPDNKQKISMGRGLVRQDVNVVM
FT                   FDEPLTVIDPHLKWKLRSKLKELHQRVRATMIYVTHDQTEALTFADQVVVMQEGEVVQI
FT                   GTPVELFDRPAHTFVGHFIGSPGMNILPAEVSGGVAHFAGQAIPLEGPITAAPGARTEI
FT                   GIRPEFVSLGLSGLPATVTKVSDVGRHTVVECEVAGSRVNAIVTGSGPEKGAMVQLEFR
FT                   RDQTRLYADGWLASEAAEGAA"
FT   gene            631354..632217
FT                   /locus_tag="SPO0611"
FT   CDS_pept        631354..632217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0611"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon.; identified by similarity to PIR:T46751"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93926"
FT                   /db_xref="GOA:Q5LVT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT4"
FT                   /protein_id="AAV93926.1"
FT                   /translation="MKTEYQKAWFFVLPVLVLVAFNALIPMMTVVNYSVQETFGDNLFF
FT                   WQGLGWFEQILRSDRFHAALGRQFLFTFLILIIEVPLGIAIALSMPRKGFWVPVCLVLM
FT                   ALPMLIPWNVVGAMWNIFTLPDIGLLGYFLNHVMGINYDMTQDPLAAWITIVTMDVWHW
FT                   TSLVVLLSYAGLVSIPDAYYQAAKIDGASNWAVFRYIQLPKMKTVLTIAILLRFMDSFN
FT                   IYTEPFVMTGGGPGNSTTLLSIDLVKIALGQFDLGPAAAMSLIYFAITLLVSWLFYTLM
FT                   TKDDQN"
FT   gene            632229..633026
FT                   /locus_tag="SPO0612"
FT   CDS_pept        632229..633026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0612"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93927"
FT                   /db_xref="GOA:Q5LVT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT3"
FT                   /protein_id="AAV93927.1"
FT                   /translation="MQKRTLVPIVYILFLMLPIYWLVAMSFKTTNEILAGFSLFPQTFT
FT                   LENYRVIFTDPTWYWGYINSILYVTLNTVISVAVSLPAAYAFSRYRFLGDKQLFFWLLT
FT                   NRMAPAAVFALPFFQLYSAVGLFDTHLAVALAHCLFNIPLAVWILEGFMRGIPKELDET
FT                   AFVDGYSFPRFFATIFVPSIKAGVGVAAFFCFMFSWVEMLLAKTLTAVEAKPIAATMTK
FT                   TASSAGYELGLLAAAGTLTIIPGAIVIWFVRNYIAKGFAMGRV"
FT   gene            633026..633304
FT                   /locus_tag="SPO0613"
FT   CDS_pept        633026..633304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48242.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93928"
FT                   /db_xref="GOA:Q5LVT2"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT2"
FT                   /protein_id="AAV93928.1"
FT                   /translation="MLSWMAWTWPTALLFIGIFSAIGVLVVLEIRHPGGDARKGVLGLT
FT                   TTRGDRLFISLLGSSYIFLAWLGLVGLPLWVPLGLALAWGSFCFWKV"
FT   gene            633392..633787
FT                   /locus_tag="SPO0614"
FT   CDS_pept        633392..633787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0614"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by similarity to SP:P06555"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93929"
FT                   /db_xref="GOA:Q5LVT1"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT1"
FT                   /protein_id="AAV93929.1"
FT                   /translation="MARKQERSLLTEVELEFMTVVWEIGSGTVRDILAELNKAQTRAYT
FT                   SVATVLKIMEQKGFLTSERHDRSLVYRSAVPKEDYQRTTLKDLSSKLFDGAPAALVARL
FT                   VDDEEVTDDMLESMRALLNERLGDNGR"
FT   gene            633777..634910
FT                   /locus_tag="SPO0615"
FT   CDS_pept        633777..634910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD73596.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97129"
FT                   /db_xref="GOA:Q5LVT0"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT0"
FT                   /protein_id="AAV97129.1"
FT                   /translation="MDGEVLLNAYLDLNLLLVAGVAIWSLLRWAVAKTRLGTAYMPQLR
FT                   LLNGLTVLLVASPLLAMAITTWIVAHPPNIPDLLVRQYLHGNVGLSASQFEALLGLRED
FT                   MVRALLAQHEVWAQVVAAAFLAGALFCTLHMGLSVLRLSNSLRGAHLWKRIGRVHLLVS
FT                   DTARVAYSTRGLRNRYVVLPSALLEAPQDLRMTVAHELQHFRQSDIECEFLLELLRPLL
FT                   FWNPAFFLWRRQVRMLREYACDQALMARPHFDMRAYCECLFRACRVAAQNRVLFARTTP
FT                   TVALVDRRETRRPSTLHSRIEALTATRQDTAGPTAWLLISGLLVASVLSTMLVMQRSSD
FT                   WSHDRIMLSTIVNLERMAQRNATVASPFQGGFVVATD"
FT   gene            634996..635988
FT                   /locus_tag="SPO0616"
FT   CDS_pept        634996..635988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0616"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93930"
FT                   /db_xref="GOA:Q5LVS9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS9"
FT                   /protein_id="AAV93930.1"
FT                   /translation="MKAVLYRAFGAARDVLTLEEFPAPRPGPGEVLVDLAFSGVNPSDV
FT                   KARAGARAGVTELPYPAIVPHSDGSGVIRAVGEGVDVARVGERVWLWNGQWGRAMGTCA
FT                   EQIALPAEQAVPLPQDVSLETGAVLGIPGLTAAHVVFSGGPVSGKTLLVQGGAGTVGFL
FT                   AVQLAKWGGARVIATASAGAAERVRAAGADAVLDYAAPDLAAAVLAANDGAPVDRIVEV
FT                   EFGANAEVDAAVIAPNGRINAYGSARQMAPVLPFYPLMFKSVTLEMTLVYLLDTANRQA
FT                   AIGHLHSALSAGALSCPVQEIYALDAAAAAHEAVERGARSGAILVRTSG"
FT   gene            636093..636167
FT                   /locus_tag="SPO_tRNA-Gln-2"
FT   tRNA            636093..636167
FT                   /locus_tag="SPO_tRNA-Gln-2"
FT                   /product="tRNA-Gln"
FT   gene            complement(636307..637353)
FT                   /locus_tag="SPO0618"
FT   CDS_pept        complement(636307..637353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0618"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93931"
FT                   /db_xref="GOA:Q5LVS8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016981"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS8"
FT                   /protein_id="AAV93931.1"
FT                   /translation="MEDLVVGIDLLLRGGAVTALAVCALIFLANRALWPRGLSVPALCL
FT                   GLGAYLLVSSPNLGLSGTWAETGLVMLAGAVPVLAVWAGAEIFLDRPVYRPWHGMLAVL
FT                   VTAGAWLAPILPFAATLRGILVVLLYAGLLYIALSTAAVDLVESRRRFRRWFVALMALT
FT                   GLGISVVEFLKLDADLPPVMYPLHASGFLVLTLLFLSWAVRIAPDLWPLRREPEPEPAR
FT                   PLSGADAAVLQRVEAAMADGIWRQEGLTIAQLAAAVDAPEHRVRRAINKGLGYRNFAQF
FT                   VNEHRIEAACEILSDPARADTPVLSIAYDVGFASLGPFNRAFREKHRQSPTQYRNRHCQ
FT                   VVGGYVLD"
FT   gene            637521..638717
FT                   /locus_tag="SPO0619"
FT   CDS_pept        637521..638717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0619"
FT                   /product="sterol desaturase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93932"
FT                   /db_xref="GOA:Q5LVS7"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS7"
FT                   /protein_id="AAV93932.1"
FT                   /translation="MEDQCIISHLAGIFSGVLATDFLRYAVGAGGVYLTVNLALAARLR
FT                   ARKIRAYEPPKGQIGREILASLRTVLIFALNGTLIVVGAEAGLVPIYREIATHGWAYLF
FT                   FSTTVLIVAHDTWFYWSHRLLHYPPIFRRFHRLHHKSHNPTPFTSYSFDLGEAVVNAIY
FT                   LPLILLVLPAHPVAILVFVTHMMLRNAIGHSGYEIFPANRRGKPLFDWITTVTHHDLHH
FT                   AHAGYNLGLYFTWWDRLMGTEHPDYHEAFQKVAKPASWPSVRAVILAFAIFTGIAVSDA
FT                   RAERLSGAYASPGFGVIVRFEPCNANPGLTCGRMIWAWDAAEVPHAQSGDVIVIDLHGD
FT                   GNVWSGRLKNPENGRMYRGSVVQRSPDTIVLRGCAGPFCTSQIWHSVRALRRALESAE"
FT   gene            638751..639377
FT                   /locus_tag="SPO0620"
FT   CDS_pept        638751..639377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91031.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93933"
FT                   /db_xref="GOA:Q5LVS6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS6"
FT                   /protein_id="AAV93933.1"
FT                   /translation="MSKPEFIARQGRKPTGWLGHIVARVMARETRPENDRALSFLDLAD
FT                   GDSLIDIGCGHGETLFQADRIVRLSGSVGVDFSEVMLKRARARNRDAVWDTRMAFHCAD
FT                   TAALPFPDKRFGKALSVHTIYFWPNPAAHLAEAFRVLRRGGRFLFCYRSTADRRAVEEF
FT                   PDTVYRFPSVQEVEEKLKLVGFLGPETTTEDIKGRLTHWSIAEKP"
FT   gene            639826..641367
FT                   /locus_tag="SPO0621"
FT   CDS_pept        639826..641367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0621"
FT                   /product="ankrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93934"
FT                   /db_xref="GOA:Q5LVS5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS5"
FT                   /protein_id="AAV93934.1"
FT                   /translation="MTKSLDQLRRDAKALGKAVADGDKGARLRVQGILTDPKQGSYKHA
FT                   DFLHVIARETGFATWPALKLAVETEGMDRAQKQGRLRWALYNGSPMTVNHLLREDPSLP
FT                   EGQVPLLVALYDVEGMREILARDPDAATRDYPPRRPMCHLAFSKHIKSQPEKQADMLAM
FT                   ADLLLAHGANVNDSFPSAPDTDHRLSALYGAIGHADNPALARWLLEHGADPNDNESLYH
FT                   STECGHVESLRLLLTHGANPMGTNALPRAIDFDNTEMVRLLLEHGANPNEGSSPHPSGE
FT                   PTLVIPALHQAARRLASAEIAQLLLQHGADPSARNRGHTPYAFARVFGNTAVAEVLEQA
FT                   GARTDLTVPEEILVRAADGTNSTHDRIDMQQIPEEMKYLLCRLVWREGTLAHMQRLVAM
FT                   GFDPNSPDEMGMPPLHLAGWEGMTEVMAYFLEQSPDLDHINEYGGTLLSTIVHGSENCP
FT                   QRHRRDHIECARMALERGVELPQKAATYATVPEMSAFLADWAESHPSQVVVHGVV"
FT   gene            complement(641832..642890)
FT                   /locus_tag="SPO0622"
FT   CDS_pept        complement(641832..642890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0622"
FT                   /product="ISSpo1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93935"
FT                   /db_xref="GOA:Q5LVS4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS4"
FT                   /protein_id="AAV93935.1"
FT                   /translation="MKSKSPEEIAVIGVDIGKETFHLVGFDHAGERVLRKNIKRLAIKP
FT                   TFEKLPRCVVGMEACISAHFVSRMLRELGFEPRIIPAIYVKPFNKGQKNDYNDAEAIAE
FT                   AAMRPNPRTVTEKSQDQLDLQAMHRVRSRLVARRTATINQIRAFLIEQGITVRAGRHRL
FT                   QSSFAAILENRRDEISSRMRAILMGLYGDWLWVDERIKAISSEIEEISRSEENSANIMT
FT                   IPGIGPLISTAIVSAIGKGEVFDRGRDFAAWVGLVPRQFSTGGRTILGRISKRGNSYLR
FT                   MLLVQAANVILMRPHRWDALGLGPWLRGVVGRMPHNKAAVALANKLARTAWSVLRYGSK
FT                   YQVERDEALAAI"
FT   gene            complement(642985..643533)
FT                   /locus_tag="SPO0623"
FT   CDS_pept        complement(642985..643533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0623"
FT                   /product="cytochrome c oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97112"
FT                   /db_xref="GOA:Q5LVS3"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS3"
FT                   /protein_id="AAV97112.1"
FT                   /translation="MVQSIFFLFCLILAPLVAHLRQWSPTALFAVATLVYAAFGGANFV
FT                   STQIVLSNIRETEPAYRDTYYVVNRGYVSLNLGLAMAVFAVLTWLQTRFGAMLYPKITK
FT                   ALFWLLHLGLIGGSAFSTMLVFLLPKPRRFIDYPEFMETFILVGSWATLISSIAVLGLL
FT                   GLLVWSSALTWLASRNSGH"
FT   gene            complement(643540..644166)
FT                   /locus_tag="SPO0624"
FT   CDS_pept        complement(643540..644166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B75629"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93936"
FT                   /db_xref="GOA:Q5LVS2"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS2"
FT                   /protein_id="AAV93936.1"
FT                   /translation="MRKYGRPYHLPTSPGVMSDDKILRDLSVLTAATEVVFTEKMDGEN
FT                   TTIYQGGCHARSPDSGYHASRDWMKAFAAVISPSLAENERIVGEYLFARHSVAYDNLNS
FT                   YFLGFAWIVDGTVKTWDSTVERFNILGIQPVSVLHRGSFSDAAVNAVLADLDLSKQEGF
FT                   VVRTTSEFSETNMGTCMAKYVRADHVQSETHWMNAEITRNGLKKA"
FT   gene            complement(644589..645930)
FT                   /pseudo
FT                   /locus_tag="SPO0625"
FT                   /note="'IS91 family transposase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error'"
FT   gene            complement(645849..646861)
FT                   /pseudo
FT                   /locus_tag="SPO0626"
FT                   /note="'This gene is disrupted by an IS element.;
FT                   site-specific recombinase, phage integrase family,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts which are not the result of
FT                   sequencing error'"
FT   gene            complement(647662..648392)
FT                   /pseudo
FT                   /locus_tag="SPO0627"
FT                   /note="'site-specific recombinase, phage integrase family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error'"
FT   gene            complement(648528..649043)
FT                   /locus_tag="SPO0628"
FT   CDS_pept        complement(648528..649043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0628"
FT                   /product="transposase, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93937"
FT                   /db_xref="GOA:Q5LVS1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS1"
FT                   /protein_id="AAV93937.1"
FT                   /translation="MLWVSDFTYVATWKGFVYVAFVIDAHARKIVGWRVSTSAQTGFVL
FT                   DALEQAVHDRKPTKAMGLVHHNDRGSQYLSIRYTERLADAGIEPSVGSVGDCYDNALAE
FT                   TSMASSRLRLSIAAALGAASRQWNTRLWNGSAGSTTAAFPSPSGTSRQPKLRQTSTRLG
FT                   KLKTWPRN"
FT   gene            649155..649751
FT                   /locus_tag="SPO0628a"
FT   CDS_pept        649155..649751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0628a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG013;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0628a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86011"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYD9"
FT                   /protein_id="AHB86011.1"
FT                   /translation="MTNESHIILRLRAEAEKKRTAALDRAEKAQREAERFSVEVEAYDK
FT                   AIKAMERAGIADALKDVDFDLDVTPKVGASDKWVSIYKALHATADAPYSYEDIGAAVEL
FT                   AGHEASAGGQRTQMMNAVKAGWFDRVGHGKFEFTDSGLALIGANQKENEPPLGGSEAGE
FT                   GDTSPKFAGGYEFGDPPGKHPDPSGQTRHWKTPGT"
FT   gene            complement(650051..650944)
FT                   /locus_tag="SPO0629"
FT   CDS_pept        complement(650051..650944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0629"
FT                   /product="ISSpo3, transposase"
FT                   /note="identified by similarity to GB:AAN56319.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93938"
FT                   /db_xref="GOA:Q5LVS0"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS0"
FT                   /protein_id="AAV93938.1"
FT                   /translation="MEKNKSSSPDFSVRDFFKRFPDDEACLEHIFNVRFGARHVCRACG
FT                   VESTFHRMSDRRAFACAACGDHVYPTAGTIFQDTRTPLQVWFYAIYLFVTTRHGVSGKE
FT                   LQRQLGVTYKTAWRIGHKIREQMDKHDLKAMLQGHVEIDEAYIGGKRPGKRGRGAAGKT
FT                   IVMGFKQRGGRLVTEIVPDVKLKTLRAETLKTVDAGATVSTDELYSYSLLKGEGYTHVA
FT                   VKHGAKQWTIYDAETDTMHHTNHVESFWRHFKHSIRGTHVSISQRHMRKYLDEFTFRAN
FT                   HRGEVNLMFDRLVAAF"
FT   gene            complement(651391..651752)
FT                   /pseudo
FT                   /locus_tag="SPO0630"
FT                   /note="'IS3 family transposase orfA, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to SP:Q51647'"
FT   gene            complement(652364..652888)
FT                   /locus_tag="SPO0631"
FT   CDS_pept        complement(652364..652888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93939"
FT                   /db_xref="GOA:Q5LVR9"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR9"
FT                   /protein_id="AAV93939.1"
FT                   /translation="MTSFNSFMRPLAAAILSALVTLAPVAPQAQEAVRGAVTNLPIPRF
FT                   VSMKANEGNVRRGPSLTHRIDWVFKRRDMPLQITAEHGHWRKVQDRDGAGGWVHYALLS
FT                   GVRTVLVEKDMMPLYARPDPASQVAAHFEMGVVARLGTCTQDWCRISAGGYRGWAPKEN
FT                   LWGVGTDEIRE"
FT   gene            653026..654012
FT                   /locus_tag="SPO0632"
FT   CDS_pept        653026..654012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0632"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93940"
FT                   /db_xref="GOA:Q5LVR8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR8"
FT                   /protein_id="AAV93940.1"
FT                   /translation="MPRERLSVVVTRRLPEVVETRLSELFNVRLRDDDTPMSRDELAAA
FT                   LREADVLVPTLNDRIDAGLLAQAGERMRLIANYGAGVDHIDVATARQRGILVSNTPGVL
FT                   TDDTADMTMALILAVTRRIPEGLAVMQKNEWTGWAPTALLGGRVGGRRLGILGMGRIGQ
FT                   AVARRASAFGMQIHYHNRRRLRPEVEDALEATWWDSLDQMIARMDVISVNCPSTPSTFH
FT                   LMNARRLKLMKPTGVIVNTSRGEVIDENALTRMIRTGEIAGAGLDVYEHGTQVNPRLRE
FT                   LPNVVLLPHMGSATLEGRIEMGEKVIINIKTFADGHRPPDQVVPAML"
FT   gene            654248..656041
FT                   /gene="ggt"
FT                   /locus_tag="SPO0633"
FT   CDS_pept        654248..656041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="SPO0633"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by similarity to SP:P54422"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93941"
FT                   /db_xref="GOA:Q5LVR7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR7"
FT                   /protein_id="AAV93941.1"
FT                   /translation="MRIRWQESLCLLWVGAATPLFAQQAADAVAPEGAATGQVRPFSAV
FT                   VEAGQAAKEAGQPVEAENWMVAAANPLAVMAGGNVLRQGGTAADAMVAVQTVLGLVEPQ
FT                   SSGLGGGAFLVWYDGNTGQMTTLDARETAPREATPRLFQDADGQPLKFFDAVVGGLSVG
FT                   TPGTPALLEEAHRRWGQANWGSLFGDAIWLAENGFTVSPRLAGLVEGDAEKLGRFPETA
FT                   AYFLPGGAAIKAGDTLKNPAYAATLRALAAEGSAAFYGGPIAADIVRTVRNAEGNPGVL
FT                   SGADLALYQVIEREPVCASYRAFEVCGMGPPSSGALTLGQILGLLEPYDLAALGAENPE
FT                   SWRLIGDASRLAFADRGRYMADSDFVPMPTKGLVDPDYLKTRSELLAGPNALESVAPGN
FT                   PEFDHASNWADDISLELPSTSHISIVDRYGNVLSMTTTIENGFGSRLMTNGFLLNNELT
FT                   DFSFKTHDNGVPIANRLEPGKRPRSSMAPTIVMQDGKPVLAIGSPGGSRIIGYVAQSII
FT                   AWADWSMNVQQALNAPHLVNRFGTYDLEEGTDAAGMEEALTGLGYKVSVRALTSGLHAI
FT                   EIGDTLKGAADTRREGIALGE"
FT   gene            656145..657542
FT                   /locus_tag="SPO0634"
FT   CDS_pept        656145..657542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0634"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93942"
FT                   /db_xref="GOA:Q5LVR6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR6"
FT                   /protein_id="AAV93942.1"
FT                   /translation="MAQITALPRNETGIETVIGILRQRFGDRLQTGQAIREQHGHTTTW
FT                   IQNQPPDAVVFPTSTAEVSEIVKTCAEHKVAVIPFGTGTSLEGHVNAPAGGISVDLMQM
FT                   NNILAVHAGDLDCVVQPGVTREQLNTHLRDQGLFFPIDPGANASLGGMASTRASGTNAV
FT                   RYGTMKDNVLALEVVMPDGEVIRTAQRAKKTSAGYDLTRLMIGAEGTLGIITEITLKLQ
FT                   GIPEAISAARCSFPTVDAACQAVMTTIQFGIPVARMELLDVIAVQAVNAYSKLDLPETP
FT                   LLLLEFHGSEAGVAEQAELFGSIAEENEGSGFAWTTSTEERNRLWKARHEFYWASLQLR
FT                   PGCSALATDVCVPISRLAECVNAATAKAEELGLFAPLVGHVGDGNFHISPLIDKDDPAE
FT                   VATTEAFTAWLAELAISMDGTCTGEHGIGQGKRAYLSRELGQTPRYMAAIKAALDPLGI
FT                   MNPGKIL"
FT   gene            657753..660260
FT                   /locus_tag="SPO0635"
FT   CDS_pept        657753..660260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0635"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93943"
FT                   /db_xref="GOA:Q5LVR5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR5"
FT                   /protein_id="AAV93943.1"
FT                   /translation="MKTQVKALVVGGGAVGTSIAYHLAKAGWNDVMLIERDELTSGSTW
FT                   HAAGLLPLFNMSYATTHIHQYSVDFYKTLEEETGLNAGFAVVGNLRMAQTQDRMDEYML
FT                   YASTAETCGVKYEWLTPDQIKERWPLIETSDLKGAIYHTEDGYINPADVTQAMAKGARQ
FT                   RGVDIVRKMQADAFHWNGTHWEVTCTKMVEKGGNLVPSDEQVVITAEHVVTASGNHAQR
FT                   TAKLLGIKMPAIPVEHTFIVMDQDPELVKWREAGNPEHPVVRDADNESYAREERGGWIL
FT                   GIYEHGAPARFEYGVPDSFRADLFPLDLDRIADQYMAMAERVPSCAESGLKDDFNGPIC
FT                   YTPDGNPLVGPAPGLRNMWLAEGFSFGITAAGGTGYYLAQMMVDGEAEIDMASLDPKRY
FT                   SSNWMTTEFAARKNEECYSHVYILHHPDEEREACRPLRTAPAYDRQKALGAQFGFVNGW
FT                   ERPNYYGPLDAPENFDHDARSFRRGGWWQYAVEEAKAIRNGVGLIDATAFTKHVVKGPG
FT                   ATQFLDWFTCNKLPKVGRINLTYALTSAGTTRTEYTIVRNGENNYYIVSAGAWTEYDAD
FT                   FLRKAAEDKMEEFGYIEIQDVTTQWGVFAIAGPKSRDVLKEVIKDADPETALSNKRFPW
FT                   LSARQIELGMCPVNAIRVAYTGELGWELHHPIEMQRYLWDLLLAAGEKHGMKLVGARAQ
FT                   NWLRQEKSYRAFGTELGRDATPLEADLPRFVDLGKDFHGKAEMEAKGIRSKCCTLLIDG
FT                   PSDADPWGREALYTPEGARVGRLTSGGYSVAFEKSIGMGYVKPELAVEGTKLKVKMLDQ
FT                   LWDAVVTCDSPYDPKNETIRKDG"
FT   gene            complement(660313..660849)
FT                   /locus_tag="SPO0636"
FT   CDS_pept        complement(660313..660849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0636"
FT                   /product="EF hand domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93944"
FT                   /db_xref="GOA:Q5LVR4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR4"
FT                   /protein_id="AAV93944.1"
FT                   /translation="MMRIRRAGAPPAAKWPDGSGRIARLTCECRQTGVTLMRLLLLASA
FT                   CALGTAALAQGAPGAHFIENWDMDGDALISAAEIVEKRGEIFVMFDQNEDGALDTAEYD
FT                   LFDETRRADIEANAGGRKGPMALVDQAMDRAFNDADGDGLVSAEEFTAKSAAFFDMLDK
FT                   NGDGVISSADFKPGG"
FT   gene            complement(660903..661019)
FT                   /locus_tag="SPO0637"
FT   CDS_pept        complement(660903..661019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93945"
FT                   /db_xref="GOA:Q5LVR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR3"
FT                   /protein_id="AAV93945.1"
FT                   /translation="MIPEHMIGSALMKTAILLAAMALASILQQLALRGAAPL"
FT   gene            complement(661052..661669)
FT                   /locus_tag="SPO0638"
FT   CDS_pept        complement(661052..661669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAO90814.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93946"
FT                   /db_xref="GOA:Q5LVR2"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR2"
FT                   /protein_id="AAV93946.1"
FT                   /translation="MEQATRKARMLDKSQKPTWTSFEEATQADWDAVMEYEEAYNAALP
FT                   ERILDAIRSLDEAWTPYPINRFQHCLQAATRAHADGAEDEIVVAALVHDVGDILSPYNH
FT                   GELAAAMMKPYVSEKCHWILQHHCVFQGYYYNHYWGGDRNARDKYRDSPYWEDARYFCH
FT                   EYDQCAFDPDYPTKPLEFFEPILRRVLSRGGGHMELNETAEG"
FT   gene            661738..662595
FT                   /locus_tag="SPO0639"
FT   CDS_pept        661738..662595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0639"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93947"
FT                   /db_xref="GOA:Q5LVR1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR1"
FT                   /protein_id="AAV93947.1"
FT                   /translation="MQISALETFLAIASSGSFHAAARHLNVTQTTVSARIKALESALGA
FT                   QLFERGRGGTRLSAAGLRLMPHAEQMLRSWDFVSAEIASDPGARGALRLGAQLSLWDAL
FT                   LADTAIWLERERGVLPFTLNYDHMLDMGDAVAGRLLDLALVHERPSQPGVEVVDLADER
FT                   LTLVADRPLRLGPDEMPLFINLAFCAEYDRQWQQVMPPGSRQHIVLGNTAMGLRYLMRR
FT                   GGVGYFPDAMIAGPLARGRLHAVAGAPTMRLACRAIYLRDNPGWAQIEAALEGVRALRD
FT                   SARA"
FT   gene            complement(662592..662927)
FT                   /locus_tag="SPO0640"
FT   CDS_pept        complement(662592..662927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0640"
FT                   /product="4-carboxymuconolactone decarboxylase domain/
FT                   alkylhydroperoxidase AhpD family core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93949"
FT                   /db_xref="GOA:Q5LVR0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR0"
FT                   /protein_id="AAV93949.1"
FT                   /translation="MSWNDKLAATRAGLRNLHGAIPDTARAFGALGKTVKEGGTLDFKT
FT                   KEFVALGISIASRCEPCISLHVEALVKAGASRAELSDVLAMSIQMGGGPSMMYAAKALE
FT                   CFDDLTG"
FT   gene            complement(662996..663646)
FT                   /locus_tag="SPO0641"
FT   CDS_pept        complement(662996..663646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0641"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAP57703.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93948"
FT                   /db_xref="GOA:Q5LVQ9"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ9"
FT                   /protein_id="AAV93948.1"
FT                   /translation="MSRTPPSVASIATQGDGARMVAPAAERNMAALCDLLAQVARHQGR
FT                   ALELASGTGQHVSAFAARLPGLQWQPTEVDAQRRASIDAYCEALDTVAPAQELNATRPG
FT                   WGADWAGQDLVVLINLLHLISEGEAATLISEAAAALAPGGRLVIYGPFMRAGELTSEGD
FT                   ERFHAALTAQDPEIGYKDDFDIIDRMQEAGLELAEVVEMPANNLALIAEKPRI"
FT   gene            complement(663643..664713)
FT                   /locus_tag="SPO0642"
FT   CDS_pept        complement(663643..664713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0642"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93950"
FT                   /db_xref="GOA:Q5LVQ8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ8"
FT                   /protein_id="AAV93950.1"
FT                   /translation="MIDFLVIGGGIAGLSAGARLSAHGKVTVLEAEEALGYHASGRSAA
FT                   LFEQAYGKPAVVALNRASAAYHHTANGGYLTPRGLMLVGAADQAEAFQADIVDMEMTPV
FT                   SLDEARAMVPILNPETVVYTAYHAEAWDIDTDRLMQDFARVIRANGGAVLTRQRVSRIA
FT                   HGAVWQVEAGEVFEARNIVNAAGAWADQVAVMAGVAPIGLQPYRRSMARIPAPGGHDLS
FT                   GWPMLMGAGESWYAKPDAGKLIISPADADPVEPQDAWADDMVLAEGLARYQEMVTEEVT
FT                   RMDSNWAGLRSFAPDRVLVLGPDPDQRDFIWCAGQGGYGFQTSPAASQLLCDLVTGAAP
FT                   EIEARMVAQLRPERLR"
FT   gene            complement(664710..665648)
FT                   /locus_tag="SPO0643"
FT   CDS_pept        complement(664710..665648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0643"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93951"
FT                   /db_xref="GOA:Q5LVQ7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ7"
FT                   /protein_id="AAV93951.1"
FT                   /translation="MTATLTTPDGRPASAFAFGTMQFGGRADAAASAAMYAACRAAGIS
FT                   HFDTAYVYTDGRSETLLGGMIGAERDRLLIATKVGYLGGAGAANIRAQFDICRQRLGLD
FT                   MIDALYLHRFDPDTDLNETMECLARLRDAGQIRYVGLSNFAAWQVMKAVAVAGLFDLRI
FT                   DLLQPMYNLVKRQVEVEILPMCADQGIAVAAYSPLGGGLLTGKYVGGGAGRLTEDDRYG
FT                   ARYGLDWMPRAAEGLVRIGAELGVDPATLAVAWVAASPLGAQPIISARSAEQLRPSLAA
FT                   MNYEMPPELYARLTALSPTPPPATDRIEEQA"
FT   gene            665776..666201
FT                   /locus_tag="SPO0644"
FT   CDS_pept        665776..666201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC48747.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93952"
FT                   /db_xref="GOA:Q5LVQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ6"
FT                   /protein_id="AAV93952.2"
FT                   /translation="MSTSNIHPMASEHLPRYIVAADGSDYLFTVMAVFTVGLILLIGVG
FT                   YFTLHALPERMAHKNNHSQFQLVGILALLALFTHNNVFWVAAVLVAGFQIPDLAAPLRA
FT                   ISDAIRGLGKTEDQGNATPSERAPEPTPHPAAATEGH"
FT   gene            666205..667443
FT                   /locus_tag="SPO0645"
FT   CDS_pept        666205..667443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0645"
FT                   /product="multidrug resistance efflux pump, putative"
FT                   /note="identified by similarity to GB:BAC48748.1"
FT                   /db_xref="E